4BGUA

1.50 a resolution structure of the malate dehydrogenase from haloferax volcanii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
303
structure length
303
Chain Sequence
b'TKVSVIGAAGTVGAAAGYNLALRDVCDELVFVDIPKMEDKTVGQAADTNHGIAYDSNTVVTQGGYEDTAGSDVVVITAGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEYNDDFVSITTSNPVDLLNRHLYETGDRDRHKVIGFGGRLDSARFRYVLSQRFDVPVKNVDATILGEHGDAQVPVFSKVRVDGNDPAFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSLVLDGEFGYEDTAFGVPVKLGSNGIEEVVEWDLDDYEADLMDDAAEKLRDQYDEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
publication title Insight Into Structural Evolution of Extremophilic Proteins
rcsb
molecule tags Oxidoreductase
total genus 111
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bguA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4bguA02
1QKIA 1ML3A 4IS3A 1E6UA 1IYZA 4M87A 2C2YA 1LI4A 1LQTA 3F1KA 1G0OA 4AJKA 3DR3A 4CUJA 1NAHA 5A03A 4C7JA 2I3GA 3RUAA 4PRKA 4EUFA 1T2DA 5T6BA 5K0ZA 1ZUD1 2Q45A 1EE2A 3U49A 3KYDB 2VHVA 3ZHZA 4J9VA 3E9NA 3ZNNA 3AUTA 4R3NA 1YE3A 2ZIZA 3OH8A 4QUKA 2LDXA 3HWRA 3WQQA 5L40A 3RFXA 1XQ1A 1YQXA 3T4EA 4BO8A 1UZLA 1LU9A 2E6UX 5C7LO 4RV9A 1V6AA 4BO4A 3RC7A 3MZ0A 1X14A 5CPFA 4BUCA 3K5PA 3WG9A 5DBIA 3I9LA 2Z95A 3P5SA 1HDZA 5JMPA 2EJWA 1I3NA 3UCEA 4IDGA 3NYWA 1RPNA 4U7WA 4CL3A 4CM9D 4UULA 2YJZA 3F4BA 3VKUA 1H6CA 4IS2A 5JMWA 4DQUA 4AJLA 1K0UA 1HDRA 4J7XA 4OO3A 4U0KA 1SOWA 5KTKA 3EAGA 3JYLA 1LTHR 5HBRA 3U4HA 1SZJG 4J43A 2PV7A 1FF9A 4JBGA 1I0ZA 4MKXA 2C2XA 2GZ3A 2ZQYA 4YQYA 1CF2O 2Q1WA 3UOGA 3I52A 2GRAA 1HE4A 3E6AA 2NUAA 4BV9A 1UP6A 5A3VA 3AOEA 4JGBA 3WFJA 5KJFA 4Z6KA 3N58A 4J1QA 4YEDA 4CLOB 4KQXA 5IF3A 3A06A 3RD5A 3GG9A 1MFPA 5GY7A 3ENKA 2AQKA 3I9OA 4E5NA 3LC1O 4R9RA 2RAFA 3ZWXA 4IPTA 4IDBA 3LYLA 4J1TA 1EUZA 2ZQZA 3ZHBA 2PD6A 1UUFA 4II2A 3ONEA 1N8KA 1YXMA 3AM5A 4P4LA 5IZCA 4I9UA 2W2KB 3UW3A 4B7CA 2ZB3A 1T4BA 2FPIA 3C8MA 2DBVO 4XQGA 3OQBA 4NU6A 1EVJA 3KV3O 3LC7O 1E3IA 2V65A 5IN4A 3OETA 1YWGO 3S2FA 4B79A 1LBEA 3ETEA 3G1UA 4RLSA 5TX7A 3DZJA 3MJVA 2DUUA 2ZTUA 4BQPA 1SC6A 3OP4A 3FSRA 4LISA 2O48X 4Y98A 2D3TA 4DIFA 4IBOA 5G0SA 3VPFA 3RWBA 3PRJA 4CMHA 2O3UA 4GKVA 1UAGA 3V5NA 1GZ6A 4PGFA 1P45A 1CIVA 1E5QA 4FFRA 4TRNA 3L0DA 1H5QA 2VOEA 4BKQA 1BHSA 2O7QA 1ENOA 2E82A 2H5LA 1TB4A 2B69A 2IE0A 4IUYA 1XU7A 4EJ0A 1CETA 5CDGA 1QXSA 2HLPA 3SX2A 4NJOA 2DC1A 1ZXLA 4BNFA 2R00C 1XU9A 4CM8B 2EV9A 4IIVA 1DLJA 4FR5A 2OBNA 3ENNA 4GBJA 3WWYA 2DBRA 5CG2A 1LRJA 2C54A 3PHHA 3IJPA 4QEDA 1C0KA 2UDPA 3WBFA 3R3JA 2FPPA 4BKUA 1BW9B 2V6GA 1BVUA 5TJHA 4DBZA 4IZIA 3A28A 3B6ZA 3JQFA 4R1NA 3WLFA 4CMIB 2NV6A 4A2CA 4RPLA 5EERA 5BSFA 1R0LA 3A1NA 1JLLA 3JQGA 4J1NA 4BMSA 3PK0A 3HJAA 3GLQA 2OMEA 1NX6A 1HTBA 1MV8A 4J0FA 5B37A 1LLCA 2XPCA 3FTNA 4E5KA 1MXFA 4J0EA 4CL8A 4WLNA 4PG8A 4TWRA 2FSVA 5JE8A 4L4XA 1JVBA 3RKUA 3WOHA 3L4SO 4GSKA 3RU9A 4BGIA 2YW9A 4HFNA 3WYBA 3CXRA 3ANNA 1NWCA 4HXYA 4RF2A 1B8VA 1EK5A 5JS6A 1DOHA 1T1SA 1K2WA 4XCVA 1XG5A 1IE3A 5C7OO 3G49A 1GR0A 3P7MA 2WD7A 1PS8A 1VSUA 4O63O 3WJ7A 1XEAA 3PQFA 4ALLA 3RQSA 1K6XA 3NT4A 1BXKA 3VVBA 5L4SA 3DBLB 2DVMA 3DMYA 1GZ3A 5I9LA 1YL7A 1HEUA 1PJLA 2CY0A 4AJIA 1RM5A 3JQ8A 4BGUA 1KBZA 4L9RA 3TQHA 1HF3A 3R6DA 3AU8A 1MX3A 4IMPA 3EVTA 3EC7A 4E4YA 4CMGA 2YFHA 2C07A 4GMGA 4FW8A 3MTGA 4MDHA 1EMDA 3NUGA 3RSHA 4GGPA 1NFFA 3QLJA 2NTNA 3G17A 3O8QA 4RO0A 2AQIA 1ZK4A 2BGMA 3QVWA 4BIIA 3DZKA 5T57A 1B15A 3ROMA 5JW6A 4CV1A 1C1DA 1R4MB 1V0JA 4JP2A 1MC5A 3WGTA 3V1YA 1JWBB 1ISIA 2OUIA 2NVUB 1I5RA 3SLKA 4E2XA 3G0OA 3HDQA 1VJ0A 3OFSA 3PYLA 5JO9A 4DQVA 5ES3A 4JN6B 3OJFA 4LSWA 3R1IA 4NH4A 2EERA 4UAGA 4IM7A 4CQLB 1A7AA 2G5CA 2FOIA 5COBA 4GL4A 3EDMA 4PRLA 5ER9A 4E32A 4K9DA 4LMRA 3BXXA 3DTYA 2DUWA 3EMKA 2VT2A 4E2ZA 1ISFA 1MB4A 4PFJA 5H82A 4E5YA 2NQ8A 3WYEA 3LK7A 3GDOA 2PD4A 1UDAA 2OP0A 3JQ7B 2HMSA 3WICA 1DPGA 3F5SA 3PFFA 2AE2A 3LF2A 2GD1O 1JN0A 3TFQA 3ZWAA 1DHTA 1AXGA 4BQRA 1RM3A 3D1LA 4BO1A 1B3BA 3KEOA 1OMOA 3KSDO 1EQUA 1B3RA 3JYNA 4MPDA 5EN4A 3LZ6A 4BNUA 4ND3A 1DDOA 1BG6A 1KEPA 3OEWA 3NTOA 3H3JA 2FWMX 3LQFA 4B3IA 4RJTA 1AE1A 3WIEA 5CDUA 3KOUA 2D1YA 2JHFA 5DCYA 1OC2A 1PQPA 4I5DA 2GZ1A 4RDIA 3W8FA 3JTMA 1H6DA 4Q39A 2WD8A 3ULKA 5C37A 5FI5A 3OJEA 2W98A 3U4CA 1HYGA 3VPGA 1I3KA 2DTXA 3DZGA 4ND2A 4R69A 2Q1UA 3L6OO 1SMKA 3AFNA 4DLLA 4FGSA 2JCVA 3TL2A 5A05A 3IKTA 3ZCXA 2Q2WA 1O89A 1ISGA 4WASA 4DMMA 2B4QA 1M67A 2Y0CA 2NVBA 1FDTA 2Q4BA 4QXMA 4XRRA 4OXYA 1NR7A 3DOOA 4GKBA 1DSSG 3CMCO 4YJFA 3DHYA 4IY1A 1BTOA 1CEQA 1Y7TA 2P4QA 3I83A 4ND5A 4CMKA 1SCUA 1K6IA 3RC1A 2O2YA 5BSEA 3IP3A 3RUHA 1O6ZA 1UZNA 2WM3A 5CPBA 4M54A 1CQJA 3CEAA 1YKFA 5HA5A 3VC7A 1ZK0A 2VYNA 3DAFA 4YT5A 4BB5A 4PG6A 3BA1A 4CMBA 1GV0A 1UJMA 2GSDA 3VPHA 4LSMA 4HKTA 3ETGA 5B4VA 1Q0HA 4OM8A 1GQYA 2AQ8A 3ZV3A 4YJHA 5JDIA 1B14A 4R16A 2FR1A 4ID9A 4YT2A 1IUKA 3Q2KA 3JCZA 1ADBA 1YBMA 4UUOA 4XB2A 2CF5A 3AM3A 3BMCB 3WB9A 3SEFA 1Q2XA 4FFLA 3VPSA 3NAQA 4BNZA 3IC5A 2HMWA 3COSA 5AXDA 1A27A 4Z3DA 2HK8A 2J5KA 2BRUA 2YV1A 3C7AA 1GL3A 2HUNA 4A26A 4ND1A 1ZKMA 3PLNA 2A4KA 3KEQA 2O3QA 1P74A 3RIHA 2IRWA 5BSHA 2VZ0A 4NFSA 5HRUA 1E3WB 3W4IA 3H65A 2QZZA 2Y67A 1HZJA 2BLLA 3NGLA 4II3A 1NQ5A 1B8UA 3ZGYA 1NNUA 4F6CA 5JAMA 3UUWA 5KVCA 1HDGO 2EP7A 2UYYA 3UCXA 1GV1A 4BNNA 5L9AA 3ZHYA 1EZ4A 2BFAA 2Y99A 4EZBA 2Z1NA 1PJSA 3WGOA 3ZWCA 3AUUA 3ZNPA 2I66A 3DO5A 3UFXA 1E3EA 2QHXA 3AUAA 1RM4A 3TN7A 5JC1A 4OHUA 3VPXA 4EGFA 3ZWMA 1ZFNA 1T2EA 1NM5A 4BKRA 3U62A 4OKIA 1J4AA 2VUUA 3AY7A 4WCFB 4B3JA 1YL6A 5AXBA 4N54A 2D5AA 4XEHA 2IZ1A 4CMJA 4J7UA 5KJEA 3TL3A 1OI7A 1G0NA 1TT5B 1MLDA 2OFPA 4FFMA 5TGDA 4IJWA 5KJ1A 5KNLA 4OSPA 1XQ6A 2J3IA 3GH3A 1HLDA 3H9UA 4GGOA 2YDXA 1SB9A 3RC9A 3ETDA 1PQWA 1YGYA 3GVPA 3FWZA 3FRJA 4CV2A 2AMFA 2VYND 3K31A 1YDWA 4XJTA 3IDSA 2NNLD 1E1KA 2HAEA 1KEVA 1D8AA 1QYDA 5FF9A 2HJRA 5TNXA 4XYEA 4HFJA 2C0CA 1EBUA 3ADOA 1DC5A 3IUSA 3PWSA 2YY7A 2POQX 4R5HA 4YVFA 4DYVA 2YQ4A 1D1TA 3DMTA 4M86A 1PJQA 3TZQA 2CVOA 1W4ZA 3B20A 1ISHA 3PEFA 4FPXA 4AJOA 2RHRA 1PZHA 1LXCA 3GRPA 2IXAA 3QWBA 1XWFA 1C3VA 1JQBA 1Y6JA 2C5EA 5K6AA 1TT7A 2FSSA 1O8CA 2ZK7A 4YXFA 2WDZA 3JYOA 2PH5A 5L95A 1GDHA 2UAGA 3ON5A 2B83A 3WXBA 2GASA 2OO5A 5THKA 4ZQBA 1YONA 1J49A 3EZYA 1ENPA 2JFHA 3TDKA 2P5UA 4Y6SA 3OF2A 1IULA 4RZHA 4GH5A 1MGOA 4GWGA 3QWAA 4FDAA 1NPYA 1Z74A 1PZFA 3ZNQA 2ZCVA 2VWHA 3ANMA 3TZ6A 3W6ZA 2EW8A 3GNSA 3X2EA 1YOVB 1GYPA 3WYCA 1YB5A 4Q3BA 1VRWA 4BO0A 1KEUA 4ITUA 1KVSA 2BGKA 1R16A 2VT3A 4NBRA 4A73A 4OXKA 4NHEA 2NLOA 3WMWA 1BVRA 1MC4A 1HE2A 3AFMA 3WGGA 5KVVA 1P77A 2XF8A 2PD3A 4TKMA 4GLLA 3FI9A 3H2ZA 4NBTA 2B0JA 1GYQA 4U8GA 4YAGA 1KVRA 1EK6A 2RHCA 5HS4A 4BO2A 3DZIA 2XAAA 2FP4A 3KSZO 4KWHA 4NIMA 4FFNA 3T4XA 3VKVA 4GMFA 5JDCC 4O59O 4QFDA 1WW8A 3W4KA 1FMCA 1O9BA 2P9CA 3BZUA 3H9JA 3IQDB 1WZEA 2I5PO 4PLPA 4PLHA 4WPGA 1HSOA 4Y6PA 3LC2O 1BXGB 4EJMA 3GDFA 4AG3A 1HL3A 2C29D 3SLGA 4H7PA 5CP8A 1I3LA 2B4RO 3E48A 1KVTA 7MDHA 3D3WA 4D0RA 4KWIA 3IAHA 3E5MA 1YJ8A 5IAAA 3GAFA 2BI8A 4XR9A 3W1VA 1PS0A 1E7MA 5JYDA 7ADHA 2O3JA 1NP3A 3UCFA 1IB6A 3LLSA 2IEDA 4QO7A 1Y8RB 1QYXA 1E5LA 2PGLA 3ZW8A 4E2WA 1A4UA 3MWEB 4NZ9A 3Q2IA 3RROA 1Y8QB 3ST7A 2IODA 2RH8A 1R4NA 4D42A 4PLWA 3TPCA 3LT4A 2EF1A 4OMUA 3U4DA 2PTGA 5G0WA 1UXJA 1QLHA 1V3VA 3WTCA 4JJFA 2P5YA 3S55A 1QSGA 3WGZA 2R2GA 4DXHA 4IXTA 1R6DA 3ZNOA 4F6LA 1LC3A 1U28A 5CDSA 1RKXA 4FBGA 3SBOA 3GY0A 3GFBA 1YQGA 4M8SA 1YBVA 4RCVA 1N1EA 1GADO 5COAA 5DCWA 3I9NA 2PZLA 2JAPA 4EBFA 3H8VA 4L76A 5CEFA 1Z82A 3INTA 4UEJA 5EQDA 1WLYA 1B26A 1EDOA 2VUSA 3C1TA 4NQZA 1GYRA 4W7HA 1UXHA 1NWHA 1V3UA 1ID1A 2GUGA 4I9NA 2A94A 4R68A 3MJ4A 3QVSA 3E9MA 2ZB4A 2BGLA 3ZU3A 1NXQA 4UEKA 4MP6A 1WDMA 3ROPA 5AXCA 3QV1A 3TZCA 4GLOA 5JCXA 3JD3A 1WP4A 2HDHA 4O6VA 3SXPA 1WAMA 4GPD1 2Q49A 3W8EA 3Q11A 4ZQHA 4E33A 1U2GA 5IDQA 1PJCA 2PKQO 2WE8A 1I2BA 4AJJA 1F8FA 3GT0A 4R1TA 2RBEA 1M75A 4CM4B 4CLOA 2GPTA 4TRRA 4HWKA 3GZNA 2ZYDA 3ASVA 1ENZA 2SCUA 3DZFA 3GN1A 5CDYA 5HWSA 2FMUA 4YT8A 1AUPA 1PJTA 3H2SA 1C0PA 1HXHA 1NBOA 1PWXA 1SBYA 4YDRA 3L9WA 5I9MA 1P1FA 4UUPA 5GZ1A 3GZ4A 3KUXA 4B4VA 3OEYA 3GN2A 5DNAA 4URFA 3VH3A 4FOOA 4F46A 1N2SA 4GX0A 5DOZA 3V1UA 3GC6A 3IMFA 4PLTA 3RU7A 2A9FA 2EGHA 3DFUA 1GAEO 1P44A 2X5JO 3F46A 4JXKA 4ILKA 4RVSA 5FYDA 3M6IA 1KY4A 2PZJA 3ZU5A 3ZWNA 2FPGA 5KJ6A 5DOVA 4YWJA 2FR8A 3I1JA 1ZXBA 1N1GA 3UHAA 3M1AA 4XYMA 4FC7A 1BXZA 5A3JA 3UH1A 2VHXA 4G65A 5JAZA 3PVZA 4TKLA 2IYOA 5A9RA 4HNHA 4U5QA 4XKJA 3Q3CA 3AY6A 1ZEMA 2GDZA 3ZWPA 2NU8A 4CLRB 9LDTA 4X54A 1PS9A 4AL4A 3VZQA 5BSGA 4K28A 3WIDA 2ZYAA 4B7XA 2HRBA 1FDVA 3E1KA 3BMNA 2CDAA 5JC8A 5A9SB 1PWZA 3UXYA 2I99A 1OAAA 2IZZA 4BKOA 1A7KA 4Y67A 4WLFA 4CLEA 4YYZA 1K3TA 3E8XA 3EUWA 2WTBA 1Y9EA 4IJUA 2X58A 5A5EA 1ZIDA 1UDBA 3DFZA 4E2YA 5TRTA 3DHEA 4RDHA 1VL0A 4CR6A 4XJSA 2ILTA 1LA2A 3AJRA 1XHLA 1PL8A 2D2IA 5A5FA 4KDFA 3UVEA 4BMVA 2P4HX 2PFGA 1IY8A 4CLXA 4D3FA 4GVLA 4R1UA 1R37A 4L0QA 4U6QA 4ZD6A 3WGQA 1FXSA 1PGOA 4RVFA 1LDMA 5TT1A 5C3MA 1QG6A 3FR7A 1MXHA 1C14A 1E1LA 1WPQA 2X5KO 3QWIA 3C85A 1H2BA 4S1VA 5A04A 1VJ1A 4MO2A 1HWYA 4RGBA 2G17A 1YRLA 2J5RA 3DL2A 3NV9A 3VTFA 3GVXA 2B36A 4ZICA 1I2CA 2VWQA 1ULUA 2UUOA 3H6KA 2NADA 2HMTA 4GQAA 1ORRA 4R4JA 4J4TA 1UDCA 3JQCA 5TC4A 1T24A 2HKIA 1ZK2A 4TVBA 3K30A 4R54A 1DAPA 2YHIA 4H16A 2IDZA 3L4BC 4PCVA 1H9AA 4XB1A 2E49A 3GMSA 4ZU3A 1UP4A 2AEJA 4HUJA 4XYBA 4CM3A 3LSYA 1VL6A 2WMDA 4BO9A 2VTEA 1GCOA 2X0JA 1KS9A 4RQTA 3PJGA 1K6JA 4P38A 3AWDA 5IXYA 5JO0A 1DIGA 3F3SA 4FCCA 1GY8A 2JD2A 3E9QA 1ZSVA 3TRIA 1Z7EA 5AQ1A 4YA6A 3CINA 4D3SA 2O3TA 1FDUA 3DB2A 5KWEA 2B35A 1Z6ZA 3WDSA 3HSKA 4ALKA 2PNFA 2J8ZA 3IS3A 3PZBA 1P9LA 4DPMA 4DPLA 2ZCUA 2EKQA 5G4LA 4WEQA 2O2SA 1NVGA 5ENDA 1PGPA 1PX0A 3OJOA 4CLHA 4RVUA 4RF5A 2YQ5A 2H1SA 3TNLA 5JXWA 4EEXA 4N5MA 1I33A 4TSKA 4EI2A 3D7LA 5C7IO 2I76A 4WNCA 1DB3A 1O94A 3WGIA 4GX2A 3HN2A 1ADCA 3Q1LA 5DBGA 4AVYA 3DTTA 4XGKA 1YQDA 2OGUA 3JQBC 3M2PA 4MP8A 5AXAA 1C1XA 1WDKA 3D4PA 3AI3A 3QSGA 4E13A 3N7UA 1IL0A 1S6YA 3RBXA 4E3ZA 1N9GA 5HM8A 4N5NA 4DWVA 2NM0A 4KUEA 3AM4A 3KLPX 5KVSA 3VAZA 4U6SA 5TT0A 3EY4A 3WNQA 4RPGA 4PLZA 1QRRA 4ZN6A 1P1RA 1LRKA 3HHPA 3PDUA 4E0BA 1LSOA 3U4IA 3BIOA 2OXIA 4E5MA 4WLEA 2X5OA 4LN1A 5G0TA 1KC3A 1X7HA 1E3LA 2O3SA 5ILOA 4MP3A 3SC4A 5L7WA 1TLTA 1VKNA 3AU9A 3PJDA 4NDNE 3RASA 5JBIA 2CZCA 2YDYA 3Q6IA 2R00A 4Q3DA 1KEWA 1DRWA 2CMDA 3FBGA 4JJGA 4FFOA 3IL2A 2D4AA 1OFGA 4M1QA 3JSAA 3WGYA 2A92A 1LJ8A 4B3HA 4QO8A 1Y5RA 1ZMOA 1NYTA 1B0AA 3MTJA 4IXWA 5JY1A 1WVGA 2PGDA 4YRDA 2HJSA 5EMHA 4I9HA 1XLTA 2J3KA 3BHIA 3ZW9A 4IDEA 4CQMA 4E21A 4NFYA 2FZEA 5FFFA 1TA4A 3H9EO 4PZCA 2DPHA 3ZV4A 1P31A 4BNMA 4B4UA 3IP1A 1D7OA 1Y1PA 3FD8A 4BNGA 2FZWA 1DLIA 4ZHSA 3L6DA 1I8TA 1QV6A 1P33A 1S7CA 2QX7A 3PPIA 4HADA 2NSDA 3JD1A 4FGWA 4WCFC 3UN1A 4L73A 2X0NA 4XQCA 3JQGB 4DBVO 5B12A 5IXSA 3KB6A 3H5NA 2GGSA 2TMDA 4DPKA 2ZTLA 3V2GA 4KTTE 4CJXA 4G2NA 1T2FA 1U9JA 3DOJA 3STHA 3CTMA 4ZRMA 2ET6A 2VNSA 6ADHA 4MIEA 1V35A 4UUNA 4EJ6A 1UH5A 1F14A 3UGKA 4N5LA 3F1LA 3ABIA 4PIVA 1SEPA 1O95A 1YB1A 4MVJI 1HDXA 1YL5A 4CMEC 1WMBA 4UVIA 5IFLA 1E7RA 4XD2A 3F47A 3K73O 1G1AA 3TOXA 4WUVA 4HBGA 2WD7B 3PTZA 5FWNA 4RQUA 3QP9A 4G5HA 3VH1A 1JVSA 3PI7A 5TSDA 1NQOA 4W9NC 5IZ4A 4ZQGA 5KVQA 3FN4A 5L51A 1M76A 2X1HA 4YAJA 1NAIA 5DF1A 3OA2A 2CVQA 2EP5A 2VRCA 4CUKA 4MIOA 4Y6RA 3PP8A 2UVDA 2YZ7A 2BKAA 4Z3KA 1FDSA 4P8RA 3JQ8B 5TIIA 1FJHA 4GVXA 4NK5A 4XDYA 3ZWBA 1XIVA 4JROA 3NJ4A 2CNBA 3G79A 1EVZA 4BO6A 1RYDA 2BHLA 4IDCA 4YRAA 3HDJA 3ZN2A 4L8VA 4DMLA 2AG5A 4IMRA 3NX4A 1JWAB 1NR1A 3FNFA 3O8QB 2GERA 1P0FA 2Q50A 3TZKA 3OQ1A 2PZKA 5DZSA 1KY5A 4FIZA 2ZYGA 2YFQA 5EJ2A 2EEZA 4E31A 1B8PA 1C1DB 1EUCA 2ZJ0A 3SJUA 4BNJA 3JQ9C 4WLVA 3QVTA 2YYYA 3FNEA 3BTOA 1JKJA 2ZJ1A 1AN9A 1D1SA 1IZ0A 1MUUA 2GR9A 4DVJA 3Q9UA 3GPDG 1EEHA 2A35A 3B1FA 3QY9A 1NHGA 2W4QA 5TQVA 1HT0A 3UICA 3FCOA 3PHIA 3DBVO 5A02A 3A9WA 1PQUA 4EITA 2V6FA 1P1IA 5F5NA 3RUEA 3VTZA 3QWHA 4E5PA 2DT5A 3ORFA 4PZDA 2H63A 1MG5A 4ALMA 3BMQA 4J4BA 3JQ6A 4NG5A 1T26A 3BAZA 2HK7A 3PGJA 4YJGA 1O0SA 4QTZA 3EGOA 5L4LA 3RBVA 4BGVA 3ZZNA 2DFVA 3M1LA 3S2GA 3NT2A 4YAIA 3LT0A 2BELA 3V2HA 4DREA 5A9TA 3KVOA 4PLFA 1PR9A 4CM1A 4N18A 4D45A 4BHTA 1M66A 4RVDA 2Y66A 2C82A 3PXXA 1U3WA 3VOSA 1RWBA 4FC6A 4PG4A 4D3DA 3PIIA 4PG7A 1E1MA 1CERA 1EE9A 2YV3A 5TF4A 3B1JA 2H9IA 1WZIA 1NFRA 2O3RA 4OYRA 1X7DA 3K9QO 4HFMA 4Z9FA 2QIOA 4FB5A 4D41A 5GZ6A 3H4VA 1M6WA 4BNKA 4MVJE 3JYPA 3NJ8A 1U1IA 2HU2A 4DIBA 1ZK1A 3RUFA 2PR2A 5JY6A 3D3EA 1IPEA 1PZGA 2O4CA 4XWYA 4BNYA 2X8LA 1F0YA 1K89A 1CJCA 2EJVA 2O7SA 2PWZA 1ISJA 1R0KA 1X7GA 3GG2A 3QA9A 3WQRA 1TI7A 1GPDG 3ASUA 2O23A 2JJYA 3OJLA 4L4RA 4L4SA 4YJFB 3HZZA 3LDHA 5BT9A 4RPKA 3DQPA 4D0SA 2P2SA 4LK3A 3DBRA 4PG5A 4CLDA 3ITDA 3RUCA 1YBAA 3MOIA 3TOZA 5F1KA 4PVDA 3UAGA 5JLAA 2IXBA 4BV8A 1PSDA 5EESA 3IJRA 3GUCA 3EW7A 4I08A 5U1PA 1U5CA 3H9GA 1BDBA 1E7WA 3KYCA 4CM6A 2E37A 4OQYA 1OC4A 1GUYA 1E3JA 2E4AA 4QT0A 5KKAA 3ZWYA 4OSOA 4LVCA 4ZA2A 2PK3A 4YJHB 2VHYA 4HFRA 2ZB7A 2AQHA 4WLOA 2DTEA 2FHSA 4FS3A 4D43A 2I67A 5ENVA 2VNAA 4QX6A 3GQVA 3ZU4A 5JSFA 5IDYA 5AVOA 1DFHA 1SAYA 3MJSA 1ADFA 1JTVA 1ULSA 1VLLA 4J1SA 3L77A 1DAOA 4NJMA 3QVOA 4JBHA 3F9IA 1GEEA 4ND4A 2BMAA 5G2OA 3P19A 3FWNA 1X13A 1XGKA 3KYBA 4TMFA 4LMPA 2GO1A 2O4UX 3GK3A 4NBVA 3VZRA 5U9CA 3JD0A 4JX8A 4W99A 3S8MA 1TVEA 1JDJA 3RAJA 2Y0EA 1XR3A 3INGA 2IYPA 3D64A 3KBOA 3VDRA 2J3HA 4BGEA 1EVYA 4IIUA 1I36A 1U3VA 4C7KA 3GA0A 5DN9A 4TROA 1E0DA 4NBWA 1U3TA 3JQAA 2W2LA 2Z1MA 3V2UA 2V6BA 1E1NA 5LDHA 1WNTA 3AY3A 3GFGA 3GNQA 2E48A 2G82A 2X4GA 3I4CA 4IQ8A 5B1YA 3HQ4O 3NEPX 1PJBA 4YRBA 5I7SA 3VH2A 2F1KA 3I3OA 3DBHA 2Q99A 3FBTA 2DBZA 1GPJA 2VRBA 1YDEA 4FFPA 4JNKA 1PL7A 4LRTB 5L7TA 3TF5A 2GN9A 3F5QA 1JW9B 3D0OA 3CE6A 5G4KA 1DEHA 3EK2A 4BNXA 5I9NA 3BMOA 4HY3A 3GVCA 2CVZA 1ONNA 2ZTVA 5GMOA 2QRKA 4WCDA 4JCOA 4AJ4A 5DCUA 1U7TA 4B4WA 4BOYA 4HV4A 4WGGA 4MVJM 4XX0A 1DXYA 5EINA 3OIDA 1DRUA 4AJEA 3GGPA 4YJDA 4IDAA 5T67A 4JLWA 1N92A 5EL0A 3ZV5A 3RUIA 1EFLA 1DHRA 3O4RA 4XIYA 4I5GA 3BHJA 4KTVE 4XDZA 4DGSA 1Y9AA 3PLRA 2OZPA 4CV0A 3S2IA 5T8KC 3KYDA 4BO3A 1E7YA 4HX5A 3KZVA 2BFPA 3P2YA 4FJ0A 1ZW1A 3DHNA 3LLVA 4YB8A 3A4VA 3K8ZA 4W7IA 3CMMA 3H7AA 4NI5A 4R1SA 1LDNA 1LQUA 4W6ZA 4Q9NA 1IHYA 3OECA 1XKQA 3I4FA 4RF3A 9LDBA 3HG7A 3RUDA 1EDZA 2AE1A 1KIFA 2W2LD 3AUSA 4ONEA 5L53A 1LUAA 2BH9A 3JQDA 4H15A 5F21A 5F1OA 5CDTA 1XCBA 1LDGA 4P22A 2EKLA 5A06A 4NPCA 2P9GA 2B5VA 1PEDA 1WWKA 2CF6A 1B16A 3E5RA 4GAEA 5JDCA 2X0RA 2HO5A 3WQSB 4J91A 4DC0A 4I5FA 1Q1NA 4KZPA 3IIEA 3QWFA 3WGHA 4KMSA 4DTIA 1DFIA 3O03A 4B8ZA 1U8FO 5H83A 3N74A 2V6MA 4H3VA 3X2FA 4HNGA 1V9LA 2HSDA 3MJCA 3RCBA 1ENYA 4J49A 2B4TO 4LCJA 3KLMX 1NVTA 5T5QA 3D3WB 2PKQP 3T7CA 3RC2A 1RM0A 3WS7A 3EHEA 3HE3A 4M49A 4ROSA 4P4GA 1W8DA 3GNTA 1X0XA 3HADA 3QW2A 1EBFA 2JKVA 3ONDA 1YJQA 2Q2VA 1QYWA 2NWQA 1ZMTA 3AW9A 1A72A 5F1PA 1OZAA 3RJ9A 2J6IA 2Y1FA 1PR3A 4RZIA 4DYDA 4OIMA 3WBBA 3Q0EA 4XR4A 2YUTA 2W2KA 4ALIA 5IZCC 3VZPA 3R3SA 2DM6A 2Y1GA 1HETA 2X9GA 1R4NB 2VZ8A 5L4NA 5TS3A 2NVWA 3D4NA 4D46A 1PZEA 3ICPA 2JFGA 2WYWA 1SNYA 3I6QA 5T8KA 5HTOA 2DQ4A 3NGXA 2JFFA 4F45A 4MVJH 2W90A 3GRKA 3R0IA 1H2HA 2VUTA 4XGNA 3U5TA 3IOYA 3HFGA 1HRDA 4WNIA 3BTUA 4J16A 3ZU2A 4OL9A 1JAXA 1LSUA 4GWKA 4WKGA 2X0IA 3GGOA 3KRTA 3VH4A 3ROKA 2GN4A 2VYVA 4YACA 3K2EA 4CM7A 2DKNA 3PHGA 1U2DA 2GN8A 4XQ9A 1NQAO 1LC0A 1DFGA 2Y0DA 1LDEA 2GYYA 4UEOA 4PZEA 1NTOA 4LW8A 3ICCA 1ONOA 3GEDA 1XYGA 5BQFA 3DWFA 2PZMA 3GPIA 3I23A 4CM8A 1ZZEA 2HRZA 1BSVA 4P4NA 1BGVA 4E6PA 2GF2A 1HE3A 3PJFA 4YTEA 4BNWA 2Q1SA 4Y9DA 3EYWA 1H0KA 2QG4A 3ZDFA 1V8BA 3CKYA 1YB4A 1Y5MA 1HYEA 4CMCA 1ZSYA 2V7PA 1ZK3A 2XXJA 3D5QA 1BW9A 3GAZA 8LDHA 4DL9A 5JFOA 3KETA 1HDOA 3GVHA 5KOIA 3HB5X 4CMIA 1A4IA 4PLVA 2ZKLA 3JQFC 4NFHA 3GF4A 1ZO8A 3GZNB 2EGGA 3FNHA 4MVJP 2JCYA 3JQEA 1IPFA 3ZH2A 4PN3A 1ZSNA 4OXNA 3VVCA 1DJQA 5B4TA 1A71A 2AXQA 3K92A 4E12A 1AHHA 4RPJA 2Y1DA 4ZJUA 4ZGWA 4BMNA 1NPTO 1LLUA 3C1OA 4B8WA 3HDHA 2EHDA 1PJ2A 1KOLA 5T64A 4J2HA 1ONPA 3CSDA 3LU1A 1Z75A 1QYVA 4IINA 3TWOA 5LCXA 5BNTA 3QHAA 4GI2A 3HUDA 4J9UE 1WXDA 2VWGA 1MG0A 2JL1A 1SB8A 4Y8VA 4ZVVA 4NR0A 3H9QA 1PGJA 1YO6A 3PYMA 4BNLA 3E18A 5ICSA 4KP7A 3PIDA 4AJNA 5KCZA 4MKZA 3ZWOA 2VYVD 4DA9A 1IHXA 3H5AA 5A4DA 1DRVA 1MFZA 3DBLA 5K9ZA 4WE3A 5GZ3A 1U5AA 1RJWA 2W8ZA 2Y68A 2Q1TA 4DIOA 1T2AA 5BR7A 1VE9A 2PKRA 4UVDA 4BVAA 4O0LA 5G0UA 4A27A 3NTRA 1VPDA 4O5OA 4MJLA 4PLYA 2AW5A 1MA0A 1ZH8A 4OJNA 1JAYA 4TZKA 2X9VA 3KM0A 4OH1A 1B7GO 5F5LA 4K6CA 3OM9A 1H6AA 3OSUA 3F6YA 4Z9YA 3V8BA 3BMNB 3U9LA 3D4OA 2HK9A 2YHUA 3KHUA 2I6TA 3PGXA 2XXBA 2RCYA 4EUEA 3GVIA 1JKIA 1HYHA 4J90A 4EUHA 3I9KA 1T25A 3WX0A 1PJ3A 1R4MA 3WTBA 5CFZA 2NU9A 3L07A 4KUGA 4B4OA 5HS6A 3DDNA 3OMLA 2NVUA 4IQ0A 4AJPA 4ESOA 3GOHA 5DBFA 2G76A 1AXEA 3PQEA 4MVJA 4PLCA 4RORA 1GQQA 3GHHA 4ALJA 1A5ZA 3JYQA 3OQ6A 3EVNA 1NPDA 4Q3EA 1X15A 4CQLA 1BWSA 1M2WA 1BRMA 1Q0LA 4DRYA 1CRWG 4B7UA 3OHSX 2JCXA 5DDIP 4FSHA 4UREA 2CDBA 1OOEA 4Q3NA 4CM5A 4WEOA 4IZHA 3ZWVA 2Y05A 1DIAA 2ZB8A 1KC1A 5CEJA 5FEUA 3JQ7A 4E30A 4DQXA 4CR8A 3M2TA 1C0LA 2CUKA 2FR0A 5H81A 3OJ0A 4EDFA 5ITVA 3G1TA 5U4QA 3QE3A 1XDWA 3PHLA 3RBZA 3WWZA 4WOKA 1DIBA 1IZ9A 2AEFA 3AI1A 4R3WA 2YHIB 3CIFA 1X0VA 3L4BA 1A9YA 4C4OA 5I7FA 1GZ4A 2PY6A 8ADHA 2Q46A 1GFSA 1H6BA 3B1KA 3DOCA 3QVXA 2WJPA 4YAEA 3E03A 3GGGA 4CR7A 1LDYA 4BS9A 4L74A 1HDYA 3OIGA 4LRSB 3GEGA 1PTJA 5C5IA 2DLDA 2VOJA 3BHMA 3QIVA 1H9BA 3V1TC 3G3EA 3DEYX 4K1LA 4HP8A 4L75A 1XSEA 4Z9XA 1QP8A 2AG8A 3DAGA 1YH3A 3NDIA 2OP1A 4XYGA 4RVHA 5JAQA 1I24A 2QRLA 1PGNA 2BFMA 1HE5A 4RL6A 1VM6A 1N7HA 2YV2A 3LVFO 1P0CA 2BF7A 4YQZA 3KXDA 1G6KA 4LVUA 1O5IA 4MVJD 1JA9A 4R9SA 1LNQA 1VI2A 4EEZA 3E82A 4TZTA 1GUZA 3JD4A 1R66A 3MJTA 3RJ5A 1I10A 3NTQA 1EUDA 1U3UA 3NKLA 4IDFA 1ADGA 2R6JA 3JQBA 5BNFA 4FN4A 2VZ9A 1XELA 1C1XB 5JNLA 4U0JA 3HB4X 4UUMA 3DZBA 3DXFA 1SEVA 4IJKA 4I8XA 4WK6A 1I01A 4WLUA 1N9GB 2UV8A 5ADHA 1QORA 4LGVA 2CDCA 2WYVA 3ROQA 1LSJA 3CPSA 3FPCA 5ICMA 1CYDA 1Y81A 5L3ZA 2C7VA 5COQA 5I7EA 3AOGA 3GMDA 4IGFA 2OL4A 4WOJA 2OORA 1C0IA 4Z0PA 1A9ZA 5AOVA 2QRJA 1T4DA 5JDIC 2VQ3A 5MGBA 3F4LA 1LDBA 1I3MA 1NASA 1R15A 2HCTA 3FF4A 4M55A 4NK4A 4QECA 4RF4A 4ALNA 3T7EA 2B37A 4IQGA 3BMCA 2NQTA 1M6HA 1P3DA 3OBBA 1FK8A 4W4TA 2CSUA 4N7RA 2AA3A 4A10A 2NU7A 2UUPA 4O1MA 3OIFA 4D7AA 4MINA 1YVEI 3L9XA 2C20A 4JBIA 1E3WA 1QLJA 2HMUA 4YT4A 1GUFA 4CQMD 3NDJA 3WNVA 5EIOA 4BNTA 2VCYA 3KTDA 2RH4A 2D59A 4AFNA 4BKPA 3U09A 1NHWA 3A14A 1YS4A 3L6EA 5FI3A 2QQ5A 2X23A 4CQMB 3ZHXA 1QMGA 2P9EA 1U7HA 1PL6A 2ZTMA 3I9JA 4OOFA 1Q7CA 3GEMA 4JP3A 4BO7A 2Y1EA 4WCFA 3ANLA 2VTDA 1U4OA 3BTSA 5TJ9A 2DTDA 1LLDA 4A0SA 3NRCA 2Q4EA 3LT2A 5IJZA 1E92A 1P1KA 3SC6A 2GNAA 4CODB 2VN8A 4K26A 1DC4A 2I3AA 4BL5A 1TT5A 3C7CB 1I2ZA 2WYUA 3C24A 2NTJA 1ZBQA 4FD3A 4WJZA 5CG1A 1NQTA 1PJ4A 4MOWA 2C5AA 1UR5A 4MVJF 3K2BA 3INRA 3JV7A 4FJ2A 4OAQA 2OOSA 4CMEA 2J5QA 2Y93A 1F8GA 3PJEA 4TRMA 1J0XO 1OBFO 2VHWA 2X86A 5JPIA 3WFIA 4K6FA 3O9ZA 4G81A 2IZ0A 3KSUA 5LDGA 3MEQA 4DLBA 1EVIA 3GR6A 2GCGA 2X7HA 5ILGA 1ISMA 4XZ3A 4YR9A 2DAPA 4W9NA 2VRCD 3DMTC 4NMHA 1P1JA 2TMGA 3OICA 4WECA 1N5DA 1DIRA 5CAEA 1I32A 3HNPA 1PU2A 5L7YA 3WLEA 5K6AC 1ZEJA 2DU8A 2JD1A 1F17A 2Z5LA 3PYXA 1GCUA 3TZHA 2EW2A 2DFDA 3DAPA 3MOGA 2QW8A 4OGWA 4XQEA 3VZSA 4BNVA 1CQIA 3TSCA 5MDHA 2Q3EA 2RIRA 4J4HA 3AK4A 5CHEA 3SJ7A 2GLXA 1DJNA 1AGNA 3LF1A 3SVTA 2DPGA 3FPLA 3QJ5A 5ITWA 2I9PA 1XA0A 1ARZA 2OHXA 1VL8A 2CD9A 3CH6A 5AYVA 2D8AA 4FJ1A 3ONFA 1DO8A 2P91A 1QV7A 1QR6A 3QQPA 4RLHA 3VHRA 4YCAA 3PWKA 1YOVA 3JQ9A 4JJIA 4XRGA 4BO5A 2GZ2A 4Q3CA 1IOLA 4S3MA 2G0TA 3HFSA 2F00A 2FN7A 1I30A 1HKUA 1ZCJA 5ER6A 2EWMA 1K5HA 1Q0QA 4UVHA 4CPDA 1H94A 2BD0A 1R0SA 5JCJA 2VWPA 1KVUA 5JAIA 1FDWA 1Z73A 4KOAA 4M89A 4Z0HO 5KIAA 4W82A 1HLPA 3PWZA 4BNIA 2PA3A 4Z0TA 1KYQA 1HDCA 4CMAA 4J3FA 3BMQB 3HDYA 1BXGA 2LDBA 5L45A 4FQ8A 1E6WA 2O50A 5IG2A 2X9NA 4QSMA 3GDGA 3C3XA 2C59A 4YJGB 5DULA 5B4UA 3S2EA 3W4JA 1E77A 1EFKA 1QYCA 2X22A 4CUZA 3FNGA 2H6EA 4Q3AA 2G1UA 2BI7A 4FOSA 3W6UA 4R51A 4GX1A 2AHRA 2WWRA 4D44A 4MIYA 3WSWA 1VSVA 4GSLA 1Z45A 5EPOA 3RKRA 1T2CA 3VDQA 2JHGA 1R12A 1Y8RA 4YPOA 1LEHA 2D0IA 1DIHA 3WJAA 1Q7BA 3DZHA 4AJ2A 5I8WA 3IUPA 1Y8QA 3GUYA 3I5MA 1PIWA 1J5PA 1F12A 3JD2A 2FY8A 5IDWA 3Q9NA 4YAKA 5IDXA 4KQWA 4AICA 4ZQEA 3I9MA 2EXXA 4DC1A 4NU5A 1BDMA 1E6EA 4MVJG 1W73A 2QYSA 2IEBA 3RI3A 5KKCA 1SOVA 4OOEA 4J7CA 1E7QA 3BTVA 2J3JA 1JU9A 3H5RA 4R01A 3RFTA 1UZMA 3UF0A 4EW6A 2NTVA 1TEHA 1DC6A 2CFCA 1BMDA 2QYTA 1KERA 1Z7BA 2P68A 3QRWA 5THQA 4YBZA 4XIJA 4R5MA 5A1TA 1X1EA 5J23A 4A03A 3P2OA 4J6FA 4DLAA 3W8DA 3D5TA 3NT5A 4RVGA 5JCJD 2QZ9A 4QQRA 1L7DA 1WDLA 2PLAA 1N7GA 3DBRB 3O26A 4MKRA 1TXGA 1F06A 1VJTA 3AI2A 4BNHA 5BNIA 5I8ZA 5LC1A 3WSVA 3MCVA 4JQCA 4ZQFA 1GEGA 3U3XA 3CZRA 4R41A 3KO8A 1D3AA 2PH3A 3ADPA 3FTPA 2D5CA 1UP7A 2FRDA 1VC2A 2Y1OA 3UKOA 4UVEA 1E3SA 3CUKA 4PVCA 4DUPA 2PGJA 3KYCB 1KETA 4JIGA 5DT9A 3S1LA 4XA8A 1LX6A 3U0BA 4BB6A 1SPXA 2AEMA 2B5WA 5I7VA 5TLSA 1JKFA 4QFCA 4CM4A 2WE7A 4CV3A 2NACA 1HSZA 1EQ2A 1P1HA 1DC3A 2I65A 1T1RA 5KJCA 1L7EA 2EIHA 1SO8A 4LCEA 4F3YA 5JYEA 1PGQA 1V3TA 3RVDA 4OQZA 1LRLA 4IGEA 4XYLA 3MWDB 3DONA 1MP0A 2WEKA 2NU6A 1UXKA 1LLQA 2GN6A 3C7DB 5DP2A 4NJMB 1ZJYA 3B70A 3FHLA 4TVOA 4JK3A 2Q2QA 3GHYA 1W6UA 3K6JA 3NDRA 1L1FA 3K96A 2Y1CA 3WR5A 3IKVA 5G0VA 3C1AA 5F3RA 5DP1A 4XGIA 1WMAA 3FR8A 2C7GA 4RPHA 3EZLA 3TJRA 1DBVO 2EKPA 2XOXA 3CZMA 3TFOA 3JQAD 1X1TA 2HQ1A 2X6TA 3WMXA 2DBQA 1GQ2A 4GX5A 5EQFA 1GTMA 1ZVMA 1H93A 5IN5A 1GD1O 1U4SA 4J2OA 3JQAB 1AHIA 4EYEA 4I1IA 3LT1A 1E7SA 1HZZA 1LSSA 1UXIA 3PZRA 3MJEA 3PFWO 4CM9A 1CDOA 1RYEA 2WSBA 3PQDA 1UXGA 4OKNA 1CWUA 3I6IA 1GU7A 1ZJZA 1U8XX 4KUHA 3DBHB 4A5OA 4CLRA 4IDDA 4TRJA 1Q7GA 1VKOA 1UAYA 2EG9A 1J6UA 1W0CA 2HMVA 2JAHA 3ZV6A 4A7PA 2BFOA 3DC2A 3OA0A 2ZATA 3AOEC 3H3FA 2OBYA 1NVMB 3ZI0A 4I5EA 5G4KB 3PDJA 3BMOB 3O38A 2JD0A 4AJ1A 3BYZA 5CEEA 3RFVA 3HN7A 4INAA 1D4FA 3ZWWA 5A9SA 4ZRNA 4NBUA 4KDEA 3ITKA 1ZNQO 4AJHA 6LDHA 4IJVA 4PLGA 2VHZA 4D79A 1NFQA 1B2LA 4NNJA 1KVQA 4TQGA 3PHJA 4UVGA
chains in the Genus database with same CATH superfamily
1C7EA 2JJQA 4KREA 5E38A 3W9UA 2OCIA 4RHYA 5A0TA 1MO2A 3HZRA 4U7JA 5IAGA 2C2YA 2GKOA 5D8DA 5AFSA 3F1KA 2H4FA 1X1RA 2ZYUX 3SE0A 4CUJA 4RGQA 2HJVA 2ZE6A 4TTQA 3IQHX 1N25A 1AQNA 2RI6A 4C7JA 4MQ5A 4PRKA 4FS8A 5DNCA 3NNSA 2COEA 4UNSA 3UQZA 2ES4A 4MUBA 1JE1A 3A6PC 2Q45A 2H1VA 1E5XA 4MQLA 3PC3A 4HEJA 2VHVA 3HA5A 3E7DA 3NU1A 3DV0B 2MYPA 4J9VA 4PAGA 5F2OA 5GJBA 4R3NA 1Z88A 4ATNA 4YMTA 5J2UF 5L40A 3RFXA 4JXZA 1AOXA 4BO8A 1II9A 1LU9A 4Z7JA 5C7LO 2B1JA 4C0SA 1ULBA 4FNMA 1GTL1 2Y4OA 4L08A 4M0KA 1XZBA 1ZUIA 5BN5A 1TRKA 1FFSA 4MCAA 4RHUA 3NBUA 1CE8A 1X14A 4JDPA 1W7AA 2V0NA 4G0VA 3K5PA 3TGWA 2PLFA 2RJ3A 2Z95A 5JMPA 4JIMA 4AZTA 1XD2B 2I2FA 3AH8A 2IY8A 3E53A 3EIQA 2X9QA 3OTQA 3UCEA 3LY5A 4IDGA 4QXQA 3WYAA 1RPNA 4CL3A 3L7JA 1M0SA 4I66A 4NRDA 2Z43A 1NE7A 4TTRA 2QBYB 4D6XA 5IFKA 3F4BA 3VKUA 2G5GX 2P4UA 1IEQA 1Z37A 2VHEA 1H6CA 3AFIA 3TVTA 4BC0A 5JMWA 1XL0A 2GJKA 5K8TA 1A69A 3RSSA 4K6GA 3ZOKA 1SOWA 1J70A 1LTHR 1R0ZA 1VPWA 2V97A 3HY6A 4UHFA 4YRRA 1USKA 1OFUA 3J80A 5KZMB 4YRJA 2PV7A 2QMYA 2YASA 1TUEA 2GZ3A 1CF2O 1AKNA 5CIWA 3VKHA 1GSAA 2HDOA 4LI3X 5IBQA 3CJTA 1YZTA 3R24A 1KQGA 5IM4F 4MCIA 4BV9A 4XSGA 4W9MC 2IZ5A 1UP6A 5A3VA 3RRJA 2HCJB 4I1UA 2E0IA 1ISRA 1QG2A 4RZQA 2JIMA 2IYZA 3JPYA 4J1QA 4YEDA 5DWVA 4KQXA 4WDRA 1W36B 4H4EA 2FX2A 3KOMA 3GG9A 4J0DA 1MFPA 3FDZA 4I3GA 4TL8A 5GY7A 1G41A 4PQEA 3EJWA 3EXAA 3LC1O 4O2RA 3M81A 4RD0A 5LNK6 2PUDA 1SUFA 3TZLA 2A84A 1AD2A 4ZO8A 1E66A 3LYLA 4AP9A 5CD1A 2ZRJA 3OT5A 5AUPB 1UBTS 4H7JA 4C14A 2BSAA 1KQNA 2B4AA 3ZEAA 2CJPA 1MORA 2OKGA 2E1RA 1P61B 3K0AB 4II2A 4A0QA 1YXMA 3PQ2A 4FDLA 5FWYB 2QD1A 5CA1F 1D2MA 4EHDA 2G8LA 3LH5A 3AVXA 2W2KB 3HFJA 4AIRA 1OROA 3EIUA 3ELBA 4N3BA 1QGAA 3L2OB 5BSMA 1Q0UA 2EBUA 4LX0A 3N2KB 2AOUA 4QU5A 4RXUA 1E20A 1UPCA 2WQ7A 5CBPB 3W79A 4R0VA 5D84A 3T52A 2WNHA 4RM2A 4F5EA 2RHMA 4V1CA 5BV0A 3MWYW 3LPAA 1IIRA 2OD2A 4KQHA 4FYIA 3RRZA 1QF7A 5EIBC 4QFBA 2YWCA 3LQYA 2O54A 2DUUA 3HBLA 5KSWB 2OGSA 2VEOA 3OP4A 4LISA 3R7BA 3PUXA 2D3TA 2H0RA 4MYHA 5FNVF 4RANA 4WHMA 5G0SA 4FHCA 3RWBA 3PRJA 3RSLA 2PJUA 4MSUA 1Q95A 1RWKA 3BH6A 1M2VB 2IPAB 2VAXA 1DX4A 1ZINA 2WFLB 1RYFA 3KKLA 1GZ6A 5AM1A 3ISVA 1CIVA 1E5QA 5BWOA 4UTNA 3GLGA 4TRNA 4G9EA 5BWCA 2ODWA 2VOEA 2GARA 4RY8A 4YYEA 1NRIA 3U5ZB 4QOGA 1P0IA 2F62A 1IK6A 1CUGA 1KDRA 3OLQA 4Z99A 1VQ1A 4EKIA 3OZCA 4JOBA 1VIMA 5I8PA 2DC1A 2R00C 2X4LA 2H07A 1XU9A 2YWJA 3ZI4A 3ESQA 2OSBA 2OBNA 1RIFA 5L6LB 2WKQA 1Q16A 4Q4HA 3WWYA 4FXOA 3SHWA 2C54A 3G2LA 1G20B 5L3QB 1A1SA 1VBKA 1KJ9A 1Z5VA 3IJPA 3LHKA 2JFBA 1CXZA 3B1YA 3WBFA 3ZIDA 5BYBA 3ZEIA 1ABEA 4BKUA 1BVUA 5TJHA 4IZIA 4HCJA 3SG0A 4YHBA 1PD0A 3EG5A 1CY4A 2Y27A 4BVJA 3JQFA 4R1NA 4CMIB 1WBJB 5IYZF 1R9GA 5EERA 1R0LA 1FFBA 1JLLA 3JQGA 2PFSA 3N59A 5AVTA 4WESB 3GDWA 1L5FA 1D9XA 2OMEA 4IUCS 2GBPA 1IXYA 1AH2A 3GCZA 3HXPA 4X6LA 4DM3A 1AQUA 1NX6A 1SIWA 3N28A 3AEUB 4BMOB 5A62A 3BE5A 4J0FA 1YZ3A 3IXQA 4JWTA 5ALGA 3T1HB 2IUUA 1A50B 1D5WA 4WLNA 1TK9A 3EPJA 3CKKA 4XDHA 2GBGA 5JE8A 1DAIA 3N8HA 2DERA 1P29A 1MVLA 3RKUA 3FNIA 5FTLA 1RS0A 5KS2A 3RU9A 4BGIA 3T5GA 2XNDD 3N7AA 1OYOA 2CZQA 4XVRA 4FLEA 4ZVQA 1GFWA 3T3HA 5JADA 3HJHA 4ZMBA 3DT8A 1FLDA 5EHGA 2XF2A 4ESEA 1T1SA 4UUAA 1AS2A 4R2LA 1Z6GA 2B1IA 1KP3A 1GR0A 2NSYA 3P7MA 4QATA 1VSUA 3FMOB 4TOIA 3VR5D 4F3NA 3QEJA 1XEAA 3PQFA 3A9VA 4OJMX 4X3CA 5EWLB 3T5CA 4DABA 1BXKA 1M1XB 3IJEB 1I51A 5L4SA 1B42A 3LCUA 3DDWA 3Q8LA 1RD4A 3BA6A 1DT5A 1I4LD 1QK3A 2IPLA 2RHBA 3KTFA 3DMYA 2QGNA 1IBMB 3DGFC 4U7GA 2WUEA 4EW2A 1GZ3A 3M49A 3NC4A 2LZ0A 3LX8A 4WINA 4HVLA 5I9LA 5J1SB 1PJLA 2CY0A 4M1SA 3B3GA 1SZDA 4PU0A 4E11A 1H0HA 3NEYA 2OO7A 4BGUA 4Z49A 4YP5A 3TQHA 5DXAA 3CO0S 2GESA 3OE1A 3R6DA 3P2MA 3SBEA 4CDNA 5BSUA 1Y1LA 3NONA 1MX3A 5CXUA 1DV1A 1X1AA 3DL7A 2VATA 4CKZA 3U26A 3VJMA 2BISA 2PH7A 2A1TR 3DXYA 3LCMA 1Q91A 3D8TA 4RJIA 1GDTA 3HLYA 1KGDA 4FW8A 3V4FA 1NVFA 1KMIY 1W34A 2XYVA 1MW9X 3RV3A 4BY9E 1LF0A 3G17A 4TMVA 1W9HA 4D8TA 1VCHA 2NV0A 4NQRA 4R40A 4BIIA 3DZKA 1C8VB 3EEIA 4GP6A 1UXOA 5TVKA 4IP0A 4KXNA 3WL3A 3WGTA 1XZAA 3UG7A 4PZYA 3KWFA 1ZJJA 3P0EA 2NU9B 2QN8A 3U7EB 4BKMA 2NVUB 3K20A 3EXIB 4FLFA 3SLKA 1JVNA 1C3OA 3H6HA 3HDQA 3PYLA 4N4AA 2I87A 2MSLA 2OBFA 4CKBB 2PBRA 3U1VA 3HSSA 3MTEA 4JN6B 3NVKI 5EP3A 1R6BX 2EERA 2ONYA 4UNNA 3HXMA 3STYA 3ELDA 1UBJS 1U0JA 4IM7A 4CQLB 2G1AA 2O8FA 4MXDA 1CT9A 1S9DA 4NESA 5AJYA 2GN2A 4GL4A 4GVPA 3EDMA 4JKYA 5CB4A 3IELA 5ER9A 5A4MS 2E6KA 4PHFA 3DKIA 3ZQ4A 1JHQA 2OHIA 3DTYA 2DSTA 1BKYA 2DY1A 4IHJA 5FUVA 4X8OA 1U8UA 1WXHA 5AVYA 3LUKA 3IB6A 3B3AA 4PFJA 5FYQA 4LJYA 1XRJA 2G6TA 2NQ8A 3UQYS 3FWKA 4E5YA 3OU2A 3DJYA 5B3AA 1I7QB 3GDOA 1P2BA 1ORVA 1Z0AA 2OP0A 1R8SA 1S4MA 3JQ7B 3WICA 2YKGA 1F8YA 2Q3BA 1ZVQA 3G68A 4Q9HA 2HC9A 3BICA 2AE2A 1EFCA 2AG0A 1BCRB 4H31A 1TTQB 2XNCA 4MWTA 4QJIA 5EP4A 3ZWAA 1B8OA 1E2IA 3GP3A 1JR3D 2B0CA 2PKYX 3G59A 4BLSA 3C8HA 4UM5A 3OLWA 3S7TA 3GLIA 4M7RA 1V2GA 5K03A 3FRIA 1F2UB 1OMOA 3KSDO 4TS4A 4K8RB 2ADOA 3IPYA 2BRUC 1EWTA 2YXEA 4NZNA 4Q37A 4YJ2B 5DN6A 4YCMA 1DDOA 5JQGF 1YQ9A 2QQFA 1WKCA 1YVUA 3G2MA 1M0TA 3SZ3A 2P9YA 3O1JC 4G23A 4B3IA 5K3EA 1AE1A 2MOKA 2WG1A 4QTTB 1B6RA 2I6XA 2D1YA 4ML3A 4BLOA 4R2WA 2BJWA 2CLCX 1NOKA 2NO9A 1PQPA 4QULA 5ELLA 2YJGA 3LPDA 5F4ZA 3TG8A 2Y4NA 1NC1A 5LQCA 2IBSA 4JB8A 4GBGA 2HRRA 2WJAA 1M6VB 3UO8B 2QDXA 5F78A 3FTDA 2WD8A 4PPGA 2V03A 2VJOA 4E15A 5KYWA 5FI5A 3ROXA 2JC3A 3W2FA 1RBZA 3VPGA 4EX7A 2WJ4A 5GM1A 3Q1KA 4ND2A 4DMKA 3F6BX 2FN3A 2IWHA 1L4HA 3EMDA 4FWIB 1SMKA 1WULS 1BXRB 1OWOA 2R5WA 5A05A 2BCJQ 3NKFA 1HMYA 1UIRA 4GI7A 4JODA 1M34B 1XZHA 4M76B 1A3CA 1W1WA 2VLBA 3KQPA 4A8TA 1M67A 1TQ2A 3ER6A 1L5SA 1C2TA 4I6JA 1FDTA 2HF2A 2ZLBA 4UHDA 1RTKA 1N5LA 1NR7A 4OXYA 3DFIA 4A16A 1EFAA 1Z68A 1JQDA 4IY1A 3MG9A 4CQJA 3P9IA 3DH0A 1UJ5A 2C9CA 1BTOA 1CEQA 2EFDB 1Y7LA 2YYAA 4ND5A 1JBQA 2QKYA 4CMKA 1NNI1 1SCUA 1KJZA 4IFIA 1L7MA 1H1LA 4JLMA 4ARZB 4ZT3A 3WYDA 4HH4A 1BWPA 5EWMB 4R8MA 4KVFA 3QF4B 4LWZA 1UZNA 4OTZA 3UFBA 1PLJA 5IU6A 3E5HA 1A97A 2AW3A 3TLMA 4ZXPA 4LC1A 3PDCA 2M1ZA 5BYKA 3GJZA 3TSZA 3AV3A 2FUNB 2PT9A 4U9HS 3MAGA 3LUDA 3VAAA 1XZLA 4CMBA 2HRCA 4H0NA 1JP7A 1GV0A 3A1EA 3HLTA 4XPIA 5FBZA 4RLFA 4OQDA 3EVFA 3TB6A 1J39A 3U39A 5B4VA 1Q0HA 2FHPA 2YHBA 1APBA 2I8AA 4HDRB 1WXQA 2AQ8A 2WAMA 5HCIA 3ZV3A 1IH8A 4BZWA 4OLBA 1BFKA 1IUKA 1R6AA 1U0RA 2WHEA 1MAWA 4G0OA 4B9AA 1R27A 4Z9BA 4XVQA 3EFHA 3T7JA 4XB2A 3WB9A 1OGYA 3SEFA 4FFLA 4MYSA 4TL7A 4Y7DA 4AMGA 3RJTA 1NJ8A 2C92A 5AXDA 2J5KA 2R65A 3GLFA 3C7AA 1THZA 1GL3A 1XX6A 4ZOLA 2HUNA 4EI9A 1NKSA 4Z7OB 4ESVA 1DG1G 3RJZA 1QONA 4ZO9A 4DJAA 1U0TA 1JQLB 3MINB 3G2NA 5HRUA 2OZKA 2VZ0A 2UUCB 1E3WB 2VFAA 3W4IA 4FHFA 4CCSA 1HZJA 5HE8A 6AT1A 4Z86A 3UPUA 3UXEA 4F6CA 2GEVA 2DY0A 2P4EA 4HGOA 2QY6A 2JARA 16PKA 1IXSB 1HDGO 3KSRA 3DUWA 1GV1A 3NTUA 2WM8A 4G4SO 4UKDA 1EZ4A 3ZHYA 4ED9A 4RKRA 2Z1NA 1TUBA 2HJ9A 5U4XA 3EVCA 4ZV7A 4W6QA 3ZNPA 2QU8A 3A4TA 3UFXA 3WLSA 4OHUA 4EGFA 3G7SA 3EY9A 4IG4A 3ZWMA 4BMPB 1NM5A 4BKRA 3U62A 1A76A 3TSYA 3W3ZB 4B3JA 1Y7IA 2FETA 2YY5A 2EKDA 2YWFA 3NV7A 3DCYA 4JYCA 2D5AA 3TR6A 3RS3A 1Q20A 3WGNA 4FYJA 1NDHA 4P5DA 1MPXA 4D2IA 3AX6A 4LY3A 1XC7A 3KOOA 2VBFA 3L49A 4PPFA 5A4KA 1FP4B 1TT5B 2OFPA 2ATXA 5KNLA 1OPRA 1Y6QA 3HB7A 2J3IA 1Y6FA 4R6XA 2V54A 1WXXA 1OFIA 3GH3A 4EA7A 3PXDA 3A3YA 4EFKA 4ZCMA 1JPJA 2OHOA 3NBKA 1Y82A 3QX8A 1PQWA 4U9UA 3LY7A 3HCNA 5A4JA 4RC9A 1EFTA 5DTEA 1OLUB 3K0BA 3K31A 5H0IA 2YX1A 1W29A 4JEUA 3ME5A 3OIYA 4G5XA 3LQ2A 5K09A 3A1WA 1LFAA 5DHPA 1AKUA 4LVOA 1FEZA 2E9SA 1P7PA 2NT3A 4JLKA 2A8YA 3UUGA 1D2HA 5BUZA 3T4PA 1KBOA 3PWSA 5CFLA 4DYVA 1L5HB 4YVFA 3SIWA 4FGJA 1Z25A 2NN3C 4COKA 4HGNA 4FPXA 3QVGA 3ADCA 1B0UA 5JPDA 2P0AA 2PEYA 2RHRA 3UJ8A 2OFOA 3GRPA 5IHPA 3IMCA 2WUVA 2IXAA 3VSBA 1PW5A 2DH6A 3E4DA 4M1EA 1SQFA 1JQBA 3EAFA 3USZA 2J33A 4QDOA 4XWWA 2ZWAA 4G0NA 4N7JA 2HBRA 4UEWA 1W88B 5BN3A 1C7IA 3JALB 1CJVC 1C9YA 2WDZA 4NCNA 2PJDA 1QUFA 3WSTA 4YXFA 2IUSA 4KE9A 4UMDA 4UPDA 2FMXA 2IEZA 5LA6A 4B6GA 1KF0A 5L95A 1UBUS 2UAGA 4F9GA 3CVUA 4DRZA 2QMOA 2B83A 4HDAA 1J9GA 4WY5A 2OO5A 1BYIA 4QICA 2ONKA 5EJ6A 3N0WA 1H4QA 1U1FA 4FFBB 3VJKA 1MJGA 1ENPA 3TDKA 1XTZA 3K09A 5K0BA 2O2XA 3OF2A 1M2OA 4D9JA 2C0PA 1AVTA 2IKSA 1R0RE 1U28C 4GWGA 4MRAA 1EHYA 1W36C 2QQ0A 1V5FA 4Q19A 1PZFA 3JS5A 3PF9A 4HH0A 2VWHA 3W6ZA 3UJ7A 3ZNQA 1PYDA 2EW8A 2FPSA 1NT2A 3GNSA 4WTOA 4ZWNA 1YOVB 2YMPA 5I9BA 1YB5A 1IQRA 3HP4A 4Q3BA 4M0FA 4MZDA 1TDJA 4P3NA 4JR0A 1KVSA 3OCZA 1E62A 1I80A 2BGKA 1E2KA 4PSUA 4UAUA 3B9BA 4AZ3A 5AM2A 1D0IA 2NLOA 5JH7A 3WMWA 2OV3A 1NN0A 2AKYA 2XVXA 4JJEA 2XF8A 2PD3A 4TKMA 4C7OB 4DA0A 3HV0A 1U9YA 4QOIA 3TLGB 3WAGA 1GYQA 4OLAA 2JGLA 3BJZA 3UK2A 1OTXA 3ZDZB 3PR3A 3IE1A 1AHNA 3LBFA 5HS4A 3DZIA 3H87A 3VV2A 3LRTA 4KX5A 1MX9A 1QPBA 4KWHA 2VS1A 4FFNA 1A9XA 1MABB 2A33A 3VKVA 1P1BA 2YXPX 7GPBA 1K9SA 3A6GA 4O59O 2R4UA 3ACBA 2L0XA 1GWNA 1GIAA 4QYIB 2FZLA 2I5PO 3OX3A 2OM2A 1GCIA 4N7BA 4AG3A 1Y1RA 1ZJ4A 2QUAA 1Y34E 2GM4A 2VNHA 4C4AA 5HOEA 1I7LA 3G2QA 1S01A 4P93A 2OG1A 4GYYA 1EK2A 4UQPA 4MHTA 1KVTA 3SMVA 3BKXA 3D3WA 2X8JB 4D0RA 2GJ4A 2YQZA 3BH7A 3IAHA 4OHZA 3FMFA 4K6MA 3S27A 4DLVA 3EGXB 3IGFA 1Z6PA 3ZIUA 3TL6A 2ZU6A 1PS0A 1Q7RA 3PQ6A 2AWOA 1E7MA 1Z2OX 4MAMA 7ADHA 5SZKB 2CXNA 1CCWA 4NOMA 1Z4IA 4EHFA 2C3UA 3I8OA 3MOSA 1M8JA 2BGIA 2AN1A 4AO8A 5L3SA 1DAMA 5DBEX 5BW5A 3O4GA 5C31A 3MWEB 3Q2IA 3IAEA 4K46A 2JJ2D 4FYPA 1XVUA 1VJCA 3ST7A 4R2XA 4A82A 3R7DA 4M0LA 4D42A 5LNK1 4E7OA 3LT4A 4R7TA 3VDXA 3T35A 5DM60 2PTGA 1UXJA 2C7BA 1QLHA 2H1LA 1WSBA 4OXRA 4MZXA 4JJFA 1Z0DA 2P5YA 2RHTA 4LQDA 2CL7X 4N5IX 3S55A 1X70A 4BRSA 5IJ9A 1AHPA 1L1RA 3CW2A 4RZUA 4DKJA 5MGNA 4UU1A 1FCJA 3GCDA 2XUGA 3DDSA 2KX7A 5ICEA 1R6DA 3ZNOA 2OWDA 2Q3CA 3HMKA 1LC3A 1KGSA 2GAAA 3AEQB 3RSFA 4EMUA 4LHSA 2QAGC 3GFBA 4RD2A 4GNKA 1YQGA 4OU5A 1SU7A 1YBVA 4YV0A 1N1EA 3S0JA 4DJJA 3I9NA 2BMDA 3FMGA 1QM5A 2JAPA 4R3UC 3ZHQA 3M70A 1XAIA 1J2TA 1Z82A 1T15A 4OGGA 1WLYA 2VP2A 1RCUA 4F5WA 1J99A 1GP2A 4P84A 3WGUA 4WI1A 3ZJYA 5DPMA 4XVUA 2IZOA 2V6JA 2GUGA 4I9NA 4PZAA 3ES9A 1JEQA 3V7NA 5K3FA 1ND5A 1P6UA 3LQQA 1U2EA 4DXAA 2DCMA 2ZRKA 3A9RA 4JLPA 2RAVA 3ICVA 3FCAA 4MP6A 3SGLA 4KR7A 3ESAA 1WDMA 2QX6A 2JBHA 5BOSB 1MV5A 4UXIA 2GCEA 5LP6F 3TZCA 1QQTA 4KHZA 1U5BB 3IQEA 3TLXA 2LPMA 1UKZA 3A6ZA 5JJKA 3DLPX 1SCJA 3REOA 1O6CA 4DLYA 3H17A 4E33A 3CNLA 4ZQHA 1ODSA 1NY5A 1U2GA 4UU8A 3CX7A 2PKQO 2OZVA 3G8AA 4BJ6A 2H1HA 2BTEA 5D5QA 1VZ3A 3SXUA 2I55A 2RBEA 2WUFA 1M75A 1D2EA 1M2NA 1V4VA 1OVMA 3RAEC 5CA1B 1BQEA 3FETA 4CLOA 3IH5A 3ZXYA 3E9EA 3N2EA 2DQKA 5DYNA 4DZZA 1ENZA 3DZFA 5CDYA 4AULA 2XSZD 3TTYA 2QVXX 3D8NA 4IIHA 1C0PA 4F91B 1NBOA 1PWXA 2Q5FA 1JIVA 1QO9A 2P2ZA 4V2IA 5CDHA 4UUPA 5GZ1A 4MTLA 1XXHA 3BD6A 5C34B 1UT5A 2IX9A 5JD3A 4B4VA 4ZO4A 2XYRA 4CIAA 1LKZA 3FPAA 5JCZA 4QVIA 2EVWX 2A5LA 4RYLA 5DOZA 2B5OA 3GC6A 3K94A 4WXEA 3AETB 1UDXA 6Q21A 3GT4A 4FGZA 4PN7A 4DCCA 1VXOA 1GAEO 4KSYA 4NKRA 3RHZA 4B7ZA 5HDQA 5DYTA 4JFAA 4JXKA 2DH5A 3ASYA 4ILKA 5C2JB 4JYMA 4J0QA 3LBHA 1N2ZA 4C5CA 2PZJA 3V4LA 2N42A 4LRWA 2DKFA 3PNBA 1GAJA 2FPGA 2W7TA 4FMPA 1XJCA 3LDFA 4YWJA 4MQ4A 1BDIA 2FR8A 4O4LB 1KSJA 2Z04A 4GMKA 3UHAA 1CZUA 3OT1B 3D81A 4FC7A 3DYVA 1NXVA 2MMGA 3UH1A 4B3FX 5A3JA 5HZKA 3VYWA 8MHTA 4TKLA 2IYOA 1G64A 2YRXA 1LTQA 1MKYA 4IQFA 1DWUA 4HNHA 3GJ0A 3VPDA 2QI9C 3AY6A 1KYZA 3H2JA 2ZUEA 3T3GA 3OX4A 4I4TA 9LDTA 1FLAA 1XMJA 2VJKA 5E4FA 4F86A 3VZQA 2P35A 4K28A 4RSRA 3WIDA 3M4JA 4FKBA 2HW8A 1X7ZB 3IDOA 4D8YA 4KAAA 3E1KA 2CDAA 1Y3CE 2JA2A 4ER7A 5JC8A 4XWOA 3FX2A 1T4CB 2HSGA 1OAAA 4OHRA 5IYZB 3AILA 3RTDA 3CFYA 3E3AA 1QHHA 3T4UA 1N3YA 4Q66C 4YREA 1HT3A 4DT1B 1K3TA 1FFDA 4XM1A 4IJUA 1Y9EA 3WHLA 2WINI 1DKLA 3LBAA 2UZ3A 2J4FA 3DFZA 4E2YA 2H29A 1AQLA 1IOWA 1RZVA 1VL0A 2JLZA 1UMCA 2GLTA 3QQ5A 4D3ZA 2GNPA 2A86A 2WMYA 5IANA 4P0PB 1TAQA 2VBIA 2O0HA 4BN5A 3UVEA 3WK6A 3H5IA 4BMVA 1JEAA 1GTJ1 1OD6A 2J0UA 4HQNA 5ELXA 4D3FA 3HC7A 2QT9A 2ZJFA 4GVLA 4WBNF 4UW9A 1JHMA 4ZD6A 1QYRA 5CK5A 3RRYA 2ERYA 5K4AA 1E9SA 4WZBB 1S96A 3KOZA 1W85B 5TT1A 3I01M 3WKAA 3HKDA 1N6NA 2EG5A 3MMSA 4Q00A 3RBAA 2QVYX 4BQFA 1WPQA 2Z3VA 1N7IA 3QWIA 4ZREA 3ZGXA 3FPJA 3IEVA 1RHMA 4CIYA 1OV4A 4RGBA 4Q05A 2DWQA 2G17A 2J5RA 2VH1A 3DL2A 3NV9A 3RG8A 3TCKA 2B36A 3DOIA 4ZICA 2VWQA 2UUOA 2QVCA 1I6MA 1CZOA 4GQAA 4P58A 4N48A 5K0JA 1LB1B 1QZTA 1WQ1R 4OH7A 3UHFA 2NX2A 1ZK2A 3UJCA 1NI5A 4GZMA 4W5NA 5EJMA 3LLMA 2F1HA 1H3EA 3L4BC 1VL2A 3VR4A 4ER6A 3NZEA 2E49A 4GWLA 3H0KA 4S05A 4BAUA 1I13A 4R9UC 4Y30A 1XTSA 3OPYI 4ZU3A 1JEOA 4HUJA 1BEEA 2WMDA 1RJ9A 4K9PA 4KE8A 5F7OA 3H5LA 1GCOA 1QZUA 1RXCA 3G7NA 1KS9A 3OUZA 1JMKC 4RQTA 1L4NA 1PEAA 3G2JA 5HQTA 2DMRA 2HF8A 1U63A 3K6SB 1DIGA 2HDNB 2WP0A 3QYAA 4FCCA 1N5JA 1GY8A 1X77A 3H2IA 4MW4A 2QIPA 3K6KA 5AQ1A 1PLLA 4BX0A 2V1XA 1G55A 4G63A 1KK0A 3U4QB 3DE4X 1CQXA 1FDUA 2GPSA 2JATA 3DB2A 5KWEA 1Z6ZA 2E4UA 1KMCA 2UZ1A 1T9KA 2ZRFA 4H17A 4HVCA 3C3EA 4FYMA 3P0JA 3QPDA 1W93A 4R8VA 2ZCUA 2EKQA 5KQPA 1NVGA 4TKVA 5ENDA 2ZS7A 4BCBA 3LXXA 1QLWA 5HILA 8AT1A 4CLHA 2AZMA 3K53A 4PE5B 3PR1A 4RF5A 2ZB2A 1G98A 2O5RA 4M88A 5JXWA 4V3BA 4N5MA 1QZXA 2GCOA 2PWYA 4DG9A 2IHJA 1FTYA 3L8GA 2XE8A 3MTBA 5JISA 2B3DA 3HU1A 4L6AA 1O94A 3HP7A 3HN2A 3CW8X 2EF0A 1Z83A 4IEIA 4UEQA 1J2YA 4K5QA 2JLQA 5KOJA 4XGKA 1O4WA 5ALYA 4YMIA 2BGWA 1QHGA 1C1XA 3IP6A 1JJAA 1GPMA 4KQEA 3D4PA 4KIFA 3G2OA 3AI3A 4QTUB 2HIAA 2CLMB 3N7UA 1XRLA 1IL0A 1S6YA 4W5WA 2WHPB 1VKJA 3TH5A 4E3ZA 3R3UA 3HLKA 4C06A 2KBFA 2HGSA 1V1MA 3IHWA 3UXMA 1GGMA 2NM0A 2YWBA 4ROTA 4KUEA 4DWVA 4M7PA 3QUAA 4AF7A 1D5CA 4G5YA 5H9WA 4MQMA 1Z9BA 2O2ZA 4EENA 1SG9A 2QE7D 5CLGA 1UPUA 3GYGA 2CNWD 1Y3HA 2WQZA 2X5XA 3A3NA 3L8MA 1T13A 3MMXA 3PDIA 1R4ZA 1UADA 2GM3A 3DKKA 4RPGA 5TT0A 4ZN6A 3BGSA 1V8OA 1EXMA 2V74B 2AB0A 3KEMA 4OBWA 1QU2A 3WISA 3PDUA 4MI6A 2H59A 2A0UA 2UYOA 1V4BA 3BIOA 4MWGA 3HBJA 3P94A 4MJ3A 4WLEA 4EPTA 2JH3A 3RC9A 2X5OA 2AN9A 4LN1A 1X7HA 4M1OA 3TQSA 3X44A 2DHQA 4J0KA 4CL2A 6CHYA 2XZPA 3V42A 3IRUA 4FEYA 5ILOA 2CXPA 4K9RA 1L4GA 3AU9A 1WVIA 4QASA 4TTVA 1DKMA 3TCNA 2CZCA 3ZW7A 4LZWA 4DM7A 3Q6IA 3BXOA 4NHOA 1WSDA 2R8RA 5C8YB 5JT1A 3ROGA 2CMDA 3ZE1B 3NHWA 3IL2A 2IPOA 4MS3B 3TEJA 3EG9B 4YPFA 4NH0A 2Z3ZA 4MMYB 4ZIRB 4QO8A 1Y5RA 2ZXUA 4ZU1X 2PZAA 3E7WA 1B0AA 3BAFA 2H65A 3FZEA 4YRDA 2HJSA 2HXGA 4JVNA 4AB1A 4MARA 4LJ5A 1RRVA 3G8YA 1B73A 1XLTA 2BCEA 4JI1B 3ZV7A 3ZW9A 1P0QA 3JAKA 4Z4HA 4NFYA 3BSYA 5B3KA 4X1KB 3QPCA 2X8BA 5KC8A 3O4FA 5FPPA 4J75A 5IH3A 3KVVA 4BNMA 5HUJA 4DMFA 5P8WA 4XI9A 1DLIA 4CETA 2P1DA 1I8TA 1QV6A 3R5FA 4WCFC 1UDRA 2NSDA 4UD2A 3KX2A 3IEXA 3KJQA 2V7WA 3CYFA 4UTXA 4XUCA 2XB4A 3H5NA 3UJ6A 4B80A 4DBVO 5HK9A 2ZTLA 5HEKA 4BB9A 3NWOA 3STHA 1XZIA 3CTMA 5ITZA 3JRNA 5FPQA 2PO5A 3FTCA 4YN3A 3MIZA 4I14A 4MVWA 3WLOA 4EJ6A 1BMFA 1WE2A 1UH5A 3Q98A 2JFXA 4BU0A 1DC7A 4N12A 2XT9A 3F1LA 4W63A 3TAUA 3WK5A 4P0QB 1GQOA 1T5HX 1W35A 1LK0A 1PJRA 4JT2A 4QBFA 4PIVA 3QNUA 2C99A 1PJZA 3H11B 3R2JA 4RIEA 1U7UA 5D86A 5EPEA 3K9HA 5K3CA 3H1TA 4URUR 2Q3DA 1SXJB 2OTCA 4UVIA 5FOWA 1E7RA 4NBLA 4XD2A 5EIBD 1Q21A 5H70A 4NC9A 4CF3A 2BUBA 3TRJA 1TTPB 1R9JA 4EECA 4MUXA 1G1AA 1TZJA 3TOXA 3WDKA 4D9CA 2VLIA 9GPBA 4FZ3A 1RJFA 1PNOA 2WD7B 4RQUA 2DQSA 3R0XA 3H2YA 1O5TA 5F73A 1UBLS 4NE2A 3VH1A 1IC6A 3WRYC 4E09A 4IXMA 4I19A 1JVSA 3PI7A 1C9EA 2IHTA 5TSDA 5AW7A 3IO5A 1KMMA 1W49A 3SIPA 4ZQGA 5KVQA 2P9BA 1QH8B 4YAJA 1BN6A 1NAIA 4AM8A 5G3ZA 2Q5CA 3TQQA 5LFAA 1I7SB 1QVWA 5JTUA 5LVAA 4PO9A 4Y6RA 4PIMA 2OC9A 3TD2A 1P2DA 3COWA 3WOVA 4P8RA 5I47A 4GVXA 2H11A 2BE7A 2Q21A 4Q34A 2R44A 3R75A 2VDJA 3ZHOA 3ZWBA 4DYHA 1SXHA 3ANYB 4JROA 3FMPB 3AR8A 3T1OA 2QLLA 4IGKA 4R1LA 1J2RA 3CH7A 3WO1A 3RC8A 2HBZA 1ZOSA 5B2EA 5CCBA 4IMRA 5AKYA 4JQYA 2P1RA 3TKAA 3P9CA 2WNIA 2GERA 3ZTWA 3TRDA 3VHXB 5B7QA 4JD5A 3IAUA 4ID3A 3OQ1A 2H4ZA 3O94A 2OZEA 5JCOA 2LBPA 3UNXA 4EY5A 6GPBA 4LFBB 5E6UA 2F9MA 2RGNA 2ACKA 2YFQA 1OASA 5ALWA 5I7UA 2AUNA 4KI7A 3DOHA 3ZGLA 3PD7A 2ZRBA 3WLPA 1XQXA 3PC8C 4J2TA 5KNCA 4EA6A 2FN8A 2CGEA 2OSVA 2NXEA 2QS9A 3Q7RA 3HM9A 4Z2AA 2OOKA 4MDYA 5B1IA 3R7SA 4XLTA 1XZPA 2FFHA 3FVVA 5E6RB 1AUXA 2G0AA 2QL5A 3C3PA 1D1SA 4I4NA 1IZ0A 1MUUA 2GR9A 1E8DA 2B6NA 4MHSA 1W4RA 1E0JA 1EEHA 3B1FA 3FHJA 3QY9A 4JLAA 1QUEA 5G1PA 3KQMA 3RIMA 4IQ4A 1NVVR 2XD9A 4BB0A 1ZUNB 5BP7A 1IQUA 1EG2A 1X6VA 2I4OA 2V7QD 2XKAA 3DBVO 1AQIA 1GL7A 1PQUA 1ISPA 4WT7A 3PFKA 3RUEA 1VG0B 1T8SA 4IDQA 4BVEA 4XCQA 2NSLA 1PZMA 3OJCA 3EDYA 1G8KA 2GZSA 4KIUA 3PQ5A 3PC2A 2VJMB 1YS1X 3A25A 3BMQA 4NG5A 4OIFA 2QTVB 4UM9D 1KYYA 4ZOQI 2GN1A 4EDHA 1UCFA 3WQHA 2BM9A 2HK7A 4W5RA 3H3XA 3T9CA 1O0SA 3ORYA 4MV5A 4DA8A 3EGOA 3KJEA 1KMHA 3ED5A 2Q27A 5ARBA 1ZMRA 4D26A 3LT5A 4DKXA 4YXWD 4FE7A 2GWRA 3UOAB 1ESMA 3M1LA 1CEEA 4LGCA 4DREA 4N03A 1N2IA 4JZKA 1PR9A 2CJWB 1G6Q1 1ES9A 1VMKA 2O20A 3HH8A 4BHTA 5DYIA 2G8NA 2D1RA 2C82A 3PXXA 1E2MA 1U3WA 2I1WA 2XMCA 4GYJA 5A7HA 4PG4A 1GGVA 4KXYA 3QG1A 4D3DA 2O2JA 1J25A 3PIIA 1E1MA 1CERA 1OU0A 1ODFA 1JIIA 1YZKA 2F3RA 2WWHA 5I3ZA 2DP4E 5TF4A 2QYOA 4YNBA 1FW8A 2P7HA 3QBEA 2C4UA 4FEGA 4JL8A 2EFYA 1NFRA 2EJBA 2O3RA 4PAWA 3K9QO 3B89A 4A92A 5LWQA 4OQ4A 2QIOA 4CKCA 5F51A 4FB5A 3T0GA 2JLVA 3A2MA 1BH2A 5F5XA 5A0VA 1M2KA 3N6XA 3ZK8A 3BK1A 4HLUA 4EAQA 4OQNA 5JWHA 2OHFA 3P2KA 5CW1A 2C2KA 1YUMA 2RDMA 4EA8A 3SKXA 5CX4A 3K9CA 2RJNA 4QDJA 4IWNA 3O21A 1ZK1A 1R0XA 2PR2A 1CPYA 3CURA 3D3EA 5D1NA 5GWXA 5JY6A 2FZCA 1ZM2A 2O4CA 4BNYA 3S2YA 3IR7A 4RTMA 2EJVA 3EBPA 4LJLA 3IDQA 3UKDA 3IAM6 1P0MA 2VDNB 4DCGA 1XCJA 2R8EA 3PCRB 3QA9A 4M60A 3ASUA 2O23A 1JEJA 2QNIA 3K72B 3UWPA 3RIGA 4PEVA 4YJFB 3L8FA 3HZZA 1ZR4A 4O2BF 4BMDA 1U8EA 1SU4A 421PA 3BGWA 4D0SA 1ST2A 2ZI9A 2G25A 3K2IA 3NHLA 2MDTA 4LK3A 3DBRA 2XVYA 3ITDA 2P6PA 1YBAA 4WKOA 3MOIA 1EGMB 2HPVA 5FPHA 2WY2D 1SUWA 3EZ9A 4PVDA 2R97A 4FD2A 3RIXA 3VR2A 3LL7A 1PSDA 3IJRA 2Q7OE 3I30X 1Q15A 1W96A 5IVPA 3EW7A 5U1PA 2FF5A 2BEWA 3D8UA 3H9GA 1BDBA 1G4HA 5CLQA 1E7WA 4ZDJA 2RE8A 4CM6A 2E37A 5JEEA 1W4LA 3BFVA 3SWWA 3OTGA 3L6RA 1H9CA 5SYAA 2E4AA 2CBGA 4OSOA 1RXUA 4YJHB 5GGXA 4EATA 2DQYA 4EHNA 1TZ2A 1SRRA 1W94A 3BIWA 4FS3A 4U7FA 4D43A 4B46A 2I67A 4MUAA 3PDHA 3TTVA 1WXFA 2VNAA 3C3AA 3F74A 4JP5A 3ZU4A 4ERXA 5IDYA 3K0CA 4MRPA 1CU1A 3MJSA 1VLLA 1CD5A 2ZYTX 4TVKA 4J1SA 4XD7D 1SZCA 1OFHA 3IEKA 4ACBA 3URMA 1DAOA 4QNRA 3QVOA 2GKSA 1RRKA 3F9IA 1GEEA 1FU4A 3L7CA 1JSCA 4O4HA 4YCDA 4MQBA 1EP2B 2A0WA 2ZKIA 3T12A 3RLFA 3FWNA 1DTSA 2NYUA 1ZA1A 1MQSA 3KKPA 3KYBA 4LMPA 4TMFA 1O6BA 2GO1A 3VZRA 2ZSIA 3VR6A 5U9CA 3JD0A 3DFMA 4H77A 5MHTA 1T8TA 1NUSA 4J29A 3S8MA 4MPRA 1TVEA 1NLUA 5IVIA 5REQB 1JDJA 3RTAA 1UBHS 2IYPA 2V7XA 3D64A 3EC2A 4F11A 2XT0A 1L4LA 5HKAA 4UNPA 4WW0A 3JY6A 1YCHA 4RCYA 4NPHA 4BAGA 2XKBA 4NXNB 1U99A 1K1EA 3VR3A 4CGZA 4KLRA 3N1UA 3QE4A 4JMLA 1QGYA 3PITA 3NYQA 4BX3A 4MA4A 4NENB 1VHJA 2FEOA 1MB9A 1EFPA 4H1WA 1ZM4A 1DZ3A 3JQAA 1WKBA 2W2LA 2Z1MA 3SF8B 5DTRA 2GJSA 1E1NA 4IUDS 3MVEA 3S44A 1FSGA 5AM0A 2A9KA 1T9GS 3CLKA 3QVVA 2G82A 1YUBA 3C6QA 4MQEB 5LP6B 1UEXC 1YVRA 4A3SA 2ID9A 2F1KA 5J47A 1PT5A 2OV8A 3DBHA 1YZYA 1R9MA 3E22B 5DO9A 4MUJA 4BJHB 4KMRA 1Q57A 3BPSA 1VFPA 4C4TA 4J0IA 1S0UA 1QCDA 1YDEA 1PL7A 1YQWA 2WTAA 4JNKA 3F5QA 5BQPA 5L7TA 1ODIA 1UKCA 1W0JA 3KLNA 3D0OA 2H2IA 4P3YA 3CE6A 5G4KA 3EUFA 1H2XA 4QQNA 5KU7A 2CVZA 5BWNA 1NRWA 4K81B 4PWYA 2ZTVA 3VMMA 2C4KA 4DDTA 2H1CA 4BOYA 5HSGA 2M9MA 3NGMA 2HTFA 4LXYA 1HBJA 2QD3A 1SG6A 4V03A 3H1BA 4XIGS 1G5QA 2BWJA 1FP2A 2XDQB 3KU4A 4WGGA 1ZA2A 4ZODA 2XWQA 3ESCA 3PPXA 1GRQA 5EINA 3O83A 4XGRA 2C84A 1DRUA 4FONA 4COOA 4EHLA 4GOMD 3LOUA 1EHIA 4P5EA 1QHSA 1R0BA 3C3CA 1O5OA 3N2NA 4HLQB 2JIDA