4BH8B

Crystal structure of germline antibody 36-65 in complex with peptide gdprpsyishll
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
222
structure length
218
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-ARS MURINE GERMLINE MONOCLONAL ANTIBODY 36-65
publication title Adjustable Locks and Flexible Keys: Plasticity of Epitope-Paratope Interactions in Germline Antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2013-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bh8B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bh8B02
1NDMA 1JFQH 3MBEB 3MOAL 5D70H 1U58A 3LDBB 4P5KA 4OQTH 1CIUA 4NGHH 2OS7A 3WXWL 1T04A 2X4NB 4B53A 1U8JA 3KJ4C 4LASH 5EWIH 2ZUQC 5I1HL 3K0WA 4FTVD 1C5BH 32C2B 4LCYA 2AGJL 5IOPB 2Z8WC 3MLYH 1ORQA 1KULA 1I1YB 2HG5B 4HUNB 4EN3A 1HI6B 2MHAA 5EBWB 2OXGA 3MRFA 1MCEA 4S1DC 4WNQA 2F54D 5D1XA 4ZAKA 1ORSB 1VFAA 4X7CC 1EERB 3HE7A 3MMEA 5IB1A 4JFEB 4U6VH 1KIPA 3C6LD 1L7TL 3HPJB 2ZOKA 1JCKA 5JMOC 1A6ZA 4KC3B 3BESR 2ICWB 2J5LB 3ARBD 1BFSA 4LEOB 1OGTA 1VFUA 4UTBL 3UYRH 5HHOE 1FC2D 1KCVL 1IC5L 2XNAB 2FO4A 1RJLA 1QRNA 4NFBA 2XWBA 3W2DL 2IPTH 1KC5L 1T4KA 5CINL 2HRPH 4UQ2B 3BPCB 2J4WH 3LKRA 3ZYZA 5E2UL 3FO9A 1MJJB 5B4MC 4HFWB 3VFTB 3ABZA 2ATKA 3NCBB 2ZPKL 1FNGA 5FHBH 3EO9H 4XCCL 5T1MA 5DURD 1KB5H 2X9YA 3WFCH 1AQKH 4X6DB 2EDXA 4XP5H 5L6YH 4XBEH 5T33H 1HCVA 3C60D 3PWLA 1NBVH 5F9OL 4ZNEA 3D0VB 3BN9C 5GGSY 3EYQD 3L3OB 4KJYA 3UDWC 5EC1B 3MUGB 4OZ4A 5DUPL 1I3UA 4I2XA 5HVHB 3VRIA 1YEEH 4HULB 4ODVH 3TN0A 1YPZA 1B90A 3SCMD 4E41A 1S7WB 3QA3B 4LCWA 4ALAL 2XKNA 4UT7H 2VLRB 5I1KH 4PJ7B 3MLUL 2IFFH 4DN4L 5FYJH 2DQIH 5EA0H 1WQVT 3NIDE 1T2QH 3W0WE 3T0EA 2R39A 5IR1A 1LNUA 1KYOJ 5IJKC 1TDQA 1MCSA 2X41A 3MV8B 5I1LB 1KPUA 2AQ1A 1DQJA 5IB5A 1MWAA 1UZ6F 2OBGA 2W38A 4J3VA 2NX5A 1DQLL 1OPGL 2VZ3A 2K1MA 1DJSA 4YGVB 4ONGL 1T7WA 1NQBA 1KF9B 5C0IA 3P2TA 5C08A 1F8TH 3UTPD 4LLVA 1OHQA 3IFNL 4JGUA 1RZJH 2VERN 5MEOB 4RA0C 3O4LA 1S7TB 1MQKH 5GRYA 2X40A 5F7EH 4KROC 2EIZA 3C09B 4PGEB 4XVTH 2VDQL 5CAYB 1JN6A 3GSWA 1B0RA 2GFBB 3IDMB 2WQRA 4L8CA 1NKRA 3FONB 5C2UB 3FOLA 5DQ9B 1ONQB 5IKCA 5CIPH 5AUMB 4KJWD 4ODTH 5EZLB 3FQXB 5ICXA 4KWUA 3BP7A 4OB5H 4FFYH 5KN5A 2CLVA 1ZA3B 3RPKA 2VXUH 3GM8A 3SE3A 3MJ7B 4KTDH 1R3IH 4RFNB 1R6VA 2WNGA 1KPVB 3CSBA 4HMCA 4M3KB 4JM4L 4NKDB 3BP5A 5FGCB 4Y19B 5CWSB 2IPUG 3WFBL 1WFTA 1RK0B 3B9KD 4OAWA 3BKJH 3MV9D 4N9GB 5E6IB 1R5VB 3K2MC 1CT8B 2DQFB 3MA9L 4GW4A 4YXHH 1YNKL 4LEXL 1JPST 1WZKA 3RDTA 3DV6B 5KVGL 5BW7A 1DFBH 2VISA 1I4FA 5C0BA 5D7SH 5FCUL 2VSCA 3LS5L 5IEKA 3AXLB 3V7AE 4OZGB 1CBVH 4PJAE 3P30H 3PV7A 3VDCA 3RUGE 1J0YA 4RAVA 4WGWB 5C2BL 1F6LL 2EICA 5DHVB 4YQXL 5GZOC 4IMKA 3HC4L 4O2FB 3LKQA 4N1HB 1CR9H 4L5FL 2X4OA 3QIWC 3DROB 3LKOA 1KLUB 4X7TA 2GTZA 2O5XL 1H15B 3IXAB 3VXME 3WD5L 4JANB 2Y25A 3G04B 3GSRB 1JZ4A 5FEBA 2DTML 1N5AA 3TV3H 1YEIL 4KK5C 4NFCA 4X0KA 4ZUVB 1ADQH 3TNNA 5D1XC 4ZAKC 1RFDL 1LDPH 1EAPB 5KVDH 1K6QL 1WZMA 2H41A 1S8DA 3CUPA 3G6JB 3LEXA 3VCLB 3ME0A 4QF1A 3DI3B 4EI6A 3VXPA 5I0ZA 2YPVL 2X4QB 5GGQL 3WNLA 2E7LA 1DBML 1IC7L 4Z0BL 4F8TA 1JI2A 4KI5C 5EO9A 1P7QA 4JM2B 1OL0A 3WFZA 2VH5H 4KJPD 3O6LH 4YHLL 1XF3A 1HNGA 1U95A 2FR4B 1IAKB 4QRQB 4NQXB 4PP1D 3PF2A 3DVNB 2R1WB 4P2OD 3WIHL 1INDH 4WTZG 3IRZA 2BNQE 4FXGA 4WUUE 1PG7X 4WTXA 3X3FL 2F9BT 1HXMA 3PABB 1M05B 3TGXA 1A4KB 3U36A 1IAIH 1D6EA 3TJEH 3QCVH 4BFIA 2YZ1A 1XIWB 4I3RL 1GOHA 2QTEA 3U48A 5DDHB 4U6TA 2IPKA 3VXNA 1YEJH 3EGSA 3H3PL 4JQXC 5EIVA 1UJ3A 4FQCL 3MLTA 1OLZA 3MLRL 2ESVA 4Y2DD 4L4TB 5C0ND 3TN0C 5DD3L 5FO8A 1U8HA 3NBNA 1AH1A 1CL7H 4QNPF 1R5IA 3QRGL 2HVKB 5TE4L 4DZ8B 3I6GA 3RZWA 1YY8A 4WDIA 5ANMB 1Y0LA 3CVHL 2ICEB 1D5ZA 3T0EC 1KXTB 3LKPB 2Q8BH 4X6EA 3QFJB 3QUMB 4EBQL 1MAMH 3KDMB 4TRPH 2ZUXA 5FUZL 1BQSA 1XCQA 5DEFA 1QSED 5BJTA 1N8ZB 1NGPH 3CFKA 3HRPA 3DWTA 4DJMA 1NJ9A 3LEYH 3NTCL 1E4WL 1LO0H 2ZUWA 3NFSL 3DX8A 2XICA 1IEAB 4FQIH 5E8NA 2ORBL 4KI5E 1SJVA 4YBLC 3PWPB 4ONFH 4WW2A 3GMNA 4ODUA 1Y18B 3P11H 5HD8C 2GTWA 1V3JA 3EO1B 1IQDB 1QRNE 2NY1B 4HKXB 4HAGA 3SDDB 4QRSA 1XF4A 4PV9A 5GGVL 5CGMA 4X7EC 4XPBH 4O51B 4JO3H 4R3SB 3KPRB 3KXFB 2JJVA 3FQWB 3H9SA 1YMMD 3GJFK 1JZ7A 5BVPL 2HP4A 4YE4L 2KQMA 3KLHC 1TJGL 1BMGA 1HKFA 4JFXB 4K71B 4L3AA 3DRQA 1H0DB 4GRMB 3TLRA 1YC8A 2X6MA 4OGYL 4TNWF 5CJOH 5L2KE 5MI0B 4PP2A 4HWEL 4K9EL 1JWMB 5HPOA 3DSFL 2O61B 4ZNEE 1XCTA 4N0CC 1WJ3A 5BVJA 1D9KD 4QGTA 2NY6C 4ZUWA 4AEIH 3ZYJA 4I2XE 1LE5B 1YPZE 2H32H 4LAQH 4E41E 3GIVB 3QCTL 5DF0A 4PRHA 5LAXB 3RZCD 1KT2A 4NKMB 5C92A 4TVPL 2Z93A 3S3SA 2ICWI 2Y06H 4J3WA 3RDTC 1BF2A 1MLBB 3T0EE 1EXUB 3Q48A 4ENED 5BW7C 5KW9L 3G6AB 3DIFB 3EYVA 1L4IA 5DFWH 5BV7H 3LH2L 1QSFB 1R3LA 5DRNB 7CGTA 5ACMA 5ID1A 2VNCA 5D8JL 4MAYB 4Y5YA 3MNWB 4FS0A 5SX4H 1I7TA 2EE6A 2HT2C 2NX5E 4PJCF 5H37H 5TH2A 5CJ8A 4IMKC 4WW1A 4U1HB 4BQCA 5F70A 3V4PH 2WANA 5D4QA 1QQDA 2VKXA 1RIVL 3BN3B 4M93B 5CFHA 3PHSA 1ROWA 4D3CH 3LN4A 4J4PD 2BCKB 1VEOA 5C08E 1BLNB 2OL3B 5T1DH 4EUPG 3SDYH 1P4LB 4HIEA 2OJEB 4IIQC 3O4LE 1P4IH 1DUZA 2AEPL 3TH2T 1N6UA 3X13B 4M4PA 1N59B 4GG8A 2JK5B 5E08H 3RIFF 5T3ZD 2W07A 3Q6GL 2WZPD 1KIRB 4YXLL 4JRXD 1WLHA 5FYJU 5F7KC 2MQ3A 1MSPA 3ZDYE 2YD5A 1JK8A 1RVFH 4KDTA 5KSVA 3MRIB 5F7DB 4EDXB 3S5LG 1CVSC 3RPIA 4M7ZB 5C07B 4BZ1L 3BWAB 4P9HL 5B3JE 2F19H 4YHOL 1D6VH 2Q86B 2VN7A 5A2IH 3NGBC 3IJHA 3CMOL 3NIDF 4WI8A 4Z7OF 3IDNB 5L2JA 2VYRE 5IFJA 3ZO0A 1J9CT 3OKEA 4YHIA 3RWCA 2IANB 3WDIA 2XN9B 1BP3B 3O3EB 4P23D 4QHKI 4RAUA 4X5WA 4HS6B 3QUKA 4W6YB 5CZKA 5D7IE 3UTSA 1D5MA 3CGTA 1FDLL 3QDMA 4YFLF 4KKAD 3GSVA 1PG7W 1XGPB 5I2IB 2H26B 1OAZL 3ZHKA 4HUWA 2A38A 1BD2B 5C8JA 5EDXA 5HYIA 2H9GA 2Y1VA 5C0BE 2V7HB 1TJIL 4HQQH 1X7QA 2R2BA 4U6YB 1ZT1B 4NNYB 2CJUL 5IFHL 2DI7A 4HKBA 1UJ3C 3DRTA 3LN9A 1T1ZA 3OKYA 1FNSL 5HHXH 4L29B 4RNRA 1NGWA 2XZCL 3W39B 1QLRA 3ARWA 1MFAH 3FN9A 3VDBA 5EBMB 3S4SA 2YMXL 3CZFB 3FT2A 5ICYB 1KG0B 2NLJA 4Y0GA 2YN5A 1L7IL 2J88H 2HJFA 1NC2A 1ZLWH 1GGIL 3KPTA 5FDYA 3CSYB 1TXKA 2PTVA 3HMWH 4QT5A 1QNZL 2QV2A 5I66A 4KMQA 1PKQE 1UEMA 4JPIA 2R2EA 2P8LA 4XP6H 1L9MA 1A7NL 2IFGA 1F3RB 1MI5A 1G6RL 3IDYB 5IB3A 5F44A 1G7QA 3GMQA 4X5LA 1RZIA 4PJDA 4X4MA 3MJ9L 1J86A 3WIHA 3SE9L 3EOAB 5EB9A 2AJUH 5BV7B 5JDSA 3RL2B 4KUZL 3KWWA 5I16A 3FQTA 4WW2C 4R0LC 5CP3H 3RWJB 4Q6IA 1ZT4A 4F7PA 4HIXL 3GB7A 3WSQL 5IBUB 4OLWL 2VDOH 4MWFA 1BJ1J 5I1JH 1FZKB 4PJAF 4OZFA 2NY2D 3FFCA 3U1SL 1EUTA 3C5SA 1GC1H 1CFNB 1HH6B 3I6KB 3GIZL 3P9MA 4N1CA 5HYSB 2E8ZA 4HJGB 2IADA 5ILTH 3MRQB 3IXTB 3BGFB 4Y4FB 1FLTX 1XGRB 2DD8H 3EOTL 2AK1L 1NCNA 5C0AB 3BRDA 4YHNA 3GUTA 3CVHA 4M7LL 2X4SB 1GZQB 5C7XH 4DGYH 2R0KH 1I1FB 4RGNB 5DI8A 1U36A 4MNGB 1QLEL 1G0XA 1N7ML 2H6PA 1WWAX 3VFNB 5CD5D 2A6KB 4OCWH 3PWVA 4PRNB 4XCYA 5FO7A 1PVHA 3M07A 3WLWC 1DQDH 3WO4B 2Q1EA 1DVFB 4S10A 5EO1A 3LZFH 1OM3L 2CH8A 1CCZA 2H1PH 4OFIA 1MPAH 5F3HB 3L9RB 4KGJA 3VMPA 1R24B 5JOFA 4L4VA 1I3GH 5K9JL 3LN5B 1MY7A 1LO3L 1JNNL 1PG7H 1K4CA 4Y5YC 5ELIA 1DBAH 1J0KA 1Q0YH 5JPNB 2BVQB 3FN0L 4PJEA 5E03A 3RX5A 3OKOA 1I8MB 1XGQA 3P0YL 2FGWH 3HE6A 1WFOA 3VXSA 5DMIL 3HS0A 5KSUA 4E9LA 1WFUA 4U1MA 1S7XB 5J4MA 5HHNB 4NKIH 4MHHI 2ADIA 5GHWH 3SY0B 1HHGA 3VGDA 3FB7B 2O26U 4WFEE 3BZEB 5J9PB 3BPLC 4U0QB 4M1DH 1AXIB 5CKGA 4LCCA 3PXHA 4DUXA 1C12B 5CLTA 4Q2ZA 3H9SE 1M7IA 2UVFA 1IGCL 4KDTC 3D69A 3WNMA 3QQ4B 2FSEB 3T2OA 4H26A 5C0GA 2OLDA 1FFPB 5TE7H 3MYJA 3W11C 2DN7A 4U3CA 4WHCA 1Q9OB 4GKNA 3WXVL 5CP7B 5EZJB 5F6IB 3L3IA 1MHHB 3OHXB 2XFXA 4YFEA 4UILH 4ZFOL 4H0IA 1A1OA 4UB0L 3GRWH 2DL9A 2YA0A 4C83B 1G7JA 3MV7A 3KLDA 4PRHE 4KKCC 3BUTA 5GGVY 3TT3H 5T1KB 5DYOA 1HH9A 1LO2L 5SWSA 5BS0A 5CSZA 1YN6B 1WSST 4RIRB 3EOBB 3O3AA 2GJ6D 1S9WA 3MLVH 4KI5F 1XR9B 5E4IA 3UYOD 2P24A 5DR5H 3B83A 2FBOJ 2R4SL 2JIXD 1B4RA 4PJFF 4PJ9B 1FAIL 3RTQA 5F72S 5DJCA 2EH8L 3SGKA 3UTTD 4PJBB 2CKNA 3P77A 1X5JA 3VRJB 1U3HD 2QHLA 4PYGA 4FQQB 3D9AL 2BY3A 1FL6B 3ES6A 5D71H 3GHBH 1N6VA 1X6LA 3O3UN 1HIMH 3QJFA 4WHTB 4NC0B 1BFVH 5I1IL 2AEQH 5A1AA 4JFDD 5M94B 4XBPB 1SJHA 5EO0A 5ITFA 3QFDB 4MX7B 4JY5L 5I30H 3NIFF 4RFOL 4DWHA 2APWA 5IIEA 1YPZF 3TO2A 2YK1H 4KK8D 2OMBA 3O2DL 3T65A 1MCFA 3OKKB 1SJXA 2YD8A 4JB9L 5BOPA 5FECB 2B0SL 4AH2B 1B3JA 4Z7UA 3PL6B 4JDTL 4NZJA 5I18H 4N68A 3W9EA 2NW2A 4Q6IC 2YD2A 3PWNA 1KJ3L 2HT3C 5FA4A 3RA7H 3DO7A 1T0MB 4FQXA 4NRXA 1T83A 3UZEA 2BJML 3UTSE 4HXBL 5INCA 4MD4B 2HH0L 5KOVC 3L3KA 1EO8H 5I8EB 4EJ1C 3M1BA 4K8RD 1NPUA 4RGMB 3WHXB 1A6WL 1Q9LA 4KRMB 3O6FB 1Q94B 1WEJH 4FRWA 4I77H 1YEKH 4WRLA 3ROOA 2ENSA 1MY5A 2NXYB 3WCYA 1WIOA 3TC9A 3FB8B 4HT1L 3MBXH 1J5OL 3EYFA 2BC4B 2VDLL 1G6RA 1X5IA 2GY7B 5E94B 2D7TL 5DK2A 4YJZL 1W0VB 1F4WL 3MJ9A 1KBGH 1JRHL 4Q0XL 1WZ1L 4RMUA 1YDPB 3HFML 1PJ9A 5JXAH 3HUJB 3DETC 4U05A 4ZUTB 4XPTL 4FABL 1FZMB 1NCDH 4HMDA 3JWOC 1VEMA 1JGUH 2PO6A 2D03H 4HFUL 1J88A 3HG1E 4PJDE 2EYRB 4X4ME 1HXYA 4HH9A 1SVZA 3U83A 3TVMB 1UB6B 4EI5B 2VWEC 5INDA 3V6ZA 3QNYB 1KCKA 4JN1L 1J0HA 3HE6C 3KJ4B 4DGVL 1G1CA 2ZUQB 1UG9A 4P3CL 1Y6KR 1MH5A 2BY2A 4GS7B 3U2SA 4ZDHA 2X89A 5IB2B 3KYAA 2FYYA 5F1NA 3ARDA 3QBTB 1TMCB 3FFCE 4Q6YA 4U6HA 5FUOH 3IDIA 4LCCC 4XNYH 3D3VA 3ZKXB 3VD3A 3S9DB 2VAAB 5KZCD 1SM3H 4NO3A 1YYMH 1N3NA 3RWEB 4LIQE 4FMFA 2GW5A 3S4SG 5E8PA 4KQ4L 4LARH 2XXMB 2YPLA 3DHJA 3B6SA 5GGRA 4PB9H 1OAXL 3ALWA 5DO2D 4LSTH 2G9HA 1XGUB 1T21B 3GDBA 3SDAD 3OJVC 1MREH 3GZKA 4POYA 4L4TD 1WK0A 1IEHA 3GFUA 1RZKH 1U8KA 1W2KT 2H3NA 2PYFA 2YC1A 4RRPG 3IJYB 4HJJH 1I3VA 1MELA 2V5MA 4EDWH 2CRYA 3LKNB 3H0TA 1E6JH 2DI8A 1NCAH 4YX2H 4YFDB 3NCEB 1EJ6A 2Q3ZA 4JY4B 3ARTA 3VMNA 4JREC 1ZWIA 4L8BB 4OBSA 4L4VE 3MRPA 1SYVB 1BFOB 3HI1A 3IF1B 1I9IL 4KPHL 1QG3A 2WINB 5LVEA 3BRGC 4HF5L 3ZTJG 4NBYB 1DE4B 2GEEA 1RJYA 1DDHB 1MRDH 5IF0B 4MGXA 4UDUA 2VB5A 3SGKC 1I8KB 3WV0A 2ILLA 2LV4A 2VWEE 4K07A 1BOYA 4PJEE 3IS0X 3SJVD 3VXSE 4D8PA 1JF1B 4G9FD 4F58L 4U1GC 2A73B 4C4KT 5F6HJ 1TCRA 2GITB 3TO4A 4JPWL 3HR6A 5GGRY 1KELH 4CU8A 4Q9QH 3SKNA 2VLMD 1CFTA 4ETYA 3OX8B 1ZSDA 3VWJA 1EH9A 4PGDA 4U2ZA 5GGTL 3RUGB 3G08B 3RY4A 4Z7WB 2VLLA 3OZ9L 4OCSH 1JGEB 4OGAD 3GMOB 4D0CA 1LEKB 3FFDA 3VXRD 4ZFOA 5I1AB 1H8OA 1IGIL 1E28B 1H3PL 1YECL 3QEGH 3O8XD 4POZD 1CG9B 2CLRA 1F3JA 4MAUH 1X4XA 4XCNB 4IOIA 3BP4A 1AHWB 3RHWK 4TVPE 2YBRA 2ZSWA 5DVKA 4I13B 1KCSL 1NLDH 2BNRD 4JHWH 4G8EB 2AV7A 1I85A 1VPOL 4XPAH 2DLGA 1NUFA 2V17L 3LPWA 4MXWH 3H9HB 1S3KL 3MV7E 1T83C 2WWMD 1NAML 5D1ZA 1AD9B 3U30C 4X4ZA 5GS1C 8FABB 5SWSE 4X7FC 5BS0E 1IM9D 4P4KB 2R29L 3U82B 4YDLC 4G6KH 1HOCA 2CQVA 3ULUL 3VD9A 1MCKA 2X4TA 2XTJC 3EHBC 1RMFH 1QEWA 5T1LD 4X5XB 1A64A 1PGRB 3BH9B 4WW2F 4RMQA 3SOBH 4IMLA 1C8PA 4F9PC 3S34H 1QO3A 3KNBB 3BD5A 2G75B 5JA8B 2WUBL 3Q3GB 4JY6B 3X3GH 2DLTA 1KCUH 2YKLL 4MA8H 2G60H 3QCUL 4WUUB 1J8HD 3TBYB 3C5JA 2LAGB 4ZO9A 4R97B 5KTEH 5IGXH 1WBXA 1MFCL 3OXRB 4FQ1L 4EEEA 1JGLL 2CDEA 2APVA 4TSAL 2BFVL 1MWAH 5EN2B 5MEQA 3V0WL 3O2DA 1T0NB 2PTUA 4OUUB 1JHTB 4GG6E 2YXMA 2B2XH 4S0SD 5BZWA 1TPXB 9CGTA 4EQ2A 4AYFA 4LLUA 2EXWD 2PO6C 4PJGE 3GBMH 1P7KA 3I02A 1NDMB 4Z76A 1D5BA 4MQXC 5IW6B 3QIWB 5C07D 2F54A 4GW5B 1UM6H 4XB7A 5DRWA 5E5MB 4ELMA 4KMTH 4Z7UE 3FO1A 1I8IB 1AE6L 4Z77B 3D2UB 4PRIA 3QB7C 5JOPD 3GSXB 3C2AH 5GGSB 4HZAA 4JZJA 2VDML 4UTAL 2W9DL 3ARDC 1IQWL 1A0QH 5BRZB 1UQSB 3MMEB 1C16A 4I0PC 2AQ3A 2P5EB 2CGRH 5DC0A 1HHKB 3F5WB 4HGKC 4M61A 4DUWA 1XF1A 2ZOKB 1BD2D 3MJ8B 2XTJE 4JFHE 4QO1A 3RIAK 5B39G 5HGBA 4I18A 4GBXA 4JFOB 3FQNA 2FWOB 5A2FA 2PCPA 4QRRA 2A6DA 1PLGL 4ZXBD 4I3GA 2YWZA 1FVEB 3QDJA 5D2LA 1HN1A 5C0CB 2AJZA 5GS0D 4MQ7A 3MRKA 1DN2A 1XR8B 3K74B 5ETUB 5IHUL 1KLGB 4A2LA 3F7VA 5KSAA 5DVNA 3T77B 3O2WL 3MRHA 1HYRC 4TN9A 3LIZL 1LK3L 4Y4KD 1KFAL 4LVOC 3DJ9A 3NMEA 4NUGH 5IVZB 4EUPB 1WTLA 5T1MB 5JPMB 2BMKA 5L2KB 3MJ6A 2WWKO 5EU5A 4GAJH 5E2VH 4LLWA 5SWQA 4XXCA 5DJZA 1EFXA 2AI0L 3ORJA 4KJYB 4RWHA 2ITDB 3OAUH 4OZ4B 5HGGS 4DN3H 4PG9A 2ICES 4XNQB 2P43B 3VRIB 4XMKH 2G2RA 3PGDA 3HZVB 3S5LB 4E41B 3L3JA 1AFVL 3A6OA 4OTXH 2QSCH 3DXAE 5T5NG 5F1SA 4ZQKA 3RI5F 3V4VH 1FO0B 1D5IL 3C9NA 1A6UL 1KOAA 4GJTB 3G5VB 1PSKH 3PP4H 5GISH 4B7IA 1WBYA 1J11A 1X5HA 4TTGA 1QBLH 2PTTB 4TOYL 3WE6A 1JE6A 3GMLA 4JPVH 2MTPA 4ZTPL 3VWJC 1KPUB 3D3VE 3MRBA 4R4NC 3QUYA 2AXFA 2HTKC 4O02H 1VACB 3STZB 2FJHB 5CJBA 3G6DL 2YPLE 4YBLB 1KN2H 4POUB 3KPOB 3NZHL 3P9LB 4P2QA 5MP6H 3UEZA 1MNUH 4DUVA 4BH8B 1I85C 4WFFE 2NNAB 4Z5RA 3SHSA 1MCBA 4FQHA 3WXWH 3SDXA 1YEDB 3DX6B 5IMKA 1MCRA 3HC0A 1B0RB 4FQ2L 5D1ZC 5I1HH 5GPRA 4WO4A 2AGJH 1LEIB 1NBZA 5IKCB 2DBLL 4XVSL 5SWZD 4M8QA 2D0HA 3B9KA 1IFHL 3MV9A 5C0EB 2DJSA 4WU7B 3WNNA 2FX9L 2OTWA 3VFPB 2RAMA 5LBSH 4M02A 5TE6L 3X11A 5HVGB 4X4XB 3IAGC 2V2TA 3IVKA 4LP5A 3CC5A 4BK5A 1W8OA 3BFOA 5GGTA 5D7IB 3E6FB 1W0YT 4UTBH 3MOQA 3IJSB 3B9VA 1IC5H 3NFPB 1EEUA 5DD6A 1A6AB 1DCLA 3QIBA 2VDKL 3ALPA 4I9WE 1I4FB 5CINH 2Z8SA 4HBCL 5IEKB 2O93L 3ECBB 4FFVD 5E2UH 1MHPL 2HFFB 2IAMA 3VXUD 5E0QA 2ZPKH 5KS9B 3LMJL 3MRRA 4FZEL 4NJ9H 1K3IA 4PS4L 3ZT6A 1TJHH 3LKQB 5D7LE 4HHAA 1JYXA 1NAMA 3MRNB 1MFDL 4RWYL 2XWJB 1CDYA 1I7RB 1U8NB 5F9OH 5AAMA 4X7TB 3UC0H 4ODHL 5F7HA 1OTTD 4CVXA 1HINL 5DUPH 4IIQB 3OXSB 3ZDXF 4F7MB 1TVBB 3D39A 1IEBA 1PKQB 3PIQA 3BEVA 3H6JA 5JHDB 4JZJC 4ALAH 1ZVHA 2DQTL 1P2CB 5I76A 5TFSL 4G6JL 5BXFA 5HJ3B 3UO1L 3MLUH 1U8OA 4DN4H 3RY6C 4K7PH 1U3JA 2PETA 2X5PA 3P4MA 4AK1A 4RZCB 4PJEF 1EMTL 2MKWA 1S9VA 4P2OA 2GUOB 4G6FD 4I18C 3LKSA 2ADJB 4OGXL 3WFHA 1T1XB 5IV2B 5L0QC 4PJ9D 2C1OA 5TF1L 3GGWA 1DQLH 2OTUB 5E95B 2EECA 4XNZC 1FV1B 1OPGH 4PRAB 3N85H 3S98A 5KSAC 2OQJB 4LOUD 4ONGH 4QRPA 3S96A 5AD0A 4MCZB 2VITA 1MFBL 1TENA 3IFNH 3U36B 4RMWA 1RJZA 3ARFA 1INQA 3BOVA 4UDTA 3VJ6B 4KVNL 3O6MH 2Q8AL 3SCMC 2VDQH 4P5TA 4R26L 2CKBL 2YA1A 2IPKB 1A2YA 2BERA 4FTVE 4XXCC 4J3TA 1JGDB 3F8UB 4LSSL 2ZG1A 2F54E 2GT9A 4O58L 1M7DB 3FT4A 5A3ID 4G6AC 1KIQB 5DUML 4ELME 1YY8B 5ID0A 2DWEA 5C71A 1IAIM 5E24E 2IG2H 1HKLL 4NKOA 5HHME 2PUQT 4JM4H 5FUCC 4IRSB 4PRIE 5CEXA 5D7JD 4OFYD 4XVUC 2FECI 3DMMB 3WFBH 4NNXB 4XPFL 3QQ3A 1UWXK 3B3IB 3MLZL 1T1YA 3QUYC 4GLRI 1Z3GH 4DKFH 3MA9H 2FJFA 4LEXH 1BVKA 1IE5A 3NVQA 4J8RA 2PN5A 2DQUL 5F1OB 1NCUA 3WBDA 5KVGH 2K9UA 3DX8B 5D2NC 5FCUH 3U4AA 5E8EB 2P5WB 2PXYB 2D7MA 2F74A 3E2HC 1AJ7L 3GSQA 4YDKL 1E27A 3GMNB 4R0LB 5EIIB 3TFKD 5D2LE 1VFBB 1YMMA 5C2BH 2DWDB 4DOHB 1H5BA 2NXYD 4KJWC 4EOWH 4LVHB 1G0DA 4L5FH 4WHYH 1NH6A 3V0AC 4P46A 2ICCA 2D7OA 1YJDL 1XF2B 1IGTA 5CHNA 1BGXL 1R3KB 2O5XH 5A16B 3WD5H 1MLCA 2QADD 1D9KA 2P47B 5F88A 2F5BL 4LPCA 3ARGA 4P57A 3VH8A 1DBJH 4TNVF 1YEIH 2Y23A 3KPMA 2MCG1 2EKSA 3B9KC 1RFDH 2QR0A 4DZBB 4Z7UF 4MJIB 3N1MC 2Q6WB 1I1AA 1I9JL 1K2DA 5EU6B 3WUWA 2YPVH 1A5FH 4KTEL 1DBMH 1IC7H 3OG6B 4Z0BH 2UZXB 4JGJA 4PRHB 4MDIA 1AO7D 2WLZA 4CVZB 1U93B 5DD5L 5JW4R 5FUCE 1OCWL 3QIBC 2NY4B 3OG4B 3WIHH 4JFZL 5M7QA 1QFPA 4KRPB 2VLKB 4NBXB 3X3FH 2VL4A 3D25B 1RURL 4L3ED 4XNMB 4LHUD 1BECA 5ID1B 1CIDA 4J4PA 3DVGA 5E9DA 2IAMC 2BOBB 5F9AC 1NEZA 4U1SA 4OFDA 4NT6A 1AXTL 5EG6C 4WW1B 1RK1A 5D2NE 4L8DA 2FATL 1FNFA 1J05B 2G5BA 3FHAA 3HTLX 5E1AA 4F80A 4OZFH 1D5XB 1LO5A 1MUJB 1QQDB 5EU4A 1QSZA 1Q9WA 4Y4HA 2IC2A 1HQ4B 4F9LA 5K9OB 4L3CA 4P2QE 3H3PH 4CU6A 1KLFA 3VDAA 4F15B 4JRXA 4X6BA 3ULUC 4U7MA 4OQTL 3KYNB 4LIQH 1VKXB 4NRYA 1C08A 2QJDA 3SDXE 3HZYB 4J2XA 3QRGH 5TE4H 5EWIL 3L3DA 4JO1L 3BAEH 4OF8A 4KJPC 3FB5B 1QFWH 3MLYL 3CVHH 2RJMA 1FRGH 5KSVB 1T0PB 3LRSB 5K33A 4NCC1 3RPIB 3MPCA 4P2OC 3O9WA 1EHNA 3ROLB 5FUZH 3MV9E 4NO2B 1HK6A 4D9QD 4CDHA 1UWGL 1MCWW 2AXGB 2P8PA 1KCRL 1E4WH 3RWCB 1F58L 2VZOA 3NFSH 4G8GD 3T04D 1TQBB 3CLFL 2ORBH 4NBZB 4WCYL 3QH3A 3JWOH 1PYWB 1B9ZA 1B0WA 3IU4L 3TNMB 1DR9A 3SPVA 3HNTL 2YXFA 3OL2A 1AIFA 3BP6A 4UV7L 3BUYB 4MYWB 5DJAA 3RAJL 5GGVH 4K8RL 1XH3A 2LU4A 2EDRA 3TWCH 4P5TC 3TJHD 2VRAA 3PV6B 4BELD 2ZUYA 1U8IA 4UNTA 5BVPH 4YE4H 4HKBB 2Y6SD 5BQ7A 1TJGH 2B5IC 4RNRB 3S4SB 4OGYH 4MJ5B 3HI6L 5MENB 3DSFH 4YLQT 5FA3A 2GSGB 3QHZL 2NY5L 3ZKMD 3ULUE 3L95A 4C4KO 1X5LA 5ESVB 3UPCA 4GKSB 3D39E 1A8JH 1OWWA 2FIKB 4JPIB 3QCTH 2AJXL 2YRLA 1H3GA 1OF2B 3A6CL 2VR5A 3ILQD 4Q74A 5FYJL 5JLZB 1B4JL 3SO3C 4GRLB 2AXJA 4TVPH 1G7QB 1T5WA 3HG1B 4NJAL 1JNHB 4PJDB 4ONHB 5J7CC 5DJXB 4TTDC 2R1YB 4JKPL 5KW9H 1QUNA 5TDNB 3MREA 3ZT5A 4LRNL 3LH2H 4DEPC 2EDJA 4FQLL 5D8JH 4KVCH 1LILA 2R1XA 4NQUA 4QTIL 5I8CA 3VFMB 4XWGH 2J7LA 1JIBA 4LSRL 4Z7VA 3K8LA 1H5BC 4AT6B 3H9ZA 4JVPA 1KTRL 2GKIA 2CKBA 3PNWA 4P46C 1T80A 1U9KA 5FOJA 3L5JA 3GMPA 4LKXB 3ZKSD 2V5TA 5J1AB 4P2RD 1RZJL 3MBEA 4RBPK 1D9KC 4JHAL 1BIIB 2VSDA 4M8VA 3ARGC 1NANI 3GBNH 5E99L 2AEPH 4XVTL 1IT9L 1XGYL 2X4NA 1NGYB 2Z91B 32C2A 5IOPA 2IMNA 4WI5A 4OF6A 4YXLH 1I1AC 4ODTL 1GJIA 3QISA 2HG5A 1AQDB 2JJWA 1HI6A 4OZIB 5EBWA 4NOFA 1OAKL 3BPNC 1ORSA 2H6PB 4ENEC 5K59E 5FO7B 4YHOH 2WP3T 4JFEA 4KTDL 4Q58C 3RGVB 4J3UA 3CMOH 4FNLH 3MROB 3HPJA 5DTFB 3DV4B 5DUBB 4YHML 2I07B 1QVOB 5LXGL 1AGBB 2ICWA 1IILE 5JOFB 1P7HL 1GIGL 3MACL 5BRZD 1CF8L 3QUML 4LEOA 1IGYB 3BXNB 3BKMH 4V1DB 4PTUB 2L7JA 1FDLH 3WO3B 1ZK9A 4YXHL 4J4PC 5HVWA 1Z0MA 1UYWL 4UOW1 3NFNB 4G5ZL 1OAZH 5I1CL 4NQVB 1DFBL 1K8IB 4XH2B 2QQLH 1WAAE 3RRQA 4CW1B 4UQ2A 1WVZA 3BPCA 1FG2B 4XWOC 1TJIH 1GH7A 3ZE2F 4LSQH 4S1QL 1MJJA 4NN7C 5KSUB 2E7CA 5C0CD 5E2JA 4F9LC 1YMME 4HFWA 3VFTA 5IFHH 1FNSH 4KFZC 2VUYA 4BFGA 3FMGL 3U4EA 1HZHL 4JDZB 3GO1L 4X6DA 2YMXH 4PJ5B 2Z92B 4R7NB 2A77L 2Q76B 3D0VA 3H42L 3MYZA 3Q5TA 1L7IH 3L3OA 4NZRL 3HI5L 3MUGA 1GGIH 5EC1A 3T0VA 3UCRA 1NDGA 2EIDA 3HPLB 4XMLL 4RX4D 1S7WA 3QA3A 5HVFB 4LBEB 5DK0B 1FNEB 4ELMF 2WSKA 2EDWA 4PJ7A 1A7NH 4JAMB 1G6RH 4OLEA 4B5EA 3OB0H 2HLFC 5DEGA 3SE9H 4FMKA 3EKCA 4ORGA 4WI6A 4CJ1A 3MV8A 5I1LA 2LE9A 4KUZH 1EBPA 2CDGB 4OZHA 1MCLA 1V5JA 2JIXA 5SWSB 2W92A 5MERB 5CSZB 2Q87A 5EOQL 4GRWF 4HIXH 3WSQH 4OD1L 4YGVA 4N0YL 1IVLA 3UROR 1WBZB 4KHXL 3VI4F 5E9DE 1GXEA 3GIZH 2BSSB 3P4NA 5MEOA 4OQTA 3QCVL 4EIGB 43CAB 1S7TA 4JEGB 3OF6A 3PP3H 5B39B 3Q1SL 2GFBA 3IDMA 4U1GB 3FONA 5DQ9A 3CU1A 4M7LH 1AGCB 1ONQA 1U2HA 3CPLA 5AUMA 2OL3L 5EZLA 4JRXE 5ACZB 3VH8G 1ZA3A 1N7MH 4NO0B 1JYVA 4GG6B 2R9HD 3CU7A 1TNNA 3MJ7A 5ITFB 3BJLA 3CVIL 1KPVA 4B7LA 1OM3H 4PJGB 1NSNL 4NKDA 4LU5L 4Y19A 5CWSA 1RK0A 2KZWA 1UGNA 4Q97A 4R4FL 1MAML 4XCEB 1Z5LB 4YUEL 5EIQA 5K9JH 5E6IA 4GOSA 1R5VA 5T3XD 3BE1H 1CT8A 1LO3H 3EDJA 2DQFA 3MTRA 4LSUL 5JHLH 15C8L 1CU4L 3LEYL 4CN1A 1DQTA 3DV6A 2C3HA 2JCCA 3PWNB 3OJMB 3FN0H 4FQIL 5ITBL 3AXLA 5B21A 5J12C 5DMIH 1RZFH 5GS1B 4KU1A 1LDSA 3FRUB 5DHVA 4XTRD 3VG9C 4YDLB 1P6FA 3FRPA 1M4KA 2Q20A 4RDQF 5DMYA 4NO5B 1WGOA 1VEPA 5CS7A 5H94B 5F6HI 2KQNA 1JTTA 4XPBL 3DYMA 1KLUA 3T3ME 2ATPB 3IXAA 1H15A 4JANA 3G04A 4ETQB 3R1GL 3GSRA 1IGCH 4ZOCA 5GRUL 4M5ZL 4ZUVA 4JZNB 5BCAA 2F8OA 4LVNC 2AS5M 3MLXL 3T4YB 4ZOEA 4XBGB 5GZND 1EAPA 1EVTC 1CLOH 3D85D 1G6RB 3G6JA 3VCLA 2IALB 3WXVH 5ADPH 4MJ4A 4AEIL 4DK3A 5TGBB 4Q7DA 4PBXA 3QHFL 2X4QA 5AYQA 4UB0H 2NR6D 5JHDD 4ZYKA 2J5LC 4JM2A 3CLEL 3UP1A 4C59B 3LB6D 5SX5K 2HFGL 4GXUN 5CMAB 2FR4A 1IAKA 4QRQA 4NQXA 2P42B 2Y06L 2XKSA 3DVNA 3ILPB 2LVEA 1J87A 4PPTA 2YS4A 1A21A 1YJDC 3DXAB 2CR3A 2EC8A 5BV7L 5KAQF 1M05A 3V6BR 1A4KA 1UADC 1RHHB 2CUIA 2R4SH 4UINL 3T2NL 1MH5B 1FAIH 4LLDB 4ZDHB 3IFOB 1REIA 3FOMB 2EH8H 2DAVA 4Z7VE 1LP9B 3V4PL 2OCFD 1FORL 5F1NB 2DM7A 4JRWA 5DDHA 2OR7A 5JTWA 4E42B 2BHUA 4U6HB 2Z31B 4QWWD 2D9CA 1NCTA 1V3KA 4I0PB 4D3CL 3D9AH 4PLJD 1XGTB 2RGSA 1YY9C 3TF7C 5HVHC 2F15A 4G9DA 4L4TA 1P4IL 1KGCE 5CJXA 4P59H 5ICZB 2ZNWA 2HVKA 1XF5B 2A2QT 1OGAB 4DZ8A 4JY5H 2MWCA 5ANMA 3ULUF 5EUKB 4OD2B 2ICEA 4X9FA 3BD4A 4ISVB 2N4IA 4O2CB 1NBYB 4X9GA 3H3BC 4UNUA 1G7IB 3EO0B 3O2DH 3QFJA 3QUMA 3KDMA 4LSPL 2F19L 3CZJA 2WLYA 3DYPA 4JFEE 2B0SH 2DQJL 1N8ZA 3BD3A 3PG2A 4JDTH 5DS8B 4WI4A 4LVOB 3U7WL 1D7FA 2A1WL 2DKUA 4Y2OA 1IEAA 3DMMD 1KJ3H 4M6AA 3BEWA 4K7FB 3TIEA 3PWPA 2BJMH 3K2UH 1S7RB 2I9LA 4HXBH 4NWUL 2XQYK 3EO1A 2CUMA 4KJQD 2HH0H 4BA8A 4HKXA 3B2UD 3SDDA 1KN4L 2ARJQ 1NMAL 4HIIB 3C09C 1A6WH 4XCFL 4R3SA 4OLYL 3AREB 5GS2H 3FQWA 4D8PB 1KJVB 2E6PA 3O0RL 4N0FB 2M8XA 2P1YA 5IHBA 5DJDB 3PDGA 3B8YA 3TIDB 3OKDA 1H0DA 4U1NA 1CFTB 4HT1H 1MJ8L 1J5OH 4X6DE 3BWUC 5IESH 1KJ2H 3OB8A 2Q7YB 4QOKB 2D7TH 3GJEB 1Y6MR 4RFNC 5TJWK 3QQNA 5IK3B 4MXVE 4Q0XH 1LE5A 3HFMH 5D7LB 5ACLA 3GIVA 3VGHA 1MIEL 5LAXA 4FABH 4PJ7E 1F3JB 2GJJA 4NKMA 5E6IC 2DLFL 3BP4B 2H2SD 5IVOA 4HFUH 2FX7L 1MLBA 1CFSB 4NZTH 2E9IA 1EXUA 1ZOXA 5I74C 2GJ6E 2BZDA 3G6AA 4K8RC 3DIFA 1ODAA 4NQEB 3LQMA 4HPYL 2KBGA 4MS8D 1PQZB 5DVMA 1QSFA 1K85A 5DRNA 1DBKL 3O11A 3WS3B 5GGUB 1JTOA 4MAYA 5D1ZB 4DGVH 4P3CH 3TZVB 3MNWA 4M7LT 2HRLA 4OZHE 5HI5D 1A22B 3LV3B 2VDOL 4U1HA 3VD7A 2VLKD 1J8HA 4LGRB 4CN6A 1NGZB 1QRKA 4HW6A 2DLHA 1C1EL 1AGEB 1BLNA 2OL3A 2NY5C 1V05A 5F7UA 3ULVL 1RU9L 2OJEA 5IVXB 3UTQB 4MCYB 3IKKA 4IM8A 4KQ4H 1DL7L 4N1EA 3X13A 1N59A 3G5ZB 2JK5A 3ZT7A 3U7AA 5I17B 3UYPA 4IDJL 3QUXB 1NCWH 1KIRA 3VWKB 4NQCD 3MRIA 4EDXA 5KANG 5MEQB 1GGYA 3M8OL 3UMTA 1OQXA 5IBTL 3QHTC 5EPMB 3BWAA 5C07A 1CLZL 2Q86A 4LGSB 4JM2C 3LHPL 3BGMB 1Z0NA 3IDNA 3CMGA 5F96H 1DEEB 4FTVB 1MJ7L 4PJXA 5D7KD 2IANA 4Z76B 3O3EA 4Y19E 1FG9C 2JKXA 2PW2A 5IMLA 3I75B 1RUKL 4BKLA 1I9IH 4KPHH 3T08A 2CIKB 1XGPA 3C6LB 5I2IA 2H26A 1UENA 1BD2A 3R0MA 2FLBT 2JCCE 4KK9C 4PY8J 2C7UB 4NZDA 3UTOA 4G80B 2VDRH 1R3HB 4PLNC 4YPGB 3ARBB 4E5XB 4U6YA 1MRFH 1ZT1A 4NNYA 4F58H 2WIIB 1BOGB 3D5OF 3QWQB 4NKIL 5DO2C 1L6ZA 5GHWL 4JPWH 4L29A 2JJSA 4KGLA 2X4UB 3SO5A 1O7SA 3W39A 2QBWA 1KJ2B 4WWKD 3CZFA 5HGBB 3L3HA 5ICYA 1KG0A 5CJXC 4J12A 3FQNB 1S78D 2PCPB 4Y4KA 3IS1X 3OZ9H 5D2LB 3CSYA 1HHJB 2AJZB 4LQ1A 4D0DB 2MQ0A 4MQ7B 1IGIH 1FFOB 1YEFL 1H3PH 1YECH 5TE7L 5DURB 4DFIA 3GKWL 4CGTA 4GXVL 5J56B 2Y5TB 3C60B 3SN6N 3G6JE 3F12B 1AKJD 2HJLB 1A4JA 1KCSH 3EOAA 3CXDL 1VPOH 3RWIB 2CLZB 3RWFB 1P4BL 3SCMB 1S3KH 1DP0A 2HT4D 4ACPA 3OR6B 1KXVC 3NA9H 2GK2A 4PR5A 1AGDB 4Y16B 3ULSB 2DLEA 2FZ3B 2R29H 1KCLA 35C8L 1FNLA 5DQDH 2ZOLA 1VB9A 2Z35B 4QTHB 2NY1C 3ULUH 3SDDC 2AQ2A 2EC9U 3EBAA 4ZQKB 2I24N 3HNVH 1S9XB 1CFNA 1HH6A 3I6KA 2RCSL 4HPOL 4WFGE 4HJGA 4NKQB 3C5ZD 4OGAC 2WUBH 3MRQA 3IXTA 4K71C 4Y4FA 1XGRA 2IMMA 1YNLL 3QCUH 1QBBA 3T3MF 3P40A 3O8XC 5JA9A 2CDFB 5MI0C 2ZP0T 1MFCH 2OSLB 4FQ1H 5DQJB 2AKRB 3GHBL 1JGLH 1I7ZB 2X4SA 4LLYB 1GZQA 2HAZA 4TSAH 2BFVH 1I1FA 1N2RB 4MNGA 3V0WH 5F1KC 1HHHB 5HYJD 3VFNA 3KYOB 4L4TE 1II4E 2A6KA 4PRNA 5D2NB 2AEQL 5BOZG 4P48A 5FYKU 5CJQL 3T2PA 3K1DA 1DVFA 1I3RB 5ANME 5HXMA 1T03L 3QDGD 2JTDA 2YPKA 3OAZH 5F3HA 3L9RA 1R24A 4NCDA 2FEEI 3QFJE 4JQVC 5GIRB 2QQNL 4XP9L 3SDXB 3LN5A 1H8NA 3QUZD 2R8SH 4NQDD 3OWEA 4MAYC 5I18L 4PGCB 1NBZB 1A7BA 1AE6H 5JPNA 1UXSB 3RY5A 2BVQA 4R2GD 1I8MA 2VXTH 2VDMH 4UTAH 1BAFL 4M8QB 2W9DH 3B9KB 5DHYB 1IQWH 4TUOB 3PWPE 4M93C 1S7XA 5F7LB 5HHNA 3SY0A 3IGAB 3FB7A 4JFPB 3TH4T 3BZEA 3BT2L 1CXKA 3E1F1 4GT7A 5B8CB 1C12A 4D9RD 2PYED 1QPXA 1YEKL 5EULV 5DT1L 3VXUA 4QLRA 4YFLI 3ZLQC 1P5UA 2B8OT 5D96B 2WBJD 3VXRE 3QQ4A 2FSEA 4P3DB 1RUAL 1FFPA 4DQOH 4M7ZC 5JORB 5KVMC 3O2WH 1JYNA 1Q9OA 5CP7A 5EZJA 1LK3H 1KFAH 3FTGB 1MHHA 3OHXA 3MRRB 3PHOB 4X9BA 3RWDA 1EVUA 1B6UA 4C83A 4GQPH 4OIBA 5CP3A 3CFJB 5T1KA 4JVUA 5D1QD 2L7UA 5H35B 2D03L 1YN6A 2AI0H 4RIRA 3EOBA 1PDKA 4R9HA 3MUJA 4ZFGL 3GJFB 1XR9A 2JF1A 3K80A 1WWCA 1AFVH 5CD3B 3DUUB 4PRBB 1QSFE 4KAQL 4ZXBC 1ZTXL 4PJ9A 1D5IH 1FC1A 1A6UH 1WF5A 1IM3B 3CH8A 1RZ7L 3FQRB 4PJBA 2JJSC 1NC4B 1I1RA 1PEZA 1RUML 2A6JB 3VRJA 1J8HE 3QG7L 4ZTPH 5FUOL 4FQQA 1FL6A 3OR7B 1GYAA 4Y4KC 2FECL 5DZLA 1FBIL 4WHTA 2CR6A 2DS4A 4X6DF 1P84K 4MNQD 5CBAB 1FP5A 3G6DH 3U7YH 4XBPA 5C09D 3QFDA 4MX7A 5KVFH 1QR4A 4P0DA 1G9MC 1ND0B 4UAOC 4ZPTB 2ZUSA 1UVQA 4Z95L 4BQBA 3PE9A 5ERWB 2BXZA 4Y2DB 1BZ7B 3RNQB 4UDTB 3OKKA 4JQIL 1RZKL 5C07E 1BZ9B 1I7UB 4PJ7F 5FECA 1GRWA 4AH2A 2PR4H 4JN2B 3HB3C 3PL6A 4FQ2H 4NN5B 3JXAA 3KHOA 5EOTB 4PJXE 2B5IB 2E6JA 2IANE 2DBLH 4XVSH 4HEME 2AV1B 2CO6B 5JOPE 3QIUB 4XP4H 1T0MA 1IFHH 2GT9B 4HK3J 2VZ1A 2CMRL 3DYOA 1QSEB 4XNXL 4MD4A 4MXQD 4N0UE 1MRDL 3QWRA 4HX1B 4NM4L 5I8EA 3QDHA 4NKOB 4AJ0A 1BD2E 4ZOBA 2VIRB 5EZIL 1MAJA 4Y4FC 3VFGH 3WHXA 3VRLE 5HYQB 1PKOA 2BVTA 3O6FA 4WENB 1T66D 1Q94A 4I8DA 1CD1B 3JUYA 1TFHA 1ITBB 3SO3B 2C3XA 1KELL 3U46B 4J8RB 2VDKH 3FB8A 4RMVA 1WZLA 2BC4A 3MCLL 4HBCH 1MQ8A 1BZQK 3QULA 1CE6B 4DEPB 5E94A 1TTFA 1MHPH 1W0VA 2C26A 1NAKL 2QKIB 1YMMB 5HHOD 1YDPA 2NY0D 1A7RL 4ZPVB 3LMJH 2BRRL 3HUJA 5JNYA 2WMPA 4ZUTA 4MSWA 1ZHKB 1MFDH 4XP1L 1CXLA 3EYSH 1IGTB 2YD1A 1A3LL 4RMSA 3GK8L 3CDYA 4JFQB 1HINH 2EYRA 1FZOA 3AS0A 3HLAB 4XPAL 4MXWL 3VH8B 3TVMA 1UB6A 4EI5A 2JB6B 5FM5O 4DAGL 4PRPB 2W91A 2DQTH 3QNYA 4U49A 2H8PB 5TFSH 4G6JH 3A6BL 3WL9B 3RZCB 3UO1H 4FHBD 4NN6B 2BP3A 1G7HB 1HWGB 2D31A 3LS4L 4FFWC 1FH5L 4LQFL 1BEYL 1OSZA 4OZGF 4M3JA 4QXGL 4CJ0A 4UT6L 3GSUB 4OGXH 3JTSB 2XRAL 4FFVC 2GY5A 2VAAA 1OB1B 1EHLL 1FO0L 2UY7A 5TF1H 1QTYT 2OK0L 3RWEA 1JWSB 3W0WD 3S97C 3L5WB 3OPZL 1S7SB 1MFBH 2EO1A 1FVCA 4MDJB 2VABB 3P4OB 1RZ8B 3MZGB 1XGUA 1OTTC 1F6AA 1ZEAH 5E8DL 4NT6B 4J1UA 4MNGE 3QXVA 3VFWA 4FQPA 1GGBL 2Q8AH 2H2PD 5CEZL 3N06B 3V0VB 5A2LH 4U1JB 1KTKE 3G6JF 1OGAD 4R26H 3LQAL 4TNWK 2NW3B 3IJYA 1A9BB 3PGCB 4L3CB 3SDCB 3LKNA 4JRXB 3DO3A 4JY4A 3L5XL 1IL1A 3CX5J 5SWZE 5D6CB 4LSSH 2O5ZH 4L8BA 4JM2F 2R0ZL 1SYVA 4YPJA 1BFOA 3IF1A 2OX5A 4LFHD 1UM6L 3D18A 5DUMH 1AI1L 2VQUA 1DE4A 5JW4Q 3ULVC 1DDHA 4PJ9C 2EYTB 3EUUA 5IF0A 5FYLD 1T7YA 5B4MD 4PD4K 1I8KA 3WDHA 4P23B 1UXWB 1GCFA 4LOUC 1JF1A 1GPOL 2A73A 1WFNA 1BF8A 2GITA 3MLZH 4CMMB 4N5ED 3MV11 5T3XL 2YR3A 1ZE3C 2P8PB 1RQ5A 2DQUH 3QO0B 3MGTB 1PZ5B 1N6QL 5IWLA 3OX8A 4D0BA 4WTZA 1TZIB 2EDQA 4JRYD 4Z7WA 3G08A 2AJVL 3MLPA 4YDKH 3B5HA 1JGEA 3VXUE 1QA9B 1LEKA 5AG8A 5I1AA 5HDBF 1QFWM 2VQ1B 1E28A 4FQJL 3JVGC 4UQ3B 6FABL 3WFDL 25C8L 1CG9A 4NPYB 1XH3B 4XCNA 5F7MC 1YJDH 1T2XA 1AHWA 3RIFK 4HDIB 3PL6C 2UUDK 5HTSA 4ODXB 2F5BH 1EK3A 1AC0A 4JFFD 3H9HA 5FYKD 1UB5B 4R7DB 2WBKA 4YHPB 3BSZH 1PX4A 4YXKL 1AD9A 1ACYL 2J8HA 2R2CA 8FABA 1MRCL 5JOEA 4P4KA 1I9JH 3OAUL 3VXMD 2EH7H 2ZUTA 4XMKL 3HZKA 3AVEA 5DJ6B 3E8UH 4KTEH 4RGMC 3DECA 4X5XA 2QSCL 4KROD 3BH9A 3UZVB 2BY1A 3ZTNL 2I60L 5FB8B 4YC2B 3O6FC 1OW0A 2VZVA 3TZVD 3V4VL 3KNBA 3ULVE 4LK4A 5E1HB 2G75A 4K2UL 5DD5H 3Q3GA 4WGVB 4WUKL 1OCWH 4PJBE 3ARRA 1A6PA 2NXYC 1OLLA 1YN7B 3G9AB 3TBYA 4WUUA 2NPLX 2NY2B 2GK0B 5EBLB 3OXRA 4W68A 5EN2A 5E8OA 1AXTH 4WEUD 1T0NA 4OUUA 1JHTA 4ZTOL 2FATH 1J1OH 1L9NA 2DMCA 3QUXD 3EJZD 3MUY1 4Q9CA 2VUOA 5MP6L 3VG9B 4PJIB 3VWKD 1MNUL 1PEWA 3OKNB 5IW6A 1I8LC 4V2CB 3QIWA 5TDOB 4WFHD 3TVMC 4IOFD 4EI5C 2B1AH 4GW5A 3PJSB 5E5MA 4IBLT 3VFRB 4JO1H 2A9NL 1I8IA 4GS7C 5F9DC 4Z77A 3D2UA 4ZFFA 3GSXA 4KZDL 5GGSA 4LVNB 4KMLB 4ZFZB 5BRZA 1UQSA 2E9JA 2F8VA 4X7DC 1F11B 2P5EA 3ZKXC 1HHKA 3F5WA 4FN0A 1VA9A 3QAZB 3P4LA 1UWGH 5LBSL 4WIQA 5D93B 1CS6A 2YUZA 3MJ8A 1KCRH 3VXTB 1O7VA 5C0JA 1OTSD 1FL3B 3U6RB 1F58H 3BZ4B 5JO5B 4JFOA 4B0MM 4KK5D 3CLFH 2FWOA 4NQSA 4W6XB 4EN3D 5KBNC 3ZDZF 3IT8D 5D1XD 4ZAKD 1FVEA 2Y9RT 4WCYH 3L3GA 5C0CA 3HE7D 4Y89A 3X14B 3IU4H 1XR8A 3PUCA 5ETUA 4Z78B 3EYOB 1KLGA 3HNTH 3T77A 4UV7H 2MJWA 5GRVK 3O41B 4R4BB 3RAJH 4S0TD 4K8RH 4F2MA 2DL2A 1YQVL 2ENYA 2HWZH 5J13B 4KI5D 1KSRA 4IOSD 3OGCA 1HSBB 1MCWM 3GSNH 5IVZA 5DSCB 4EUPA 2D7PA 5DHVH 4NJ9L 4RX4A 1OP5K 3IU3B 1TJHL 2UYLB 1EEZB 3HUJE 5IT2L 1QRND 2XA8L 4Z18A 3U4EB 1SEBB 3R8BB 5JPMA 2R56H 2XOTA 5L2KA 4OI9A 2X9WA 5F97E 3RJDA 3HI6H 3UC0L 4G42B 4JQXA 2ITDA 1DANT 1U8QB 3QHZH 1NDGB 2NY5H 4XNQA 2EKJA 3HZVA 3S5LA 1FCCA 4MB3A 3W81A 5ESAA 4OCRL 2AJXH 1FJ1B 1WT5A 3LPFA 1OT2A 3A6CH 1FO0A 4Y16D 4MLIA 3ZYIA 5E6ZA 4K7PL 3FL7A 1B4JH 3SE8H 3FQUB 3G5VA 4NJAH 4MMZC 2P8MB 5DEGB 3VRLF 4H1LG 2GJ6B 2PTTA 2HA1A 4JKPH 4ORGB 5EZOL 5IWLC 2J8OA 3RBGA 4LRNH 4L3EE 4LCWD 3DBXB 2WW8A 4FQLH 3TJHC 3GI9L 5JIPA 1EDQA 1YEGL 4OZHB 2JIXB 4QTIH 4LF3B 2GHWB 4OT1L 1UFUA 4LSRH 1VACA 3STZA 3UTTB 3N85L 2FJHA 2B7DT 3T0ED 1U3HB 3KPOA 3P9LA 1AHWC 5C0FA 1OAQL 1UM5L 4WV1B 3P4NB 4BH8A 4JHAH 2NX5D 3RNKB 1F97A 3CJJA 2NNAA 3O6ML 3AS3A 4MJ6B 4NWTL 4YHZH 1YEDA 2QLVB 5E99H 3B5TA 4Y5VC 1IT9H 5DD0L 1NUNB 3DX6A 4CADB 4JFDB 1XGYH 2HLAB 4LRIA 5IHLB 1EAJA 3FZUD 4NHCL 1LEIA 3ILQC 2R15A 5IHZB 1K9TA 4P4KC 3CPLB 5C08D 1FIGL 1CGXA 2XV6B 4HG4K 3NCJL 4J7RA 1OAKH 5F71A 3MRMB 5C0EA 4HKJB 4WI7A 4WU7A 3VXQB 2NZ9D 1OW0C 2GJZB 1H3TA 2AXHA 3VFPA 4XRCA 3PHQB 1I9EA 4MA3B 2IG2L 1DANU 2F53B 5F8QC 4E0RA 4X4XA 3KLHD 4YHMH 4X9IA 5C86A 2C9AA 4G8GE 3ZSTA 5LXGH 3MUZ1 1GIGH 2OMNA 3TPUB 5D7IA 1BREA 3E6FA 3MACH 1CF8H 3QUMH 4LHUG 4M00A 4R97C 1LWRA 2VXSL 3IJSA 2X4PB 5HPMB 5GXBB 5DC4B 1Z3GL 4DKFL 1LD9B 3NFPA 4N0CD 1UYWH 1A6AA 4G5ZH 3AY4A 5I74B 5I1CH 4M62L 1UC6A 4MJ2A 2JCCB 5EH1A 5LGHL 1RZKC 4LSVL 2W60B 4LCUB 1O0VA 3ECBA 2DYPB 1TPXC 1QOKA 4OIAA 3T0DA 3ZKNC 3ALXA 2HFFA 4S1QH 4Z7WE 3GSNB 5DLML 3UJJL 3VGEA 1ZXQA 2IBGA 3JWDL 5KS9A 2I9TB 1JVKA 2Y36L 4EOWL 3VMOA 3FMGH 1HZHH 1CXEA 5FIEA 3MRNA 3GO1H 4BH7B 2XWJA 1I7RA 5C0BD 1U8NA 2A77H 3H42H 2FH8A 3IDXH 4NZRH 3BVNB 3HI5H 4X98B 2FD6L 1TZGH 4IIQA 5F7NC 2A9ML 3OXSA 4QRUB 4QXWA 2XZQL 4XMLH 3B43A 1TVBA 3WNKA 2N7BA 4DVBB 4F7MA 6CGTA 1DBJL 1PKQA 2QQKL 5JHDA 3ZSSA 1P2CA 5HJ3A 1V8HA 4BSVB 4D9LL 2F5AL 5J6GB 4RZCA 2ERJC 1FHGA 2GUOA 3RX8A 1A5FL 2IQAB 3UAJD 1H8SA 1ED3B 1MFEH 4ZYKB 2ADJA 1T1XA 3RWGB 4UNVA 5JQ6L 5IV2A 4PLOB 1IZJA 2P44B 1BQUA 3NH7L 3WJJA 3V5DA 1NFDB 2OTUA 4X7SL 5EOQH 4EZMA 1FV1A 1NC4D 4PRAA 2AJSL 3EDEA 4OD1H 2OQJA 5MEPB 5F3BB 4N0YH 3NCCB 4XAKE 4MCZA 5TF0A 1CDJA 4KHXH 3QQ9D 1P1ZB 1BX2B 1P7QD 1NKOA 1F2QA 5KZCB 5EOCH 2AEIT 3VJ6A 5I1EH 3GMMB 2X7LB 4DTGL 1U8PB 1X5GA 3Q1SH 4HXAH 3H9YA 3U9PL 1LEGB 4X6FB 3ESVF 2ADFL 4PGBB 1AXSB 2OL3H 1JGDA 4CKVX 3SDAB 4G9DB 2DMBA 4LIQL 1IZKA 3V8OA 1M7DA 5JW4N 1KIQA 1U0QA 1PY4A 1BJMA 1WT5C 2ITCB 1J0IA 3BAEL 5HGDB 3CVIH 4PJHA 1QFWL 1FNAA 1FRGL 1NSNH 4IRSA 4LU5H 1S9KC 3QIUD 3DMMA 4YR6B 2ESVD 3S35L 4R4FH 4NNXA 2LQRA 4YUEH 5BRZE 3B3IA 4I5BB 3ULVF 2P5EE 4OV5B 4C57C 4LSUH 1K8DA 15C8H 1CU4H 1U91A 1CGVA 4PJBF 3ZE0E 3MA7B 2QSVA 5TQ0L 2BXYA 3MCG1 3BGAA 5E8EA 2P5WA 5ITBH 2ADGB 2DQGL 2PXYA 3LQAC 3BEWB 1RULL 3TIEB 5FF6B 3SJVB 3JWOL 4G9FB 2I9LB 4PY8I 1VFBA 4R0LA 5EIIA 5C0CE 2DWDA 1WISA 5GRWA 4GKOA 5I6XB 3QRFM 2W9LA 1NMBL 4QHLA 5I9QC 3KPQB 2C4XA 2R9HC 2VXVL 3TWCL 1XF2A 3BIBX 3L5HA 3NPSB 1R3KA 4LRIC 5A16A 5J57B 3R1GH 3VXRB 4OLVL 4F7TB 5GRUH 1F90L 4M5ZH 4BQ9A 3OKDB 4U1NB 3MLXH 2EYSB 5E70A 3O8XB 4DZBA 3LSOB 4KZEL 4MJIA 2Q6WA 4LPUA 4AIOA 2OR9L 4LLAA 5EUOE 4JKLA 5EU6A 3H9SD 2BNRB 1FYTD 3QHFH 1EEQA 3KPNB 5C3LD 4UMGA 2V5RA 3V79C 4PRPD 2VDNH 4JLRB 3CLEH 2HFGH 4W4NA 3MRCA 4CVZA 1U93A 2FRGP 1G9MH 1RI8A 4XTRC 1IM9B 3HR5B 3IDJB 5GSVB 4LCIH 1OOAA 3AY4C 5IBLD 4I4WB 2VLKA 3D25A 1QACA 4ZO8A 5IG7B 4XNMA 1A7QL 4JO2L 5T1LB 3DX7B 3O11B 3WLWD 3DURB 4KVCL 1XAUA 2BOBA 4UINH 3T2NH 3WUZA 2BX5A 4XWGL 3LQZB 4M48L 3QEHB 3EDKA 1JHKL 5CEZE 1FORH 1J05A 2QL1A 1J8HB 5CZVL 1D5XA 1MUJA 5GZNC 1HQ4A 5K9OA 4MA7L 1YUHB 4YK4C 1XZ0B 3UBXG 4NQCA 3HUJF 2W65B 3KYNA 4K7PY 3BIAX 1SMAA 1VKXA 3GBNL 2ZKHL 4P3WA 3HZYA 3VA2C 1CD8A 1CDUA 3HN3A 3VG0L 1CGSH 5KANI 3FB5A 1L0QA 1OP3K 3SDCD 1MCPL 4F37F 3LRSA 4ZG1A 3MFGB 1Z2KA 1VADB 3MQIA 3ROLA 4LSPH 1HNFA 1CWVA 2VLJB 4TUJB 4NO2A 2DQJH 5T3XE 4FNLL 2AXGA 3J8F7 3WJJC 3U7WH 5CCKL 1BWMA 4PJXB 2A1WH 1BWWA 1CGUA 1JNJA 1C5CL 1UEYA 3JV5A 2PW2B 5IMLB 3BKML 3MZTA 2R23B 3W11D 4BKLB 1CQKA 1PYWA 2D2OA 1Z9MA 4NWUH 1U3YA 1UACL 3TNMA 4N0UB 1EO5A 3BUYA 1KN4H 5C9JB 2QQLL 1NMAH 3NCYS 4XCFH 2W1NA 4LSQL 4OLYH 3PV6A 4K3HA 4ZXBB 2EDNA 4Z7NE 3CFCL 3D0LB 3O0RH 3UTSD 5E2WH 3MGOB 4HV8B 4OFVA 3QDMD 2BOCB 4KDVA 3RVTD 5KS9E 2DLIA 5I1GL 2HKHH 1KJMB 5E2TL 1MJ8H 4CAGA 4MJ5A 3L3HB 3QXAB 4GRWB 5MENA 3MRDB 4G6ML 3U9UA 2C1PB 3BQUB 4Y4KB 3KHQA 1AKJA 1FSKB 2GSGA 5FAAA 5KSBE 1UWXH 1CICD 3TCXA 5ESVA 4IRSC 4GKSA 4YDJB 4ZO7A 3Q0HA 2FIKA 4JDVB 3DMMC 5JHDE 3F7YB 1S5IL 5E00A 1MIEH 1RJCA 1OF2A 1JNLL 3OSKA 4RRPA 4NQTA 5JLZA 3R0NA 2A6IB 2DLFH 4GRLA 4UAOB 3HG1A 2FX7H 1JNHA 1HHIB 1NC2D 1A4JB 4ONHA 4KJQC 4RISL 3CSPA 3O3BB 5DJXA 2R1YA 4QRTB 5FKAB 1T2JA 1OD9A 4HPYH 5TDNA 1CGTA 2PXYC 1DBKH 3RBSA 3AGVA 4PR5B 2FEEL 3VFMA 1MI5D 2VR4A 3UX9B 4AT6A 2ZOLB 2BVYA 4RMRA 4LVHC 1U8LA 1WC7B 5EC2B 3RUGF 4Z7WF 3FHQA 1BQHG 5BO1H 4JVWA 4LKXA 1C1EH 5J1AA 4LNVA 3ULVH 3WNPA 1RU9H 3G5XB 4HGWB 2XQYG 3CCHB 1BIIA 2Y4SA 4NYLB 2X1PA 3X17A 1T22B 2YEZB 4PLKC 1DL7H 2NY3D 1NGYA 2QEJA 2Z91A 4KKBD 4XHJD 4IDJH 4KKLC 1X9QA 5TDPA 3E6HB 4EXPX 1AQDA 4H88L 4OZIA 3BI9X 5GJSL 1HDMB 4CNIB 3M8OH 2R2HB 2XWTA 1EO7A 5IBTH 1F42A 1CLZH 4QYOB 3RWHB 1JGVH 4MS8C 2ZSVB 3RGVA 1QLFB 1Y6NR 3LHPH 3MROA 4NQDA 5DTFA 3DV4A 4PJHE 1MJ7H 3TBWB 5DUBA 4YO0B 2YPKB 2I07A 1QVOA 4DGIL 2NY4C 5SWZB 1AGBA 4YGAB 3SQOH 4J3OC 1IGYA 3BXNA 4KRPC 5LG1A 1RUKH 4V1DA 4O2EA 4PTUA 3BE1L 3ARZA 5JHLL 3NFNA 3NAAL 4QHKJ 3BW9B 3MXWL 3VFVB 4NQVA 4KUCF 1K8IA 4XH2A 5CGTA 1ZT7B 4CW1A 1SHMA 1FG2A 2P5WE 3DETD 1G7PB 1A1MB 1RZFL 5LKNA 5F9WB 4F15C 4DOHE 3CFIC 4EQ3A 3V52H 1ZLUK 1B0GB 2K7QA 4JDZA 3V4UL 3HRZB 4XXDB 4PJ5A 4R7NA 2Z92A 4DK6A 2Q76A 4J23A 2N1KA 3VXSD 3NZ8B 3HPLA 3RVXD 3VXUB 2EE3A 3UTZB 3RVUD 4OV6F 1YEFH 4LKCB 4LBEA 5DK0A 4ZS7L 1FNEA 3WKML 1YEHL 3GKWH 4GXVH 1CLOL 4MJIE 3WNOA 2ZZUT 4JAMA 2CRIA 5ADPL 5CGYD 5EU6E 3OJDB 3GI8L 4QXTB 1XEDA 3CXDH 2BK8A 4R96B 1VGEH 1P4BH 3RWDB 2DI9A 4HC1L 5FYKL 1TQBC 1RZGB 4KY1H 5JW3L 2CDGA 1A1NB 3ZE0F 5MERA 1WWWX 1DLFL 3JWDC 1X3DA 35C8H 1T89A 1HEZB 4XB8A 3BIKB 4M6OL 4G6FB 4HUMB 4HZLB 2VLKE 4WWKC 1WBZA 3DTXB 1E4XI 2HJKB 3T0AA 2RCSH 3CNKA 5DMKB 2BSSA 4HPOH 1N4XL 5J0BA 2AJ3B 1F00I 43CAA 3BPOC 5FGRA 5BS0D 1SEQL 1P6AB 1YNLH 5B39A 1A7OL 1J8KA 4FP8L 1RAMA 2VL5B 1J12A 4P4RB 1WTGT 1AGCA 2IBBA 2CXKA 3HCVB 5ACZA 1A02N 1DZBA 4UT9H 2GAZB 4NQCE 1LE9B 3RTQD 1QKZL 4NO0A 4ERSH 4GG6A 4P59L 4MA1C 1JZ5A 2OP4L 2J8UB 4K94L 3N9GL 3JZ7A 4K3GA 5CJQH 1A3RL 4P5MB 1G7LB 1T03H 4BZ2L 4GRLC 4PJGA 2PW1B 1UVQB 1CFVL 1BVLB 1MHCB 3KG5A 4XCEA 1Z5LA 4OCYL 2QQNH 4XP9H 1WIPA 4APQD 1M6OA 4GFTB 4OM1L 1C5DB 2F53D 5I75B 3C8KA 3MNZB 4MD0B 5D7JB 5ISZB 5JZ7D 1PZUB 1MFNA 1BAFH 4U1IB 4BQ8A 4N8PA 1J1PL 2EEDA 1Z9OA 4RBPH 1TVHA 3K2UL 5GS1A 2EDEA 3QEQD 1MF2L 3FRUA 4O9HL 5DJ8B 2X05A 2AK4B 4NO5A 1F4AA 4JFYB 5H94A 2EZ0C 5AWNL 3BT2H 4H1LB 2YA2A 4S11A 2DYPD 4HK0A 4X99B 5IFAL 4K3EL 2I5YL 4F9PA 2ATPA 4FQXD 1QFUL 2XXCB 4ETQA 5DT1H 1SMOA 3TYFB 1GGTA 1NGXB 3PWJB 1T3FA 3RGHA 4OF0A 3TYGL 4JZNA 1RUAH 1UZ6E 3OTTA 3T4YA 5DFVC 4XBGA 2XTJD 3EHBD 4IRJB 5IESL 1KJ2L 3KPPA 4JFHD 3OQ3B 3UXFA 3QULB 2E8YA 5C0DB 5MENE 1G84A 4HUXB 1T7XA 2IALA 3RGVC 2IBZY 1GGCH 2ED9A 1WIUA 3ZDYF 2MSPA 2QADB 5TGBA 3EW3B 3FO2B 5B3JF 2D4DA 2B1HL 5JNYB 3KYMB 5EORL 2DQDL 4M1GL 3CDGB 2XG5A 4MSWB 4JKKA 1JV5B 2HVJB 3W5NA 5CMAA 3B8SA 1LQSR 3TBTA 3THMH 3ILPA 4NZTL 2HKFL 1FZOB 4ZFGH 4UUJB 5D7IF 3EJJX 3DXAA 1CFQB 1YQ2A 3SEPA 4KAQH 5C9KA 1RHHA 1AO7B 5CBEB 4BSWB 1ZTXH 5ESQB 5J3HC 1BQLL 4LLDA 3IFOA 3FOMA 3OJ2C 3NOIA 2WBJC 3MSPA 2PO6D 2D31B 1LP9A 1RZ7H 1JYWA 3O81A 1OSZB 4ZSOA 1RUMH 4E42A 2Z31A 4CMHB 3QG7H 4Z7NF 1VFOA 4I0PA 4L3EB 2LVCA 3R8QA 4LHUB 1X5AA 1XGTA 3VFUB 5KS9F 1FBIH 1WUNT 5D5MB 3V6OC 3GSOB 1JPTL 2R0WL 2X89D 2X10A 5HYJE 3ZYOA 5ICZA 1MAKA 4GLRH 5HHVL 2Q7NA 1XF5A 2FL5B 1OGAA 3ARDD 3BJ91 4CVUA 2NCMA 1UH3A 4WWID 1JRHI 3TH3T 1NCWL 1FVCB 5EUKA 2ZCHL 3D3VD 3QDAA 4OD2A 2C3WA 1F6AB 4Z95H 1I9RH 3EFDL 4ISVA 4OZIE 4O2CA 1NBYA 1U8MB 4J1UB 4AG4L 1G7IA 3EO0A 3F65A 4JQIH 4TNVK 3VFWB 5IMMB 1H3WM 4KV5E 4ONOA 3A0OA 3L1OL 3T0WA 2YPLD 1NLBL 4GAYB 5DS8A 4NQDE 5F96L 1IAMA 1S9YB 1KTDB 1I75A 1IL1B 1T89C 3CFEB 4K7FA 4UIMB 4FFZH 4WFFD 2FGZA 1S7RA 4V1DE 2CMRH 3CDFA 3D18B 3T3PE 2BRQA 4XNXH 3REWB 2FBJL 3TA3D 4NM4H 3OBAA 4QHMA 2E3VA 1K4DB 5EZIH 1MJUH 2GIYA 3B5GA 4G8GB 4HIIA 2VDRL 5FV2A 4K7PX 4M1CC 1W72H 2EXYC 4WEBH 3AREA 1M71B 1MRFL 1KJVA 1KTLB 1DQML 4N0FA 4H20L 2BVPB 4MNHB 2C3GA 2DM4A 5DJDA 3KS0H 3TIDA 5J6HB 2AJYL 1IJ9A 3JV6B 3QPXH 4NSKB 3HC3H 4D0BB 4PJ5E 5CUSL 3RVVC 2BNUB 3MCLH 2Q7YA 2HMID 4QOKA 3GJEA 5IK3A 1NAKH 3V5HB 3LVEA 4ZS6D 3V6OE 1A7RH 1EUUA 3KLSA 3TO4D 4HC1A 4JFFA 2BRRH 5D7LA 3MRJB 4OF5A 4I9WD 4XP1H 1E6OL 3NCFB 4YWGH 4UOJA 4GAGH 1FPTL 1IAOB 3ARQA 1A3LH 3GK8H 2P7TB 4MXQC 4RQQB 1MCOH 1CFSA 2C4FT 5C1MB 3SE4A 2VZUA 2HTKD 1QFOA 4EUPH 4NQEA 4DAGH 1PQZA 1Q72L 4Y5VB 3WS3A 2IH1B 5GGUA 1C7TA 3TZVA 3PQYB 3A6BH 3NA9L 5IM7B 5EU3A 3LV3A 5DQDL 4TSBH 2DKSA 3LS4H 1FH5H 4LQFH 1BEYH 3QT2A 3HZKB 1SY6L 4QXGH 4UT6H 4HWUA 2IWGA 2NXZD 1NGZA 3BMWA 3SGDI 3HNVL 1AGEA 2XRAH 2V2XB 3FT3B 2IGFH 5HGAB 1EHLH 1FO0H 5T5FL 4AL8L 5IVXA 2EEBA 2OK0H 3UTQA 2NY0C 4MCYA 4UBDC 4LLQB 3NN8B 2DJUA 4L9LB 4MNQE 3G5ZA 4D2NA 4N8VG 2MCPH 5I17A 3OPZH 4YZFE 4TVSa 3QUXA 4ZNCD 1BM3L 4YIQB 1IKNA 3BHBB 4N90D 3TT1L 4D94A 3VWKA 4P2RB 2UV3A 5DD1L 4CBPA 5E8DH 5E8OB 1ZA6A 5SX5H 5EPMA 1GGBH 5CEZH 5I1DB 1B6DA 3LQAH 3BGMA 2QQQA 5DK3A 2XACC 4U33A 1DEEA 4FTVA 1RSFA 4JJ5B 5FGSA 4U0RB 3L6FB 5GSRB 3L5XH 5FOBB 3JV0A 4F33B 3I75A 4YNYB 1DSFL 2R0ZH 1OAUL 2VLJD 2A83B 3MO1A 4ODSL 3EDFA 1EJOL 2R8SL 1AI1H 2CIKA 3W5MA 3C6LA 5LGJA 2WBWB 2RR3A 5F7WC 2C4FU 4XNUL 4ZFFB 2C7UA 1HCFX 1VHPA 2VXTL 4G80A 4I48B 1R3HA 1W72B 4YPGA 1DTUA 1FL5B 4PG2A 3ARBA 4E5XA 4KXZI 2Z31C 2V2WB 3SQBA 3GHEL 1GPOH 2WIIA 1BOGA 3RY6A 2ARJB 2P49B 3I85A 1S7UB 5T3XH 1YMHB 5C0RH 3EFFB 4AEFA 2ERJB 2X4UA 4WU5B 5C0JB 4JHBA 2C3VB 1INEL 1KJ2A 5HHMD 3VA6A 4H0HB 3VXOB 1N6QH 4NFDA 4PRID 3BISA 2E5EA 2H2PC 4NQSB 3N1PC 1TTGA 1UZ8B 1SBBA 4JZOB 1GOFA 2AJVH 5GS2D 3VE0B 3L3GB 1CYGA 1HHJA 4D0DA 4NDMB 2ZJSL 1FFOA 1FNHA 3FJTA 4FQJH 4PRDB 3TBSB 4PJFA 3LEVH 2Y07L 4DQOL 3BO8B 3EYUL 1FFQA 3WFDH 4KK6C 25C8H 4PJCE 1MEXL 6FABH 2Y5TA 1CQYA 1FZJB 4F2MB 4CU7A 3C60A 4GBXD 3BQUD 3F12A 5F9JB 4QRRD 3CX5K 2HJLA 3OGCB 3ZHDA 3QDJD 5FDWB 1AP2B 3RWIA 4P9MH 3UBXB 2MNUA 5I8KL 2CLZA 3RWFA 4F7CB 3SCMA 2YD6A 3OR6A 5KSAD 3FAWA 3DGGB 3I50L 2ZNXA 2ZCLL 4YXKH 5K9KB 1ACYH 3ULSA 1AGDA 1ZMYA 4Y16A 1VESA 1MRCH 1NANH 2FZ3A 2ARWA 4XPHL 1RV6X 4N5EC 5EUOB 4DKEL 1T20B 1ZHBB 2Z35A 4QTHA 4XAWL 2LTQB 4C56B 2F8XC 1U42A 5ESAB 4HBQA 3ZTNH 2I60H 4NRZB 1S9XA 3AREC 5IW1B 4NP4L 4K2UH 3S35X 4WUKH 1EFXD 4M7KL 4ZD3L 1LP9E 4Z7OE 5HI3D 4ZSOE 3S7GA 2CDFA 1IBGH 4HUVB 2OSLA 5DQJA 2AKRA 4G6AD 4LLYA 1I7ZA 2G5RA 4L8SB 3IETB 4UIKL 2EE9A 5D72L 3KYKH 1N2RA 3LOWA 2N56A 1HHHA 4MVBC 1W8NA 1DEDA 3KYOA 5D2NA 3WIFB 4ZTOH 3M17B 4XVUD 3U7YL 4IRZL 4HCRL 5I15L 1G6VK 5KVFL 3QPQD 1OGAE 4C54A 3B2VL 5CSBA 1I3RA 5DMGD 5C0FB 1QR1B 1X6NA 4DFHA 3U4BL 3QUYD 2VO5A 1DBBH 8CGTA 3NABL 3SE4C 1V7NL 3BKCL 4YEEA 4UU9A 5C6TL 5GIRA 5I9QB 4NM8L 2PR4L 1UCTA 2HFEB 3HAEA 1MHEA 4Y8AA 3PDOB 3TZVC 2A9NH 4PJDF 4PGCA 5T3ZL 4P2QD 1UXSA 5FYLE 1UCBH 4KZDH 4RSVA 3CFBB 4M5YL 4XP4L 5DHYA 1CZ8L 4TUOA 1NBQA 5B38G 1ZHLB 4TPRL 3IFPB 4G3YL 3IGAA 4XRCB 3EJYD 4JFPA 4WJ5B 4WO4D 4E0RB 4PV8A 5CSGA 3VFGL 4U3XA 4K94C 3UJTL 5B8CA 4X6CB 4JRYE 4XGZB 3QUXC 3EJZC 4HWNA 1KV3A 4QHNB 1IKNC 1EV2E 4F7EA 2FEDC 2UZIH 4MZ2A 3VWKC 5E7FA 1T7VA 4P3DA 1MVUB 3FB6B 2AP2A 3QZWA 5JORA 4IOFC 5EU7C 1HSAB 2APXA 1YQVH 4QOKE 4IJ3B 1BQHB 3FTGA 4OZIF 2EO9A 4Z8FL 2XT1B 3QO1B 3PHOA 3TCLB 5H8DA 3QNZB 1TNMA 4JFFE 4KV5F 5FYKE 2XA8H 5IT2H 3QIBD 1FQ9C 1KB5B 1WCBB 4LFHG 2KH2B 2PNDA 4OKDA 3X12B 1S7QB 3CFJA 3DX9B 3D85B 3EYSL 1ZHNB 3O45B 4ZUSB 5H35A 5IB4B 1K5NB 5JR1L 1Q9KB 3DUSB 4YK4B 4YDIL 3C6LC 4ODWB 3V5KB 2IAMD 5KSBB 1T5XB 2HN7B 3GJFA 1SY6A 1OTSC 4NZUL 4NQEE 5CD3A 3DUUA 3FCTA 4PRBA 4PG2C 4OCRH 4EN3C 3T3PF 3ARBC 1BBJB 2Y7QB 3MRLB 4LAJH 3JUZA 2CK2A 1G7MB 2BSRB 3HE7C 4NC1C 4HUUB 1IM3A 3MNVB 3FQRA 1NC4A 3P73A 3ULUD 2A6JA 4AM0B 5EZOH 3D39D 2PKDA 2KL6A 3OR7A 3BH8B 4BK4A 3GI9H 2DOCA 4GW1B 1YEGH 4NUJB 3V5DB 2UWEB 4W4OA 2IBZX 5IVXE 4OT1H 4J6RL 3VU2A 5CBAA 1OD7A 3M45A 3VI3E 2CIIB 3V7AG 1J1XL 5JUEL 5F7FA 5DRZB 3C60C 1ND0A 2JLLA 3REVB 5HHPB 3EYQC 4ZPTA 1OAQH 1UM5H 1ZEAL 2E9BA 5ERWA 4Y2DA 1BZ7A 3RNQA 4L1HA 3GKZA 4WFHE 2FX8H 1BZ9A 1JZ6A 4NWTH 1I7UA 5EU7E 5DD0H 1CD9B 4M43L 3F6LA 4JN2A 5LQBL 3C08L 5E6YA 3W82A 4QRPD 4Y16C 1A7PL 3BZFB 1N0XL 4NHCH 5EOTA 2OZ4L 4IS6B 5CIPB 1FIGH 4AMKL 2AV1A 3QIUA 1CFBA 2O5ZL 3NCJH 3ARFD 3C8HA 3HMXL 3AMLA 1LK2A 5AEAA 1UT9A 2VDPL 1QSEA 4P5TD 2KDGA 4UOW0 5HGHB 1JWUA 4HX1A 2QSTA 4PJHB 1KYOK 2DQHL 1KEML 1U92A 2VIRA 5ISZD 5HYQA 3ARVA 3PDDA 5L9DL 1BFTA 3S37L 3P0VL 2VXSH 1CD1A 4YDVB 2AK4D 3ETBF 1IGML 4NC1E 4WY7L 1K8DB 3H7BB 1U91B 5KOMC 3U46A 3O3DB 4M62H 5LGHH 4LSVH 2DJ4A 1WAAA 4YZFF 4BYHA 2RHEA 1CE6A 3J7HA 2QKIA 4P49A 3FZUC 5DLMH 4ZPVA 3UJJH 3WLBB 1CXFA 3JWDH 1QHOA 4GG6F 2Y36H 4AEEA 4PJFE 4IRJD 2AVGA 4TTDD 1ZHKA 4QHLB 1NUGA 4PY7B 2LU3A 5IQ9B 2NZ9C 4JFQA 4PJGF 3KLAB 2FD6H 4KDWA 5AZEH 2A9MH 4UV4L 1AR2A 2XZQH 3HLAA 2JE8A 4M6NH 1FYTA 2JB6A 2QQKH 5HI4D 4PRPA 5KG9B 4ZODA 2H8PA 5BZDB 3BSZL 3Q5OA 2CK0L 3O4OB 3VD4A 4P46D 3WL9A 2L0DA 2EEAA 3RZCA 4D9LH 1FN4B 4GSDH 1IGFL 2F5AH 3SE3C 2K7PA 1G7HA 3E3QC 3WN5B 1FGVL 4PJ8B 2EH7L 1CLYL 1S7VB 1EEYB 4DVRL 2VC2L 3NIFE 3E8UL 1JPFA 3EDDA 3ARGD 4QEGA 3RP1A 1JMZA 2WM0A 5T5NF 3GSUA 5IQ7L 3JTSA 4LL9A 1GAFL 5B8CC 5JQ6H 5JMRA 1MCCA 4G8FA 4LCWE 1OB1A 3NH7H 3MRCB 5D96C 2YUXA 3OAYK 3G5YB 1I1AD 4X7SH 1UKTA 1JWSA 1NCCH 2AJSH 3UPRB 4HCRA 3L5WA 3O6KL 2FO1A 4OFPA 5FFLA 1S7SA 2ID5A 4K3JH 3MR9A 4MDJA 2VABA 3P4OA 1RZ8A 3OAZK 3V6FB 3QJHB 3UTPE 4DW2L 5L8LB 2B20A 1KENH 3VGAC 3ZTJH 3V0VA 4DTGH 2X44D 4U1JA 1J1OL 1PY9A 1ZGLA 2VJXA 2NW3A 4BUGA 1A9BA 4Y1AD 3S3JA 4BUHA 2DIJA 4G43A 3U9PH 3UBXI 3T1WA 3PGCA 3EZJB 4JR9H 2ADFH 1UM4H 3SDCA 4H25B 1LO4L 5E9DD 4NQCB 5D6CA 1FVDB 3F62A 3UAJC 1N5YL 2B1AL 5IMOB 5LCVH 4XWOD 1QD0A 2ZUVA 4G8IB 5BMFL 4GXUM 2EYTA 4Y4HD 1YNTB 1NGQL 3KPLB 3QNXB 3KPSD 3TM6A 4PP1C 5I0DA 3SGEI 3BDYH 3IDGB 2X4RA 4P23A 2KPNA 1UXWA 3S35H 3W9DB 3HHRB 2E7LC 2W0LA 2E7BA