4BHRA

Structure of the ttha1221 type iv pilin protein from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
81
Chain Sequence
TAAQAYVRNVATAVEAERDPTTGALPQLPQACDQFVANPPASVTQCNVTANNDGVNFTVTAQLTYGSVSFDSSTGQFSFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PILIN, TYPE IV
publication title Structure and Assembly of an Inner Membrane Platform for Initiation of Type Iv Pilus Biogenesis
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Cell adhesion
total genus 20
structure length 81
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18682 PilA4 Pilin A4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.70 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4bhrA00
5G2FA 4BHRA
chains in the Genus database with same CATH superfamily
3LE8A 2G5ZA 2EJCA 1N2BA 2A88A 3AG6A 1V8FA 3CI0I 3IUEA 4MULA 1MOPA 4MUFA 4MUIA 4MUHA 3IOEA 3IVGA 3ISJA 1UFVA 3IODA 3UK2A 2GR8A 3COZA 3CI0K 2A50A 3MXTA 3CFFL 5HG0A 4DE5A 3AG5A 4DDHA 2G16A 3EMOA 5G2FA 5BW0B 3UY4A 1N2OA 2A54A 3MUEA 3COWA 3UA0A 3Q10A 2A53A 1N2HA 4MQ6A 4MUKA 2X3FA 2G3DA 1N2EA 2IECA 2OGFA 4G5FA 5EXCA 3IMGA 3INNA 3IUBA 3IVCA 2GW4A 3CFHL 4FZJA 3IOCA 3COVA 2A86A 3IOBA 2GR7A 4MUGA 4EFKA 2A56A 3IVXA 2I52A 3COYA 2LMEA 2A7XA 1N2IA 3IMEA 4MUEA 2RETA 1N2GA 4MUJA 3IMCA 4DDMA 4EF6A 2G2SA 5KWVA 3CFAL 3LF4A 3QTTA 3Q12A 4MUNA 1IHOA 4G5YA 2A84A 2A52A 3N8HA 3CFIA 4BHRA 1N2JA 4DDKA 4IXJA 3HL6A
chains in the Genus database with same CATH topology
3LE8A 2G5ZA 2EJCA 1N2BA 2A88A 3AG6A 1V8FA 3IUEA 4MULA 1MOPA 4MUFA 4MUIA 4MUHA 3IOEA 3IVGA 3ISJA 1UFVA 3IODA 3UK2A 3COZA 2A50A 3MXTA 3CFFL 5HG0A 4DE5A 3AG5A 4DDHA 2G16A 5G2FA 3UY4A 1N2OA 2A54A 3MUEA 3COWA 3UA0A 3Q10A 2A53A 1N2HA 4MQ6A 4MUKA 2X3FA 2G3DA 1N2EA 4G5FA 5EXCA 3IMGA 3INNA 3IUBA 3IVCA 2GW4A 3CFHL 4FZJA 3IOCA 3COVA 2A86A 3IOBA 4MUGA 4EFKA 2A56A 3IVXA 3COYA 2A7XA 1N2IA 3IMEA 4MUEA 1N2GA 4MUJA 3IMCA 4DDMA 4EF6A 2G2SA 5KWVA 3CFAL 3LF4A 3QTTA 3Q12A 4MUNA 1IHOA 4G5YA 2A84A 2A52A 3N8HA 4BHRA 1N2JA 4DDKA 4IXJA 3HL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2F A;  4BHR A; 
#chains in the Genus database with same CATH topology
 3LE8 A;  2G5Z A;  2EJC A;  1N2B A;  2A88 A;  3AG6 A;  1V8F A;  3CI0 I;  3IUE A;  4MUL A;  1MOP A;  4MUF A;  4MUI A;  4MUH A;  3IOE A;  3IVG A;  3ISJ A;  1UFV A;  3IOD A;  3UK2 A;  2GR8 A;  3COZ A;  3CI0 K;  2A50 A;  3MXT A;  3CFF L;  5HG0 A;  4DE5 A;  3AG5 A;  4DDH A;  2G16 A;  3EMO A;  5G2F A;  5BW0 B;  3UY4 A;  1N2O A;  2A54 A;  3MUE A;  3COW A;  3UA0 A;  3Q10 A;  2A53 A;  1N2H A;  4MQ6 A;  4MUK A;  2X3F A;  2G3D A;  1N2E A;  2IEC A;  2OGF A;  4G5F A;  5EXC A;  3IMG A;  3INN A;  3IUB A;  3IVC A;  2GW4 A;  3CFH L;  4FZJ A;  3IOC A;  3COV A;  2A86 A;  3IOB A;  2GR7 A;  4MUG A;  4EFK A;  2A56 A;  3IVX A;  2I52 A;  3COY A;  2LME A;  2A7X A;  1N2I A;  3IME A;  4MUE A;  2RET A;  1N2G A;  4MUJ A;  3IMC A;  4DDM A;  4EF6 A;  2G2S A;  5KWV A;  3CFA L;  3LF4 A;  3QTT A;  3Q12 A;  4MUN A;  1IHO A;  4G5Y A;  2A84 A;  2A52 A;  3N8H A;  3CFI A;  4BHR A;  1N2J A;  4DDK A;  4IXJ A;  3HL6 A; 
#chains in the Genus database with same CATH homology
 3LE8 A;  2G5Z A;  2EJC A;  1N2B A;  2A88 A;  3AG6 A;  1V8F A;  3IUE A;  4MUL A;  1MOP A;  4MUF A;  4MUI A;  4MUH A;  3IOE A;  3IVG A;  3ISJ A;  1UFV A;  3IOD A;  3UK2 A;  3COZ A;  2A50 A;  3MXT A;  3CFF L;  5HG0 A;  4DE5 A;  3AG5 A;  4DDH A;  2G16 A;  5G2F A;  3UY4 A;  1N2O A;  2A54 A;  3MUE A;  3COW A;  3UA0 A;  3Q10 A;  2A53 A;  1N2H A;  4MQ6 A;  4MUK A;  2X3F A;  2G3D A;  1N2E A;  4G5F A;  5EXC A;  3IMG A;  3INN A;  3IUB A;  3IVC A;  2GW4 A;  3CFH L;  4FZJ A;  3IOC A;  3COV A;  2A86 A;  3IOB A;  4MUG A;  4EFK A;  2A56 A;  3IVX A;  3COY A;  2A7X A;  1N2I A;  3IME A;  4MUE A;  1N2G A;  4MUJ A;  3IMC A;  4DDM A;  4EF6 A;  2G2S A;  5KWV A;  3CFA L;  3LF4 A;  3QTT A;  3Q12 A;  4MUN A;  1IHO A;  4G5Y A;  2A84 A;  2A52 A;  3N8H A;  4BHR A;  1N2J A;  4DDK A;  4IXJ A;  3HL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...