4BGUA

1.50 a resolution structure of the malate dehydrogenase from haloferax volcanii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
303
structure length
303
Chain Sequence
b'TKVSVIGAAGTVGAAAGYNLALRDVCDELVFVDIPKMEDKTVGQAADTNHGIAYDSNTVVTQGGYEDTAGSDVVVITAGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEYNDDFVSITTSNPVDLLNRHLYETGDRDRHKVIGFGGRLDSARFRYVLSQRFDVPVKNVDATILGEHGDAQVPVFSKVRVDGNDPAFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSLVLDGEFGYEDTAFGVPVKLGSNGIEEVVEWDLDDYEADLMDDAAEKLRDQYDEIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALATE DEHYDROGENASE
molecule tags Oxidoreductase
publication title Insight Into Structural Evolution of Extremophilic Proteins
rcsb
total genus 111
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bguA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4bguA02
4KUHA 1MGOA 2PZKA 3Q2KA 4XZ3A 4ZQEA 3KTDA 4J1NA 5KJEA 2H1SA 2GASA 5I7VA 1RKXA 4UREA 4AJOA 1H6DA 3CINA 3U4IA 1NQAO 3SLKA 2B5WA 2B4RO 3ZNPA 3GUYA 2E48A 3JQ9C 2R00C 2ZQZA 3KETA 4WCFC 3ZWWA 3AM3A 4YJGA 4RZIA 3D1LA 1CQIA 2O3SA 3DB2A 3FCOA 2BGLA 2BFOA 3AI1A 2BKAA 1IY8A 4RPGA 1DIRA 3GDOA 3IOYA 2OFPA 4AICA 2ZYGA 4UUNA 3WYEA 3DHYA 3F5QA 3OA2A 4DL9A 3MCVA 5HBRA 3GN2A 1JA9A 3MOIA 3AY3A 2HMVA 4IIVA 3WGOA 2DBZA 1NQOA 3KB6A 1M6HA 4CUKA 4DIOA 4NR0A 5A9SB 1E1MA 1K89A 3ZH2A 3DFZA 1ZIDA 2GN4A 1UAYA 3OJ0A 4CM5A 4WLUA 2VHWA 4I5FA 3BMQA 3DBVO 4DIFA 2C5EA 5G0VA 4E2ZA 1M2WA 2ZKLA 5F1KA 1ARZA 3KM0A 5IN4A 4IXTA 2C20A 1GTMA 4YDRA 3GFBA 4YJGB 1KEWA 1G6KA 4J2OA 1BGVA 4OXKA 4WOKA 5JDCC 2V7PA 4FJ0A 5CPBA 3RUCA 2JCYA 5KVVA 5JAIA 3L9WA 3OQ1A 4IDDA 1XQ1A 5HTOA 1CEQA 2ZIZA 4D42A 1C14A 1E3IA 4BIIA 1EE2A 2R2GA 2Y1FA 1Z7BA 2O4CA 3W8EA 5ER9A 1UZNA 3BHMA 4D46A 1JKJA 2PFGA 2UVDA 4WLVA 1GD1O 1RJWA 3DZBA 1Q0LA 4YJDA 1O6ZA 1PGNA 4QX6A 3CSDA 1C0PA 3B1JA 1HSZA 4YBZA 4MDHA 1LLQA 3QQPA 1HT0A 1CERA 3WGQA 1ENYA 4XYGA 3ZWCA 2DTEA 3GVHA 4D0RA 4E31A 3BTVA 4DQUA 4JGBA 1PJBA 2EP5A 1ONNA 5A3JA 2VWQA 3MJVA 3FPCA 3PVZA 4UEOA 4HXYA 3TPCA 5AXBA 3WQQA 4JBIA 4A73A 4O0LA 3QVTA 1SC6A 4GBJA 5IDQA 3HSKA 4GMFA 1DRVA 3GVCA 3LVFO 2WDZA 5TSDA 1AE1A 1Y5RA 1L7DA 1ADGA 2JAPA 3WWYA 3WYCA 3C1TA 3SXPA 3ANMA 1Y8QB 2W4QA 3ETGA 2EW8A 1GADO 2V6BA 4FQ8A 3C24A 3GLQA 2NTVA 4FC7A 2HCTA 3OJEA 2NU6A 4XRGA 3AY6A 3PWKA 4W7IA 1E7WA 3RKRA 2HRZA 2ZATA 1Q0HA 4WLFA 3MWDB 5C7LO 1PU2A 4J7CA 2W90A 4Z0TA 3TZHA 3AFNA 1R15A 2X9NA 4MP8A 4ZRNA 4NNJA 5I8ZA 1QYXA 1E6UA 3VOSA 2JFHA 3C7CB 3H2SA 4N18A 3MJSA 1XGKA 2DU8A 3K6JA 1SO8A 3ZHBA 4CR7A 4L4SA 4BMSA 5ICSA 4XEHA 4OXYA 1SZJG 1ISHA 1Z74A 5HS6A 5EN4A 3JQAB 3RUHA 1PQWA 3WJAA 2P9GA 4JP2A 4R69A 2VWGA 3OEWA 4TRNA 2DC1A 2W2LA 4JK3A 3JQFA 4Q39A 4J1QA 3Q6IA 4QFCA 5G4LA 4J3FA 4TSKA 3UGKA 3PIIA 3KLMX 4B79A 1YVEI 1BXZA 5JPIA 4CJXA 4QQRA 1C0LA 4U5QA 3E6AA 4BL5A 3SJ7A 2GYYA 2P91A 4DUPA 2J6IA 4DWVA 1NX6A 2ZTVA 3KEOA 1GPDG 2GSDA 2VOJA 1K3TA 2PD3A 4NU6A 1PGPA 2BFAA 2E82A 5KOIA 4U6QA 3RC1A 1R16A 1VI2A 2G1UA 2QYSA 3UVEA 4DRYA 3LU1A 3WQRA 3DTYA 4DTIA 3RVDA 3JQ8B 2ZB7A 3G1UA 1VPDA 3GZ4A 3PWSA 1ZK0A 1SBYA 5CDTA 1E92A 3GT0A 1QYCA 3ZV5A 3GHYA 1DXYA 2PLAA 3QWBA 5HA5A 4UVIA 1LDBA 1GZ3A 2DUWA 5L4SA 4IJWA 1DFHA 2GO1A 1P31A 3EY4A 4LVCA 3BXXA 2OZPA 2J5RA 4ZQHA 1Q7GA 5ADHA 5ILGA 3UAGA 1UJMA 1LSOA 3EGOA 2ZJ1A 1PSDA 3L6OO 3P2YA 3D4OA 5HRUA 3PZRA 1L7EA 1FMCA 1BXGA 3RI3A 4FCCA 3GG9A 4YJFA 3KVOA 4TRJA 1QYWA 4CV2A 4XJTA 4BNFA 4XIYA 1HL3A 5I7FA 2FMUA 3TQHA 1NP3A 1X13A 3VZPA 5JC1A 3PDJA 5K9ZA 3R3SA 1E7RA 4A0SA 1VKOA 1NHGA 4MVJH 5JS6A 1SOVA 2HJRA 3OJFA 3ONFA 2D1YA 1AGNA 1PJQA 4QECA 3SC6A 3INRA 2IRWA 4PG6A 2Q2VA 3CMCO 1CIVA 3VPSA 3VZRA 2HO5A 4O1MA 1RYEA 2XAAA 2FP4A 1LA2A 2NVWA 3OJLA 2BRUA 1N2SA 1KIFA 2HJSA 4L76A 2J5QA 2BGMA 2YHUA 2ZTMA 3AUAA 4PZEA 1NFFA 2I76A 2BMAA 3FWNA 4XQ9A 5DT9A 2AA3A 2HMTA 2CFCA 3W8FA 4FFNA 2PGJA 1LDMA 5A1TA 2D2IA 2NADA 4FN4A 1IHYA 1SEVA 3WG9A 3GNQA 3UCXA 3UFXA 1IYZA 3LC7O 1DC4A 4RLSA 4JXKA 2PZLA 2EF1A 5DP1A 2PGDA 1T1SA 3JQ8A 4I8XA 3PGJA 4MO2A 3RSHA 2GRAA 4I5DA 4NJMA 3NKLA 4IMPA 4TKLA 4K6FA 4MVJP 2EGGA 5K6AA 4I9UA 1P3DA 1R4NB 2VT2A 3MWEB 4ZGWA 1LXCA 4NK5A 4R3NA 5EPOA 2QRLA 3O03A 1ENPA 3W8DA 4BO6A 2IE0A 2JFGA 4MJLA 5U9CA 5TRTA 1DFGA 4RVUA 4ZQBA 3H5NA 4XCVA 4OIMA 3WIDA 2B36A 2OGUA 3G1TA 1VL8A 4IJVA 4DMLA 3JQFC 1YB4A 5KJ1A 1HF3A 4TRMA 4Z0PA 1LQUA 4RO0A 3IQDB 3Q9NA 4CLEA 1YJQA 4FJ1A 5GZ6A 5JO0A 1HYGA 3K8ZA 4BKOA 2GF2A 1YL5A 1AHIA 1O95A 3N74A 5A5FA 1YBMA 2EG9A 4OL9A 1ZZEA 1PS0A 4CV1A 4GL4A 4NMHA 1E7MA 2VNAA 4RQTA 4YJHA 2VQ3A 4B8WA 3E5MA 3CUKA 2CF6A 1AN9A 1ISJA 2O23A 2HRBA 4URFA 4E5YA 4XX0A 4NBRA 2NVUA 1GZ4A 3C8MA 4CQMB 1EUCA 2IDZA 4FFOA 2RH8A 3BHIA 4ZHSA 3L4SO 1KEVA 2BGKA 4OSPA 4BNLA 4J0EA 1A9YA 5TX7A 4PLPA 4FS3A 1ZJZA 4R3WA 4E4YA 1K5HA 1KVTA 3V5NA 2X22A 4Z6KA 2RH4A 4MVJF 3FF4A 3PHHA 4AJKA 4YAIA 1P1IA 2A9FA 3S2EA 1HDGO 4CMBA 1B0AA 3EVNA 4L4XA 2SCUA 4M1QA 1X15A 1ZNQO 4PRKA 2YDXA 3CPSA 1WDMA 4EBFA 1PJ4A 2DFDA 2WMDA 1MA0A 2G76A 3HHPA 1GEGA 1MXFA 4K26A 2IXAA 2ZJ0A 3LLSA 1QR6A 1ZFNA 1D3AA 3O4RA 1PQUA 2X8LA 1E5LA 2CF5A 4CQLB 2GZ2A 4J91A 5JMWA 4C7KA 1NHWA 1RYDA 1A71A 4CODB 3HN7A 3OICA 4RCVA 4BO7A 4NFHA 4UVGA 3K5PA 1JKFA 2Q1WA 1GV1A 2H63A 3FRJA 4ND1A 5IZCA 2DKNA 3DBHB 3RC7A 3IL2A 3IS3A 1R4NA 2O3RA 4NQZA 1A72A 3RAJA 4GX0A 1HE2A 3OM9A 3BMQB 3MJ4A 3P7MA 1NXQA 1UP7A 1NVTA 3U09A 4IDFA 4MVJD 1U8FO 1UH5A 1EBFA 3GNTA 3WLEA 2PD6A 4IUYA 4EGFA 3F3SA 4CMIA 2NQTA 4ZRMA 2WYUA 4PVDA 5BT9A 4OKIA 5G2OA 4INAA 4R51A 5EMHA 4BO4A 1DSSG 5A9SA 3NT5A 4RQUA 1OI7A 2ZK7A 2YY7A 3GGOA 3NGLA 5COQA 1DOHA 4GLLA 4JROA 4GPD1 4FOOA 1KYQA 1ZUD1 1F06A 4HY3A 3HG7A 1WDKA 4L9RA 5K6AC 3K9QO 2YHIB 1QSGA 3VTZA 1O5IA 3QVOA 4EITA 4O63O 3L6EA 1I2ZA 3I52A 1X0XA 4CLOA 3IAHA 4BNXA 2J3KA 2VRCA 2X0NA 4I5GA 4Z0HO 5JCXA 3U62A 5IDYA 3ROPA 1E6WA 2HK8A 4KQWA 4B3IA 3OSUA 1I8TA 3ICCA 1GDHA 3E5RA 4DQVA 4HV4A 3JTMA 2CVOA 3SJUA 1GYRA 3JQBA 1XHLA 2VRBA 3DZJA 1U7HA 4UEKA 1NVGA 2YV2A 4E3ZA 1Y8QA 3WX0A 2I5PO 3UCEA 5JXWA 1RM3A 4KUEA 1T1RA 5BR7A 2EGHA 4YJFB 4CM4B 2O2SA 5IF3A 3PQFA 1P77A 3BIOA 4B8ZA 3DZKA 4LN1A 2Q4BA 2B69A 5TQVA 3GZNA 1JAYA 3D3EA 5JNLA 4L4RA 3ZZNA 4RPLA 2IEBA 1MC4A 2NQ8A 3W4IA 5L4LA 1HDCA 2Q1UA 1I33A 2GN6A 4YAJA 1A5ZA 1Y8RA 2O7SA 3EHEA 1DC6A 1YBAA 2UUOA 1PIWA 3FNHA 1PWXA 1ADCA 3IJPA 2P68A 2QX7A 4PLYA 4DXHA 3IIEA 4CPDA 4N5MA 1BSVA 4EJMA 3F47A 2DTXA 3GMSA 5L7WA 1YOVB 5H83A 5I9NA 3ZHZA 3G17A 3L0DA 1S6YA 2XXJA 3T4XA 3OETA 1KY4A 1E1LA 1Y81A 1BWSA 1PGQA 3U4HA 2FSVA 1WMAA 2OHXA 4YQZA 3PFFA 4KWHA 3NTQA 2NSDA 3V2GA 4GQAA 3E8XA 3I6QA 1HRDA 3ADOA 3KBOA 2FR8A 5JMPA 4P38A 1UXHA 3LDHA 4AJEA 4FB5A 2YW9A 3LF2A 1IOLA 4GGPA 4UUOA 2PA3A 2ILTA 3HWRA 3FBTA 4XYBA 3VVCA 3ZU4A 5IZCC 1G1AA 1E77A 4U8GA 5DNAA 1P1JA 4CR8A 3WMXA 1LLUA 4Z3DA 3ZWNA 1TA4A 4R1NA 4OOEA 5F1OA 4RL6A 4YT5A 1MP0A 1XCBA 5FYDA 1HLPA 5KNLA 4FFRA 4QO7A 1LTHR 2W8ZA 1PR9A 3D7LA 4ZICA 3H3JA 1BDBA 2Y1GA 1HZJA 2EERA 4RVDA 3S1LA 4DYDA 1W6UA 2FZWA 2P2SA 2J3HA 1F0YA 4B3HA 4TROA 1F17A 5A04A 3GUCA 2AQHA 1E3SA 3I6IA 2CMDA 4J2HA 4L0QA 4JJIA 4YA6A 1GPJA 3ZNQA 2G17A 3AI3A 4PLFA 3H9JA 1Y8RB 4IQ8A 1P9LA 4MIOA 1GUFA 1TT7A 3ASUA 3L9XA 4CUZA 1LSJA 4M54A 1VRWA 3JQ7B 3JQAD 3R6DA 3GOHA 4KTTE 2OBNA 3JYPA 4YPOA 5JY6A 4I08A 4PCVA 3R1IA 4PIVA 1UXGA 5HM8A 4BO0A 3GEDA 2EP7A 1DIHA 1NQ5A 2GLXA 3BTOA 4RVSA 2ZYDA 1B8UA 1OAAA 2EKQA 1YBVA 1QLJA 4HFMA 5G4KA 3VVBA 3W1VA 3I9OA 5HWSA 4ZN6A 3QHAA 3ST7A 2VRCD 5T5QA 4CM6A 2DM6A 4J9UE 1YS4A 3GZNB 3CZRA 1N5DA 1P1FA 3ZWAA 3ASVA 2EWMA 5I9MA 4YXFA 5JCJD 1LJ8A 2XXBA 5CG2A 5H81A 4PZCA 1M6WA 4Y9DA 3PXXA 4FD3A 4CLHA 5LDHA 1E6EA 3WGHA 1AXEA 1YB5A 4R41A 1XEAA 1HDOA 4W9NC 1E7SA 4M49A 4J4BA 4DBVO 4D44A 3H5RA 3M2PA 2NVUB 1UAGA 3JQDA 3NTRA 1ISFA 2Q1TA 4PLWA 3CKYA 3DOOA 3I3OA 1N7GA 3MJCA 2PGLA 1EQ2A 4R01A 3COSA 1I3MA 3NTOA 1WNTA 3KSUA 3ANNA 1PJCA 3U5TA 1NWHA 1ZK3A 5BQFA 3VDQA 1PQPA 1U3VA 5EIOA 4GLOA 2Y67A 4GWGA 3TZCA 1MG0A 3DZIA 1VJ1A 4CM8A 2YUTA 1KVRA 3NJ4A 1CDOA 1UXIA 3PHLA 3DMYA 1GV0A 1ZK4A 3DZHA 4TVBA 3OBBA 1LSUA 3U3XA 3PFWO 4IPTA 4UVHA 4KP7A 5I9LA 4BKPA 4HBGA 4NHEA 5DCYA 2VCYA 3WJ7A 4C7JA 1TLTA 1V3VA 1Q7BA 1PJSA 5T64A 4LVUA 3E9MA 4UUMA 1UP6A 3DOCA 1J4AA 3STHA 2AE2A 3MJTA 4GX1A 1Y5MA 1D4FA 3CEAA 3Q2IA 3VTFA 4YR9A 3GA0A 3DFUA 2JHFA 1T2FA 2JHGA 3ZWMA 4EUEA 3P2OA 4ZJUA 3BHJA 3FSRA 4YAEA 4RPKA 3OQ6A 1X7DA 2FSSA 4CM1A 3DR3A 1GCOA 4OYRA 2V65A 3RUIA 1ID1A 5EQFA 3CMMA 3ETEA 3MTJA 3U0BA 2YV1A 4G5HA 1E0DA 4GKBA 3B1FA 1O94A 4J1SA 1G0OA 5CEFA 3CXRA 3KYCB 1PS8A 3FTNA 4JBHA 3AW9A 4D45A 3ZHXA 4LGVA 1KC1A 1PJ3A 2IYPA 3MJEA 1BTOA 2O48X 2GNAA 1Z6ZA 4ALMA 3HN2A 3RCBA 2YV3A 2ZQYA 1H5QA 1HSOA 3RU7A 4Y6SA 1SPXA 1B26A 2B0JA 3AUSA 4OXNA 4CUJA 4D43A 5U1PA 3PLNA 1TVEA 4MKXA 5BSEA 4UAGA 5GY7A 3WYBA 2X9VA 1QV7A 1HETA 4RORA 4GKVA 1C1DB 4GX2A 4RPHA 1Y9AA 3SEFA 1DLJA 2BFMA 1JVSA 4FFPA 2PZJA 3TRIA 3KLPX 3H7AA 3GVXA 4E13A 5J23A 3X2FA 3NRCA 5A4DA 1K0UA 3RBZA 1WP4A 4IMRA 7MDHA 5TIIA 4TRRA 1DC3A 3D4PA 3ZV6A 3OF2A 4E32A 2X6TA 1VE9A 3A06A 1QYVA 4PRLA 2XPCA 4X54A 4FW8A 2O7QA 4BNKA 3KEQA 2W2KB 2R6JA 4RLHA 1ZJYA 3JD3A 5LCXA 2HLPA 4S3MA 2BELA 4NFSA 4IS2A 4PLVA 4LMRA 4PVCA 4WEQA 4A2CA 3FTPA 2V6GA 3ONEA 1CWUA 3E9QA 4QEDA 4J7UA 4A7PA 4W9NA 5JYDA 1IULA 4K1LA 1YL6A 4FOSA 2W98A 1NVMB 2HMSA 2ZB4A 2PR2A 2X86A 3TL3A 4E0BA 3JQ9A 2R00A 4MP6A 3IKTA 4XYLA 1YE3A 3BAZA 2VUUA 1NNUA 2IYOA 3K73O 4CMIB 2VHYA 2XF8A 2VZ9A 5KKCA 5BSGA 2Z1MA 4Q3CA 4U7WA 1OC2A 1V3UA 5AYVA 1XLTA 1AHHA 3KYBA 4KDFA 1PJ2A 3IDSA 4BNNA 1E3WA 3JQGA 5EINA 3DBHA 1PZHA 4L75A 1OMOA 1U7TA 1YB1A 8LDHA 2I99A 3S55A 4DIBA 2VNSA 4XJSA 2JKVA 3WNVA 4BS9A 3AOGA 4FSHA 3QVXA 2A92A 3TL2A 1DJQA 3VDRA 3B6ZA 1HDXA 2EIHA 1BXKA 2EV9A 4OQYA 2LDBA 1B14A 2ET6A 5L9AA 2O4UX 1FDTA 1SCUA 5JDCA 3S2IA 4ND5A 2DLDA 4DLBA 1V0JA 2DBQA 6ADHA 5DP2A 1DIGA 2W2KA 3GGPA 3A4VA 3PDUA 5L7YA 5THQA 1KEPA 1JWAB 3BYZA 4O5OA 3WICA 1X7HA 5KVQA 1U8XX 2D8AA 1YONA 1HDZA 1OOEA 3LYLA 4TQGA 2F1KA 1UXKA 1VL6A 3EDMA 5CHEA 1Z45A 5HS4A 2Y0CA 1PJTA 4OQZA 5F1PA 2NNLD 3PWZA 4Q3EA 3K96A 3ZU3A 4NDNE 1JDJA 2HMUA 1HTBA 5L95A 4XWYA 1T4BA 4IS3A 1ZO8A 1WVGA 3MOGA 4FGSA 3B20A 4PG5A 4D3FA 1ZMTA 1HZZA 3AM5A 4J4TA 4YEDA 3GFGA 1ISGA 4F45A 1EUDA 1IHXA 1NPYA 1QXSA 4BNYA 2D3TA 4CLXA 2ZTLA 1ZBQA 4DVJA 4NBTA 2F00A 3ZWPA 1H0KA 3VKUA 2NLOA 3GK3A 4MINA 3QLJA 4ZQFA 2PZMA 1LDEA 4RJTA 1ORRA 5F21A 1Y7TA 2WWRA 4BV8A 3GNSA 3WGIA 3VPXA 3EK2A 5JLAA 3I9NA 5TC4A 1T2EA 1EVYA 4KDEA 3QWHA 2D5AA 1Q7CA 4M8SA 3WGGA 4DQXA 1N9GA 5COBA 4BNIA 4E5NA 3W4KA 5BSHA 3TFOA 3ZWXA 3WSWA 5DBIA 4WCDA 3AY7A 3ITDA 1P1RA 4O6VA 3PRJA 3TWOA 2IEDA 1I32A 5BNIA 1LU9A 1NR1A 3PJFA 4NU5A 4QTZA 3RKUA 5DULA 4MVJI 3TZKA 5L4NA 1C0IA 3CZMA 4ITUA 2VT3A 4ALNA 3FPLA 3K2EA 2FR1A 4PLHA 4A03A 1SEPA 4EDFA 4CLRB 3FD8A 5A05A 4BGEA 1R66A 1YO6A 2E6UX 4IM7A 4Q3NA 4Y6PA 5EESA 1HE3A 4EEXA 3H9EO 2O3UA 2ZYAA 3PPIA 4JN6B 4MP3A 1GQYA 1R6DA 2Y66A 2WEKA 4WLNA 3PYXA 3EW7A 4QO8A 1Z75A 1FJHA 5IN5A 1ZK1A 2ZTUA 1HXHA 1T4DA 2FY8A 3I4CA 3WR5A 4JCOA 4CL8A 4DPKA 1ZEMA 4W82A 3T7EA 1GQ2A 1A7KA 3NYWA 5I8WA 5AOVA 3BMCA 1OZAA 3UF0A 5G0WA 4IJKA 2CY0A 2AEFA 2FZEA 2CUKA 4B7CA 4D7AA 3GHHA 1EVIA 4HUJA 1F8GA 3OIGA 1P0FA 4OOFA 4L8VA 1VL0A 4D41A 1YH3A 5TGDA 4CMAA 3EYWA 1HKUA 4GI2A 2PD4A 4EUFA 4OKNA 3K2BA 1OC4A 4CLDA 3O38A 4ZD6A 4HFRA 1OBFO 1WAMA 1GUZA 3AOEC 2V6MA 4LRSB 3GAZA 2HQ1A 1I2CA 3OIDA 1DDOA 4BNWA 1P33A 2Q49A 4NJOA 3F9IA 4OSOA 3V1YA 3HDYA 4G65A 3HFGA 3GRKA 4J16A 4DPMA 2NM0A 4OJNA 3P5SA 1F12A 3L6DA 2FHSA 3BZUA 4CV0A 3DXFA 4ALJA 2J3IA 3E03A 4YACA 4QUKA 4EJ6A 2NU7A 3JD4A 2GZ1A 2H6EA 2PH3A 3OIFA 1EMDA 3PJEA 4A26A 2OO5A 3PHIA 2B5VA 1C0KA 3ZI0A 4J4HA 4YAKA 4B4WA 3EVTA 3DMTA 2TMDA 3ZGYA 4FGWA 2FPPA 1UUFA 3HB5X 4R4JA 5EJ2A 5FI3A 3ZV3A 1B8VA 1HWYA 1DAPA 2Y99A 4GX5A 5JAMA 1A7AA 3L77A 4WOJA 3PTZA 1SAYA 2PK3A 4RF3A 4GAEA 4YJHB 5DZSA 4B4OA 4PZDA 1QORA 5EQDA 4IXWA 2QRJA 4XYMA 4CM9D 3BMCB 3WTBA 5CPFA 1I36A 3RC9A 3I83A 5EERA 3KYDB 3EZLA 1U1IA 2GUGA 4FBGA 4HADA 4HFNA 5IJZA 1ZEJA 2C82A 2Q50A 3PP8A 4OAQA 3Q0EA 2JAHA 4IGFA 5AVOA 1LLDA 2Q2WA 1QV6A 4P4NA 4XB1A 5DDIP 5F5NA 3U49A 1UDAA 4RVHA 1PGJA 3ANLA 4ALKA 2E4AA 1Y6JA 1DPGA 4WECA 2X5OA 5G0SA 4CM8B 2Q4EA 1JQBA 3O8QB 1QLHA 5COAA 4BB5A 3ZU2A 1U3UA 1NWCA 4HNGA 2NWQA 2RCYA 1ZXLA 5L53A 2EJWA 5KTKA 1IZ9A 3B70A 3T7CA 1UDBA 2C59A 5JO9A 3JD0A 2JCXA 1WZEA 2P9CA 3ZN2A 3FR7A 1X7GA 3F4BA 4II3A 3GDFA 1HE4A 1DRUA 4YVFA 3RROA 4YRAA 2G5CA 1GCUA 2DTDA 4CQLA 1QKIA 4KTVE 1LBEA 1N8KA 4CV3A 4BOYA 1U5CA 1TEHA 3QE3A 1MX3A 5T6BA 4BUCA 2EW2A 4E21A 3DQPA 3JYNA 1Z82A 1HYHA 1VSVA 3DONA 2DAPA 5L51A 2PWZA 1PGOA 2I3AA 2PKRA 3C7DB 3U9LA 4FJ2A 4XDYA 1H93A 4BQPA 1ENOA 4WE3A 4NFYA 4LK3A 1S7CA 4XQCA 3WWZA 1LUAA 1MLDA 3WSVA 1ZW1A 3OHSX 4Z9XA 4CMJA 3JQEA 4LSWA 1ZSVA 3H9GA 5KCZA 4II2A 4N7RA 3D64A 2IZ1A 9LDBA 2OUIA 3LC2O 3ON5A 3UOGA 4CM4A 1T2CA 4R1SA 3KUXA 2PNFA 4B3JA 2IODA 5IG2A 1NPTO 5KJ6A 3PYLA 5CEEA 4NBUA 2HUNA 1N7HA 3HADA 4CMKA 1PL8A 4R16A 2RAFA 1YXMA 1I0ZA 3E48A 3QA9A 1DEHA 4M89A 4ONEA 5CFZA 1EFLA 2Z95A 2AEMA 1I30A 1FDVA 2Q99A 1GAEO 1UZLA 3PZBA 2C7GA 4BGUA 4MOWA 1ULUA 3VH2A 2BF7A 2P4QA 3PYMA 2X7HA 2C7VA 2B4QA 1EDOA 1YL7A 3LT0A 4J1TA 3VC7A 3WBBA 4YAGA 4WUVA 2X9GA 1U2GA 1W73A 2HDHA 4IJUA 4IDEA 4LMPA 1GQQA 5ENVA 3EMKA 1ONOA 1W4ZA 3N58A 4G81A 4GVXA 3RJ5A 1WZIA 2DQ4A 2CNBA 2PKQP 3VZQA 4J90A 1QRRA 1BHSA 1YQGA 3G3EA 1NAIA 3W6ZA 1EK5A 6LDHA 1PEDA 3F5SA 4Y8VA 1CETA 1H2HA 2V6FA 3EZYA 3KO8A 5KWEA 3ETDA 2X4GA 4JJGA 1TT5A 1SMKA 5BSFA 1O0SA 1SNYA 5I7SA 3KSDO 3CIFA 4IIUA 4MVJE 4IQGA 3GVPA 3TSCA 1AXGA 1H2BA 4FC6A 3AWDA 4UUPA 2Y68A 5B4TA 2Q45A 1YQXA 3NUGA 4MIYA 3L07A 1LRKA 2VHXA 4D3SA 1T25A 1EK6A 4BKQA 1E7QA 4UVEA 3BTSA 1K6JA 1E3EA 2QHXA 1J6UA 3G49A 3BA1A 4QSMA 1FDSA 2HKIA 3I5MA 3PQDA 3RFVA 1J5PA 4B4VA 2Q3EA 1NFRA 3PLRA 3AM4A 2WSBA 1BW9B 2Y1OA 3MEQA 1EVZA 3W6UA 2WE7A 1EZ4A 2FWMX 3FHLA 4E5MA 2BH9A 5KVCA 1LC3A 2GD1O 2DUUA 4BNTA 3AU8A 3RUAA 3VPGA 1H94A 3Q3CA 2C0CA 4MVJG 4E12A 2WM3A 1C1XB 4ZVVA 2VUTA 1YDWA 2G82A 4JP3A 5T8KA 4BHTA 2UYYA 1NPDA 3M6IA 1M75A 2DT5A 3JQ7A 4QT0A 4Y6RA 4F6LA 3QVWA 3LF1A 4TZTA 4HNHA 3SX2A 1Y1PA 2RIRA 3LSYA 3JYOA 3OH8A 3OMLA 4IBOA 5G0TA 5AXDA 1B16A 4MVJA 2X23A 4Y67A 5AXCA 5JE8A 5T57A 3UCFA 3H5AA 4IINA 4QXMA 1CYDA 2QW8A 1P74A 3BTUA 4WCFA 4RDIA 1EEHA 5B12A 3HZZA 2TMGA 2BFPA 4RF4A 4YRBA 3GC6A 1IZ0A 1UZMA 4ND2A 4BVAA 1H9BA 3CTMA 3EAGA 1BG6A 1H6BA 3C85A 1IPEA 3FNGA 5I7EA 3UKOA 1LDGA 3O8QA 4TMFA 1PR3A 1H6AA 1GEEA 4ND4A 3IKVA 3HQ4O 1I5RA 1JN0A 2WE8A 3ICPA 4QFDA 4U6SA 2EXXA 5CDGA 3RBVA 2VWHA 1E3WB 3JQGB 2FR0A 2UAGA 3DL2A 3PJGA 3RUEA 5THKA 3KV3O 5LC1A 5IFLA 1KVSA 5IZ4A 5IAAA 5JAQA 4PLCA 1RWBA 3QY9A 4GH5A 3DTTA 3RWBA 1A4IA 4HKTA 4IZIA 4EEZA 4OM8A 3D5TA 4W6ZA 1V35A 1YGYA 3W4JA 5C3MA 4D79A 1VSUA 4P22A 2EEZA 3CH6A 5TS3A 1CJCA 2VUSA 3TZ6A 4E6PA 1LSSA 3LZ6A 1D1TA 4WASA 3G79A 3QIVA 4ZQGA 1DLIA 4XB2A 3QWFA 3ITKA 3JD2A 4Q3BA 5JBIA 4JIGA 3ZWOA 1Z7EA 4J0FA 2XOXA 3QSGA 4N5LA 5CDSA 3F1LA 1ZMOA 4WLEA 3ENKA 4WJZA 3A1NA 1LI4A 3H9UA 5JDIA 1KETA 4CMCA 3LLVA 1UR5A 3AK4A 1QG6A 4LCJA 2YFQA 4XKJA 3ROKA 2P9EA 4AJ4A 2VYNA 2GCGA 4OHUA 2GN8A 2J5KA 4CL3A 4YT8A 1KERA 3ROMA 4YCAA 3IC5A 2I65A 3LK7A 1U2DA 3SLGA 5F5LA 1MC5A 5CEJA 2HK7A 2AQIA 1X0VA 3K31A 4WKGA 1ZSNA 2QYTA 4F6CA 3Q9UA 4PN3A 2E49A 3GH3A 2AHRA 4BKUA 1XU9A 4IDAA 2WD8A 4ESOA 5DCUA 1FF9A 2Y0EA 1LQTA 1P45A 4GWKA 3GN1A 4NBVA 3LT1A 3VPFA 3WS7A 1SB8A 4BNMA 2RBEA 2EKPA 3AI2A 1DBVO 5IDWA 1PZFA 1I01A 3PGXA 5T8KC 3UICA 3QJ5A 4AJPA 5T67A 5ILOA 1LLCA 2BLLA 4FPXA 1JLLA 5JY1A 4P4LA 3GMDA 4J49A 5ENDA 3ZWVA 2AE1A 2DFVA 4U0JA 1F8FA 5JAZA 3U4CA 2P4HX 4AVYA 1EQUA 3P19A 1IPFA 2CZCA 5DF1A 1X14A 1JWBB 1XIVA 1MG5A 1ISIA 4UVDA 4KUGA 1DHRA 3E82A 1XR3A 4YB8A 3GGGA 1A27A 1XELA 4XYEA 2I67A 4Z9FA 4BNGA 4KOAA 4R54A 3NDJA 1GUYA 1AUPA 4BO2A 1DC5A 3KRTA 1ULSA 2OBYA 2GERA 3ZNOA 4J7XA 2CSUA 3PHJA 4GGOA 4I9HA 1T2AA 4E33A 1BVRA 3S2GA 2VYVA 1NR7A 4WEOA 4XGKA 1VKNA 3ZDFA 4A5OA 4BO3A 2HU2A 1WWKA 2D0IA 1ZK2A 3GY0A 1V9LA 4JNKA 1GFSA 1YQDA 3IUPA 2OMEA 1L1FA 1DAOA 3SC4A 1YWGO 1NFQA 1E1KA 3OA0A 1CQJA 1P1HA 3QP9A 4JLWA 3D5QA 4R68A 5ES3A 4TKMA 3HJAA 1X1EA 4PLZA 3RJ9A 1EUZA 2FN7A 4WCFB 1Q0QA 4R9RA 2AQKA 4Q9NA 4F46A 3QRWA 5KIAA 4EW6A 1A9ZA 1XSEA 4MIEA 1ZXBA 1TI7A 1JU9A 3K92A 4NZ9A 4JX8A 5F3RA 5CAEA 3TN7A 4ID9A 3QWIA 2DPHA 3FN4A 4WGGA 2VHVA 3WDSA 4FFLA 5JYEA 2CDCA 3V1UA 2B83A 3ZU5A 1C1DA 1M76A 3PIDA 1PL6A 3JSAA 1DIAA 3BMNB 3GF4A 2NTNA 1EE9A 5L7TA 4CMHA 1PS9A 1KOLA 2I66A 1PZGA 4BGIA 4AJJA 2VZ0A 3A14A 3H2ZA 3GPIA 5JDIC 1WXDA 2O50A 4J6FA 2BI8A 2BD0A 1B7GO 3C1OA 1KBZA 4RDHA 3VZSA 4CMGA 1LDYA 2OXIA 4NI5A 3A28A 1KC3A 5G4KB 1V3TA 1EVJA 1BW9A 1LNQA 4G2NA 5DCWA 3L4BA 1I3NA 4RVGA 2JD0A 3DEYX 4R1TA 1I2BA 3AJRA 2NU8A 3DAPA 1PWZA 4LISA 1NAHA 3GAFA 3WNQA 1XYGA 4IY1A 4DPLA 4OMUA 2ZCUA 4BO5A 2C07A 5TNXA 4RPJA 3PK0A 3RFTA 4KQXA 4EUHA 1RM5A 5K0ZA 1YDEA 3T4EA 1B3RA 3NV9A 4CQMA 4ILKA 3VKVA 4L73A 4BNHA 2Z5LA 3G0OA 4FFMA 3HDQA 4NIMA 4P8RA 5DOVA 4ZA2A 2B4TO 2Y0DA 4IDBA 4K28A 4IDGA 2X0JA 2AMFA 4H7PA 2Y1DA 2QG4A 5DN9A 3SVTA 3FWZA 3UH1A 4UULA 3ROQA 4CM9A 4RGBA 1C3VA 4BB6A 4D0SA 4YWJA 4YRDA 1YJ8A 1NASA 1B3BA 1HYEA 3NT2A 4OO3A 2HMWA 5A3VA 2C5AA 4XGNA 5DBFA 5IXSA 1OFGA 3IP3A 4L74A 3VH3A 3PI7A 2AEJA 1BVUA 3D4NA 3JV7A 3I9JA 1P1KA 5TLSA 2C54A 4H16A 4CMEC 1E5QA 4RZHA 1E7YA 3WB9A 2YQ5A 1HEUA 3B1KA 3NGXA 3KYDA 2Z1NA 4N5NA 3NDIA 4FDAA 5C7IO 3OQBA 2FPIA 1SOWA 3HFSA 4XR4A 4W7HA 3D3WB 1T26A 2AG5A 4O59O 2GZ3A 1ISMA 3WQSB 3DBRB 5A9TA 3FI9A 1IUKA 2CVQA 1N1GA 4DA9A 3ZV4A 4ALLA 4BMVA 3QWAA 5GZ1A 3ABIA 2DVMA 5KKAA 4ND3A 4Q3DA 1PX0A 2Q1SA 1HLDA 4I9NA 2IXBA 1SB9A 5ITWA 2P5YA 3RU9A 2VOEA 1M66A 3E1KA 4YT4A 4HWKA 3LT2A 1HDRA 1FDWA 2UDPA 3LT4A 1I3KA 3RASA 4PLTA 3WTCA 3ZNNA 4BKRA 1JVBA 3C3XA 4XRRA 2DPGA 4BMNA 4HFJA 3HB4X 3TJRA 3ZW9A 1WMBA 4BO9A 3JYQA 3GPDG 3DBRA 5C5IA 2OP1A 5ICMA 3U4DA 1RM0A 3UW3A 1LEHA 3DZGA 5BNTA 3D3WA 1V6AA 4W99A 3DAGA 1NTOA 3PQEA 3TDKA 2I9PA 3ONDA 2O2YA 1PJLA 1ZSYA 2DBVO 5ER6A 3M1LA 5JW6A 1ADBA 2X5JO 5L45A 3L4BC 1P0CA 4LRTB 2G0TA 1XA0A 3NAQA 4IDCA 4CLOB 4AJHA 2ZB3A 5JSFA 3LQFA 5B1YA 2P5UA 1LC0A 3GDGA 4Y98A 2YHIA 5MGBA 3E9NA 3AFMA 1TT5B 1JTVA 3H3FA 2GPTA 3TZQA 4TWRA 2HK9A 4M87A 3QW2A 1Q1NA 1GY8A 4XR9A 3C7AA 1U9JA 3ZWBA 4MPDA 3INTA 1VJTA 1GL3A 2VYND 3JD1A 5A9RA 1R4MA 1T2DA 5GMOA 2PH5A 3RD5A 5GZ3A 2OL4A 1MFPA 5JFOA 2BI7A 4E5KA 3O9ZA 3H8VA 4Z3KA 4NBWA 1HDYA 1E1NA 1IB6A 2WD7B 2VWPA 4XDZA 4BO8A 4I1IA 3IMFA 3A9WA 3MTGA 1A4UA 2POQX 2O3JA 1XWFA 2RHRA 4JQCA 2A4KA 3NDRA 2UUPA 5CDUA 2X0RA 2D5CA 1XQ6A 2CDBA 2VYVD 3UUWA 4OGWA 4A27A 1K2WA 1X1TA 2WTBA 1MUUA 4CMEA 2X58A 5FI5A 4EZBA 3I4FA 4AJNA 2CDAA 1O8CA 5TT0A 3DC2A 1U4OA 3DDNA 1UXJA 4GMGA 5JC8A 1T24A 2PV7A 3JQBC 2UV8A 4XIJA 2Q2QA 2X1HA 1PTJA 3DZFA 2B37A 5G0UA 3WMWA 2JD1A 3KSZO 1GYQA 1VLLA 4JBGA 5FFFA 5TF4A 3WOHA 4DREA 4E30A 3OJOA 5MDHA 4BGVA 4H15A 3C1AA 3FBGA 1WLYA 1JAXA 1J49A 1GZ6A 1CF2O 2D4AA 1CRWG 2YFHA 1RPNA 5C37A 3N7UA 1KEUA 4A10A 2FPGA 2QZZA 3CE6A 5A5EA 3I9MA 1D1SA 3V2UA 2IZ0A 1KY5A 2J8ZA 4DGSA 3AOEA 4BV9A 3BMOB 3DBLA 3BMNA 2EKLA 4AFNA 4HX5A 2HAEA 4YQYA 1R0LA 1ADFA 1LRLA 1BRMA 4GVLA 1IL0A 4EI2A 1GYPA 2CVZA 5A03A 3F4LA 2WJPA 5DBGA 3RFXA 4B7XA 3AUUA 4XQEA 4AJLA 4FR5A 4B4UA 4PFJA 3JQCA 4WPGA 1IE3A 3UN1A 2I3GA 2NTJA 3M1AA 1PZEA 2QRKA 4W4TA 3WIEA 4RVFA 2Y93A 1I3LA 4D3DA 1B15A 2A35A 2GR9A 3M2TA 1DRWA 4LCEA 1Q2XA 1XDWA 5DOZA 1W0CA 4E5PA 3NT4A 4R5MA 2OP0A 3H65A 2GDZA 1VM6A 3OFSA 3WFIA 4XGIA 2FOIA 1EDZA 3RUDA 3EUWA 3DMTC 4CM7A 3F46A 3JYLA 3DOJA 5ITVA 1Y9EA 2GN9A 3HUDA 2QZ9A 4Q3AA 4S1VA 3I9KA 3ZWYA 3VAZA 1B2LA 2NUAA 4IZHA 3F6YA 1I10A 1LX6A 4EJ0A 1M67A 2C2XA 1DB3A 4Z9YA 5BNFA 3GRPA 3RIHA 2LDXA 3TOZA 3H4VA 4XA8A 2PY6A 4BQRA 1R0SA 4CR6A 3K30A 5B4UA 2YYYA 1XG5A 2OOSA 3AU9A 2IZZA 4NG5A 4LSMA 3VH1A 4E2XA 3WGTA 4N54A 1J0XO 1VJ0A 4IQ0A 4NJMB 1R4MB 2X5KO 4PG4A 3ZCXA 3TF5A 3V2HA 5IDXA 3ORFA 4BNJA 4CM3A 3GG2A 1N9GB 2JFFA 3OECA 5FF9A 3OEYA 2PTGA 4F3YA 1LDNA 1DIBA 2NVBA 4GSLA 3DO5A 2H9IA 3GEGA 1K6XA 2Y1CA 3MZ0A 1KVUA 3RC2A 3WLFA 2GGSA 3EC7A 3QV1A 3V8BA 3KOUA 2I6TA 3TFQA 5B37A 3S2FA 3FNEA 1NM5A 5EL0A 5A06A 4R5HA 2D59A 4PGFA 4E2WA 1I24A 4EYEA 2AXQA 5CP8A 1YOVA 3HNPA 3R0IA 1BMDA 2Y05A 2JJYA 2VTDA 2CD9A 4KWIA 2O3QA 1LRJA 3H9QA 3H6KA 3O26A 3QVSA 3INGA 3PEFA 2NU9A 4U0KA 1E3LA 4UEJA 4AJ2A 7ADHA 1TXGA 3ZW8A 1F14A 1E3JA 4J43A 1HE5A 2JCVA 2YQ4A 4PG7A 3IP1A 1QP8A 1ZCJA 3RUFA 1C1XA 4C4OA 3UHAA 4XD2A 3ZHYA 1D8AA 2VHZA 1XU7A 3DHEA 5B4VA 1R37A 3KXDA 2HSDA 1DHTA 1RM4A 1ZKMA 1JKIA 3KZVA 1B8PA 4BO1A 4DC0A 4DMMA 1U4SA 5FWNA 3FR8A 1ML3A 3DWFA 3E18A 4AJ1A 3GVIA 4GSKA 4YT2A 3AUTA 3HDJA 1FDUA 3JQ6A 3ULKA 3WGZA 3NEPX 1PL7A 3SBOA 2QIOA 3TNLA 2FRDA 1QYDA 4DYVA 2BHLA 4FIZA 5AQ1A 4MKRA 4R1UA 3OP4A 3KYCA 4WK6A 1MXHA 1O9BA 4IGEA 3WGYA 1UP4A 3Q1LA 2YDYA 2QQ5A 4WNIA 1JW9B 3GR6A 1R0KA 1H9AA 4BNZA 5AXAA 5LDGA 1U28A 2ZCVA 4AG3A 3RBXA 4BNUA 1UDCA 4R9SA 2EHDA 5C7OO 8ADHA 5KJCA 5JCJA 2C29D 3V1TC 3I1JA 2EJVA 1N92A 1XKQA 2ZB8A 4MVJM 2WD7A 1ENZA 1P44A 1NBOA 1U3TA 5KJFA 4MKZA 2NACA 3IUSA 2AQ8A 5L40A 1EFKA 4DLLA 5CG1A 1R12A 4HP8A 4NH4A 3WBFA 4DBZA 1NYTA 1EBUA 2B35A 4JJFA 9LDTA 1TB4A 3JQAA 2C2YA 1MFZA 5TJ9A 1YRLA 4DC1A 2X0IA 1GR0A 3PHGA 4M86A 4AL4A 2VTEA 4LW8A 1V8BA 3TOXA 3WFJA 2A94A 3WXBA 5CDYA 2OORA 1KS9A 3IJRA 5H82A 4CLRA 4PG8A 1WPQA 1YKFA 2O3TA 4DLAA 2YZ7A 1FXSA 3X2EA 5TT1A 1VC2A 2Q46A 3ADPA 4K6CA 2AG8A 4ALIA 5TJHA 2Y1EA 2JD2A 2WYVA 2J3JA 3NX4A 5FEUA 2DBRA 3UXYA 4KZPA 1DJNA 1QMGA 3FNFA 3NJ8A 3RQSA 1DFIA 2W2LD 4J9VA 4TZKA 3HDHA 4WLOA 1WDLA 4YTEA 5A02A 1O89A 2VZ8A 4AJIA 1N1EA 1Z73A 4TVOA 3VPHA 3JCZA 3BMOA 3DBLB 1MB4A 3VH4A 1H6CA 5KVSA 4NPCA 1D7OA 2H5LA 1KVQA 2AW5A 2JL1A 3D0OA 4M55A 4WNCA 4I5EA 4YYZA 4RF2A 3LC1O 4OH1A 4ZU3A 3S8MA 4XQGA 1W8DA 4RV9A 2VN8A 4E2YA 3ENNA 4BNVA 3Q11A 4PLGA 2E37A 2RHCA 5IXYA 4P4GA 3F1KA 1FK8A 3R3JA 5L3ZA 3PJDA 3I23A 3HE3A 4H3VA 1G0NA 3DAFA 4NK4A 1MV8A 1BXGB 3DHNA 4KMSA 1DO8A 4ROSA 1NQTA 1WW8A 1BDMA 1U3WA 2NV6A 4B7UA 1GU7A 2YJZA 5U4QA 3GEMA 3KHUA 1K6IA 2WYWA 4CQMD 1ZH8A 2PKQO 3I9LA 4K9DA 1U5AA 4RF5A 1ZVMA 3VHRA 1ONPA 3GQVA
chains in the Genus database with same CATH superfamily
1MGOA 3Q2KA 2VDUE 5P8WA 3HEAA 2H1SA 2BMFA 3NBUA 4EMSA 1IWPB 5JBQA 5I7VA 3HXMA 2NP6A 4UREA 2Q8QA 3TI9A 4F4IA 3U4AA 2AKEA 1UC5B 1NQAO 3U26A 4TTIA 4CFSA 1X2BA 1EK2A 1RW4A 2B5WA 2J41A 1D2NA 2VEOA 3GUYA 1TLLA 3CLUD 4QGGA 3TO5A 3U48A 1VCOA 3LBAA 5JQWA 2QTZA 2XZPA 4GEGA 4WCFC 2PUFA 3AM3A 3TTYA 2IS2A 1H1LB 4F11A 3TVDA 2G28A 1SQ5A 1GA4A 1B6RA 1PVVA 3EBLA 1ESNA 3A27A 4A1FA 1FUUA 3RYHA 2A1IA 4C6SA 1DRKA 5CJ2A 3RLIA 3DB2A 3OTHA 1RWPA 2BFOA 3VOBA 1XOIA 2WKSA 3EQ7A 2G72A 1TKRA 2Y76A 4RPGA 3S1SA 1DIRA 4AO6A 1KRXA 1XLUA 1UDXA 1Y4SA 3BRWD 3S2SA 1NDHA 1KJ9A 1KMHA 3UHPA 4AICA 5EUCA 2P2GA 3MCVA 4RVNA 3MERA 3GN2A 1JA9A 4QUGA 1GNLA 1KWKA 2HIGA 4Q6BA 3UAVA 2VA9A 5K0LA 2HMVA 4IIVA 3SKXA 4CUKA 3SHVA 5HJEA 3BKXA 2BFEB 4MV8A 2BISA 3H19A 2AWOA 4X90A 2B1QA 3DCYA 4OBEA 5K8VA 4K1XA 4QDOA 4GI5A 2HA4A 8OHMA 2GN4A 3OJ0A 3WSTA 1QGYA 4WLUA 3FUCA 4HMOA 1F2TB 4MLZA 1BOFA 1ZU4A 3KM0A 3RYHB 4M3NA 4LXTA 1IHDA 4P7BA 5AM2A 1RAIA 2GOYA 4Z8XA 3VHLB 1ADYA 3EIFA 3GFBA 2C5FA 5LB4A 3O91A 1NJFA 1Y9JA 5CPBA 3RUCA 3OUZA 2J1LA 3WB0A 1ACLA 4ZDJA 4ZVQA 4JBLA 1S2MA 4IDDA 4X8HA 4PR3A 2AWNA 2AR0A 4O4JF 4LZZA 5EPEA 3PQ7A 2ZUWA 3N8HA 4P3PA 5GJVC 2CMKA 4XVCA 3K3PA 1U1EA 3MS4A 3PC2A 3PXUA 2JVJA 2R2GA 4MICA 2Y1FA 4RH0A 5D5HA 3W8EA 4V38A 1T8YA 3BHMA 1JKJA 2UVDA 4MV4A 2JFOA 3VDXA 3DWEX 2RJNA 2G36A 4BUJA 5KMGB 3HJFA 1SQSA 4PYLA 3VPDA 4G0PA 1PGNA 3LUBA 4KKXB 1Z88A 1C0PA 2QVLA 4G07A 2OKGA 5GP1A 1CEYA 4YBZA 2XGSA 1MJHA 3IRVA 3GA5A 2BLNA 3QQPA 2C03A 1TCAA 1BA3A 3CNLA 4BWGA 1Z0AA 1ENYA 2NPOA 2DTEA 3GVHA 4MS4B 3SKYA 4AMYA 4JGBA 1PJBA 3VPAA 5EIXA 1RQXA 2P9JA 3GLSA 4XSGA 1C50A 4TKVA 4ZCIA 2YOHA 4JBIA 4LOLA 3OT1A 4O0LA 1L4FA 3OZBA 3OTGA 5IDQA 4GQIA 4TN1A 2NN3C 5FOSA 2H9YA 2MYPA 3CBQA 1AKQA 5K2OA 2ZVDA 1DRVA 3C5EA 2WDZA 1GM5A 2H7CA 3BDIA 1OBOA 4R2IA 2XUJA 2ZIFA 3P2EA 1ADGA 4PE5B 3A6FA 4EW6A 5DIZA 2A0XA 3ORQA 4JJ7A 3I53A 1N25A 3OLZA 3VR1A 1Y8QB 4I5IA 4I99A 1MDFA 2IDKA 1Z13A 2Z9CA 1XTKA 1XVAA 2V6BA 2W2XA 4FQ8A 4MQLA 5K5EA 4G4IA 4ZO8A 2NU6A 4XRGA 1MRZA 3NHMA 3X1KA 3EGDB 3ES9A 2IEYA 3IUNA 3MUFA 4FWBA 3UXMA 2CHQA 2PYDA 4RA9B 3GUUA 4MS1A 4OXXA 5JUWA 2PX0A 2W90A 5E9AA 4Z4EA 4MP8A 2X9NA 1ZXXA 2YWDA 4AUKA 4HN2A 2H59A 1AKNA 1QS0B 1A2OA 3C5WP 2PANA 3PL5A 4JP5A 4UQPA 3VOSA 3C7CB 5AIBA 1XYYA 4KLRA 3DVSX 4BVEA 1BXRB 3BIFA 1CHNA 1N0HA 3CJRA 1JEOA 2VK8A 1UWLA 3HWSA 3TAXA 3ZHBA 2ACWA 5IC6A 4BMSA 3Q8XB 4RHCA 3A7EA 3B60A 5HS6A 5EN4A 3E9DA 3SOZA 2VLIA 4TS4A 3NYIA 1D4OA 2VNJA 2XSZA 1L4YA 1T3ZA 2P9GA 4J0CA 4JP2A 1SC9A 3QE2A 4X9XA 4P98A 2PMCA 3FOCA 4X93A 4YROA 4FWTA 1LBQA 4K5QA 3CSSA 3FCXA 1EX9A 5EFZA 3IAAA 4Q39A 4F3TA 3Q6IA 4QFCA 2H4WA 4J3FA 3QTBA 4TSKA 4MEJA 1A5TA 4KSCA 1A8PA 3V6LA 4WOCA 4O2AF 1EVLA 4CJXA 4CF4A 2H65A 3OZUA 4H7JA 3GYBA 4DWVA 3MMNA 1D04A 1N34B 2P91A 1QE5A 3HRHA 1NX6A 1TADA 3KEOA 3G8AA 2C3PA 4BO2A 2I54A 4QVKA 5F2OA 5KOIA 2E82A 1D1PA 1YRWA 4MI9A 1G5PA 2XQGA 3RC1A 4QOEA 1VI2A 2WWVD 3SX4A 3ZLUA 4DRYA 1P2TA 3WQRA 5DGTA 2QTGA 1MOZA 4IUBS 1D0VA 3DTVA 4O4LB 4LJ5A 3RVDA 4ERNA 4Z54A 1PYOA 4B85A 5HXAA 1P80A 1LK7A 4GOJA 4IGKA 4Q9AA 4KN8A 4QTUB 5E4TA 4BBJA 3OFND 3THXA 2IJGX 3CUWA 3GZ4A 3PWSA 3R9KA 1HFEL 2J45A 3Q7IA 2VCHA 5CDTA 5K6TA 4G5OA 3ZV5A 3I5YA 1DXYA 5HA5A 2NAFA 1GZ3A 4YUAA 3AERB 1I4LD 2W5UA 4IJWA 5KDDA 1P31A 4LVCA 1A9TA 4PF1A 2R7LA 2OZPA 4CTNA 4ZQHA 4FD2A 1VZ2A 4YONB 4MGYR 3KELA 4QTTB 4NECA 1U8TA 1UJMA 1TA0A 2H52A 2Z4SA 2ZJ1A 3EGOA 3L6OO 2G9NA 1GDDA 5LQAA 1JFFA 2ZEJA 1L7EA 5AM5A 5IUJC 4GBGA 1E2EA 1A50B 5FOWA 1FMCA 1AK1A 1JPVA 3RI3A 4G67A 4FCCA 5AW8A 3MJFA 4IL5A 4M0MA 3E7FA 4TRJA 2Q7OE 1QYWA 5JHHB 3FB1A 4BNFA 2HGZA 4XIYA 1PLLA 2VXBA 3REFA 1WZNA 1QFXA 4JLUA 1SUWA 5JC1A 4QPJC 2C2KA 1HNXB 2ETVA 4JI0B 3OZTA 5KNDH 3BB1A 5GPBA 1VRCA 2VPPA 3GD7A 1VJCA 4YC7A 1ZD2P 1RXIA 2OESA 1GTL1 5IBQA 2HJRA 1NVEA 1OLSA 1XVUA 1OT3A 2YZGA 3OJFA 4QECA 2R6AA 4B43A 2OCPA 2WHQA 3INRA 3VSBA 1ATZA 4YIHA 4PG6A 1JH8A 4BUZA 5DMHA 3KTOA 4C21A 2JAUA 3K2QA 2I91A 3T3PB 1U02A 5CIWA 1M8KA 4G2TA 3VXKA 4XTCS 1FFWA 2GM9A 2O2GA 4H9GA 1SIBE 3OPYB 4OHWA 3RYCA 1THGA 1WX1A 2ZUTA 2C5GA 1T9CA 4XARA 1JI0A 2O1EA 3WL7A 5J2TB 4QPDA 2BRUA 1G291 2PS0A 4ZTBA 2ZI9A 1R6TA 1JLMA 5KSWB 2R6GA 3AG5A 4PZEA 3SC2A 1NFFA 2H1RA 2I76A 2RH9B 3KOOA 3B3GA 1RVV1 5D3MA 3FWNA 1II9A 1Y1QA 2L82A 2W70A 3TPZA 3W5DA 4FFNA 4L28A 1JKJB 2JASA 1ZGHA 4AJ9A 2QE7D 1F48A 3UFXA 1IYZA 2CLOB 1DC4A 3AFOA 4KLCA 4ZI3A 5BXQC 5IS2A 1SZCA 1D2RA 5DP1A 1NVVR 1QTRA 3ZTYA 2FZCA 4K9SA 4V0RA 3K09A 2NTEA 3FRIA 1L5FA 3R9XA 3RSHA 1GPBA 3INYA 5B3LA 4IEEA 1AKWA 3NKLA 4NJMA 4DNXA 1R5OA 4LJKA 3OWHA 3X1DA 4TKLA 4H7HA 1Z6PA 1ZRMA 3I6ZA 1V1RB 4P93A 1P3DA 3WL4A 4N0DA 4NE2A 5CX1B 3MWEB 3NVMB 1XZIA 2XWSA 5B58T 4R3NA 2WV9A 5EPOA 2HA0A 3W8DA 4BO6A 2GPBA 2JFGA 3D0QA 3TFWA 2QJOA 3HUTA 5AVKA 4RVUA 3Q8MA 1ZVJA 4ZQBA 3VR4A 4XCVA 2B36A 3S99A 1E2JA 3OZEA 1QQ7A 1QKKA 4IJVA 3BIXA 3MLAA 4B40A 2XB4A 3HU5A 1NI4B 2BC9A 2AI3A 4P6VF 3IQDB 2UZ1A 1YJQA 3LLUA 3OCZA 1JKXA 5EJ4A 1SA0A 1FFYA 1IJFA 3EA5A 2IPMA 4ZT7A 3K8ZA 2CC2A 1NVAA 2XGGA 5LLSA 2GF2A 2LD4A 4HNSA 1VRVA 2HHHB 2XCRB 5A5FA 3N2KB 5JYBA 1ZZEA 1Y3AA 2XTJA 3HABA 1ZOIA 4ZEWA 3VMFA 2WHPB 5AI8A 2HW8A 1UBCA 5G41A 3RV3A 4YJHA 1JU3A 1F0NA 3L7JA 1P6XA 2K2WA 3CEHA 3E5MA 3CUKA 3O73A 1CUZA 2O5CA 2JLVA 1JHRA 3QM1A 4RAQA 3PC6A 1KQ3A 2O23A 2HRBA 2ZJ5A 1ZJ4A 1UPXA 4DW8A 4EPWA 1Z38A 1EUCA 3L1HA 4N41A 1U5BA 1YVDA 3A1EA 4D1YA 1XZ8A 1XXHA 2ZE7A 4FFOA 2G9ZA 2RH8A 4YCBA 5A4AA 1JILA 5DLPA 5H8WA 1Y4AE 3G2MA 4NCBA 2XDYA 1UKAA 3F6CA 2VPZA 4PAGA 1IN8A 1AQNA 2I6FA 2YFYA 5JJBA 5EIBD 4FLEA 2O7VA 4JFAA 2PKYX 2QXUA 3N70A 1ZJZA 3DLPX 3PC3A 2Q0SA 3NGMA 3W2TA 3WK8A 5IULC 1WBJB 2CNLA 4Z9AA 1QU2A 1GG8A 2X22A 1Y7LA 3NWPA 4DLZA 1GLGA 4LA4A 5BORA 1KR5A 1PWEA 4D9IA 2GYWA 2DR3A 1K92A 3S2EA 5SY4A 4A82A 1HDGO 1NXOA 3T1VA 1QWSA 3P9NA 5DYTA 2XTAA 4DZTA 4IKOA 4X6UA 5KQGA 5FIUA 2P77A 1RJEA 3F2IA 2GPJA 4M1QA 1YBHA 4NMWA 5G1PA 3OX4A 4AZ0B 1EM8B 1X15A 4PRKA 3FYUA 3GLHE 4IDNA 4EBFA 2WMDA 3HHPA 1MA0A 4ETWA 1WA5A 3H75A 1BZYA 1IM8A 5I7RA 2QB5A 1ZAKA 3LLSA 5AP9A 1ZFNA 3GAAA 5CVJA 3IUQA 1YD7A 1PQUA 4MRVA 1VG8A 2IUFA 5IDVA 1Y4UA 5K0GA 3KTAA 5LKAA 1NHWA 2XKKA 1NBWB 1RYDA 3CGWA 4PYNA 5EA2A 3TKLA 1ZGCA 3HN7A 3NIBA 3OICA 4Q4JB 4CODB 2FNAA 3HFJA 1HOXA 3K5PA 1YOBA 3TZLA 1ODLA 2Q1WA 3NR2A 2JCSA 3TLJA 5IZCA 1Y34E 5LXTA 2DKNA 2TECE 1QAQA 4ESHA 2QDKA 5AKJA 3S4YA 1E8MA 3L7DA 1CD5A 521PA 4YRNA 1WZCA 3IE0A 3IS3A 1SBQA 1R4NA 4LVOA 2IH2A 4NQZA 1KH1A 4LYJA 2FEKA 4LHSA 3BMQB 1CJKC 3MJ4A 4RBNA 3IIJA 4IXDA 3PQ2A 1HE1C 1NVTA 1Y8AA 3SIWA 3U09A 4COOA 1UMDA 4IEFB 1TX4B 4DA4A 3NOVA 2GAIA 4K9RA 3OLWA 5AVJA 3F98A 4IUYA 4EGFA 4CMIA 3AILA 3QW4B 3IAM6 1L5OA 3IQHX 4ZRMA 3U7JA 3EVAA 5HM6A 4INAA 3QU5A 4BO4A 1DSSG 2WIJA 5A9SA 4G0MA 3P26A 3SC3A 3NT5A 3W9SA 5IFKA 2ZK7A 2W0MA 3NGLA 1DOHA 4GLFA 4ZXFA 3TLCA 1P4RA 1JDUA 1UK7A 3GZJA 3AY0A 4EG8A 3JAMA 5JAHA 3COYA 4Y7DA 4GPD1 2Y2VA 2EGUA 3ZIUA 4HY3A 1WDKA 3GJ8A 3K9QO 2FJUA 2H4JA 3DQZA 5FOXA 5BN5B 3KDPA 2CD7A 1O5IA 3FSGA 3R5XA 2J6BA 4O63O 3ZXXA 2ZGVA 3CURA 2VAXA 1FP4A 3KQWA 1X0XA 5G40A 4R0NA 4FFVA 3AL0C 1ACMA 3O4JA 3E4CA 1OWOA 2AOTA 4L5AA 2X0NA 1JV2B 3OU7A 4I5GA 1M34A 4JT4A 3GLFE 1YDFA 4X6LA 1BVHA 4B3IA 1KJZA 3N75A 4DQVA 2JEZA 1GDHA 1AK2A 3RFUA 1KO1A 3JTMA 3KT6A 3SJUA 4HGPA 3GFFA 4OHRA 5LWHA 1MJNA 4CEHA 1OXSC 1U7HA 5GM1A 4UEKA 1NVGA 2Q5QA 1QBKC 1Y8QA 4JOSA 4E3ZA 3G8YA 3HACA 4O4IB 3UCEA 4QARA 3DCIA 3AEXA 3MD9A 4RHYA 1XAIA 3T9DA 1T1RA 5BR7A 4MUXA 4RUKA 2GXAA 3WK4A 4MYSA 6PFKA 1W49A 4HNTA 4ZKEA 1T1EA 1GLNA 2QK4A 5E1OA 2GKSA 3AXTA 4FFDA 5IF3A 3K6KA 4D5GA 3F6PA 1PNRA 2VQSA 3QXGA 2ZBDA 3GZNA 4REQA 5BYJA 5E9JA 3QPAA 4CCYA 1XZMA 3ZBQA 4KQIA 1ZD3A 3WLMA 2QSZA 1PR6A 1N7IA 4LYFA 5EHIA 1GFWA 1SIOA 3CZCA 2A30A 4NV1A 4QPZA 3ADCA 1Y33E 2OHOA 3COWA 1MC4A 1THZA 2F9FA 3FKJA 3NLLA 1HDCA 1U04A 4NOMA 3GJTA 3VNBA 4YAJA 3WRYA 1MZVA 1YQTA 2ZU6A 3EEQA 2O05A 3DWGA 1P91A 3UJ9A 3H5TA 5HSGA 1DC6A 2GH1A 3IMGA 4O4IA 5C8YF 1PIWA 1PWXA 4TSFD 1ADCA 5K0BA 3IJPA 2P68A 3SM9A 3JASB 3URKA 4PLYA 3IMKA 1BGXT 1I4EB 1ZIPA 3BJEA 3M83A 4N5MA 1V95A 3F6BX 2FJ0A 4EJMA 4DKXA 4D8TA 2GDJA 1DUIA 3THSA 4CG0A 5FAXA 3FMFA 4IHJA 5HCNA 3M5DA 3SJAA 1NNEA 1QH8B 2HV9A 4AUEA 4FMBB 5JAPA 3ZDBA 1N2BA 4C88A 3U0VA 5BUSA 2XMQA 1E89A 4KBYA 3U4HA 1ZX1A 1H2RS 2AB0A 4BWFB 2CLMB 5DYWA 4CKWA 1OX4B 2GZMA 3NTQA 4KWHA 3E8XA 1HRDA 2GAOA 4XM2A 2GN1A 4EGCB 3ADOA 3KBOA 3VYWA 2QMQA 3N9IA 3L7YA 4RSRA 1Z33A 3SNKA 4JB2A 1G20A 5C31A 4DYHA 3S27A 4FB5A 4PONA 1XCLA 1ZJ6A 4RWZA 3FCEA 3LF2A 2D7CA 4UUOA 2PA3A 3VQTA 2ILTA 2PO5A 5AW3A 3FBTA 3VVCA 4V02A 3ZU4A 4B3DA 1ZQ9A 1E77A 1P29A 4IFEA 4ZI7A 4XVUA 4CVNA 1X7ZA 1K8QA 4MCIA 4RW0A 4HO1X 3ND6A 2W4IA 1XZNA 3VO2A 2VJNA 1GPAA 4JHXA 1RKVA 5F1OA 2A3RA 4RL6A 1KA9H 1MP0A 4HLNA 5KNLA 3MJDA 2W8ZA 1Q57A 3N87A 1ODFA 2BMDA 1BDBA 1DKRA 2JDIA 2Y1GA 1A69A 2BGJA 1W88A 3IV9A 1AA9A 3IBCA 4QG7A 1Z3CA 3UB3A 3GUCA 2CMDA 4J2HA 4YA6A 1LBSA 2XMGA 3BCHA 6REQA 1P73A 2GEFA 3AI3A 4PLFA 2VPTA 1DQSA 2Y4NA 2YS6A 3JWGA 2WWFA 5HTKA 2VK2A 4CW7A 4OVKA 4ETMA 1MX1A 4NBLA 4CUZA 1GLVA 1P2BA 3GCGA 3R6DA 4F0JA 1H8HD 4EMTA 2GJ4A 2QVYX 5T41A 1WY7A 3JYPA 4MPTA 3I45A 4EY3A 3NC1C 2BUBA 1XDUA 1AKEA 1YS7A 3I1FA 3LX8A 3PA6A 3OG9A 3GEDA 1NQ5A 3K9NA 2DUJA 3TLEA 4HFMA 5HWSA 3VVBA 5JH7A 4L2IA 4EMBA 2ODBA 2JFZA 5FBRB 4GYWA 1Z83A 4YQEA 3ST7A 4AM8A 4ZN6A 2DM6A 3O95A 4Z4QA 1PQ4A 3O4IA 4X7PA 1EP9A 1QM5A 2ZT6A 2TRSB 2RD2A 2AK2A 2DKFA 2QL6A 3ASVA 4HGNA 1FNSA 2EWMA 2ZSDA 4KE8A 4DMKA 5JCJD 2V58A 4P5PA 4KIWA 1IMOA 3B1VA 5DASA 4KZKA 4Y30A 3RRJA 2R11A 4LJ7A 4PZCA 4Y9DA 2XXAA 4LRUA 4XB6B 5AKZA 2D00A 3P4UA 2ZXEA 2G71A 3UG6A 3BILA 4M0DA 5FBZA 1MJFA 2NUBA 2V7XA 3AVPA 1S2NA 3OQHA 1U8YA 2ZE8A 1KXZA 4ER0A 5A4JA 4J4BA 4PAQA 1YULA 3H5RA 3DUFB 1EP3B 1X77A 3X1JA 5SZHB 3S29A 3UY4A 2C2OA 1CK4A 1HDIA 3CT4A 1OGJA 4HDSB 3VX4A 2BH2A 4H18A 1EQ2A 4UXJA 3I01M 1UFQA 1WNTA 3KSUA 1Q19A 3NTXA 1XP8A 1NP6A 4HN9A 4QNRA 4DA8A 2NU9B 3OM0A 4NYMQ 1NVXQ 4G0UA 1XNHA 3QBTA 3VU9A 5EIOA 1WR8A 3RG8A 4Z53A 2FQXA 2G04A 1M5UA 4QA9A 1FVOA 3NG1A 3DZIA 2CMHA 3SJCA 3SU8A 3MBIA 2YUTA 3QF7A 1CDOA 2Z56A 3CEPB 3PHLA 3N07A 3FYCA 1GL7A 1VP9A 5CCEA 4HGRA 3M81A 2V6IA 4UVHA 1YUBA 5DM70 1MOPA 4RE6A 4XD7D 3QQ5A 3BG5A 2ZYVX 4G86A 5CBPA 4NAHA 5DCYA 3H4IA 2XCIA 4ER7A 1SKBA 4DQDA 2JJ1D 2Q0QA 3MRVA 3I32A 3P2JA 3P94A 4EPRA 1DKLA 1F4LA 3D1JA 5FJJA 4UUMA 3J81k 1UP6A 1F1BA 1T9ZA 1YU9A 3ADDA 4E4TA 4HQRA 1Q12A 2DCMA 2JAOA 1DP4A 1U4NA 2FFRA 3AJ9A 3TUIC 3GFOA 3GUZA 4YR9A 5DM0A 2JHGA 1GUBA 2W48A 3KJQA 3H11B 3ZWMA 2FSHA 4EUEA 3K9HA 2VTBA 1XU4A 3BHJA 3BS4A 3FFXA 1DAKA 4FE3A 5ECDA 1O95D 2PRSA 3AYXB 2P2LA 4GECA 1CUCA 1XJCA 4HDKA 4CM1A 4PZUA 1I1QB 3UJPA 3ROGA 1V1MB 3IXLA 1A8SA 1A0OA 1NKSA 5I5EA 5EQFA 2BHNA 4C76A 3CMMA 1OB2A 4MHTA 1CRZA 3N2LA 2YQZA 1OJLA 1GPLA 2AD5A 3QHQA 1QOQB 4GKBA 3B1FA 1O94A 2GM5A 3H4TA 3OC6A 4LVNA 4NARA 4P54A 5EHGA 3KPUA 5EXXA 3CXRA 2OZLB 5NLLA 3BXPA 1PS8A 2QG9A 4DRXB 2D5LA 3JQPA 4JBHA 1WUHS 4B2LA 3FTCA 4KPUA 1FFAA 3MA0A 2YS7A 4AQ7A 4L1KA 2IYPA 2X0FA 1YRAA 1BTOA 1GTZA 4D4JA 2G25A 3QYPA 4LQLA 3A3NA 3B53X 4KRYA 1YMUA 4B33A 5K99A 3BPSA 4UBMA 2OCGA 4BYMA 2XB2A 1HSOA 1KJWA 4S1OA 4JYPA 2IV7A 4QATA 3SDBA 5IEJA 1B26A 2B0JA 1KP3A 1SCQA 2G4LA 1CDEA 3AVQA 3KUUA 4CKYA 2P11A 1HZZC 2A57A 4D43A 4ZVOA 3X3HA 1TVEA 3HO8A 1KZ1A 4MKXA 3BVPA 1U6JA 2P79A 1GPKA 2X9VA 1QV7A 1HETA 4MH0R 4RORA 4F85A 1C1DB 4F9TA 4GX2A 3QE9Y 4ZAGA 3N0TA 3U7RA 4FK8A 1J39A 3RVJA 1DLJA 1A8UA 2FUEA 3R5JA 3I1YA 4ENRA 1C7ZA 2F43B 5AK3A 2JFNA 1JVSA 4TT3D 2PZJA 2QLMA 3Q2OA 3L1KA 4KGVA 3T0FA 1QANA 3CSUA 4JKOA 1R6UA 3K5WA 1USUA 2JIPA 4HGQA 5JMOA 5J23A 4Y2SA 3ITNA 2FDXA 2Y71A 3FKSD 1NNSA 2FFBA 4KXWA 5C32A 2BKUA 4M1YA 4IMRA 7MDHA 5LNK1 1ZN7A 5TIIA 2PT6A 3RVSA 2Q6OA 1TD9A 3A06A 4PRLA 1QYVA 2WJAA 2XPCA 3HKCA 5EHNA 3ZHSA 2QUAA 3ZQKA 2O7QA 2BCJQ 2C2HA 2EFYA 1DWQA 2A5LA 2R6JA 4RLHA 4G8BA 4J75A 4KGZA 1AS0A 2RAVA 1B6TA 2HLPA 5EAIA 1RHMA 4G5XA 1Y3BE 4TMTA 5HUHA 3OX3A 2AKAB 4IS2A 4K9LA 3FTPA 4L5CA 1MQSA 1EHCA 1AC5A 1I1NA 3ZCQA 2C7RA 3GLVA 2Y0BA 4GPIB 3TUJC 1Z28A 2JLRA 3UQYS 5EG5A 4YAOA 4Q34A 1MO4A 1VPTA 5JYDA 3QX9A 1YL6A 4JH0A 4HLUA 4ODIA 2HMSA 3NRJA 2PR2A 2X86A 2ZUBA 3KJXA 4RDCA 3TL3A 2I34A 4E0BA 4M0UA 3JQ9A 4ZYUA 3ZWDA 2E9SA 3HDVA 3GCXA 4MZDA 4FHEA 4TT3A 3IKTA 3ZGZA 4HLCA 1YE3A 1D09A 5C8YB 2VUUA 4NMLA 4EHFA 2WZCA 3HM2A 2XF8A 2LE0A 1S3GA 3OURA 3S2ZA 5KKCA 4R2JA 4PPNA 3DNMA 4XUGB 2OSBA 4H1WA 4PIMA 3ZDYB 4UOZA 5KTMA 2OBBA 2B1IA 5TQ2A 2WFLA 4ESEA 5I48A 3KYBA 3LXMA 3FLEA 4DLUA 4RFSB 4B6JA 3H9BA 4BWYA 4XCQA 1L9XA 4A6PA 4UHFA 1L6IA 1E3WA 1NN3A 3Q6MA 5BO5A 1C7EA 2E21A 3KOWA 2R8EA 3H83A 1OGIA 4ZCSA 3I30X 1ZU5A 1TJYA 3N5CA 3TQCA 3RRYA 1OMOA 1T13A 1P7VA 1U7TA 2R751 5DYYA 4A4DA 4C6HA 2VAVA 2HTEA 5JR3A 1Z62A 8LDHA 4WX2B 2I99A 3HB9A 4NABA 2VR1A 5DGHA 3WNVA 1G60A 1A1SA 1W76A 2P2CA 3AOGA 4OF4A 2WMYA 1JR3E 2HLNA 4OMFG 3V4VB 5F2NA 5FUXA 4NU0A 1DJQA 5DM4A 1ZGAA 3B6ZA 1HDXA 1E9SA 1IC6A 2FG5A 2QR5A 3DWIA 3EG9B 3AEQA 4FZ5A 4W1SA 1RE0A 2W6CX 2O4UX 1M2OA 5EUQB 3AL3A 4ND5A 1Q1ZA 1ZH6A 3LW8A 3SY8A 1WY5A 4BX8A 1EUDB 1BMQA 4LZAA 2RC6A 2Q3BA 3GGPA 4FZ3A 3R7BA 4CEJB 5L7YA 2ODAA 2Q9CA 4DUGD 3MK31 1L4BA 3EJ6A 1XCJA 4OSEA 2B2CA 3VR0A 1YS1X 1X7HA 4J16C 3UHFA 2DULA 5KVQA 2OYCA 3D8NA 3RR2A 3X1MA 3VYRB 3UGTA 2XQFA 4PC7A 1RHKA 5EWJB 2VJAA 3EDYA 3M4JA 5CHEA 4OFBA 4IH4A 1J25A 3ZWKA 2EFDB 1RWQA 1AQ6A 2QRVA 4U2CA 3MS2A 4L3WA 2NNLD 1UJBA 2CV1A 3ZU3A 1BHJA 3K96A 4MDEA 2F1IA 3RE1A 3B1XA 2QR3A 4HH3C 5KWSA 2UVPA 3ZBUA 1U9IC 4G25A 1T4BA 4IS3A 3M6UA 5IWCA 1W1WA 2G9VA 3G5TA 2WJYA 3VTAA 4FGSA 3I9FA 4DDWA 1UL1X 1ZMTA 3ETJA 3D6UA 5DNWA 3T35A 3PFBA 1GQSA 1ISGA 3BM5A 5FBVB 1J1ZA 1HTTA 4NOLA 1ONSA 4ZJYA 3EVEA 4RQBA 2JGRA 1GRCA 1EYZA 3A8TA 3CRZA 1NC1A 2EFCB 3C8UA 5IBRA 5GGYA 1XKTA 2ILVA 3LQ4A 4V0KA 4CLXA 3TAUA 1CT9A 1G42A 4EFKA 4U2KA 4EHBA 1U9CA 2V54A 2EVWX 1OIXA 1L7AA 2PLWA 1CX9B 2PZMA 1INLA 4RJTA 5EP3A 2RGGA 1J2UA 4KQCA 3TQTA 4HK4A 1GGJA 1NE2A 5JLAA 1RXEA 3I9NA 1T2EA 2P2ZA 4KDEA 2JJ2D 3QWHA 2AMYA 3WGGA 4JLBA 4IWXA 3EGWA 4AKTA 3IP5A 4RJLA 3HYNA 2ES4A 3QFFA 3W4KA 3F5DA 2CXRA 5K8LA 2HOQA 4BFVA 5HJ5A 2ZZNA 1YR6A 4EFLA 2FFHA 1A9XA 1ULTA 2HXYA 2VJYA 2DBYA 2YWCA 3PRJA 4US1R 1YQ9A 3OMWA 5M04A 2IEDA 1BFDA 3HY3A 5BNIA 4XLTA 4FMCF 3IEXA 1NR1A 3PJFA 3QLTA 4NU5A 1Y1LA 2DHRA 1M73E 1NLZA 2XT6A 4MVJI 3FZQA 3OPMA 1I6MA 2GRJA 3NUZA 4M9QA 2GJ9A 5AI6A 1R50A 1YK1A 1JIXA 4RU1A 5BSRA 1QTIA 4Q9JA 1ZIXA 1SUPA 3I01A 2UXDB 3L79A 3GRYA 4PLHA 5K6RA 4OLBA 4A03A 1KTVA 3G9XA 1SEPA 4DCMA 4BGEA 4FHGA 4RXTA 4CU2A 4BMZA 5EESA 5DN6D 4IM7A 3LPMA 4XGQA 2C78A 4QYSA 5BWOA 2ZYAA 3WQHA 3AVOA 1DG9A 1J99A 1G63A 4PX5A 5DGXA 3W1EA 4L0MA 4WLNA 5C35A 1KDYA 5D86A 3NW9A 3IO5A 5ALLA 1SY7A 2A9KA 1Z75A 5IJWA 4K9KA 1W5SA 2I6GA 1QG4A 2QROA 4C3OB 1O96B 3U80A 4YQFA 3C87A 4OTZA 2FY8A 1T4DA 3VI4B 4Z2AA 2BM1A 4JCOA 4W1QA 4DPKA 3CKMA 3KZMA 5B6PA 4W82A 4TYNA 2CJFA 3NYWA 5BWBA 5I8WA 1C81A 1QCZA 3BMCA 3IFSA 3QVJA 2KJQA 1G66A 2AEFA 2FZEA 3CUTA 4U4AA 4D7AA 4EHJA 3IAM1 5A7GA 4WXPA 3OIGA 1E99A 4KFUA 5JI2E 4L8VA 2EYUA 1YH3A 5KS2A 1HLFA 4ZT6A 5LQSA 3TN7A 1HKUA 1Y7HA 4M9RA 3VUFA 2PFSA 3EAQA 3K2BA 1OC4A 3L7KA 2PXCA 3QXCA 4RMNA 4BEWA 4BDSA 4HFRA 5EHQA 5CFPA 4RTSA 4IRUB 2V6MA 3GAZA 3P0FA 1J9ZA 4JLOA 3RAFC 3OIDA 1DDOA 4BNWA 1FU8A 4Z2YA 4LTMA 4EB6B 2VF7A 3SLRA 3ZKWB 3RH0A 3ZCSA 4RACA 1W4RA 2CLFB 3OOHA 4OQFA 3PICA 3PL1A 1MKYA 3QBJA 2WOOA 3GOQA 2GJ8A 5JVDB 1XEWY 2JG3A 4DPMA 4E3WA 1N36B 3B7GA 2J5XA 2D3WA 4AF6A 4JEMA 5CA1B 4F4FA 1P2SA 5D85A 1M5TA 1NXTA 2VDLB 3CC8A 3BZUA 3LBYA 3RVRA 2ZLBA 1PEKE 3VYSB 2J3IA 4K46A 4M21A 2NU7A 1J0CA 3A3OA 3LPCA 2H6EA 3I62A 2HUPA 3OIFA 3RK1A 1EMDA 4PCLA 2ZBUA 2UZ1B 3C7KA 3CVJA 4BP8A 3PHIA 1Y6RA 1E0AA 2B5VA 2I6UA 2P1ZA 3R8XA 1NBHA 4IIEA 5ALSA 3FDZB 3ZI0A 1WSBA 2WFZA 1GCAA 1OYOA 5JZBA 4KHZA 2WRZA 1DBSA 3FLBA 3ZGYA 3KEFA 5KO2A 2JI9A 1WOYA 4LI3X 1DS6A 1UUFA 1YE5A 5FI3A 5JZSA 2XYHA 3FHCB 3M49A 4XX0B 1B8VA 3F6SA 1DADA 1DAPA 3E7WA 2AKYA 3K0CA 3OE5A 4LE1A 3DVAA 5E6SB 4UTVA 5JAMA 3FTFA 3L77A 4JI2B 3UMCA 4B4OA 5DZSA 1W47A 4GAEA 4BQNA 2PYZA 1HKHA 5TPZA 3BF7A 4CEJA 3OQOA 1OT5A 4IXWA 4EL5A 2R97A 3BMCB 3EY9A 4D99A 1P7WA 1QMPA 4MYRA 3UOAB 1B42A 1ZP6A 3GJQA 3IX7A 3K20A 4M8KA 3EOBI 4QNNA 3UWMA 5FHQA 3KYDB 5F52A 1TM1E 1R88A 2F1OA 3C3EA 3FJ1A 3IBYA 2QORA 4TUYB 5C1IA 2OXTA 3SVZA 3TW0A 2C82A 1NUPA 4ZVMA 4AU1A 5IM4A 1N8TA 4HVTA 1RXWA 2NMVA 2JAHA 2FE1A 4IGFA 4AUMA 3C2QA 3WP0A 3ERCA 5K2MA 5FA8A 5FD8A 1UDAA 2FF5A 5F2EA 3EDCA 3BXEA 1K6MA 3HKBB 3STWA 3NFYA 3QUTA 3G82C 4INOA 4D97A 1EWRA 2LVBA 2PG3A 1QLHA 3G7UA 3U1TA 1T0UA 3WLPA 4BB5A 3IKLA 5EQJB 3SE7A 2H5IA 4A92A 2NWQA 4KJZA 1P9RA 1Q7TA 2NGRA 2P0YA 1ZXLA 3OCXA 4O4HB 2EJWA 1IZ9A 3ESRA 4IZOA 3CUUA 1H1LA 1UDBA 4IG4A 3SBEA 4O3FA 1NY5A 3BWBA 3CUVA 3WV4A 3L7MA 4N6OA 5J5AA 1WZEA 3K71B 3N86A 4V24A 2OZEA 3HCNA 4II3A 4E1VA 3KWLA 2FCRA 4PZPA 3GDFA 1HE4A 3CF4G 3FB4A 4AZTA 4EATA 1LBTA 1G3IA 1WS6A 1UBGA 1JAHA 1HEIA 1R9JA 1FMLA 1EUQA 4BFTA 2QKYA 3ABQB 1N8KA 4NAUA 5T4BA 5C1BA 1TEHA 3B36A 3LLMA 4MRNA 2BFBB 2HNBA 4G5GA 2JGEA 1PGOA 1RHRA 3PUKA 2HXGA 3LRXA 5E4YA 2H3HA 5EKSA 3ESCA 4PX3A 4H7KA 4U7DA 1H93A 1ENOA 2FZKA 3L8DA 3NYQA 3WYDA 3UAYA 4NFYA 1GG2A 4P5EA 2FPLA 2FETA 1LV7A 3LX5A 3WSVA 1KPIA 2QSYA 4PR0A 3C7TA 4PO9A 2OVBA 2JLSA 4LSWA 1JALA 4WBNB 4KQ2A 1QVWA 2JDID 3A1DA 3AWIA 3H9GA 5KCZA 4D4GA 1F6WA 1FZTA 9LDBA 3LC2O 1K4KA 3ZY3A 3AHFA 4D9FA 3GL9A 4R1SA 3KUXA 4B3JA 1NONA 1II0A 3NB0A 1IN5A 3IDQA 1ZOOA 4B44A 4ZIRB 2O2ZA 5GAJA 5BYBA 4BRZA 1JRLA 4CMKA 4BVHA 3NORA 2O8EA 4R16A 1XTTA 3KKPA 3USZA 1QIGA 2V59A 1TUIA 1I0ZA 4UAUA 4CIAA 4J76A 1EJBA 2IYZA 4PFQA 1UFOA 5LM3A 4MUFA 3L49A 2EQAA 2XITA 3OZRA 2IX3A 2NP7A 1HURA 1ZNXA 1YC5A 2Z95A 1ZDMA 2IIBA 5IC4A 1GR1A 2F90A 1I7NA 2Q99A 3PNSA 2QRVB 1UZLA 1I5OA 3PZBA 5DN6A 4PHTA 7ABPA 4O3MA 1KY3A 1ZCBA 2OBFA 3VH2A 3I5UA 2X8WA 1BKYA 4YJ3F 4HZUB 3IVXA 1L5ZA 2M6LA 1PR2A 5CLQA 1ZJJA 4KPFC 2PGOA 4AECA 2X9GA 1U2GA 3E1SA 1OXKB 3Q9LA 2ATVA 3V1MA 2OOKA 2HDHA 1C8LA 3PD1A 4JDUA 4JYBA 1SG6A 2QMEA 3OX1A 3OZCA 2HCBA 2Z3VA 5T4EA 3WL3A 4A1OA 3EMKA 4L15A 3VR2D 4GVXA 3N8DA 4R83A 1WZIA 4IJQA 1DZIA 1HNNA 2DQ4A 3VNUA 3HL0A 5D5QA 5FTMA 4ETNA 4J90A 4QOHA 5FH9A 2A0KA 2VBFA 4W1PA 1DGQA 2B7CA 3CO5A 3W6ZA 3L8MA 1PT7A 2BEVB 3F5SA 3LHKA 4JL6A 1CETA 2W6IA 3EZYA 2CCJA 4JA0A 4XCXA 5KWEA 1L1RA 1ND5A 2KLHA 1JIIA 1D07A 3D3NA 3JXEA 1TT5A 4R71A 1SMKA 5BSFA 1O0SA 4LX0A 3V8QA 2HEGA 2LRHA 2HBZA 4IIUA 4YP1A 3GVPA 5F7OA 1PK9A 5EWMB 4YPVA 2IYEA 2Y68A 3IUMA 4RA9A 4RZQA 1YQXA 4NZOA 4R8RA 1PW5A 4YPFA 2GFIA 2BVNA 4WXRA 1M1UA 5K3FB 4D3SA 1C30A 4IHKA 4LYEA 5E6SA 5ALVA 1E7QA 1H65A 3WB2A 3BBLA 4HXGA 4UVEA 4A8TA 2VNHA 2JBHA 5LL6P 2QR2A 1I2AA 1TNDA 1RLUA 3AHJA 4WRRA 3HB0A 2WD9A 4KNVA 4MWZA 4V2UA 1KK2A 3PLRA 1F1JA 3AM4A 2XCQA 2Y1OA 2HNKA 2ZYWX 1I4DD 2CE2X 1U2DC 4F7WA 2WE7A 2G1AA 4PGHA 5HPYB 2DY1A 1IJEA 4MNTA 1YDHA 1N2CB 2O7NA 4TXMA 5ENZA 3BICA 5BSWA 1LFDB 2C9ZA 4DDKA 1YNSA 3S5UA 1NDUA 3EUEA 4BWVA 3T1QA 2QTWB 3RJMA 1NBMD 4EHDA 4FYMA 3CLTC 2Z2KA 3DNFA 5IJ9A 2ZAGA 3BZWA 1Z0SA 2XZLA 2ZITA 1LX7A 1MO2A 1XJ0A 2GAFA 3B82A 2BCEA 1D2EA 3Q3CA 2C0CA 4HBZA 4LMAA 3QMWA 1JDNA 1GZUA 3JW8A 1C1XB 1V2GA 3ICOA 4ZVVA 1ZJ5A 1ZKDA 2AG0A 5DIFA 5ILQA 4JP3A 1CUGA 1Z0UA 2B82A 5CFQA 5C8VA 2UYYA 1NPDA 1JQDA 1E3DA 1TUGA 2GBLA 1Z2DA 2JGAA 3K4HA 2DOKA 2QM7A 2VHQA 1KJJA 3JQ7A 3N2ZB 1AKVA 3QBVA 1DI0A 4Y6RA 4C4RA 2C2WA 4F6LA 2BGTA 1E9FA 2JI7A 4I2VA 4HNHA 2FPGB 3SX2A 1Z63A 3LSYA 2OEPA 1UDRA 4HI0E 1L5HB 4RIHA 2I71A 1WL8A 3O2JA 1QVVA 2O8DB 3KQVA 2NSHA 2YFKA 4C0KA