4BGUA

1.50 a resolution structure of the malate dehydrogenase from haloferax volcanii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
303
structure length
303
Chain Sequence
TKVSVIGAAGTVGAAAGYNLALRDVCDELVFVDIPKMEDKTVGQAADTNHGIAYDSNTVVTQGGYEDTAGSDVVVITAGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEYNDDFVSITTSNPVDLLNRHLYETGDRDRHKVIGFGGRLDSARFRYVLSQRFDVPVKNVDATILGEHGDAQVPVFSKVRVDGNDPAFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSLVLDGEFGYEDTAFGVPVKLGSNGIEEVVEWDLDDYEADLMDDAAEKLRDQYDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight Into Structural Evolution of Extremophilic Proteins
rcsb
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 111
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bguA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4bguA02
1P1JA 1JW9B 2W2LD 1HDOA 5AOVA 1N5DA 3PTZA 4BO8A 1JVSA 5DULA 3V2HA 5IZCA 2QYTA 4AJLA 3GA0A 3DBRB 2PZKA 3MJVA 3WIDA 2Q50A 3H7AA 1ZZEA 1MFZA 4O5OA 1Z73A 4IZHA 4ZU3A 4I5EA 3EHEA 4IUYA 1L7DA 4CM4A 1QYWA 3ZV4A 1UR5A 2VUUA 3A06A 4XQGA 2FN7A 1R4NB 3NGXA 2VCYA 3SC4A 4YPOA 4M1QA 3HADA 4JROA 5THKA 4CQMA 3H6KA 3V1TC 4ZQEA 4Y8VA 3QWFA 4DIFA 1LDNA 3GMDA 1X14A 3IIEA 5DCUA 2PK3A 3ZWWA 1Y9EA 1UXKA 4M87A 4J1QA 1K2WA 3FN4A 3H5RA 5JMPA 2AXQA 3ICCA 5CDYA 3MJEA 1E6WA 4IY1A 1H5QA 4RF4A 1BVUA 4L4SA 4BO1A 3F4LA 3ZNOA 4JJGA 1A5ZA 3EW7A 3ZWCA 5JO9A 5FEUA 4AJNA 1WXDA 3KLMX 1BDMA 4CMGA 5JY6A 4AJ4A 4BS9A 3ADPA 1HXHA 4W9NC 1R4MA 5I9NA 3GNTA 3ZU3A 1O95A 1DC5A 5BSFA 1GEGA 4RPHA 3RU7A 1BVRA 1NFRA 4EJ6A 3NEPX 4E5NA 4PLHA 3UCXA 4WOKA 4W6ZA 2BI8A 3K96A 4C7KA 4BNXA 5ICSA 3DOJA 1DFHA 4NG5A 5GY7A 4PLGA 3FNEA 1I24A 4URFA 1T2CA 3OJ0A 4BIIA 3DZHA 3OECA 5HRUA 3CMCO 2AEFA 2C5EA 3TL2A 3TWOA 1C0PA 1PGNA 2YHIB 2X8LA 1WVGA 3JQ9A 1R4NA 4OOEA 5G0VA 3IP1A 3RC2A 1LRJA 4H15A 5DP1A 4YJGB 3FPLA 3DTYA 1MG0A 3AUUA 1KETA 4Z0PA 3UKOA 1GAEO 3H9GA 2BFOA 3CINA 3DONA 4BKRA 1V8BA 4ND2A 2W2KB 4DMLA 2PGLA 1HZZA 1RM4A 2Y1FA 1A7KA 2Y67A 5A9SA 1E7QA 1A4UA 3F9IA 3ENKA 4CV1A 4FFNA 4BKOA 3AM3A 4CL3A 1GPDG 3A9WA 2QHXA 2YZ7A 3W8EA 1E5QA 1ADBA 5T67A 3H65A 2P5UA 2H6EA 2B4RO 4S3MA 1I0ZA 3RKRA 3BHIA 3ZWXA 4PN3A 1NR7A 1MLDA 2JCXA 2YV1A 4E30A 3B1JA 1LLQA 3WYBA 3ETEA 4M8SA 3EVTA 3OBBA 3JTMA 3C7CB 3BZUA 4EJ0A 3DFZA 5TSDA 1EBUA 1XGKA 3WNQA 3NTRA 5ADHA 2HSDA 4BNUA 2JCVA 4FBGA 2V6MA 3CZRA 4CMEA 5KVSA 4XQ9A 1EVYA 1DDOA 3HSKA 4IMRA 1YDWA 3MEQA 4YJHA 3V2GA 4XA8A 4I9HA 2P2SA 3PJEA 3H8VA 1PJCA 2CNBA 2Q1TA 3F1KA 3I6IA 3FBTA 3SEFA 3GNSA 3VPHA 2XXJA 3QLJA 1H2BA 4YJGA 2YW9A 1TB4A 5B4TA 1KC1A 5DF1A 1A4IA 1E3JA 2X0NA 1JKJA 2DUUA 3JQDA 4ALIA 4QXMA 2HMSA 3LZ6A 4CM1A 3JD1A 4WLEA 4FFRA 4C4OA 3ZH2A 5DN9A 2WE8A 3S1LA 3F5SA 2VHZA 2P9EA 2WWRA 1U8FO 2PA3A 2EERA 4B7XA 4QT0A 1I36A 1VE9A 2GZ2A 3HZZA 3CKYA 3TRIA 5IAAA 4TZKA 5I8WA 2Y68A 1T1RA 4NPCA 5DNAA 1XLTA 1A7AA 4Z0TA 4LCEA 1ZK2A 2G76A 2GGSA 1FDUA 2AQIA 4MP3A 2Q2QA 3G3EA 4D46A 1K3TA 2UV8A 3JQAB 4FC7A 3IL2A 3DOOA 2IE0A 2DQ4A 1IHYA 5BR7A 3AM5A 1RPNA 5KOIA 3NDJA 4CLOB 4WNCA 1KVQA 2FSSA 1F12A 3QWAA 4AJHA 4DVJA 4MINA 2PD3A 4O1MA 2B5VA 3DHYA 1DIHA 5KKCA 2PKQP 3GHHA 3ROKA 1VL8A 5A4DA 3U4DA 4I08A 1T2EA 3DMTA 4XYGA 4F6LA 2QQ5A 2DFDA 2J3KA 1UAGA 3C24A 1ZIDA 4ZD6A 2H1SA 1GYQA 1YONA 3GEMA 3PHHA 1HKUA 2X1HA 5IFLA 3WDSA 4WLOA 1X1EA 5EL0A 4Q3CA 4BNKA 1KYQA 2B0JA 3ZWYA 3ZV5A 5L40A 5TIIA 1H9BA 1FDWA 3GQVA 4BB5A 4O63O 1PS9A 2W8ZA 3I9OA 4TROA 4YDRA 5FWNA 3ZWPA 2FPIA 4ND3A 4OSPA 5L4NA 3JQGB 3JCZA 2NADA 3WGOA 1XSEA 3QHAA 3WFJA 4RVGA 3GPIA 2AHRA 3ZW9A 3UF0A 4PIVA 3CEAA 4KDEA 2YYYA 1YVEI 1MFPA 2D2IA 1EK6A 1Z7EA 3P5SA 4PZDA 3GFBA 4RVUA 3GAZA 1QV6A 1E6UA 5JNLA 5T5QA 9LDTA 2IZ1A 4ZQFA 4YJFB 2PTGA 2PLAA 3DZBA 5CPBA 3DEYX 1E1NA 1BDBA 1IE3A 3ITDA 2VRCD 2NWQA 4J9VA 3M1AA 1KVUA 3LF1A 4RF5A 4ND4A 3UCEA 4W4TA 4W99A 4EUEA 3NJ4A 4LK3A 1I3MA 3GRKA 1AN9A 4IS3A 3G0OA 3WX0A 1H93A 4BKUA 5T57A 1QKIA 4E6PA 1F8GA 1EK5A 4KUGA 3AK4A 4HP8A 1T1SA 3PYMA 1M66A 3PZRA 4NJMA 4UVDA 1KY5A 3MWDB 4FPXA 3DZKA 4D7AA 3BIOA 1I2ZA 3QA9A 3NDRA 4XJSA 1Y6JA 2YJZA 3FPCA 4GVXA 1K89A 1PWXA 2BD0A 2F1KA 2NLOA 8ADHA 3STHA 4FIZA 4XB2A 3LT4A 3Q9UA 3UHAA 4LMPA 5TT0A 1PJ2A 3VVBA 2GN6A 5JAQA 4ALJA 1IUKA 3JQEA 1E7WA 1ZO8A 5LC1A 1U2GA 4IJVA 1P0FA 1X1TA 2AE1A 3D1LA 5TX7A 4R3WA 3KYBA 4NIMA 3BYZA 1T4BA 3BMQB 3DQPA 1I3KA 1P77A 1VKOA 4RDIA 1O8CA 2UDPA 4ILKA 2VHVA 3WG9A 2EGGA 3MTGA 3Q0EA 1GFSA 5DP2A 2FMUA 3SX2A 4BV8A 4B8WA 3JQAD 2Z95A 4MKXA 3W4KA 2C7GA 4DRYA 1U3UA 1N2SA 3I9KA 4OQYA 2IZ0A 4KOAA 1LI4A 3WTBA 4RPJA 4BOYA 5IZ4A 1NVGA 1HWYA 2O3RA 2TMGA 1E3WB 4Q3NA 2C29D 5IZCC 3D3WA 4KTVE 4HY3A 2X0IA 1Z82A 4ZRMA 1GEEA 3EZYA 4CMKA 1E7YA 3H2SA 3JYOA 3FWNA 4XYBA 4B4OA 3GGOA 4WASA 1PJLA 2DU8A 5JAIA 4YRDA 4E3ZA 3KO8A 3AUSA 5BNIA 3WNVA 3CSDA 3UW3A 4NBVA 5EQDA 3QVSA 3QVWA 1LXCA 5ITWA 4B7UA 4Q9NA 4OO3A 3D4OA 3OSUA 3DBLA 4K6CA 3OA2A 1F8FA 2R00A 3I4FA 4EW6A 4JX8A 4BO0A 5ER6A 4AVYA 2YDYA 5L53A 1ISJA 4Y6SA 3D5QA 1JWAB 3KOUA 2GN4A 4JBIA 1ZXLA 3WXBA 4QFCA 3HN2A 1GD1O 3F1LA 2NQ8A 3K73O 3PJGA 2GPTA 2ZCVA 3JYQA 3WGTA 5IF3A 4H3VA 2NTVA 3SLGA 4CLHA 1ZK1A 4WLUA 1PZFA 3G79A 3EYWA 2DBRA 1YBMA 2FSVA 3OEWA 2DFVA 2ET6A 1WPQA 2EKLA 3JD2A 4PVCA 1EVIA 4CM9A 4K6FA 1PR3A 1U8XX 1YXMA 3GVPA 3FNGA 1Q0QA 3H5AA 3KYDA 3U4IA 4IDBA 1HDYA 4TRMA 4R69A 5EJ2A 3H9UA 3ZNQA 5A5FA 4GL4A 2G5CA 3BMCA 2VN8A 3UH1A 1U4SA 1R0LA 4IXWA 3LT1A 1TT5A 3BHMA 2VZ0A 3IJPA 4PZEA 3NTQA 3RC7A 3DAPA 1H2HA 4KTTE 4IM7A 4E5KA 1HL3A 1W73A 3AUAA 4BMSA 2EJVA 4J1TA 2JFGA 4PFJA 4K28A 1KEUA 3OIDA 4MVJD 3PQDA 4YAKA 3LU1A 4J9UE 4IBOA 4II2A 2DM6A 5JW6A 1O89A 2O3TA 3P2YA 1HDGO 1SOVA 2P5YA 1NAHA 3RD5A 3U0BA 3LC2O 4GX2A 1IL0A 1QYCA 4OOFA 4F6CA 1QYDA 2DC1A 7MDHA 3DB2A 5IXSA 4YAJA 2HK8A 4CLDA 3MWEB 4G81A 2JCYA 3LC7O 2VWGA 1GQQA 1WDMA 3ZWMA 1BTOA 1I3NA 1KBZA 1W8DA 3RFTA 4MIEA 1EE2A 1ISFA 3RJ9A 2HMUA 1H9AA 4INAA 3PWKA 4GLLA 3GVCA 3KYDB 4IQ0A 3I52A 2GLXA 9LDBA 1GQ2A 3GC6A 4UEJA 4WLNA 1RKXA 1XQ1A 4Y6PA 3LLVA 4J1SA 4YT2A 2BFAA 1I2CA 1NQAO 3QE3A 5CEFA 1LEHA 4CR7A 2EWMA 4R01A 2OUIA 1CETA 3K2EA 1DOHA 1NQTA 4HV4A 2HU2A 3RAJA 1YGYA 2C82A 3ZU4A 3VZSA 4EBFA 3N74A 1WMBA 2VYNA 4RVFA 4PLTA 2D5AA 3IS3A 5G2OA 1QSGA 2VYVD 4FD3A 4LCJA 4R68A 3BTSA 2NVUA 3V5NA 1P1KA 4PG6A 4R1NA 1C1DB 4XB1A 1DRVA 2O7QA 2E4AA 3HUDA 5L3ZA 3EDMA 1R37A 2ZJ1A 3VTZA 2Y93A 5KTKA 2IZZA 3EMKA 4GPD1 5F1OA 5U4QA 3U49A 3VH1A 4FR5A 1YJ8A 3KV3O 4HNHA 4DLBA 2YDXA 1HYGA 3MJSA 1BW9A 2CD9A 3NUGA 2PR2A 3JQ9C 2O4CA 3K8ZA 5A3JA 3PFFA 3QWHA 1MV8A 2A94A 1BHSA 1HETA 3W8FA 1LC3A 4BNWA 4FFMA 1EFKA 1JWBB 2GUGA 4CM9D 3GVIA 1XWFA 1WP4A 3HB5X 2IODA 4XKJA 2B4TO 1LDBA 5AYVA 1WDKA 3O8QB 4PLFA 1ENZA 3QQPA 3OH8A 4QEDA 4BL5A 4U6QA 1N9GA 1GUZA 3D5TA 4RJTA 5JCJD 1UXJA 3PQFA 3X2FA 5L9AA 1GDHA 4GAEA 4KDFA 4D45A 1O0SA 2ZATA 2PD4A 1PJTA 3BHJA 3BMOA 4AJPA 3G49A 3AUTA 4XQCA 3NT5A 4Q3BA 4E31A 1N8KA 5TJ9A 1XKQA 2JFHA 2P9CA 2X9NA 1YJQA 4LRTB 1NPDA 1N1GA 3IKVA 3HN7A 1K0UA 2Q2VA 4UVGA 3RVDA 5BQFA 3GG9A 2VRBA 2RBEA 5JBIA 5B4UA 1GADO 1KS9A 3AY6A 1TT7A 3WGQA 4TQGA 2CY0A 1PGQA 2YHUA 3KTDA 2FY8A 1P33A 1ZUD1 2BGLA 1JAYA 2HO5A 5JXWA 1V3TA 4CUZA 5KNLA 5ER9A 1V6AA 2OORA 1DIBA 1H6BA 3EAGA 1EDZA 3ZCXA 3WLFA 4ID9A 2CDBA 3I3OA 3Q1LA 4Y98A 2QZZA 5DCYA 5A1TA 5C7LO 2WSBA 2Y1CA 1XHLA 2AEJA 5F1KA 3V1YA 4ND5A 3TJRA 1UXIA 3IMFA 5I7FA 1X15A 2VT2A 5AXCA 1PJBA 4XIYA 1G0NA 1YQDA 1DO8A 2HRZA 2Q1UA 3CUKA 5BT9A 4A73A 1Y8QB 4LMRA 5JE8A 1UDAA 2J3IA 3S55A 4AJ2A 4M86A 1FXSA 3GZ4A 3U3XA 4ALMA 4RGBA 2R00C 5GMOA 3ZWOA 2JD2A 4R41A 3HJAA 4IJKA 3F6YA 3O38A 3DZGA 1IHXA 5ENVA 2QRLA 5B4VA 3NRCA 2C54A 4YYZA 4Q3DA 2ZYDA 1VSVA 3HQ4O 3OP4A 4BNLA 4EEXA 4UULA 5A03A 3JYPA 5HWSA 4BB6A 4WCDA 1XG5A 2ZTLA 4L9RA 5HBRA 4G65A 2V7PA 5KJ6A 1NWHA 3OA0A 1IZ0A 1IPFA 3SJ7A 3DAGA 3I9MA 3AM4A 3VDRA 3ZZNA 3CMMA 1KVSA 2RH8A 3PIIA 1LX6A 5TC4A 1Q2XA 2HK7A 1YS4A 2YHIA 1I30A 2VTEA 4U7WA 2ZQYA 4XYMA 1UP4A 1WW8A 1LU9A 1YBVA 1UXHA 3WSVA 2I3GA 1LDMA 3FTPA 5A05A 4U6SA 4K1LA 3QVTA 1J5PA 4NBTA 5DCWA 1LBEA 3OM9A 4NJOA 5FYDA 5LCXA 2X23A 1LTHR 2CF6A 4AJJA 2VWQA 1VRWA 3ENNA 4G2NA 3R6DA 3UGKA 1ZNQO 5DBGA 4MVJP 4J1NA 4NK5A 1ENYA 2AA3A 4IJUA 1DAOA 4FGWA 1E0DA 4BKPA 1GR0A 1A27A 4IQGA 2VOJA 1MP0A 4R5HA 4LSMA 3BTUA 3K6JA 3L77A 1Y8QA 1Z45A 2C20A 3IJRA 5JMWA 4TKMA 4TZTA 1PR9A 2CVOA 4TKLA 1PJ3A 3KSUA 4RZIA 4ZRNA 3RSHA 2GN8A 2DTDA 4M49A 4QTZA 4BMVA 3MJTA 1HE2A 1NPTO 3V2UA 3BA1A 3WGZA 4IDGA 1ULUA 2A92A 1FDVA 1AXGA 1VKNA 3JYLA 1E3LA 4L73A 5KJFA 1P9LA 3GK3A 3OF2A 3C1TA 4BNVA 3QIVA 1ENOA 5T8KA 2UUPA 3DZIA 4WEOA 2OBNA 1E7MA 3RUCA 4FSHA 3WQSB 4DWVA 5JYDA 2QZ9A 4MVJA 3OFSA 2GN9A 3WSWA 4Y67A 1LA2A 2NTNA 3WJAA 1DIRA 1O5IA 1VI2A 2Y1DA 3GG2A 4JBGA 4QQRA 3VZQA 1LQUA 4RLHA 2O3QA 3W6UA 1NAIA 5JY1A 2W4QA 3QJ5A 3WIEA 2CSUA 3WMXA 4YRAA 1NBOA 5HS6A 4OXNA 4RPLA 1Q0LA 3AI2A 4OSOA 4BO2A 1R15A 2JL1A 1B7GO 3JQCA 4D79A 4PG4A 4N5LA 4YJDA 3R1IA 3GGGA 4I9UA 2NSDA 2I3AA 4R1SA 4KWIA 4CLXA 1UZNA 1HT0A 1N7GA 3GN1A 2Y99A 1KOLA 2IEDA 4WNIA 5CP8A 3OMLA 2JAPA 3VAZA 2POQX 4W7HA 2WEKA 1LDEA 1ONNA 2ZB4A 1GY8A 3Q9NA 5TS3A 3WGYA 3OEYA 4G5HA 2PKQO 5IN5A 5G0SA 2DT5A 3GRPA 3QP9A 1SB9A 3GDGA 4OAQA 1PSDA 3E9MA 3GHYA 1U3TA 1T4DA 2NNLD 1R66A 1EE9A 1WDLA 4PLPA 5T64A 1BGVA 1XQ6A 2RIRA 2I66A 3E5MA 4UVEA 5JDCC 1YL5A 1VJTA 3VPFA 4Q39A 4UVHA 3B1KA 2XXBA 3UICA 5COAA 4CMJA 5TLSA 2W2LA 3H3JA 2HUNA 3CPSA 3FI9A 2SCUA 1DIAA 2AMFA 3C7AA 1EVJA 3AY7A 3JQBA 3UVEA 3TDKA 5CAEA 4UREA 4L8VA 2VUTA 4KQWA 1QYVA 3DMTC 4J0EA 2R6JA 4DQXA 1PWZA 2UUOA 3KBOA 3Q6IA 1QXSA 5CFZA 5I7SA 2Q3EA 1F06A 1TLTA 1U4OA 1E92A 4YBZA 3VH4A 3D64A 3F5QA 3JQGA 2Y0EA 3GVHA 1EZ4A 2VHYA 1GYPA 1Y7TA 4WGGA 2IEBA 4CM3A 1QLHA 4CMHA 4F46A 2X5OA 1LC0A 3NV9A 4YT8A 4FJ2A 2AQHA 3DC2A 1M76A 1ML3A 1P44A 3ROPA 3V1UA 3FCOA 4DBZA 3DBVO 3AY3A 4B8ZA 1DBVO 1LSOA 1P45A 3JD3A 3TOZA 4PCVA 2CVZA 2Z1NA 4XJTA 3RJ5A 2FHSA 4FS3A 4NH4A 4RQUA 1PU2A 4YEDA 3GT0A 3W4IA 1CRWG 3QV1A 1QP8A 2YUTA 3X2EA 3GAFA 3E9NA 1C3VA 1ZJYA 4WPGA 4I1IA 1V0JA 3TNLA 4U0KA 1SMKA 4BGVA 2GNAA 4YTEA 2ZTVA 3UAGA 4E5YA 3ONEA 4LN1A 1ZMOA 2J5QA 4E13A 2E37A 3Q11A 1PQPA 1PZGA 3C8MA 4JLWA 5C37A 3A28A 2B5WA 1XA0A 1B0AA 1XCBA 1J0XO 2Y1OA 4P38A 1EFLA 3SBOA 4ONEA 4JP3A 1B15A 4QFDA 1UDCA 1PJSA 2HK9A 4Y9DA 4YA6A 5K0ZA 2UVDA 3N7UA 4Z3DA 3BTVA 1GZ3A 3WS7A 4PG7A 4DIOA 1BXKA 1S7CA 2CDCA 5JS6A 3KXDA 3TF5A 4XGNA 4F3YA 3O9ZA 2NU8A 2O4UX 4A10A 5JDIA 1R16A 4CLEA 5KVQA 3RUIA 1UXGA 5IDYA 4J6FA 2J3HA 3KYCB 5ILOA 1GL3A 4D43A 1HZJA 2I5PO 4BKQA 1PJ4A 1HE4A 3PGJA 2EV9A 2I76A 3DAFA 5B37A 3PXXA 3I1JA 3LLSA 4DL9A 2JFFA 3PJFA 2J3JA 1B26A 4YT4A 4U0JA 3WYEA 3PLNA 2QYSA 3OJEA 1YBAA 2DKNA 1QG6A 1Z7BA 4UUOA 4HKTA 1FMCA 1R12A 2QX7A 4CM8A 1E1MA 4N54A 1ZEJA 2W2KA 3M1LA 4WLVA 3HDYA 4HFJA 3NJ8A 2DPGA 2WYVA 1NVMB 5A9SB 3JQFA 3NX4A 3IUSA 4ZJUA 1DFGA 1FK8A 4BO4A 5T6BA 4QSMA 5F5LA 4CMAA 1WNTA 2ZB8A 3HG7A 1BXZA 4NBRA 1O9BA 3WJ7A 1KEWA 3E03A 1LLDA 1MA0A 3GDFA 4OXKA 3DDNA 3FHLA 3OIFA 2A9FA 3GF4A 2I6TA 3BXXA 2YV2A 3RUDA 3FNFA 4GQAA 1VL0A 3O03A 4BQPA 4CM5A 2EKPA 2V6BA 2DTEA 5JC1A 1CERA 4YT5A 2W90A 3H9QA 4ZVVA 3ZN2A 2EEZA 5IDXA 5LDHA 1X0VA 3PHJA 4KQXA 1EVZA 4BVAA 4XD2A 3MTJA 3Q3CA 4Z6KA 3JSAA 2PZLA 3ANLA 4WK6A 2RAFA 4IZIA 1DC3A 5MGBA 3L4BA 4ZGWA 1KC3A 1HE3A 2PH5A 2W98A 2C2YA 4JQCA 1Q7CA 1IOLA 5IDQA 2E48A 4H7PA 4NJMB 1A9YA 4TRNA 3L9XA 5DT9A 1KEPA 3KSZO 1LNQA 2O23A 3COSA 1ZSYA 4LGVA 4TVBA 3IKTA 4CM8B 4EGFA 4YRBA 2CMDA 3AU9A 2NU7A 1ZW1A 1H6CA 4Z9FA 1E5LA 1Z75A 4N7RA 1PGJA 1G1AA 4BQRA 1EDOA 2XPCA 2ZB3A 2CZCA 1E3SA 3DXFA 3GUCA 2P9GA 1GTMA 3JQBC 4FOOA 4YAEA 3WGIA 2O3JA 2ZYGA 4A26A 4L74A 5BNTA 4E12A 2OL4A 2BGKA 2DVMA 1PZHA 2ZQZA 5F21A 1QORA 3KETA 3TOXA 3NGLA 1NNUA 2DAPA 1ISGA 1LSSA 2VRCA 1Z74A 4TWRA 3GVXA 3PLRA 3TZCA 3GUYA 4J4BA 5KKAA 4PRLA 1HEUA 2ZTUA 1F17A 2V6FA 3JQAA 4MDHA 4OQZA 5H83A 3I9LA 3E82A 3OETA 5AXAA 1EMDA 3INTA 4XGKA 5A04A 5HTOA 2PGDA 3GZNB 3HDHA 4L76A 3BTOA 4HADA 4I5GA 4YWJA 1ZKMA 5CEJA 1XELA 4W7IA 3SLKA 5G0WA 4RPGA 2OO5A 3VOSA 2BMAA 2IYOA 4IMPA 4WOJA 3M2TA 2R2GA 4J91A 2B83A 3ROQA 3KSDO 1OZAA 3NYWA 2JD1A 4PLWA 4BO6A 2Y66A 3KRTA 1DJQA 4IDAA 1H0KA 2H9IA 3FRJA 2FZWA 3VC7A 1RM0A 1UUFA 4FJ0A 2D3TA 5C7OO 3AFNA 4J0FA 4TRRA 2WM3A 4E32A 3RWBA 1LSUA 3FD8A 1NYTA 2OP1A 3BMNB 2JKVA 3HFSA 1OFGA 3JV7A 4DREA 1Y8RA 3CIFA 3JQFC 2OHXA 3U9LA 2PKRA 3AW9A 3RCBA 4B3HA 2X58A 4OKNA 5JCJA 4D41A 4PLYA 2O2YA 5CG1A 3LF2A 5CDGA 4ZN6A 3DBLB 2E49A 4RDHA 3RQSA 5EPOA 4E2YA 5A5EA 2G0TA 1JKIA 2AG8A 2XAAA 3MOGA 1U3WA 1RYEA 5I9MA 3DHEA 1ZMTA 5JDCA 2NM0A 1W0CA 4WCFC 4Z9YA 5T8KC 3VKVA 3LVFO 3RUEA 1MB4A 2VNSA 3GR6A 3KHUA 2EW2A 2ILTA 3U09A 4J90A 4DYDA 4ALKA 1S6YA 1P1RA 1UDBA 2HAEA 1B8PA 4CMEC 1AE1A 1BG6A 1JA9A 3SJUA 3IUPA 3R3SA 1Y9AA 3OJFA 3KB6A 5C5IA 4PLVA 4XEHA 5F5NA 5DZSA 2Y1EA 2WYWA 3PRJA 3MCVA 3I4CA 1FDSA 3GEGA 3TZQA 4MO2A 4CV3A 4E2WA 4D3FA 5L45A 1ISIA 3QY9A 2P4QA 4ZHSA 3BMCB 4GMGA 1NHGA 2X0JA 2VYND 4LISA 1ARZA 2IYPA 1TT5B 5L4LA 4EDFA 1YL7A 5AXBA 1HRDA 1E3IA 1B16A 1QRRA 1P1HA 1Q7GA 3CTMA 1U5AA 4WJZA 1PGOA 1N9GB 2JHGA 2OZPA 3HDQA 1NP3A 2HLPA 1OI7A 1GCUA 2X6TA 1D7OA 3HDJA 4AJ1A 3TPCA 3RKUA 2B36A 1XEAA 2NACA 3ETDA 4MVJH 1DLJA 4BUCA 4CMIB 4J2HA 1AHIA 2RHRA 1M67A 2V6GA 5B1YA 5BSHA 3E8XA 1NFFA 3M6IA 1HYEA 1K6JA 1XU7A 3GMSA 4WEQA 4ND1A 3OIGA 1OC2A 3LSYA 5IG2A 3IQDB 4UEKA 2EF1A 3ULKA 1HF3A 1QV7A 4CV2A 1UP6A 3PDUA 5A9RA 1VPDA 4IQ8A 5JCXA 5KIAA 1CF2O 3I5MA 1U9JA 3H9EO 1M75A 2Q46A 4GMFA 4R5MA 5IJZA 5BSEA 1C1XB 1A71A 4TVOA 2DTXA 1R6DA 3KEOA 1PS0A 1HDZA 2NVWA 4U8GA 1Y1PA 1Q0HA 1ZBQA 3TZKA 3OQ6A 3C85A 3Q2KA 2JD0A 3D4PA 1Y81A 2VNAA 4XX0A 3PFWO 4E5MA 4ZA2A 1JQBA 4GBJA 1LUAA 1AXEA 1GV1A 3HB4X 4IINA 1GUYA 4JBHA 2CF5A 2ZB7A 1I33A 5KJCA 4K9DA 2X7HA 2FPPA 4GX1A 4XDZA 4OXYA 4CM4B 3N58A 3U4HA 1GQYA 1V9LA 2O50A 4IIVA 4RQTA 4YQZA 5CDSA 3OHSX 3VH2A 5IN4A 4DC0A 2AE2A 2QIOA 3QWBA 4CMCA 4HXYA 1DHRA 1YB5A 4BMNA 1MG5A 1MC4A 3AFMA 4CL8A 1YB4A 1U3VA 1CDOA 4FJ1A 4IS2A 3R3JA 3C1OA 3PK0A 2DUWA 1ZK3A 3VPSA 3ZWVA 4PLZA 2EJWA 2VWHA 4JP2A 1BW9B 1J4AA 2UAGA 4AJEA 4JK3A 3ICPA 2Z1MA 1ONOA 3B6ZA 1DEHA 2NU9A 2WMDA 4KWHA 4KUEA 5AVOA 3ZV3A 2FOIA 1C1XA 3TSCA 2EP5A 4MKRA 2G82A 2OXIA 3E9QA 4I8XA 1GU7A 2D5CA 1N1EA 4GSKA 1F14A 1QYXA 1FF9A 3RBZA 3PVZA 4D42A 4BNHA 2X5JO 4J3FA 5DBIA 4DUPA 3EY4A 4RV9A 5U1PA 3DZFA 3UOGA 2X9GA 1DLIA 2VWPA 3P2OA 4YVFA 1O94A 1LRKA 4CJXA 3S2GA 3FSRA 4RL6A 4O59O 4JNKA 3FBGA 5EERA 2LDBA 3EUWA 4HFMA 4J7UA 3OJLA 1XR3A 4EZBA 1ADGA 5EQFA 4YAGA 4AJOA 1V35A 4E5PA 5L7WA 2HMWA 3IC5A 4GWGA 3OICA 4BO9A 3ZHYA 1MC5A 1VJ0A 1OAAA 4MIOA 1NASA 1DHTA 3LK7A 3RI3A 3UN1A 1ZCJA 1E7SA 4RPKA 1T25A 4DC1A 2B69A 2YQ4A 2ZK7A 4R4JA 5H81A 1I10A 3FR7A 4D3DA 5THQA 2CDAA 2QRKA 3RUAA 1XIVA 1NVTA 3K30A 1AHHA 1GV0A 4IGFA 4BO3A 2RHCA 2NQTA 1PGPA 4NI5A 3U4CA 5KWEA 4J4HA 4GX0A 3GY0A 1BRMA 4UUMA 1SO8A 1PTJA 5DOVA 3U62A 3DBHB 2C0CA 1W6UA 3M2PA 4MVJG 1EUZA 4Q3EA 3MJ4A 4ALLA 4FDAA 5CG2A 4IIUA 4YJHB 4KMSA 4JGBA 4OH1A 1PL8A 2NV6A 1GZ4A 1DPGA 4J7XA 2AEMA 3TN7A 1RM3A 4DGSA 2C7VA 1KVRA 2OBYA 1P0CA 4O6VA 3JQ7B 2D0IA 2PGJA 2NU6A 4Q3AA 4XDYA 1UP7A 1VLLA 5B12A 4DPKA 3Q2IA 1A9ZA 3PYLA 3D7LA 5IXYA 1B8VA 4D0SA 3ZHXA 3ASVA 4QO7A 5GZ6A 1W4ZA 3ASUA 3RIHA 2UYYA 4PG5A 1LJ8A 3T7CA 1V3UA 1WZEA 4NBWA 1HE5A 3PPIA 3PZBA 4BHTA 1WAMA 3TZ6A 2JJYA 4JCOA 2O2SA 2D1YA 1X7DA 1V3VA 4R3NA 4BGIA 1RJWA 1R0SA 4FFOA 3VVCA 4P22A 2EHDA 1WZIA 3AU8A 3V8BA 2ZCUA 4NMHA 4II3A 1A72A 4NU6A 5I9LA 4OM8A 4ITUA 2VT3A 1MXHA 4LW8A 2CVQA 1BSVA 3JD4A 2Y1GA 1ULSA 3AOGA 2BFPA 2AQKA 3AWDA 4CLOA 2IRWA 1NFQA 3NTOA 3DBHA 3BMOB 3VZPA 4B4VA 4HX5A 2C2XA 3DMYA 1T2FA 3ADOA 5L4SA 1EQ2A 1MUUA 4L75A 2NVBA 3GN2A 2Q1SA 5TF4A 1ZVMA 2X22A 4CLRA 2PWZA 3D4NA 1KY4A 2Q2WA 1Z6ZA 4E0BA 4B7CA 4NNJA 2BH9A 3JQ7A 4E33A 3K9QO 2JHFA 4QECA 1KVTA 3ZI0A 4N5NA 3ZWNA 4B79A 4LVUA 1SB8A 5DBFA 3RU9A 4A27A 4HNGA 1BMDA 2EG9A 3RBVA 1T2AA 3QVOA 3H2ZA 4XRGA 4FFLA 5JLAA 2A35A 3C7DB 5IDWA 1NTOA 1Y5RA 1N7HA 4XQEA 2F00A 1ZSNA 1GYRA 3ZGYA 2GZ1A 4J4TA 4YQYA 2TMDA 1LLCA 4U5QA 5C7IO 3VKUA 3DHNA 4NDNE 3G17A 4IXTA 4EUFA 1U7TA 3F4BA 4NFYA 3ZNNA 1PX0A 5JAMA 3SVTA 1CYDA 3H3FA 4A0SA 2AG5A 1Q7BA 3E1KA 1C0LA 4GGOA 4GVLA 1ISHA 2WE7A 3L6DA 2VZ9A 3QWIA 3I23A 1B2LA 1IY8A 2GSDA 2Q99A 2BLLA 4AJIA 4NFSA 5JAZA 5COBA 2I99A 2WD8A 1YL6A 3F46A 2P91A 1QMGA 3IOYA 5G4KA 5MDHA 2Z5LA 5C3MA 4E4YA 1H6DA 4P4GA 4BO5A 3I83A 1E1LA 5F3RA 3WBFA 3ABIA 2PZMA 4AJKA 3E6AA 2Q4EA 1IPEA 1HTBA 2AW5A 4NU5A 3IAHA 5TJHA 4PLCA 2HRBA 4BNNA 1SOWA 5EINA 4CLRB 3I9NA 4NR0A 4UUPA 1J49A 2PV7A 1LQTA 3WGGA 5JO0A 1ADCA 1KEVA 1VC2A 4B4WA 5CEEA 1LLUA 1K6IA 2ZYAA 2Y05A 1GUFA 2GO1A 1KIFA 4DQUA 4WE3A 1DRWA 3AOEA 4E21A 2Q1WA 2EGHA 3GDOA 3ZDFA 4D44A 2Y0DA 3LQFA 5KJEA 4PRKA 1M6HA 1SCUA 4RVSA 4MP6A 1PEDA 2DBVO 3RBXA 1QLJA 1AUPA 4CM6A 1PZEA 3A14A 4K26A 3VHRA 1XYGA 1U5CA 1SAYA 1SPXA 3H4VA 4KZPA 4BGUA 2OP0A 3MOIA 3T4EA 4BNMA 4R9RA 2WYUA 1EEHA 5FF9A 2C07A 4B3JA 3MJCA 4Z9XA 1JDJA 4JJFA 4DXHA 1UH5A 1IYZA 4F45A 3ONFA 3L0DA 5EIOA 4CQLA 2GR9A 5G4KB 3GOHA 3ZWAA 4MVJE 2H63A 1JTVA 1NR1A 3WWYA 1PS8A 4UVIA 1TVEA 1DJNA 4LSWA 1OOEA 3A1NA 3WMWA 1YQXA 3DFUA 2VQ3A 1YRLA 3GFGA 5I7EA 4GH5A 2LDXA 1YKFA 3EGOA 1E3WA 3ZU2A 5LDGA 3TZHA 3K2BA 3D3WB 1P74A 3WWZA 2HKIA 3WICA 4A7PA 2IXAA 3LC1O 1CEQA 5L7TA 3RUFA 5DDIP 1IULA 1MXFA 4DLAA 1JLLA 2ZIZA 3T7EA 3DZJA 8LDHA 2EXXA 2BHLA 2BI7A 5F1PA 3DL2A 4IGEA 4FW8A 3ETGA 2WJPA 4GSLA 2CUKA 5A3VA 3WQRA 1H6AA 1O6ZA 3F3SA 2WTBA 3L9WA 4FN4A 5FI5A 3TFQA 5G0TA 1U28A 1RM5A 1GPJA 4RF2A 4NFHA 1P1FA 4JN6B 3OQBA 2D8AA 1L1FA 1I5RA 3ROMA 1NX6A 4DMMA 4MVJI 3PJDA 1X7HA 4CMBA 4J7CA 2OGUA 2YV3A 4S1VA 1YWGO 4HFRA 3DO5A 1WMAA 1RWBA 1OMOA 5CHEA 2IXBA 4YJFA 4EUHA 4OMUA 3W1VA 2G17A 3WFIA 1QR6A 3PEFA 4XR9A 3RFXA 4CQLB 3KVOA 4QUKA 1EUCA 1ZFNA 2VTDA 4OYRA 3ZW8A 5K9ZA 4GGPA 4W9NA 1HDXA 4XYEA 2X4GA 1YO6A 3ITKA 2HMTA 4DQVA 3S8MA 3ZWBA 2X0RA 3E48A 1I01A 1BWSA 1GZ6A 3ANNA 1NXQA 4A5OA 5G0UA 1B3RA 3KM0A 3NDIA 5KCZA 4GLOA 1VJ1A 4OJNA 1P31A 3BMNA 3AJRA 3L4SO 3PI7A 4CPDA 1ONPA 4FGSA 3PHLA 1E7RA 1H94A 1Y8RB 2QG4A 2VHWA 3BAZA 1JN0A 3HWRA 3CXRA 4RVDA 4CR8A 3TL3A 1YH3A 3OJOA 3GGPA 2J5RA 4D0RA 4H16A 5CDTA 3UCFA 2DBZA 1UZMA 1CIVA 2HCTA 4DPLA 4HWKA 1NPYA 4WLFA 1D1TA 2AQ8A 1RYDA 1YB1A 4P4LA 4IDCA 2NUAA 4PVDA 3VPXA 5J23A 5BSGA 2Q49A 4R16A 3ZU5A 4DBVO 2BRUA 1VM6A 1PQWA 3NKLA 1G6KA 3CE6A 4L4RA 3ZNPA 3HFGA 2WD7A 1JVBA 4ZQBA 3D0OA 3RASA 2DLDA 1WLYA 1U1IA 2Y0CA 4AICA 2A4KA 4BNTA 5AQ1A 4R1UA 1E1KA 4DTIA 2BELA 3IP3A 2BFMA 1LDGA 1ZEMA 2DBQA 1FDTA 4W82A 1DFIA 3TFOA 2Q45A 4OGWA 3WR5A 1I3LA 1B8UA 1EQUA 4WCFB 4TSKA 1M2WA 3WQQA 4WUVA 4C7JA 4R9SA 1IZ9A 1I2BA 3B1FA 3HE3A 1ZH8A 3KZVA 2GASA 2D4AA 3PYXA 2DPHA 2J6IA 2GCGA 2I67A 3QW2A 1Y5MA 3NAQA 1DSSG 1UJMA 5ENDA 1B14A 3CZMA 4EEZA 4QX6A 4RORA 3INRA 4XR4A 3FTNA 3B70A 3S2IA 4YCAA 5L51A 4NQZA 3WB9A 4ESOA 3VDQA 3H5NA 4DYVA 1ZK0A 3K31A 1CJCA 2P4HX 1TEHA 2E82A 3VPGA 1C1DA 3LYLA 4WECA 2VHXA 1Q1NA 3GZNA 3UFXA 3SXPA 3FF4A 2YQ5A 1EUDA 3KYCA 4MKZA 3E18A 1HLPA 4CMIA 4RZHA 4AFNA 3H9JA 3DR3A 6LDHA 1T26A 3TQHA 1EBFA 4CM7A 1B3BA 4NHEA 1XDWA 2WD7B 1SNYA 4EYEA 3L07A 2HQ1A 1YE3A 4JJIA 2O7SA 4R1TA 2J8ZA 3JQ6A 3HNPA 1UZLA 1SC6A 3RUHA 4ZQGA 1R0KA 2HDHA 5A06A 2PH3A 4MP8A 4GI2A 2EW8A 4QO8A 3PGXA 1CWUA 4YXFA 3EVNA 1SEPA 4BNZA 4JXKA 4DA9A 5HM8A 3E5RA 4A2CA 4L0QA 4I5FA 3W4JA 3I9JA 1VL6A 3DOCA 4PGFA 4FB5A 4WCFA 4CV0A 3WYCA 5JFOA 1P1IA 4FQ8A 3U5TA 4OL9A 2YFHA 1NM5A 4I5DA 3GNQA 3FNHA 5ES3A 1OBFO 3MZ0A 4P4NA 3GPDG 3L6EA 4DIBA 5TT1A 4EI2A 3LT0A 4ROSA 4NZ9A 1G0OA 3WTCA 3BMQA 3ANMA 2VZ8A 3L6OO 3ZHZA 3R0IA 1ZK4A 3AI3A 2FWMX 4RLSA 2V65A 5JYEA 4RO0A 3DTTA 2PY6A 1KERA 5TQVA 2WDZA 5TRTA 4XCVA 1MX3A 3PQEA 4GKVA 4BGEA 2O48X 4J49A 5FFFA 3P7MA 4MPDA 4D3SA 2B37A 1DXYA 2J5KA 4BNIA 3RC9A 6ADHA 2CFCA 4KUHA 4KP7A 5CDUA 2IDZA 1ORRA 1TXGA 3PIDA 1E3EA 1C0KA 4R54A 3G1TA 4CUJA 5KJ1A 3NT4A 5U9CA 1PQUA 3HHPA 1C0IA 1ZXBA 2XF8A 2QW8A 4CQMD 2EP7A 4CR6A 2GYYA 3AI1A 3PHIA 4ALNA 4BNJA 4IPTA 3S2FA 4EJMA 2QRJA 1LRLA 4J43A 4UEOA 2VYVA 3P19A 1D3AA 5A9TA 2BKAA 5HS4A 1DC4A 5EMHA 5K6AC 4CODB 2GF2A 3RC1A 3ORFA 4RCVA 3LT2A 2FPGA 2PZJA 4I9NA 2H5LA 5GZ3A 3VH3A 3VZRA 4BO7A 1DIGA 2O3SA 1D8AA 1K5HA 4JIGA 2NTJA 4MVJM 3B20A 3QRWA 1SBYA 4PG8A 3K92A 1C14A 2OFPA 4AG3A 2ZTMA 3A4VA 4O0LA 5TGDA 2VUSA 1OC4A 1L7EA 4B3IA 1FJHA 4TRJA 5FI3A 3UXYA 3WBBA 4L4XA 1IB6A 2G1UA 1HLDA 2PD6A 2X5KO 4IDEA 2HMVA 3ON5A 1WWKA 4XZ3A 3GH3A 1U2DA 2P68A 2GD1O 3S2EA 1UAYA 1DRUA 3QVXA 2I9PA 5JC8A 4IDDA 3PP8A 4BNGA 1HSOA 1SZJG 2D59A 4NBUA 5I8ZA 2Q4BA 5ILGA 5L7YA 3VTFA 2JAHA 2XOXA 2HJSA 3WOHA 4AL4A 4BNYA 4N18A 3KUXA 2PFGA 2RH4A 1HYHA 1K6XA 7ADHA 1X7GA 3ST7A 1LSJA 4PZCA 2FR0A 4EITA 2FP4A 3PHGA 4HBGA 2C59A 4OKIA 1D4FA 3DWFA 3KEQA 4X54A 3JQ8B 3ZV6A 4Z0HO 5CPFA 1ADFA 4XRRA 1BXGB 2B35A 4BV9A 3OQ1A 5EESA 4WKGA 3O8QA 4M89A 2E6UX 1F0YA 2C5AA 4HUJA 5AXDA 4R51A 2EKQA 2ZKLA 4BNFA 4GKBA 3L4BC 5G4LA 3RFVA 3K5PA 2YY7A 1CQJA 2YFQA 3D3EA 1AGNA 5K6AA 2OOSA 1T24A 1TA4A 4XIJA 4OHUA 1SEVA 2B4QA 4FFPA 1NQ5A 3PWSA 1ISMA 3PDJA 5BNFA 4FCCA 3W8DA 1X13A 1ENPA 2HJRA 4UAGA 3NT2A 1ZJZA 1NHWA 4OIMA 2OMEA 3W6ZA 1DC6A 4MOWA 1JAXA 1HDCA 1JU9A 5JPIA 4B4UA 5GZ1A 3INGA 3C1AA 2GDZA 2RCYA 2FRDA 4LVCA 1J6UA 3ONDA 2EIHA 4UUNA 3GLQA 5COQA 1I8TA 2FR1A 1NWCA 4XWYA 3EC7A 1YOVA 5HA5A 4NK4A 5KVCA 1PL7A 3LDHA 1ZSVA 3T4XA 1YQGA 3O4RA 4XYLA 1TI7A 4IJWA 4RF3A 5H82A 2I65A 5ITVA 5JDIC 1PIWA 3FR8A 1D1SA 4MIYA 4E2ZA 1ID1A 4P8RA 5TNXA 1CQIA 3I6QA 1U7HA 5KVVA 4YR9A 3DBRA 3IDSA 3UUWA 4YB8A 3JQ8A 1LDYA 4MVJF 4IDFA 1BXGA 4HFNA 5EN4A 4FOSA 3AOEC 1P3DA 2FR8A 4GX5A 5ICMA 1T2DA 3G1UA 3QSGA 1E77A 5A02A 4YAIA 1GCOA 2NVUB 4RVHA 4TMFA 4YACA 4A03A 3CH6A 3O26A 4XGIA 1VSUA 4CQMB 2VOEA 3WLEA 5L95A 1HDRA 3JD0A 2ZJ0A 1HSZA 2BF7A 3JYNA 4M55A 1MGOA 4ZQHA 5JSFA 5DOZA 1YDEA 5I7VA 2GZ3A 4ZICA 2FZEA 3F47A 1E6EA 2X86A 3SC6A 4E2XA 4M54A 1XU9A 2GERA 4LRSB 3GEDA 1PL6A 4J16A 3EK2A 3ZHBA 1DB3A 2X9VA 2GRAA 3PWZA 4J2OA 4N5MA 4FC6A 4Z3KA 4DPMA 3KLPX 1M6WA 4Y6RA 1N92A 2PNFA 1YOVB 1DAPA 1JKFA 2BGMA 3C3XA 4MJLA 4CUKA 1X0XA 3WGHA 1I32A 1R4MB 1PJQA 3FWZA 4DLLA 1NQOA 2O3UA 3EZLA 4GWKA 3RROA
chains in the Genus database with same CATH superfamily
2P69A 1ZGHA 5BWOA 1XQWA 5E4FA 5AOVA 1N6PA 4R2MA 4LNUA 1C4OA 2B2CA 1NMYA 5IZCA 1V2HE 3BXPA 3OPYI 4INOA 2FSFA 3EH1A 2J32A 2EC5A 4ZVQA 1DUIA 1HUQA 3DBRB 5JPCA 3GLFA 1R9NA 2Q50A 1AVTA 1MFZA 3AVVA 4B45A 3L7BA 2FPPB 1YHYA 2FZ4A 3IEVA 4YMSA 2GESA 2ZWVA 4ZU3A 4CT5A 2DPXA 1YDMA 4YRCA 1U2DC 4BFYA 5IJ0B 5CFPA 3NEJA 3D8TA 4TXNA 3LQ4A 3NASA 3ZV4A 3SPXA 2KW5A 1IQ0A 3Q40A 4IHAA 3IEKA 3UWPA 1WPGA 1YJBA 2FN7A 3WB2A 1XYYA 2A1IA 2ZAMA 3ILHA 2Z2IA 1KSHA 4HHEA 2GI4A 5JCPA 4YPOA 2O54A 4IJQA 1T3ZA 4I5IA 4F6RA 3HADA 3M6AA 5THKA 4KITB 1XEXB 4IVPA 1HMPA 4LXQA 3M7IA 3QVGB 4ZQEA 1LDNA 3E4CA 4EO4A 3PA8A 2V5VA 1LPPA 4A16A 1X14A 2BW0A 1AS3A 4QQNA 4BEWA 2PK3A 1FSPA 8ABPA 1Y9EA 2ZJ2A 2BFBB 2YYZA 3T9DA 3FPJA 4GOLD 2VYCA 4A4DA 3H5RA 1II8B 5FUWA 1RNLA 4BN0A 4MR8A 3MJEA 5JATA 2R87A 1H5QA 2AZ4A 3IBFA 4KLNA 1BVUA 3IV6A 4I9FA 3T3GA 1C9JA 3PCXA 3EW7A 3JVVA 3EFHA 3KLMX 1NULA 2DWQA 2JFVA 3WWOA 5TMBA 5CB0A 5IVKA 5K03A 2O5RA 1JQJC 1XXHA 2VHQA 4PINA 1IXSB 2IOQA 4FI3C 3KQHA 4W9NC 3QVMA 5A0TA 3LUCA 2FQ1A 2MR5A 2NYUA 1Y6QA 3Q12A 3ZU3A 4B84A 2AX4A 1DC5A 1KA9H 1JQLB 3MT9A 2GAJA 1NFRA 4V03A 3NEPX 3TCNA 4E5NA 4X62B 2YZGA 3KPWA 4NJEA 4PGMA 3I1IA 1P73A 1X3SA 4IICA 4C7KA 1Y5NA 4BNXA 5ICSA 3DOJA 1YR7A 2CVHA 1PUIA 3REFA 4P7KA 3FNEA 3SXJA 3VU0A 1GFWA 5GQSA 3MF4A 5B7PA 1NM5C 4Y7DA 4LDRA 1JIUA 2AEFA 3TL2A 1SC9A 2DUJA 4EJSB 1C0PA 3VKHA 1PGNA 4AQ7A 2VJCA 2WMYA 2YHIB 1Q2UA 2X8LA 3A36A 3JQ9A 2C1XA 3OAAA 1K06A 3JR3A 1MBZA 3IPRA 3PWTA 4YLGA 3RC2A 5JSUA 1LRJA 4CT0A 4V0MA 2W2OA 4BASA 3I2IA 1J42A 1HQCA 2I1LA 3R5TA 2BFOA 3CINA 3DONA 1KDYA 2C96A 2W2KB 2PGLA 3ENVA 1HZZA 1RM4A 1SD1A 4GOND 3EF3A 3L8MA 2ZT8A 3SEZA 1E7QA 3KB1A 3ILSA 1EEXB 1FX1A 3OHPA 5DT2A 1T4CA 1ZL2A 4FFNA 4G07A 5JJIA 5F5XA 1ZJ6A 2XMSA 1I51A 5CYGA 2G1KA 1G21A 1SN7A 3FDFA 3T3DA 1SHJA 2JLYA 5CXSA 4QLAA 1TPZA 2RBKA 2JW5A 3H65A 3M34A 3KD2A 5DH9A 3RSOA 2PQ6A 3P0RA 1KPGA 4CI0B 3B78A 2EEPA 5CFLA 3PQ8A 2CD7A 2V3VA 2R68A 2R6R1 4PN3A 5CDFE 3GEIA 1ZRSA 2JCXA 1C8KA 5IT5A 2V3CC 2ZJOA 2G72A 5DHFA 5H4GA 2DFPA 4AXBA 3P0FA 2IYUA 3BZUA 3DFZA 5TSDA 1NLMA 1EBUA 3V4LA 3ZVRA 4B9EA 5KC9A 3KXPA 2BTEA 4RNDB 4MR7B 5JS1A 2PQ2A 4M98A 1MJHA 2HIGA 3DNMA 1CUJA 1P75A 1Y1QA 2QM0A 4B73A 4L28A 5KYVA 3HZRA 4RMHA 5TMEA 1ODJA 1TQ8A 1ODIA 4N7BA 1DKLA 5D2CA 1TO1E 3QYFA 3HCCA 4YRFA 5PNTA 4E5DA 2A59A 4DG5A 3PJEA 1MENA 1Y6GA 1P72A 4Q93A 4QXRA 4UE2A 1GLVA 3FBTA 3IIJA 3IPLA 1O9GA 2PGOA 5BR8B 1M83A 5J1TB 1DCMA 3DTVD 1H2BA 4JB3A 4UU0A 5IC5A 2YW9A 5B4TA 3SJZA 3SK0A 1Z6GA 1NV8A 3ID6C 1E79D 1MNQA 1XZEA 2WKRA 4WD3A 4AF7A 1XKLA 1TM1E 1JKJA 2X0NA 3FHCB 4QXMA 1Z29A 3RJMA 4OX9Y 4DZRA 2TRSB 1UPFA 3GUUA 4GYYA 2VHZA 5FBRB 4FMCF 2P9EA 2KLHA 5K20A 2PA3A 5FBHA 3CX7A 1SKYE 1G21B 4JP1A 1VE9A 4FMCB 1H5NA 1E9CA 4C20A 2R66A 4Z0NA 3CKYA 2O2DA 2VK4A 4YRKA 5IAAA 4TZKA 5I8WA 3N6XA 1CTQA 1T1RA 2HBYA 2GPWA 3PGLA 4KYTA 5CLJA 4RHTA 2OY0A 3IAXA 3VC3A 1T0JB 3V55A 4Z0TA 4RFLA 3MA0A 2G76A 3OE1A 2IYWA 1MAVA 1FDUA 3HCBA 1Y5LA 4NE7A 2AQIA 4L78A 2Q2QA 4FZ5A 4MRMA 3G3EA 1VJDA 1QGED 1Z5ZA 4IRXA 4D46A 1RWKA 4A8JB 3N0XA 4FC7A 2B3TA 1VMDA 4GQBA 3U7IA 1NE2A 1Q5PA 1UWKA 4WESA 5BR7A 4GKJB 1ZD4A 3AM5A 1T9AA 2O1SA 3WK8A 2ZIUB 3DDSA 2F17A 4CLOB 4D6XA 3DEAA 3VHXB 4DR7B 4DVJA 5KYNA 1N6LA 2B4YA 3K0KA 3DEIA 2B5VA 2PG3A 5EWMB 2HBZA 3V97A 4RH0A 3GHHA 3ILXA 3OCVA 3ROKA 3FRHA 5FOWA 4EGSA 2O2EA 5A4DA 1U9YA 4NZPA 4YRNA 5F23A 1W581 5HG0A 2QQ5A 1FFCA 1QO9A 1DQSA 2ZIXB 4L27A 1XVLA 3ZS8A 1AC5A 3IB3A 4PQRA 3RAGA 3PS9A 1W7AA 4GUAA 1I0IA 1QR2A 4Q3CA 3NIWA 5M3BA 1AMNA 3UC9A 4OQLA 4EENA 3ZV5A 5CU7A 1F4VA 1FDWA 3OX1A 4MLPA 4YRTA 4BB5A 1HG1A 2L69A 3BWXA 4DHEA 1QONA 1UQRA 5LLSA 2YCLA 2FPIA 4RACA 4GLBA 4OSPA 1IN4A 1DWQA 2EVWX 2IIBA 3L40A 4PHCA 5L4NA 1YFLA 4GBGA 2IWRA 4JJ6A 2Y6UA 1T29A 3I8SA 4ECAA 1DO0A 3FG9A 1YCFA 1OROA 4BQQA 3EIWA 1P4HA 3CEAA 3GYGA 2UU9B 2DFNA 3PC3A 4ER3A 1YVEI 1C30B 1EM8A 1NY6A 1EK6A 3KTAB 3M6WA 4QULA 2FLVA 2EQAA 1FP7A 4PZDA 4TL7A 4LRYA 3GFBA 5CBPB 1ONBA 4P3XA 3ZS9A 4UNQA 1EE1A 1SK8A 1P0QA 1I13A 2EFGA 5HMMA 4YHHB 2MSCB 1T9GR 1AUOA 1EHYA 4M9QA 4QRHA 4F1KA 4KIUA 2VDOB 3DPUA 4FNGA 4HZUB 2WJJA 2YNMC 3HRKA 2GF0A 3V3KA 4ZT5A 4I55F 2WBLC 4B2LA 4D92A 1RWNA 4ND8B 4NG4A 3RS0A 3SKYA 3UCEA 4E4TA 3DXYA 3P9YA 4HDRA 4EY7A 2BH2A 1Z8DA 3GRKA 1BEZA 3EBOA 1QK3A 2IEIA 2BTQA 3F2IA 4RD1A 4YP9A 4KUGA 4HP8A 5KYYB 2XVAA 5ALPA 1R27A 3NALA 3PLAE 2Q5QA 4QHYA 5DBEX 4K88A 1G55A 4UVDA 1G8AA 1CJMA 1G7CA 4P93A 2OCXA 4U7DA 3WY9A 2ZETA 5FHRA 4FPXA 3P20A 3B2QA 3G02A 1N57A 3TJZA 3W7BA 1XE3A 3DKPA 4PPGA 2YKGA 4XJSA 4ZDIA 1Y6JA 2Y27A 2YJZA 3FPCA 2H3EA 4JD5A 4UFPA 1PWXA 1J24A 1N5RA 1E9FA 2F1KA 3GAMA 4G0XA 4OI4A 3TCKA 4BP8A 1EI9A 3LT4A 2FLWA 4R1PA 5HDQA 5HJ7A 3KHKA 4LMPA 1R88A 1KH3A 1V2GA 1Q0RA 4XWGA 4WL0A 1BJKA 4CTKA 1G8KA 4G24A 4R8VA 1RT9A 4M0FA 3U7EB 1DJLA 1ZINA 3VVBA 3PFNA 3BICA 5AHXA 1IUKA 1SZCA 1Z4NA 1ZO8A 3GBSA 4S05A 2M6SA 2QLJA 5BN5A 3CURA 4J3NA 1TOAA 2C9ZA 1P0FA 2J4DA 3HP7A 3D1LA 5TX7A 4N6NA 4NE2A 1H69A 4KV9A 5AKKA 1TX4B 1ZX1A 2QXYA 3AETB 4UDOA 5EJ6A 3ZU6A 3B1XA 5KKNB 1FUKA 2REQB 1CJVC 1TJ3A 2VA9A 3EVAA 2RHWA 3AIKA 3TR0A 5CBPA 1TZKA 1LH0A 1CY2A 1T1GA 2RIPA 4QICA 5EQTA 1SK9A 2H1RA 4B6RA 2VHVA 3GMTA 3ZBTA 3N2GB 1M2NA 2B6HA 3SX2A 4BV8A 4B8WA 1Q20A 1CZLA 3HCNA 4B6OA 3JQAD 4ARCA 3K1ZA 3RVRA 3W4KA 4AWBA 4TT3D 1D6NA 4OP2A 4F84A 4WQMA 2KYRA 1N2SA 5JEDA 2EWWA 4OQYA 2IZ0A 4OLJA 2XNCA 2ZEJA 1THTA 2Z0MA 3COPA 1YUNA 5FOQA 4RYLA 5IZ4A 2GB4A 3DL0A 3OOHA 4CEHA 5E6SA 4Q3NA 4NLLA 1RZUA 5KYYA 2H51A 4JP8A 1L7QA 2X0IA 3QV2A 4HVLA 2QLLA 4ZRMA 3UUGA 4YONB 1AIPA 1DU4A 3IODA 3MGBA 4KKVA 3CRW1 4CMKA 3KQVA 1E7YA 1UK8A 2ZAGA 1X86B 3PI6A 3H2SA 3QUTA 3PB3A 4B4OA 2XX3A 3HJFA 2DU8A 4IXDA 5JAIA 2GXUA 5EHXA 3KO8A 3URKA 5IHPA 1NQVA 3CSDA 1BX1A 4NBVA 3GFTA 1UPAA 4YLYA 2Y3IA 1SVKA 1CQXA 2O0LA 1HFKA 3U9TA 5HX7A 1MIOA 5JS2A 4M7RA 1CUWA 3KAJA 2MMGA 4FM9A 4J75A 3QXSA 2WPDD 3WLQA 3OSUA 3DBLA 4I55A 4K6CA 3R76A 1J2UA 3DTVB 1XZMA 1ZYUA 1F8FA 1G8JA 1KMHB 4JLKA 2R00A 4LTDA 4UMVA 3B38A 3OZEA 3S4YA 3SWWA 2YN2A 1YZYA 2X3UA 4AVYA 5L53A 4Y6SA 3ESCA 1JWAB 3KOUA 2GN4A 1JILA 4JBIA 5C2JB 3DZCA 2GJKA 4X45A 4DS3A 1R8QA 4LJ9A 3P2IA 4OMFG 1I3OA 3MWEA 3KQLA 1AHNA 2QSJA 3OKPA 4RH1A 1KOJA 1O4VA 2GPTA 2ZCVA 3BD7A 3PJGA 4UC0A 3RIMA 4NYIR 4OU4A 1M5TA 4LFBB 4H3VA 3FUXA 1J1IA 1Y42X 5ALJA 2OFFA 5IM4F 4R2HA 1Y37A 1ZK1A 3H5VA 4HLUC 2QNRA 4DLYA 4DV2B 3C8ZA 4C0QC 1Z9BA 2DFVA 2WWXA 1RYNA 1PF7E 4OB6A 4F1WA 2WIFA 3BZWA 2ZUEA 4PVCA 3CXUA 1W30A 5JH7A 4HDNB 2YVKA 1UL1X 2FN9A 3LY8A 2CCGA 2DWPA 5EXPA 1OUMA 1JDZA 3FNGA 4X24A 3CZQA 2RGGA 1LY1A 3K09A 1HDYA 1PD1A 4TRMA 2JIZD 3I01M 5T41A 4B87A 2DWOA 1G3IA 4L0DA 2X6QA 1PKXA 3VYVA 1V8OA 4Q66C 3HVIA 3RSZA 1GNVA 3KR2A 3H5IA 2C2WA 2QMZA 1R0LA 5JSHA 1ML4A 2EZ4A 2QMQA 1YZUA 3DFKA 4O4HA 3EXHC 4PZEA 3NTQA 2ZJBA 1AGRA 2CLEB 2PMFA 3EN0A 3E3OA 3PQ7A 4X63A 4UBOA 3TLAA 1XF9A 2RSLA 5F2OA 2ZFUA 1HL3A 1KYZA 1MC1A 4C6SA 4C2AA 2XVZA 2R6ZA 1H2YA 2ZE6A 4AYWA 4C21A 3I6MA 5KYXB 5DTRA 4B46A 3PQDA 4YAKA 3LU1A 3ADDA 4IBOA 4II2A 4XPZA 1MU0A 3GCWA 2XTNA 1G20E 2GKOA 3P2YA 2JGFA 2HIAA 2IVFA 4JDPA 4EY8A 1J9EA 3CLVA 3SZLA 2P5YA 5D3QA 1SOAA 1QYCA 4OOFA 1UM9A 1ZP6A 4MPTA 7YASA 2HA2A 1QYDA 1TFRA 2H7CA 1VJGA 3JAWB 3NHMA 5CVCA 3HR7A 3DTNA 7MDHA 4CXMA 5LQRA 2WA2A 2HK8A 3WYFA 3MWEB 1YE8A 1IQPA 4CF7A 2JCYA 4HN2A 3TRHA 3THRA 2N1BA 4CGZA 3C3AA 4MUFA 3ZWMA 5K01A 3VR4A 2W8BB 1W8DA 3RFTA 2A88A 4MIEA 2IYFA 3F9RA 2IYEA 4FZ3A 1W85B 4KN8A 5I4BA 2HMUA 1L3BA 2WAOA 3DVAA 2PSDA 2CZGA 4Z7OB 2FW1A 1WKVA 1A7JA 2K4MA 3GC6A 4XLLA 3RC3A 4MCIA 4ZV4A 4DLNA 3AJ9A 2AUMA 2IPOA 4WLNA 1VMEA 3D2LA 3TZLA 1GL7A 1N1DA 2BEWB 2O57A 4YT2A 4RESA 3ORQA 3EMBA 1I2CA 4I4TA 3A9TA 2X0DA 3QE3A 4KU4A 3ZIAA 5CEFA 2UUBB 4R01A 2OUIA 3AP3A 4B5KA 1NQTA 1MH1A 3RAJA 2C82A 3TFWA 5HCNA 3VZSA 3N74A 3SKXA 2AFVA 5DYYA 1A77A 1QSGA 2GPSA 3WHPA 1VLZA 3MNFA 2C84A 3RUPA 4F4JA 2W22A 1JDNA 5A3SA 2QY6A 2J08A 3MSCA 5F12A 1M54A 2NVUA 4U2GA 3FJYA 1G2PA 2FJUA 3KPYA 2FG7C 4PG6A 1A5AB 1B93A 1D1PA 2FMKA 3O2JA 3HCEA 2E4AA 3KQWA 4Z49A 2ANCA 4A3SA 3M6UA 4K3VA 1FZTA 3X1DA 1QIJA 1EINA 4G4IA 5L3ZA 5TV2A 1TJ4A 1XZJA 1I2DA 2AXEA 2Y4NA 3K6KA 5AKLA 4GPBA 3W5VA 5KTKA 3U49A 5ECDA 2BFEA 2CJXA 1Z0JA 2VPYA 5EE3A 3DLIA 4FR5A 4QFMA 1V1RA 3HACA 5BV1A 3B52X 4BQSA 3RGGA 3K70B 4FE3A 2BP7A 3TIGA 2FZ5A 2YDXA 3E9RA 1BKDR 1BW9A 1FOEB 3EUAA 3EX7C 2DXIA 1VHTA 3JQ9C 5TLSA 5EE0A 2O4CA 2YBDA 1KO4A 3K8ZA 3W8FA 1EWVA 2JFBA 3LP8A 4GP9A 4LX8A 1LC3A 3D59A 4DT1B 3W5DA 1EFKA 2HRQA 4WZAA 4CM9D 2VPXA 5TQJA 3L82B 3QEKA 1W29A 4AY5A 1PZXA 2IODA 3HB5X 5JG7A 5LU8A 2EOAA 1CX9B 5AR1A 3TUIC 4ZFNA 1LDBA 2VSQA 4ZT7A 2HBQA 3LBYA 10MHA 3DVAB 2BFFA 5HNKA 1ENZA 3CCFA 1EB8A 3OH8A 3JWHA 4ZI7B 2JCBA 4D82A 1R8SA 2EX4A 4EMUA 4RJTA 5JXJA 1UXJA 3H0CA 1ZNYA 2ZR8A 3BDAA 3QLVA 5CT4A 3ECCA 5FUVA 2JJ2D 4WK4B 4WBNF 5HKOA 4LQLA 1M8GA 2GZSA 3IX7A 1FUEA 1G8HA 1P4RA 2XA9A 5D5HA 2HU8A 4D45A 3AY0A 4KXFB 1Z4LA 2PD4A 4WKNA 1RXCA 2R48A 3FNIA 3LHKA 3VU3A 4K8RB 4PZLA 5KX5B 4KHPB 1YHZA 2Z4SA 2NPIA 5TE9A 3CWZA 1SHLA 1XKQA 2JFHA 1HGXA 1N0IA 5LPNA 3UMMA 1U3CA 3ETCA 3MVEA 3O3NB 3IKVA 3HN7A 1K0UA 4AS2A 4J76A 5BQFA 4OHVA 4JJZA 4AO8A 3FGNA 4NV3A 5DYNA 5JBIA 5KSOA 5B4UA 4AZ0A 5C4GB 1KS9A 3G2IA 1ESNA 4RHUA 2C9DA 4F2GA 3VSBA 1GTL1 3QITA 2CY0A 1PGQA 4EHAA 1P33A 1ESZA 3KBBA 2W83A 5A5GA 4L9AA 1V3TA 1WHSB 2WOOA 3K1TA 5ER9A 3UV6A 2OORA 4OHCA 1ZRNA 1DIBA 1H6BA 2H57A 4QYSA 4BEVA 5K6RA 3T5PA 1J21A 1D6SA 1CS4C 1QPGA 2JVKA 4PX3A 2CDBA 3I3OA 3HCPA 3SVZA 2CFRA 4DV0B 2TMKA 1GT6A 2PSJA 2Y1CA 2AEJA 3LCJA 4EKIA 3AHCA 2XB9A 2C8KA 2P6NA 4XEUA 5I7FA 1X15A 3AEKB 4HAUA 2HQOA 3EIQA 1PJBA 4KJZA 1BXRB 2NSHA 1ZHFA 3SAJA 2DF8A 1XUOA 2Q1UA 3IEPA 1Y82A 3CO5A 3EDRA 2RHHA 3T1TA 2OFWA 3CLHA 3V4OA 1D4ZA 3C74A 2CUTA 5LFAA 5ALQA 4AJ2A 1EP3B 1MVNA 4HB3A 4ALMA 2JI9A 2BE7A 3V8RA 2PQ0A 4KQFA 5AIBA 1L3IA 3ZWOA 1YB7A 2JD2A 4L2IA 4R41A 5JZ9A 3K35A 1FU8A 3NOOA 3OURA 4IJKA 1X7XA 4RJIA 4KGDA 4ZCMA 3EQ7A 1WKBA 3O21A 3DZGA 3Q3HA 4IZOA 5FTWA 3VMMA 3WDKA 4RTSA 3U31A 2FMIA 3NRCA 1BYIA 4Q3DA 4EH1A 1UC9A 2P77A 4YYZA 3HQ4O 2IF0A 4EEXA 4UULA 4HEA6 1IXZA 4G65A 1A4RA 3O7WA 1ULBA 1RQXA 1FUYB 1VPEA 2H8GA 2X7JA 1NWHA 3C97A 4QBIA 2DH5A 4KJXA 5EIWA 5ABPA 3DAGA 3ZZNA 3CMMA 2R751 3ZWQA 4QDUA 1KVSA 3BQMB 3OM1A 4FTWA 2QN1A 4R6WA 5EY5B 5KI6A 1Q2XA 5DXAA 2ECOA 3CBQA 2FUNB 1Z5OA 2VSYA 1HH4A 1FTSA 2JHCA 2VTEA 2XT0A 3BWVA 1XHFA 3F5FA 1GRQA 1LPBB 1Y8CA 4KIWA 5I7OA 1N5LA 1LS1A 3VAAA 4F7DA 2VSNA 2RI0A 2WHEA 3MAAC 4EG6A 8AT1A 3QVTA 5A4KA 3ETLA 4LGCA 1LBEA 2ANBA 2X23A 2CBZA 4GOKA 1LTHR 1WZNA 5CHYA 1I1OA 4HK4A 3NXKA 4G2NA 1G3MA 2DQZA 3C45A 3NTXA 1K4KA 4HDMB 4PW0A 3QG1A 5DBGA 1FVOA 1XO1A 4J1NA 5LNK1 1ENYA 1VKHA 2Q6IA 2ID9A 2W00A 1DAOA 3MXTA 4H6PA 4FGWA 5EZYA 3UJ6A 4CBVA 4BKPA 4DWJA 7MHTA 2ZI7A 1QH8B 1SR8A 2VOJA 3A3NA 2IZ6A 3L92A 4FCTA 3QUBA 4UTOA 4Q4JA 6GPBA 3L77A 3A9CA 3K6JA 2JAWA 2QLBA 1Z45A 3IJRA 5JMWA 1MB3A 3BSYA 2CVOA 3O91A 3L0IB 4XOUA 3R7FA 1PJ3A 1Y3IA 3G5LA 4RZIA 3WHKA 1EGAA 3QPAA 1O97D 2Y8EA 1QF6A 4M49A 1KI3A 3S27A 4L2IB 4DZZA 3T5CA 1WKCA 4KRYA 4MGKR 4MCAA 3E1GA 3SDZA 4DSOA 1NBHA 1VIAA 5AFSA 4XASA 5AVUA 1ULUA 3B9BA 1X42A 1FDVA 3MYRA 1XEXA 3E0XA 2RHBA 3JYLA 3M5DA 1JR2A 4GI7A 1M5UA 1L4GA 4K2AA 1P9LA 2FHPA 3AF2A 4KVGA 4FU0A 3FNBA 3WZ2A 3A11A 1UBHS 1J7JA 3QIVA 1JP7A 4Q19A 1FQKA 2UUPA 3LFHA 1G17A 4L50A 2OBNA 1E7MA 2WZQA 4FSHA 4YQFA 3TBFA 4N5DA 3WSWA 5EP3A 1TZBA 2NTNA 2QTCA 1DIRA 1O5IA 3D4IA 3LECA 3OZBA 3Q9LA 4F38A 4RLHA 1WXWA 5JNUA 4N9WA 1O1YA 3DEJA 1L5SA 4P31A 1J22A 1MF7A 2VF4X 3V3TA 3WIEA 5KQLA 1P4SA 3UJDA 1SFRA 5HS6A 3G89A 1KI8A 4FWIB 4OXNA 1JPUA 4RPLA 4JLSA 2NP7A 1JFVA 4BO2A 4JOQA 3A9VA 3JQCA 5FUXA 2CYCA 4G0MA 4Y2GA 4QHTA 3R1IA 1JU3A 2JS7A 2QTZA 5IAJA 3THXB 4M6WA 2NSDA 4C1BA 2WB4A 2I1QA 4H27A 4BP9A 2JJQA 4M4SA 4CLXA 1UC4B 5EZYB 5KNCH 4G0VA 3W7AA 1EP9A 1IN5A 3N59A 2GFHA 1ZOLA 4KQ2A 1L4FA 2JAPA 1QGUB 2D74A 3H7IA 1A4XA 1NP7A 1C3XA 4W7HA 4CDMA 2ZSAA 3Q9NA 3WGYA 4C0KA 2OT3B 2WRZA 2PKQO 1PD0A 1YC2A 2ZRKA 2QW1A 7ABPA 2PBRA 1GPYA 1P7PA 1ZR2A 1Z5VA 3ZXXA 3C8HA 1QVRA 4ZGGA 4MPJA 1QHXA 3SFVA 1PSDA 2ODBA 4GICA 1NLZA 4ROTA 2PUEA 4JXXA 4PX2A 1NGSA 3VR2D 3KUKA 1FMLA 3FGOA 2LVBA 4CKBB 2O8FB 1WDLA 1WY5A 4QGHA 1KFEB 5HIIA 5C3UA 4DN6A 5D5QA 3W5AA 1TYBE 4G0ZA 4GRDA 3WDMA 4UVEA 3TS1A 3IOMA 2YASA 4AYXA 4Q39A 4I4TF 1L3CA 3P4YA 3ABRB 3CN9A 4GNKA 3H3JA 2B25A 2IQ5A 3CPSA 1N3IA 4LKOA 4R1MA 5J2TF 1NVVR 3AB3A 2JARA 5K8VA 4DMUB 1JEQA 5AK3A 4OUDB 3UVEA 3TDKA 1ECCA 5CAEA 3MWYW 3JAKB 3A04A 4UCQA 2MMCA 1MNAA 5LQSA 4DCNA 4KQWA 5LDDC 3IEIA 1KZ7B 5EGSA 5FLKA 2ZRHA 3EHDA 3OZXA 2Q1XA 4DQXA 4ZAGA 2Z6VA 2ZWIA 3L6RA 5CFZA 4WOBA 1TLTA 4YDHB 3HL4A 3VO1A 2EWVA 2GZDA 2HSWA 1PR4A 3FGZA 2HRRA 4RLFA 4UHHA 4F4DA 5EHIA 3U4GA 4Q4LA 4B35A 3ZHQA 3G0HA 3CIOA 3CVYA 4FYJA 2ZPAA 3FCXA 4K6GA 4X92A 1S8FA 4YPFA 1HR0B 5JWOA 3B7WA 1ZN2A 4YT8A 1QQBA 3OQJA 5LZ7A 1NW5A 5DBOA 2Z5VA 4KIJA 1HURA 3GLFB 3DBIA 4KYUA 3DBVO 1NJ1A 2H08A 4IXMA 4OF4A 5AIAA 5FPPA 1DBVO 1FDOA 4OBWA 3MWLA 3JD3A 4UBJA 2NV2B 2CHEA 1YVUA 4HGNA 3B3AA 4JSRA 4FDLA 2H85A 3D6VA 4B83A 1P7CA 3QE0A 4QLBA 5DFAA 2O2ZA 2XUAA 1LBQA 2P9JA 4QTXA 4FS3A 3OTHA 4NH4A 4RQUA 1PU2A 1ZH2A 3M3PA 4YEDA 5KAMA 3W4IA 1NLYA 3QV1A 4WIAA 1F48A 2WV9A 3KQNA 5J2UB 4H7HA 1WPRA 5HM6A 3CNHA 3MMXA 3O75A 3N76A 4D9CA 4F3TA 1P0PA 2GJAA 4YTEA 5BO5A 1JT2A 1FBNA 3B8EA 1O97C 4EW1A 1PQPA 3ZHUA 3LSTA 1NW3A 2BONA 1ZW6A 3C8MA 1SQFA 3NVAA 3PXGA 4TTAA 5IKMA 1GLNA 1M1UA 4N3BA 5ITZB 2A1TS 1YR1A 3I53A 2GKSA 4G97A 4H18A 4OQQA 3AI7A 4K1XA 1KDVA 3FAZA 2JFYA 5E4TA 3RT7A 1EZZA 2VDNB 1KYVA 2H06A 3FFBA 4ONEA 4QFDA 4JYCA 1U2SA 4RSRA 3DOFA 1LD3A 5EJEA 3NANA 3BFPA 3TTXA 5IX8A 2DHCA 3EWAA 3OT1B 2GTPA 1WB6A 1Z0DA 2ZS9A 2COUA 1DEXA 4PG7A 5KTNA 1NI5A 1TF5A 1XRNA 1Y9DA 1QC5A 2QAGB 2Q6KA 2A9QA 2CDCA 3QMMA 4IRMA 3KXDA 3D2BA 4K9MA 1P5RA 5HILA 2ZBDA 4MYCA 5ENZA 5KDLA 2HSJA 3O9ZA 4EKNB 1KQFA 5ED4A 3VC1A 3MRSA 5KVQA 5AHRA 1UXGA 3P0EA 3FUTA 5JSKA 4KQGA 5IK2D 5HIAA 2Q5LA 4J6FA 2PBZA 1EUDB 2J3HA 5DHUA 4XUDA 3BE8A 1HZJA 5C1DA 4O29A 1JA1A 3ACDA 4WXPA 3CUYA 4L8LA 1O5TA 3E61A 2EV9A 1RJ9A 1XRSB 4EUKA 2J3JA 2Q5CA 3T35A 2J7PD 2VLIA 4AMGA 4RK0A 3SIPA 5A0FA 4E46A 2I7TA 2QYSA 3OJEA 3BXZA 4YMVA 2EQ5A 1MJFA 3MGGA 4AZ3A 4MRRA 1E62A 3F71A 5I9BA 3SGLA 4YWHA 3F49S 3PPYA 5AVQA 1XX6A 4U9UA 2AXNA 1Q16A 3CSUA 5D01A 5HZGA 1KP3A 3UKJA 2A3RA 2W2KA 2GM9A 3M1LA 4TTSA 5JT1A 2JI6A 3JQFA 2EDAA 3NX4A 5ALFA 1DFGA 1FK8A 1SCUB 4JUIA 4ITVA 3FKJA 2DPMA 1J2EA 1K66A 2F43A 2QT0A 3HV2A 3NNSA 3Q6MA 4MUHA 4QSMA 1WNTA 2LUOA 2ZB8A 3KLNA 4CMAA 5LQAA 3E03A 1KFJB 1MA0A 1SZDA 3GDFA 3IXMA 3D8NA 3EVGA 3U2QA 3ZKWA 1NIPA 3GF4A 2I6TA 2FG6C 2YV2A 3FNFA 2E55A 2XB4A 4CF5A 5IHXA 2EKPA 1M1ZA 1NBEA 2GN1A 2I87A 5CVEA 4YCCA 1GAXA 3LO5A 3A9UA 1AV6A 4HH3C 2GF9A 2H0RA 4ZEMA 4YX9A 3VDXA 4C4XA 3I0MA 1O95C 1PYGA 3VDNB 5BYKA 1J1UA 5B1DA 1SJ9A 2W90A 2IHZA 2OUKA 4HAZA 4ZVVA 1CR4A 1JIIA 1NDUA 4H1TA 5DSTA 3UXEA 3VR6A 1FRNA 5CB8A 4AJHA 3QUAA 1ESMA 3JVDA 5H3LA 2E85A 3UIEA 4IOMA 3BRCA 4XLZA 4IZIA 5AJVB 3U7FB 4B85A 1K8YB 4ERNA 3L4BA 1Z6YA 3CB4A 4ZGWA 2IUYA 1AG9A 1ORDA 2WP8J 5ECGC 1XZQA 3I4LA 3U40A 1DGQA 2P78A 4J94A 3BRSA 5LR6A 3GDWA 5EC8A 1Q7CA 5E7MA 5IDQA 1KQPA 4MA0A 5IAKA 1WXEA 1A9YA 4MZXA 1TK2A 2FVXA 3E53A 3BT7A 3L9XA 1Y7LA 5ALLA 3V4SA 2ZS7A 3KSZO 1E9AA 3O4VA 2O23A 2ILVA 1ZSYA 4TVBA 3HPQA 5FOXA 1KY3A 3IKTA 4ARVA 3R74A 1XB2A 2GARA 4QGFA 4YRBA 4Z7JA 1ZW1A 1L5VA 3VV2A 1E5LA 3LWBA 3OD1A 1S3IA 1JPNA 4RSHA 3UENA 4UHDA 3LY9A 2EZTA 1W5EA 3C6ZA 3RRMA 1QX3A 3Q7QA 3LUFA 2QL6A 4I8DA 1QUEA 3PX7A 1WUHS 1JFSA 2P9GA 1GTMA 3Q10A 4FOOA 3WGIA 4X64B 5F51A 2WJZB 4A26A 2OYRA 4CKXA 1NQXA 4EHDA 4D4GA 2QBYB 1XAIA 2BGKA 1PZHA 2VNHA 3UA4A 4MJ7A 1QKJA 1AKQA 4CYMA 3TOXA 1ISGA 3D0RA 4M7PA 4C0SA 2YIDA 3GVXA 4PY2A 1YCGA 3TIVA 4TXLA 5HR5A 4D56A 4MV0A 1Z2AA 1ECBA 1SGWA 3R7NA 1K98A 4K6KA 3W9UA 1SVWA 3N70A 2PO5A 2Y77A 1F17A 3JQAA 4LNHA 1HA3A 1EP1B 3I9LA 4EKYA 5BUCA 2NGRA 3TJMA 3TNDA 4N6GA 5A04A 3MS7A 4JVLA 4L76A 3BTOA 3MFYA 4DCUA 4HADA 4I5GA 1VBMA 1ZKMA 1EU1A 5E3JA 2CDNA 4YWJA 3TOSA 3WYDA 4RPGA 5LOVA 1IUOA 2AFIA 2YY5A 1OFTA 3OOWA 5IUKC 1G6OA 3VOSA 4WBNA 4GOJA 4RHFA 3P4UA 2VJMA 1CJTC 3OPXA 4CEHB 5AM3A 1OZAA 5WRFA 1IXRC 4BO6A 1F8UA 2Y0BA 2H2HA 3T0FA 1DJQA 4ARSA 1S02A 5DI9A 1YA4A 4ARZA 1D2RA 2YBEA 3NHZA 4UCFA 3AFNA 3SBEA 4F0JA 3GPLA 5EPEA 4QEZA 1NYTA 3BMNB 4HPJB 3I5YA 3B48A 2YHBA 3JV7A 1EK1A 1NF8A 4LZAA 2PPLA 1Y8RA 1BOOA 4INZA 4H7IA 1M3SA 3CIFA 3SS8A 1FFDA 3H2JA 4ZZ2A 2AOUA 3AW9A 1THMA 4B3HA 3UMFA 5JCJA 2JAUA 2O2YA 3O74A 4TOIA 4XM0A 3LF2A 5DM60 3DBLB 2DQKA 2Q62A 4CKCA 3DV0B 3RQSA 1IN8A 2PH7A 1NF3A 5A5EA 2V1XA 1C30A 3MOGA 1P91A 2JLZA 5I9MA 3DHEA 5FAKA 4B2IA 1TYEB 1C50A 2XADA 4J0QA 1BMFA 4LXXA 2INGX 3GI1A 3GJQA 2GEKA 1FDIA 2IA5A 2BEUA 3B6KA 3PFIA 2B30A 5HMLA 2XNDA 4CHGA 4M0CA 4GL2A 1NG1A 2EW2A 2RGDA 2WFAA 2QE7D 3OCWA 2GM3A 4GR4A 1XZLA 2CNWD 4J90A 4Q3OA 3T06B 1CRPA 2PT5A 3OPYB 4XUGB 3CNEA 3D7SA 4MUBA 4D9EA 4P3PA 5BR1A 4LV5B 3DMNA 4XGQA 3GLUA 1LTQA 2EIXA 5DNUA 3L0ZA 5BWCA 3HBJA 4EB8A 2GPJA 2Z8YA 2E87A 3MFQA 4UOEA 1CRLA 1KQ3A 3C8DA 5FA8A 3DMRA 2C9CA 4TMTA 2IHBA 1ZOOA 2QL9A 4H4DA 1XTKA 2WYWA 4U9IS 4XEHA 3SFTA 3P32A 1N8NA 2JDIA 3MMPA 5JAHA 1U0RA 1Z6PA 3EBPA 1JBQA 1X1BA 3KOZA 1KI7A 3NOQA 1OU0A 3B89A 1WCWA 4JFAA 4ZHSA 4GMGA 2AYYA 1NNI1 4LISA 2A9JA 2NZXA 2IYPA 3M33A 1GQOA 1KYXA 3TQOA 4E7PA 3IQZA 4K0RA 3MAJA 3I73A 1DAGA 4JLJA 5AXBA 4FGZA 3RHZA 2ZI9A 4V1CA 3B7PA 5CFQA 1XD2A 4BRUA 4KFTA 1XVTA 2QD5A 3EXG2 4DARA 2IDJA 2UXBB 3LBAA 3CLKA 1NJ6A 2AOUB 4NDAA 3GRUA 1N9GB 1D6JA 3A1SA 1WUJS 2JHGA 2OZPA 4BIMA 1NP3A 5ADWA 1UK7A 1ZH6A 2HLPA 2WF9A 2YY6A 4LJ8A 4BU1A 1UFKA 3HDJA 4UBKA 4UTNA 3TPCA 3HXMA 3ZTWA 5EVJA 5BN5B 2GMWA 1OHHA 4GW3A 2FWRA 2RGUA 3LUDA 1IY9A 4H77A 4HPWA 4MWGA 5E7QA 4V0OA 4B47A 4ZI7F 3SZ3A 2PQMA 2EAUA 3DJYA 1KL7A 3UK7A 3JAWA 4E07A 5B1YA 5BSHA 4JENA 3E8XA 1NFFA 4BUZA 3KAKA 2REQA 1HYEA 1SCQA 1MJGM 3GMSA 1TYAE 4Y0VA 1OC2A 5IG2A 2ZRQA 3D6AA 3AJDA 4RADA 4Z1MD 1L8XA 3HKCB 5IKEA 1ZONA 2ACEA 2GCNA 5JD6A 2WTUA 1VPDA 3Q4GA 4NNPA 3LX6A 2G07A 1MT3A 2GCIA 3JZDA 3I6BA 4Z1MA 5JCXA 3PQ4A 4YIKA 3S68A 1N3LA 2Q0XA 2Q46A 3H9EO 2H1WA 4ZAVA 4R9UC 4YYEA 2DTXA 3KEOA 3AUJB 3MTIA 4AUMA 4F3NA 1JFTA 4ZP1A 3H1TA 4BVGA 1EVEA 4JC5A 2Z83A 4F2PA 1Y1PA 2E3JA 4PYQA 1RIFA 2PEYA 3K94A 2ZSIA 1XCPA 4Z9BA 5E8JA 4YRMA 4RENA 4GS5A 3B9PA 5IU6A 1C0EA 4UMEA 5E6SB 4JX9A 3K1JA 4G1VA 3DF7A 3L7AA 4HAOA 4C14A 4QOFA 1U1FA 5EIEA 1OKKD 3D5EA 3ZI7A 4C78A 3E22A 4GBJA 1LUAA 2AOTA 3NG1A 4GEKA 2JB9A 1AXEA 3HB4X 4IINA 4W5WA 3ED5A 5EKDA 5CT8A 4GYKA 3HRIA 1VLHA 5KJCA 5AT1A 4K9DA 1YB2A 2X7HA 4GX1A 5B7QA 4W5OA 3QXHA 1B8OA 1NXWA 1TUEA 4CM4B 1EP2B 1P7ZA 1POWA 1GQYA 4PONA 1E6MA 1Y1KE 3LXMA 3PVCA 4IIVA 4RQTA 1FYVA 5IN4A 4IOJA 3VR4D 1OTHA 2FMHA 1F8YA 5BW4A 4TYNA 4CMCA 2OOKA 1GQRA 4GDFA 3A6HA 5AOCA 1QHHA 4RHXA 3DTVA 3EIFA 4YMTA 1F0KA 2E9SA 4RPIA 1KMHA 1Q17A 4BBAA 2VP2A 2QT1A 1LI7A 3SR0A 4CKEB 1OZFA 3W3AH 4ENRA 5KINB 4I3FA 1RZRA 3CNOA 3S8YA 5C53B 1GRCA 1XA4A 2AH5A 3OEEA 2PX4A 4KREA 2DUWA 4S12A 2ODTX 3ZW7A 3BXEA 4ZV7A 4US2R 5D87A 3Q88A 3ZXSA 4R1QA 2WSYB 5JS8A 1J4AA 1C2TA 4YRRA 3AILA 2P4UA 3ICPA 1CNMA 2Z1MA 1CRZA 1C7FA 5FDFA 2P6RA 1C7ZA 3VUEA 2WMDA 3FM9A 4RGYA 4KWHA 4KUEA 5FBKA 1ANKA 1B00A 5HK8A 1W96A 4BC0A 4RGVA 1K8XB 3HMKA 3P27A 1KXJA 4GC5A 3EF0A 2ZBGA 1NVWQ 4G1MB 5FO0A 3DAHA 2GBCA 4CL0A 4GSKA 3DKKA 3J7AC 1VKJA 3HGTA 1F14A 1NUQA 3RBZA 1X1SA 1JXMA 3RS8A 1AMUA 3EMDA 5DEOA 2VT6A 4O3FA 1KK1A 1BZYA 3T1HB 1J8YF 3FRIA 3JALB 4RV9A 3OCYA 4TXJA 4JI4B 3UJ9A 1DLIA 3P2OA<