4BI4A

Structure and function of amidase toxin - antitoxin combinations associated with the type vi secretion system of serratia marcescens.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
163
structure length
163
Chain Sequence
b'MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTAAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSP1 C50A MUTANT
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
total genus 46
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi4A01
4BI8B 4BI3A 4BI4A
chains in the Genus database with same CATH superfamily
4BI8B 3ASKA 3A8OB 3UT1A 4M7AG 1M9SA 5FWCA 2MIOA 3PVQA 3V7SA 4C5GA 5GAMf 2XD0A 2EQKA 2C06A 2HEQA 3MEAA 2CKKA 5LJ3d 3S6WA 2RH2A 3QHSA 1WDXA 3CCQT 7AT1B 2XI9A 2QQSA 2M9UA 3MP1A 2EJGA 5EG2A 2KGTA 4C0GA 5LJ5f 1O9SA 2ZPHB 4F7UA 3M0SA 2MYSA 1JXOA 3CCMA 3GIBA 2CDTA 3UATA 3CCST 1YITA 5IHNA 3QIIA 4KH0B 2YHTA 2DD5A 4P5NA 1NM7A 2XKOC 1GBQA 3QXEB 4J9CA 1VQ7A 2KK4A 2D0NA 3JCMJ 3LGFA 4PK4A 3L2VA 3LWHA 1NJIU 2LZ6B 3CC7A 1QVFP 1Q81C 2QQBA 2HMAA 1M2VB 2COYA 1OPLA 3O5ZA 3OYMA 1UECA 1WXTA 2C0OA 4D8KA 1K8AU 3CMEQ 2EYXA 4C92F 3PMTA 4QW2A 5HK0A 2GTOA 4M7DC 3EFRA 2ROLA 4JJBA 1M8MA 3ZFJA 3P8DA 3G71T 4ZTFA 4Y92A 4UC4A 3RESA 2E5QA 3TVTA 2HCKA 1OX9A 3G6EA 4ELZC 1FMWA 2QK0A 3N5BB 4FT2A 1IB8A 2A36A 1FYNA 3EGDB 2O9SA 4RTWA 2EAYA 3OYHA 2M02A 2QEXT 4A4FA 4RUGA 2EJFA 2OTLT 2YRVA 2FEIA 1NPPA 2M51A 1SHGA 1M2VA 3ZEHA 1TOVA 2G6FX 2H8HA 2DM1A 2JVVA 3CBMA 4C8QE 2E65A 2W0ZA 3EG1A 2PU9B 3MP8A 4TVRA 1M90R 4C92D 5GAMj 4BY6B 4C5HA 2CYZB 5J39A 4KGVB 5IAYA 3QWXX 3CCMQ 1YITQ 2DYIA 3T9NA 3MCAB 5I21A 3TREA 2E6ZA 2CT3A 2XIDA 1KC8R 5CQXA 5GMKh 2L0AA 3CXCP 4M7AB 1VQ7Q 5A0LA 3E9GA 4E7IA 4QKUA 3BDLA 1JXMA 3VV0A 2PUOB 3QKJA 2RI5A 3CC7Q 1WLPB 2AT1B 2YLCA 1K0SA 3EGDA 4A63B 2SEMA 4OMLA 4F7UE 2EYYA 1FMVA 3URGA 2EBPA 4M7DF 2YUQA 3FIFA 1JJ2P 5L23A 3JCMW 2FYKA 1OQKA 4BDZA 2EWNA 4FIBA 1UJ0A 2GGRA 4WCIA 3G6EQ 3UA6A 5IN1A 2OX7A 2AIRB 5J26A 3DLMA 4XTYA 3V8LA 2DXBA 5KYXB 5GMKe 5GAN7 2CH4A 5IHIA 4M7AA 2NYSA 1QLYA 2LRQA 2DJQA 4LDWA 4AG1C 5CO7A 1YBYA 3SD4A 1K73R 2J7IA 3JB9H 2X51A 2E5KA 4RTYA 4J6YA 4Y91A 4F17A 2QDLA 2K3BA 1ARKA 3FDRA 2L3SA 2W10A 2FL7A 3REBB 3ME9A 4DOWA 1NEGA 4PJLA 3BY7A 2CT4A 1Y0MA 3O8VA 3JB9G 3JSCA 2HAXA 5GAN4 2LP5A 2HQHA 3UF4A 1WHLA 1WA7A 2BE7D 1UG1A 3JCMf 1QKWA 1M5Q1 4RG8A 5GAN6 5KE3A 1UGRB 3JCMc 2DD4A 3LLRA 1LPLA 1G3SA 3QWYA 4J5YA 4DBRA 2DZCA 1Q82U 1I4K1 3H8ZA 3M0UA 3VS3A 2YUPA 4C0ZA 4AFQC 5CKEA 4FM4B 2M16A 1NPRA 2VYTA 5FU7C 4PFOA 2L89A 2HKQB 3H6ZA 3GPLA 1WXBA 2X3XD 2COWA 1SRMA 1QP3A 2LNVA 4C8QC 1TUCA 1VQ6T 4JS5A 4C0FA 2F2WA 1VIFA 2GCXA 2DL4A 9ATCB 1W70A 1M4ZA 1KHCA 5A0GA 4RTUA 3OSVA 1WI7A 1N5ZA 4QT7A 3QPHA 4Z02A 1BKBA 4JJNK 2KT8A 2DL8A 4ATOA 2WACA 2K6DA 1UGSB 1ZA1B 1VQNT 3RDVA 1W4SA 5GAMh 3CCRA 3PMIA 2QG9B 3FEOA 4PFPA 3QZ5B 1D3BB 4HT8A 1TUGB 1Q95G 2EGCA 5C6SA 2DERA 2JTFA 1UUEA 2AZSA 2QYZA 1M3AA 2RNAA 2KRSA 4J9BA 2DVEA 2O4XB 1GCPA 2MOXA 4PFZA 3RUXA 1PC0A 2JM9A 4N4GA 1YJ9T 2LQ8A 1PD1A 2XHCA 3SWNC 1YJNT 3LH0A 3I56A 3JCMP 4BE0A 3OS0A 2VWFA 2IIMA 5D6YA 2KQWA 1WNLA 4HCZA 2KDSA 1YIJT 3ZBDA 3S3MA 1RI9A 1R0CB 2VB6A 2K3XA 3E9FA 4M7AE 3MO8A 2K57A 2YT6A 1NLPC 3KUFA 3UPUA 1PRLC 4XTXA 1KQSP 1WJQA 5HK3A 5D6XA 5GAN3 2KXDA 1ZUKA 3CC2T 2HQEA 1OI1A 1M30A 3QDRB 3PVLA 4FYWB 4LXCA 1D3BA 2LT1A 5GAMe 1KQ1A 1WHMA 1J3TA 1C6VX 5KE2A 2A37A 1BI0A 2LCSA 4BUGA 3S3OA 4LN2A 3VRZA 2K79A 3CPWS 5DM7R 4C8QF 3EHRA 4QVDA 1PG5B 5GANd 1QVGP 2CP5A 2BIVA 5LJ5e 1YI2A 2LX9A 1YWPA 2DBKA 4ZGEB 1CKAA 2F69A 3IQLA 2QI2A 2DAQA 4QVZA 4L6V5 3LGLA 1OZ2A 3OYJA 2Y90A 1N8RU 1PKTA 2PVGB 2BZ8A 4EPCA 1Q7YU 4JLGA 5GMKl 2EYQA 3G4SA 3PIPA 1BCOA 4V2SA 2K4YA 2EQIA 1FMKA 3VS0A 2EYZA 2D6FA 4A4KA 4DEYA 3CCRQ 5AYFA 2NWMA 4L59A 2ZPEB 1W2BP 1VQ4A 1SEMA 3JCMb 3HPWA 4NS5A 3QBYA 4B6MA 1TXQA 4C0DB 4ZTJA 2BZXA 2C0IA 1SHFA 1RLPC 2L3QA 2O01E 4II1A 1LNXA 1QVPA 4N4IA 2KNBB 3RKYA 3I56Q 4O5VA 1Y96B 4M4ZA 1KK7A 2A3LA 2DEQA 2RI2A 3OA6A 3OQ5A 4IURA 3L42A 2JJ9A 4HKEA 4PJJA 4PLIA 3M55A 2CZ6B 3J81E 4M77G 1KFZA 3M5AA 1M1KR 1VQKT 4N0AA 3CCLT 2KY9A 1U5SA 5D7UA 2YRDA 2DYBA 2AK5A 1QCFA 2IVWA 3QZ9B 5GAN8 1GCQC 2RK2A 1MMNA 2O31A 2JM8A 3OBWA 4J83A 4OMFB 4IUVA 4NOYA 1QQJA 2X4XA 5GMKm 4BY6C 1M3BA 3RMQA 4XTUA 3FJPA 4FYXB 1YI2Q 2DL5A 1K76A 2DTOA 3D7SB 1D1CA 2DL3A 2P0KA 4J6XA 3GBQA 4PJOG 1VQPT 2BZYA 2QQRA 2ED0A 2WSEE 4IUUA 4M7AC 3G4SQ 1RAAB 1K73C 4Y28E 2GBQA 1TH7A 3NTKA 5GAMg 1AOJA 2J06A 2F2VA 4JUVA 4JJCA 1VQOA 1KJWA 1X43A 1D0YA 3CC4Q 2DKGA 4JRQA 2P4TA 1QMCA 2DILA 2I2LA 4IUQA 1VQLT 5CK9A 1YCSB 1I0CA 1U3OA 1VQ5A 5LJ5g 1VQ4Q 5KYUB 3RKWA 1VQ8T 1NZ9A 3HHTB 3DLLA 3DB3A 3A8LB 1BU1A 1TTHB 2CSQA 4OB2B 3C12A 1Q86U 1IHVA 1MNDA 2SRCA 3QDFA 1Q82R 1TS9A 3CCQA 5DLOA 1R8OB 2PVDB 3H41A 3QSUA 3JCMh 2FHDA 2RQTA 2K5FA 2XDBA 2VGMA 1XNIA 3PGGA 3CCSA 4M77D 4X9DA 2LNHB 1OYXA 2X9HA 2HDAA 2KXCA 3H9NA 1B3QA 1AZEA 1VIEA 1OZ3A 2A0FB 1QWEA 3MHXA 5KYUA 4BI3A 4MMKA 1SRLA 4JJDA 3OYYA 2K2MA 4D8DA 1AWWA 1SKUB 2DJZA 6AT1B 3FRNA 1QVFS 3C4SA 1KD1R 1NYGA 2DX1A 2DXTA 3EG2A 3HFNA 1X75C 3A8MB 2RJFA 1AZGB 4M7AF 2L2PA 1VYUA 1N9RA 4M77B 1Q81U 1GRIA 1K9MR 4X1VA 5AT1B 1W1FA 1WPYA 1U1TA 4C5EA 1Z9QA 2NLUA 3SDZA 1X2QA 3EHQA 4PJOD 3OYDA 1VQOQ 1OV3A 2LQNA 3QYGB 4ANJA 3JCMe 1TSFA 1AWJA 1G3TA 2L5QA 3C95A 4QQGA 3G71A 2O9VA 3OYGA 2HQXA 2JXBA 2EKOA 1VQ5Q 5GANh 3PTAA 5I22A 5LJ3j 1B7TA 2F5TX 4OMNA 2KE9A 5FU6B 2V26A 4MZTA 3RIRA 2QEXA 4AFZC 2DE0X 1T0JA 4LDYA 1BI1A 2OTLA 5GJVB 4XU0A 4ZGJB 2M0YA 2MMPA 5LJ5d 3MP6A 4PJOB 2DXCA 1ABOA 2JW4A 1LVKA 1I5LA 1WHGA 4OMPA 3CCQQ 1X6OA 1QW1A 2M0OA 2RA2A 2CUDA 4OMQA 1ACMB 4JRPA 1MNEA 4LNPA 1JU5C 2DTIA 1EIFA 4M7AD 4LDVA 2EFIA 4LDXA 2RQVA 4M77A 2DO3A 5A2QE 2DNUA 4R55A 2AKLA 3CCSQ 3VU3C 4E7JA 4QVCA 2NUTB 4ZGDB 2O2OA 1Q7YR 1S1NA 3NTHA 2MK5A 3OS5A 3U23A 2KEAA 5CIUA 1NLOC 3QG1A 2LJ0A 1BIAA 2E3IA 8AT1B 3CXCS 3CBPA 2EW3A 4EMHA 1D1BA 1YN8A 2VVKA 2RHYA 2ENMA 1KQ2A 2VV5A 3G1JA 4Z8AA 1G5VA 5GAOp 2MF2A 4M7DG 2PNIA 2ZPBB 1G3YA 3CMAA 4AFSC 1GFCA 3X28B 2HD0A 4WF2A 1QVFA 1S72T 4PJOA 4Q5WA 2QA4T 1GFDA 4QQDA 4DBHA 3QO3A 2X4JA 2EGAA 2P0QA 1ZSGA 3CMAT 4GLMA 2ZCFB 3G71Q 3M56A 4RCCA 2ZPIB 1PKSA 3P8BB 1UFFA 2NUPB 3R6OA 5IHKA 5KH6A 1IZ6A 4JZ4A 3TQ7P 1N6AA 4D6WA 2NUTA 1AD5A 2XDDA 4X9CA 1K1ZA 1XTDA 2CP6A 4F16A 2GF7A 3HTRA 4C5IA 2QEXQ 3SFMA 3FLGA 1I5OB 2OTLQ 1M1KC 1YWOA 2LX7A 3QJYA 1RAFB 2YDLA 1ZA2B 2J6OA 3JCMg 4N0AC 4MZPA 4J9FA 2D0QB 2L3PA 5I11A 4AFUC 5I2SA 3I55T 1G2BA 3KXTA 1RLQC 1CSKA 5IXFA 2ATCB 4JRIA 1KSWA 2FPFA 2KI7A 3M0QA 3AT1B 1GL5A 3QYHB 3X20B 1LCKA 4BB7A 2KBTA 2E6NA 4J7FA 3CCET 2EYWA 4C0DC 1M27C 2VXFA 1KHIA 2CZ7B 1NBEB 2OTJT 3MJXA 2V8JA 1I8FA 2NUPA 2ZPFB 5CCAA 3PFSA 2EGEA 1YJWT 5CAIA 4XAXB 1UTIA 1HD3A 2VGNA 4RG2A 3RKXA 4R56A 3PT9A 1QWFA 1K4US 3EAEA 3CXCA 4GY5A 4M77E 3VS2A 1FXXA 8ATCB 3VUBA 2YUOA 1PD0A 4BE2A 3OYBA 5DLQE 4FU6A 1M1GA 5LJ3h 1Y7XA 1WXUA 2V8KA 4CC4B 2XG8D 4KH1B 2HL3A 1RAGB 1XJWB 2RMOA 3MPUB 1VQ6A 1KG1A 3FC3A 5KCOA 4M75G 1ZSZB 1D09B 2YXYA 4IUTA 4ZN3A 4OMOA 3I35A 2RJDA 4MDWA 4M78G 2CREA 1LJOA 1JJ2A 1BI3A 2I0NA 2LMJA 1OULA 4RTTA 3E1SA 1PSEA 2JZ2A 4ORZA 2OI3A 3GP8A 1VQNA 5CR2A 1VQMT 1TWBA 2AKKA 3I9QA 1XOVA 3JB9F 2VKNA 2DZ9A 5HKCA 4PJOE 2RM4A 4AG2C 1MMGA 5FRMA 4A4GA 1YJ9A 1V76A 1IXDA 1TU0B 1YJNA 1HK9A 4DBFA 1WIEA 4J6WA 2O88A 2ED1A 2CZ0B 2BKDN 2R5AA 2J6FA 4J9GA 3OYIA 2L3RA 1YIJA 2ESWA 2PTKA 4F14A 2RB6A 2RQWA 5GANf 1I07A 2BE9B 1NJIR 1UE9A 1ZSZA 3JCMV 3EFSA 1KD1C 4OGCA 3A1PA 1AT1B 4A4HA 2JS0A 2FPDA 2QXFA 4KULA 3CD6T 4KBMB 1K8AR 3HRSA 3CC2A 1WFWA 1K9MC 2F2XA 4PLLA 3REAB 3JB9D 1D1AA 1ABQA 4M7DA 4LD9K 2E64A 1WZOA 2FVUA 2MAMA 3H0IA 5GAOl 2XK0A 2P4RA 1FX7A 1I81A 1WHHA 3F70A 3ER0A 1O75A 1RACB 1VQ6Q 4VUBA 2QTVA 1VYVA 3TCJA 4J9HA 3EH1A 1R0BG 5GJWB 1QVGS 2MWPA 4FYVB 1NEBA 3Q1JA 1E6HA 2CP7A 2JT4A 3M57A 2BUDA 3H0HA 1AWXA 4M75D 1AVZC 2FB7A 4NL2A 3OYFA 2H3JA 4RKUE 3G7ZA 1VQ9T 3OW2P 5EC7A 1F1BB 1VQNQ 5J3BA 2GFUA 1HSQA 3GNGA 1Y07A 2LQWA 4LDUA 3JCMX 3AHUA 3L2UA 1R77A 3CCVA 3CCUT 1T0HA 1D0XA 4CC3A 3OSSC 4M77C 3VKIA 3CPWP 3QJ6A 1M3CA 2OJ2A 1YJ9Q 2X3WD 1M90C 1YJNQ 1K9AA 3CCJT 3CBOA 3CCVT 4M75B 2LDMA 3M0RA 4F7UF 2ZAEA 2NUZA 1YIJQ 1EZZB 1JEGA 1SSHA 4IIOA 1YP5A 1VUBA 2HNIA 4M78B 1KC8C 4LUEA 3MKDA 2LCCA 2HZYA 2M1HA 3I5SA 3EG3A 3RBBB 1VQKA 3CCLA 1JO8A 4L5GA 1EX4A 5FU6C 1DJ7B 4DOVA 2V1RA 4J9DA 3OYEA 2X4WA 1A0NB 5GAOm 3CC2Q 3CC4T 5KYNA 5GANj 4PJMA 2RQUA 2K5IA 1KQSA 2EIFA 4OGEA 1YCYA 4PJOC 1OPKA 2K7AA 4XK8E 3OS2A 1V29B 4Z88A 2FRWA 4ELYC 2HL5C 1XQHA 2EKHA 2K2VA 2LQKA 1YHQT 4KUDK 1RAEB 3BFMA 1BIBA 1BBZA 5FWBA 4M75A 1OX8A 1VQPA 3EGXA 1QVGA 2LJ3A 2K5LA 4E47A 5GMKi 1X01A 4M78A 4AMCA 3KBGA 4M7DE 3NHNA 4PKCC 5FW9A 4KUIA 4K11A 1VQLA 3M53A 1OEBA 1BK2A 4JPBW 1FWZA 2FPEA 2CP2A 4M77F 5LJ3f 1ZUYA 1VQ8A 4FSXA 2H3EB 1D0ZA 5L8RE 3LX7A 3RR6A 1UB4A 4CRIA 5FROA 4EDUA 3OYLA 2PQWA 1ZQ1A 1W2BA 1G83A 2JNGA 2CH4W 2V1QA 3RMSA 2V8IA 2A7YA 3M4YA 5C0MA 4E7HA 2DXUA 5GAN5 2KMTA 1WJSA 2JMAA 5CQYA 3JCMQ 2AZVA 2D8JA 4PNOA 3M59A 1UJYA 4FT4A 1VQKQ 1X6BA 5HY6A 3C94A 3CCLQ 1PHTA 4YTLA 1M8VA 2P84A 2DETA 3OYAA 3CMET 1ZBJA 2CSIA 2MCNA 2JTMA 4ME7A 4PJOF 4FCYA 1AWOA 1ZHIA 2K9GA 2DPPB 1Z9ZA 1JB0E 3JAME 1ZX6A 3RERA 2FO0A 3VS7A 2IPOB 2B8AA 4FL6A 2QQ9A 4QQ6A 4DBQA 4GBQA 4HVUA 2RK1A 4J9EA 4E7SA 3TEEA 1UHCA 4CC2A 1PCXA 3X24B 3OYNA 3EG9B 3LYIA 4JLIA 4A54A 1SPKA 2ZPGB 2MPXC 4C92G 1VQPQ 3TSWA 1GXIE 3OBYA 1WQWA 4E7LA 2YUNA 3V7CA 3VS6A 3NGPA 2RHIA 1BI2A 2DMOA 4BE1A 2J6KA 1H8KA 1WHKA 1VQLQ 3SWNA 4B9XA 1CKBA 1WQ7A 4EMKB 4HVWA 5D6WA 1TUDA 2EQUA 2E10A 2EQJA 3VRYA 2GQVA 2QDYB 3TSZA 1VQ8Q 1WX6A 2BTTA 4M75E 5KYYB 3CQTA 2DIGA 3CCMT 3A8GB 2VXEA 1YITT 1VYTA 1NJIC 5LL6S 4OMMA 1UGQB 2KYBA 2YSQA 4JS4A 2XICA 1ZSZC 4M78E 2KR3A 2VC8A 3JB9J 5GAMd 1QKXA 1K8AC 4J8OA 4NL3A 2KSSA 4HCKA 1VQ7T 4XQ3A 3EG9A 4ZNXA 2AHJB 2RI3A 1BCMA 1I1JA 1MHNA 2DK3A 2K3YA 4E7ZA 3CC7T 1JRIA 2R58A 3J7AF 2VASA 3V7RA 1T3LA 2JOYA 1X2KA 3VYGA 4EIKA 3OS1A 3A5ZB 1OU8A 4E6RA 3INZA 4IKFA 5FLXE 1OOTA 4EMKA 3META 2DL7A 4DQ2A 4E7KA 3BE3A 4DEXA 3OYCA 1GBRA 1N8RR 2XDPA 5KYYA 4RMOA 4LUDA 5GAOq 1PSFA 5CKBA 3G6ET 3DKMA 2EPDA 3A8HB 3M54A 3HRUA 4FW1A 2QAZA 3NMZC 1P92A 1S72A 5GANe 4J9IA 2QA4A 2F1LA 4XU1A 2RQRA 2DF6A 3HRTA 1RL2A 3FB9A 2Y4YA 4RTZA 5CKFA 3OYKA 1WGSA 1T3SA 1PM3A 1Y57A 1IGUA 5LJ5j 4XU3A 3S3NA 3PIOA 2X35A 1JJ2S 1SSFA 2F5KA 3WVDB 1N9SA 3PE0A 1AHJB 1UDLA 4C92B 2MI6A 2RHUA 1NYFA 1NG2A 2DTHA 4OB0B 4E2FB 2LT4A 1GCQA 2LJ1A 2FZCB 1M1KU 4ESRA 3OY9A 3I55A 1K0XA 4XTWA 3PNWC 4CI0C 2HKNA 2QGFB 3GF5A 3V8KA 2KRMA 2RF0A 2GFAA 3CCEA 3WXMB 4FYYB 1JQQA 2OTJA 4FSSA 4XTZA 4HA8A 5ECAA 3GOXA 1YJWA 1MGQA 2DFUA 4M75C 2JS2A 4BACA 4HT9A 4OP0A 3P8HA 1H641 3L1AA 2PZ1A 2CUBA 3A98A 2QTXA 1ZBXA 4R0KA 3X26B 1MUZA 4M78C 1YFNA 2PUKB 1X6GA 1B07A 1IREB 1OU9A 1S72Q 3THKA 4C92A 3NFCA 2QA4Q 1RADB 2HBWA 1IGQA 3SEMA 5M9OA 2RJEA 3SHWA 3CMAQ 4M7DD 1IRXA 1UHFA 3H0FA 1N27A 3VS1A 1BB9A 2GNCA 3UDCA 2ZZDA 5GAN2 1YNZA 1TG0A 4A53A 2YLBA 3KFVA 4F04B 1Q86R 1VQMA 4ZN1A 4LD6A 2JUFA 2ABLA 2KYMA 3HL8A 2E70A 4B9WA 5GANg 1WYXA 4XTVA 5KYXA 5A0DA 3EFOB 1ZUUA 1Q82C 3SB2A 4O6JA 2FRYA 1QP2A 5DY9A 1QCOA 3E2UA 4PL6A 2GQIA 2HSEB 2R5MA 4M7DB 4BDYA 2XU8A 1U06A 4MZMA 2OAWA 2XMFA 3HSBA 3JRZA 3L2QA 3I55Q 4BI4A 1KIKA 3UA7A 3WVEB 5CKHA 4OB3B 1V1CA 2A08A 1MMAA 3M0TA 3CCEQ 2B86A 2J05A 2OTJQ 1H92A 3CD6A 2COZA 5LJ3e 3M0PA 4XU2A 4M75F 2RO0A 1YJWQ 3JCMd 1B34B 2VUBA 1X69A 4J7IA 1PWTA 1E7OA 1Q81R 2KAFA 4M78F 1KD1U 3M4GA 1KQSS 3GNFB 5LJ5h 3EFOA 1K9MU 4C8QG 3CCRT 1RUWA 3L2WA 2RJCA 4AT1B 3QUIA 4CC7A 2JN0A 4JDSA 2ROTA 1SG5A 1UEBA 1IHWA 2HBPA 2DIQA 4PJNA 2CS7A 3GLXA 5GAOn 1VQ9A 3LWIA 5KCHA 3I56T 3BDUA 1VQMQ 3OW2S 3NTIA 3MEUA 2E3HA 4WTOB 4C92E 5KYWB 4HVVA 3CCUA 1B34A 5CKDA 4F7UG 3JB9I 1AEYA 5IXBA 1LOJA 2RN8A 4KGXB 1UGPB 1PNJA 4M78D 2Y4XA 3LW5E 2E41A 2PVOB 4MMLA 1U8RA 3CCJA 1EFNA 2E4HA 2CZ1B 2O4XA 2LC4A 2E1HA 3VJPA 2KROA 1W2BS 3FJ5A 2KVQG 5IH2A 3MEVA 2YRCA 4KGZB 3VS5A 2LCLA 4EMKC 4Z89A 3CEYA 2HSPA 1M90U 1N8RC 4A4EA 1Q7YC 3CPFA 1NE8A 1VA7A 4MDXA 2E12A 3M58A 2L8DA 3EGXB 1YI2T 4IUPA 4RTVA 2CP0A 3X25B 3CD6Q 3EGUA 2YWWA 3MEWA 2QASA 4N4HA 3CC4A 1KC8U 2P0PA 1WJRA 3ZL7C 3JV3A 4KRTA 3HKSA 3L2RA 2MWOA 2DRKA 2DLPA 3DB4A 3G4ST 2DVJA 2Z0WA 3OMCA 2IG0A 5KYWA 2WSCE 2RPNA 1RAIB 1G8XA 3E19A 3EG0A 1G3WA 5GAOr 1RI0A 1YHQA 1JBMA 3R6NA 2EVRA 1W6XA 4GLKA 3OB9A 1X27A 3C0CA 2LTOA 4C8QD 5I2MA 3L2ZA 1H3HA 2EJ9A 4RTXA 1VQ4T 2ZGWA 5LJ3g 1M2OA 3VUZA 2RD1A 1MV3A 4HCBA 3TU4K 2G3RA 1IO6A 3I5RA 1VQ9Q 3VS4A 2R57A 4JZ3A 2RHXA 2OAUA 2D9TA 3HP9A 2GTJA 1M1FA 3J80E 3V8JA 5FU7B 3CCUQ 3VYHB 4EMGA 1ZLMA 2JTEA 3OW2A 4BD3A 1RABB 4C8QB 4FW2A 1C1AA 2RHZA 2DA9A 4RCBA 5CVIA 3OMGA 2D1XA 2FZGB 2LVMA 2KRNA 2QQAA 2WSFE 2A28A 3CCJQ 1WHJA 1K73U 3CCVQ 1C0MA 2C0TA 3EH2A 2FZKB 1QCNA 3CPWA 4HXJA 3M9QA 3ULRB 1H3ZA 3RNJA 5IT9E 3LH5A 4OVAA 1PRMC 4OB1B 1Y96A 2D8HA 4X34A 1HJDA 1U1SA 2DBMA 4IIMA 2DRMA 2DEUA 1MV0B 5FRNA 4LE9A 4KT0E 4HCCA 3CMEA 1UGVA 1E6GA 2CP3A 1HYOA 1RAHB 1Y71A 2QGGA 3BW1A 5GMKj 1BYMA 2CGHA 1SF9A 4F7UB 5HCKA 4C92C 4JRKA 2FG0A 2ECZA 2EQMA 1HXDA 4OF1A 2JMCA 3SWNB 4DA4A 1VQOT 2X4YA 3UWNA 1MMDA 4C8QA 1YHQQ 2KT1A 3NPFA 1Q86C 1VQ5T 1VOMA 3HFOA
chains in the Genus database with same CATH topology
2RJDA 4MDWA 4BI8B 4M78G 3HRTA 3ASKA 1LJOA 3A8OB 1JJ2A 1BI3A 3UT1A 1RL2A 4M7AG 1M9SA 4L59A 3E1SA 1PSEA 2ZPEB 3FB9A 2JZ2A 2Y4YA 1VQNA 3GP8A 1VQ4A 5CKFA 5CR2A 3HPWA 3JCMb 3OYKA 4NS5A 3V7SA 1VQMT 4C5GA 3QBYA 1WGSA 1XOVA 5GAMf 2XD0A 3JB9F 2EQKA 4C0DB 4ZTJA 5LJ5j 4XU3A 5HKCA 2DZ9A 2C06A 4PJOE 2O01E 3MEAA 3S3NA 3PIOA 4II1A 2CKKA 1LNXA 3S6WA 5LJ3d 2X35A 2RM4A 1QVPA 2RH2A 3QHSA 1SSFA 4N4IA 2F5KA 3CCQT 1JJ2S 3WVDB 3RKYA 2XI9A 4O5VA 2QQSA 2M9UA 1Y96B 3MP1A 2EJGA 5EG2A 4C0GA 5LJ5f 5FRMA 1O9SA 2A3LA 2DEQA 4A4GA 2RI2A 1YJ9A 2ZPHB 1N9SA 3OA6A 4F7UA 3OQ5A 1YJNA 1HK9A 4XU1A 1AHJB 4J6WA 3CCMA 4IURA 3GIBA 3L42A 2CZ0B 4HKEA 4PLIA 3CCST 1YITA 3QIIA 2BKDN 3M55A 2R5AA 4C92B 2CZ6B 2YHTA 3J81E 2DD5A 2L3RA 2MI6A 3OYIA 1YIJA 4M77G 2RHUA 4P5NA 3M5AA 2XKOC 2DTHA 4OB0B 2RB6A 1VQKT 2LT4A 4N0AA 3CCLT 2KY9A 5GANf 3QXEB 1M1KU 1VQ7A 2KK4A 3OY9A 3I55A 3JCMJ 3LGFA 3PNWC 4XTWA 4CI0C 3JCMV 3L2VA 3EFSA 3LWHA 2IVWA 3QZ9B 5GAN8 1KD1C 3GF5A 1NJIU 3V8KA 4OGCA 3CC7A 2RK2A 4A4HA 1Q81C 2QQBA 2QXFA 4KULA 3CD6T 4KBMB 3HRSA 3CC2A 2GFAA 3OBWA 3CCEA 1K9MC 3OYMA 3WXMB 1K8AU 2OTJA 4J83A 4OMFB 4XTZA 4IUVA 4HA8A 2X4XA 4NOYA 5GMKm 4PLLA 4BY6C 3JB9D 4M7DA 3RMQA 3GOXA 4C92F 1YJWA 4LD9K 4XTUA 3FJPA 3PMTA 1MGQA 4M75C 4BACA 4HT9A 2E64A 4OP0A 3P8HA 4QW2A 2FVUA 2MAMA 2DTOA 1H641 3L1AA 5HK0A 5GAOl 2XK0A 1FX7A 4M7DC 1I81A 2P0KA 2QTXA 4J6XA 3F70A 3ER0A 1ZBXA 1O75A 4VUBA 3EFRA 4PJOG 3X26B 4M78C 3TCJA 2PUKB 2QQRA 1VQPT 3ZFJA 2WSEE 4IUUA 4M7AC 3P8DA 3G71T 4ZTFA 1QVGS 1K73C 2MWPA 4Y28E 4UC4A 3RESA 1IREB 1TH7A 2E5QA 3NTKA 3Q1JA 5GAMg 4JUVA 1VQOA 4C92A 3NFCA 3M57A 3G6EA 4ELZC 2BUDA 3N5BB 2DKGA 4FT2A 4M75D 2FB7A 4JRQA 4NL2A 2P4TA 3OYFA 5M9OA 2H3JA 2RJEA 2I2LA 4IUQA 4RKUE 3G7ZA 1VQ9T 1VQLT 5CK9A 4M7DD 1VQ5A 5LJ5g 2EAYA 3OYHA 5J3BA 2GFUA 1N27A 3GNGA 2QEXT 4A4FA 3RKWA 1Y07A 2EJFA 2OTLT 4LDUA 2YRVA 3JCMX 1NZ9A 1NPPA 3HHTB 1VQ8T 3AHUA 3L2UA 3UDCA 2ZZDA 5GAN2 3DLLA 3ZEHA 3DB3A 3A8LB 4A53A 2YLBA 3CCVA 3CCUT 1VQMA 4ZN1A 1KD1U 4LD6A 4OB2B 3C12A 2JVVA 3CBMA 4C8QE 2E65A 1Q86U 3OSSC 2JUFA 4M77C 3HL8A 3VKIA 2E70A 4B9WA 2PU9B 3QJ6A 3MP8A 4TVRA 5GANg 4C92D 5GAMj 4XTVA 4BY6B 4C5HA 2CYZB 5J39A 5A0DA 3CCQA 1M90C 5DLOA 1R8OB 2PVDB 3CCJT 1Q82C 5IAYA 3CBOA 3SB2A 3CCVT 4O6JA 4M75B 3JCMh 3QSUA 2LDMA 1QP2A 5DY9A 2FHDA 4F7UF 2K5FA 1VQ4T 2XDBA 3T9NA 3MCAB 5I21A 4PL6A 2E6ZA 3TREA 2VGMA 2XIDA 5CQXA 4M7DB 2R5MA 5GMKh 1XNIA 4BDYA 1VUBA 3PGGA 3CCSA 2HNIA 2XU8A 4M78B 1KC8C 4MZMA 4M77D 4X9DA 4M7AB 3HSBA 3JRZA 5A0LA 2LCCA 3L2QA 2M1HA 4BI4A 3E9GA 4E7IA 3BDLA 1OYXA 1VQKA 3VV0A 2PUOB 3CCLA 3QKJA 4L5GA 5FU6C 1DJ7B 2RI5A 3WVEB 4DOVA 5CKHA 3OYEA 2X4WA 4OB3B 2YLCA 5GAOm 1VIEA 1OZ3A 3CC4T 5GANj 4F7UE 3MHXA 4BI3A 2K5IA 4MMKA 3OYYA 1KQSA 2EIFA 4OGEA 4XU2A 1YCYA 5LJ3e 3CD6A 4M75F 4PJOC 3URGA 2RO0A 2DJZA 3FRNA 3JCMd 1B34B 1QVFS 3C4SA 4XK8E 2VUBA 3OS2A 1V29B 4J7IA 4M7DF 4ELYC 2DXTA 3FIFA 1XQHA 2KAFA 3HFNA 4M78F 1X75C 2FYKA 3M4GA 2K2VA 2LQKA 2RJFA 3A8MB 3JCMW 1YHQT 4BDZA 4M7AF 4KUDK 2EWNA 1N9RA 4M77B 1Q81U 1KQSS 4FIBA 3BFMA 3GNFB 1WPYA 1BIBA 5LJ5h 1U1TA 4C5EA 1K9MU 4C8QG 2NLUA 4M75A 3SDZA 3CCRT 4PJOD 3OYDA 3QYGB 3JCMe 1VQPA 3L2WA 5IN1A 2L5QA 1G3TA 3C95A 4QQGA 2RJCA 3G71A 5J26A 1QVGA 3QUIA 2K5LA 2JN0A 3DLMA 4XTYA 3V8LA 2DXBA 4E47A 2HQXA 1X01A 5GMKi 3OYGA 4JDSA 4M78A 5GMKe 5GAN7 3KBGA 2EKOA 4M7DE 4M7AA 1UEBA 5GANh 2HBPA 2LRQA 3PTAA 4MDXA 2DIQA 4LDWA 4PKCC 2CS7A 5CO7A 1YBYA 3GLXA 2F5TX 3SD4A 5LJ3j 5GAOn 4KUIA 1VQLA 1VQ9A 3JB9H 3LWIA 5KCHA 3I56T 4J6YA 3M53A 5FU6B 4Y91A 4MZTA 3RIRA 1FWZA 3BDUA 4M77F 2QEXA 4LDYA 1BI1A 5LJ3f 2OTLA 1VQ8A 4FSXA 3OW2S 3NTIA 3MEUA 5L8RE 3LX7A 3FDRA 1UB4A 4XU0A 4ZGJB 4CRIA 2MMPA 5FROA 4C92E 2FL7A 5LJ5d 3MP6A 3CCUA 4EDUA 3OYLA 2PQWA 4PJOB 3ME9A 4DOWA 1ZQ1A 2DXCA 1B34A 5CKDA 1I5LA 4F7UG 3BY7A 1W2BA 3JB9I 1X6OA 3O8VA 1QW1A 1LOJA 2JNGA 2M0OA 2RA2A 1UGPB 3JB9G 4M78D 4JRPA 2Y4XA 3JSCA 3LW5E 2HAXA 2DTIA 1EIFA 5GAN4 4M7AD 2E41A 2PVOB 2EFIA 4LDVA 4MMLA 4M77A 2V8IA 2A7YA 2DO3A 3M4YA 1U8RA 4LDXA 3CCJA 5C0MA 5A2QE 4E7HA 2DXUA 4R55A 5GAN5 2CZ1B 3VU3C 2KMTA 2O4XA 1WJSA 2LC4A 3JCMf 4E7JA 2E1HA 3VJPA 5CQYA 3JCMQ 1M5Q1 4PNOA 4RG8A 2KVQG 5GAN6 1W2BS 3M59A 3MEVA 4FT4A 4QVCA 5KE3A 5HY6A 4ZGDB 1UGRB 2LCLA 3C94A 2DD4A 3LLRA 3JCMc 4EMKC 4YTLA 1M8VA 1G3SA 4J5YA 3CEYA 3NTHA 3OS5A 1M90U 1N8RC 2DZCA 5CIUA 1Q82U 3OYAA 4A4EA 1Q7YC 3QG1A 1I4K1 3H8ZA 3CMET 1BIAA 3CPFA 4C0ZA 1NE8A 2JTMA 5CKEA 3CXCS 2E12A 3CBPA 4ME7A 4PJOF 4FM4B 4EMHA 2M16A 1NPRA 3M58A 2L8DA 2VYTA 5FU7C 4IUPA 1YI2T 2RHYA 1ZHIA 2L89A 2DPPB 1KQ2A 3X25B 2VV5A 3H6ZA 1JB0E 3MEWA 4N4HA 3GPLA 1G5VA 3JAME 3CC4A 5GAOp 2MF2A 3RERA 1QP3A 4M7DG 2LNVA 2P0PA 1KC8U 4C8QC 1WJRA 2ZPBB 2B8AA 1VQ6T 4FL6A 4JS5A 2QQ9A 4QQ6A 3HKSA 4C0FA 1G3YA 3L2RA 2MWOA 1VIFA 3CMAA 3DB4A 3G4ST 2GCXA 3OMCA 2IG0A 2RK1A 2HD0A 3X28B 4WF2A 1QVFA 1S72T 3TEEA 3OYNA 2WSCE 3X24B 1M4ZA 4PJOA 1KHCA 3LYIA 4Q5WA 5A0GA 2QA4T 3OSVA 4JLIA 3E19A 4QQDA 4A54A 1G3WA 5GAOr 1RI0A 3QO3A 1YHQA 2ZPGB 2X4JA 1JBMA 3QPHA 4Z02A 1BKBA 4C92G 2P0QA 4JJNK 4ATOA 4GLKA 1GXIE 2WACA 3OBYA 3OB9A 3CMAT 2LTOA 1WQWA 4C8QD 2ZCFB 1UGSB 5I2MA 3L2ZA 1VQNT 2EJ9A 3M56A 4RCCA 1W4SA 2ZPIB 5GAMh 2ZGWA 5LJ3g 3CCRA 3PMIA 4E7LA 3FEOA 3P8BB 3V7CA 3VUZA 2RHIA 3QZ5B 1D3BB 2RD1A 4HT8A 1BI2A 3R6OA 5KH6A 1IZ6A 4HCBA 5C6SA 3TU4K 1N6AA 2JTFA 4D6WA 2G3RA 4BE1A 2XDDA 3SWNA 4B9XA 4X9CA 1XTDA 2DVEA 2R57A 1WQ7A 4EMKB 2GF7A 5D6WA 2O4XB 4C5IA 2RHXA 3RUXA 2OAUA 4N4GA 3FLGA 2D9TA 3SFMA 2EQUA 1YJ9T 2E10A 2EQJA 2LQ8A 2GQVA 2QDYB 3HP9A 1M1KC 2XHCA 3SWNC 1YJNT 1M1FA 4M75E 3LH0A 3QJYA 3J80E 3I56A 3JCMP 4BE0A 2DIGA 3OS0A 3A8GB 3V8JA 3CCMT 2VXEA 5FU7B 5D6YA 3JCMg 1YITT 4N0AC 3VYHB 2KQWA 4EMGA 1WNLA 4HCZA 1NJIC 2KDSA 3OW2A 1YIJT 5LL6S 3ZBDA 4BD3A 4MZPA 1UGQB 4JS4A 2D0QB 3S3MA 4C8QB 2RHZA 2XICA 4M78E 4RCBA 2K3XA 2VC8A 3E9FA 3MO8A 3OMGA 5CVIA 3JB9J 5GAMd 4M7AE 2K57A 1K8AC 4J8OA 4NL3A 2KSSA 1VQ7T 2LVMA 3KUFA 4XQ3A 4XTXA 5I2SA 3I55T 2QQAA 2WSFE 3KXTA 2AHJB 3UPUA 1K73U 2RI3A 1WJQA 4JRIA 5HK3A 1MHNA 5D6XA 2DK3A 2K3YA 5GAN3 3QYHB 3CC7T 3CPWA 3M9QA 1H3ZA 3X20B 1JRIA 4BB7A 2R58A 5IT9E 3CC2T 3J7AF 2E6NA 2HQEA 4OVAA 3V7RA 1OI1A 2JOYA 4J7FA 3QDRB 4OB1B 3CCET 4C0DC 2VXFA 1KHIA 1Y96A 3VYGA 2CZ7B 2OTJT 2V8JA 4X34A 3OS1A 1D3BA 2LT1A 1I8FA 1KQ1A 5GAMe 1U1SA 3A5ZB 2ZPFB 5KE2A 5CCAA 3INZA 3PFSA 1YJWT 1BI0A 4XAXB 4BUGA 5CAIA 3S3OA 5FRNA 2VGNA 4RG2A 3CPWS 4IKFA 5FLXE 3RKXA 4KT0E 3PT9A 4C8QF 5DM7R 4R56A 4QVDA 4HCCA 3CMEA 4EMKA 5GMKj 3EAEA 1Y71A 3BW1A 4GY5A 3META 5GANd 3CXCA 4M77E 1BYMA 1FXXA 2BIVA 2CGHA 3RMSA 5LJ5e 4F7UB 4DQ2A 2LX9A 4E7KA 1YI2A 3VUBA 4BE2A 4C92C 3OYBA 4JRKA 4ZGEB 2F69A 5DLQE 3OYCA 2QI2A 2XDPA 2DAQA 2EQMA 1HXDA 4FU6A 1M1GA 4OF1A 4QVZA 5LJ3h 1Y7XA 4RMOA 2V8KA 4L6V5 3SWNB 2XG8D 1PSFA 3LGLA 1OZ2A 5GAOq 3OYJA 4DA4A 2Y90A 1N8RU 5CKBA 1VQOT 1VQ6A 1KG1A 2PVGB 3G6ET 4EPCA 2X4YA 3DKMA 1Q7YU 4JLGA 3UWNA 5GMKl 2EYQA 3FC3A 3PIPA 4C8QA 3A8HB 3M54A 3HRUA 3G4SA 5KCOA 4M75G 4V2SA 1P92A 2K4YA 1S72A 5GANe 2QA4A 2D6FA 4IUTA 4A4KA 1Q86C 1VQ5T 4ZN3A 3HFOA 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI8 B;  4BI3 A;  4BI4 A; 
#chains in the Genus database with same CATH topology
 4BI8 B;  3ASK A;  3A8O B;  3UT1 A;  4M7A G;  1M9S A;  5FWC A;  2MIO A;  3PVQ A;  3V7S A;  4C5G A;  5GAM f;  2XD0 A;  2EQK A;  2C06 A;  2HEQ A;  3MEA A;  2CKK A;  5LJ3 d;  3S6W A;  2RH2 A;  3QHS A;  1WDX A;  3CCQ T;  7AT1 B;  2XI9 A;  2QQS A;  2M9U A;  3MP1 A;  2EJG A;  5EG2 A;  2KGT A;  4C0G A;  5LJ5 f;  1O9S A;  2ZPH B;  4F7U A;  3M0S A;  2MYS A;  1JXO A;  3CCM A;  3GIB A;  2CDT A;  3UAT A;  3CCS T;  1YIT A;  5IHN A;  3QII A;  4KH0 B;  2YHT A;  2DD5 A;  4P5N A;  1NM7 A;  2XKO C;  1GBQ A;  3QXE B;  4J9C A;  1VQ7 A;  2KK4 A;  2D0N A;  3JCM J;  3LGF A;  4PK4 A;  3L2V A;  3LWH A;  1NJI U;  2LZ6 B;  3CC7 A;  1QVF P;  1Q81 C;  2QQB A;  2HMA A;  1M2V B;  2COY A;  1OPL A;  3O5Z A;  3OYM A;  1UEC A;  1WXT A;  2C0O A;  4D8K A;  1K8A U;  3CME Q;  2EYX A;  4C92 F;  3PMT A;  4QW2 A;  5HK0 A;  2GTO A;  4M7D C;  3EFR A;  2ROL A;  4JJB A;  1M8M A;  3ZFJ A;  3P8D A;  3G71 T;  4ZTF A;  4Y92 A;  4UC4 A;  3RES A;  2E5Q A;  3TVT A;  2HCK A;  1OX9 A;  3G6E A;  4ELZ C;  1FMW A;  2QK0 A;  3N5B B;  4FT2 A;  1IB8 A;  2A36 A;  1FYN A;  3EGD B;  2O9S A;  4RTW A;  2EAY A;  3OYH A;  2M02 A;  2QEX T;  4A4F A;  4RUG A;  2EJF A;  2OTL T;  2YRV A;  2FEI A;  1NPP A;  2M51 A;  1SHG A;  1M2V A;  3ZEH A;  1TOV A;  2G6F X;  2H8H A;  2DM1 A;  2JVV A;  3CBM A;  4C8Q E;  2E65 A;  2W0Z A;  3EG1 A;  2PU9 B;  3MP8 A;  4TVR A;  1M90 R;  4C92 D;  5GAM j;  4BY6 B;  4C5H A;  2CYZ B;  5J39 A;  4KGV B;  5IAY A;  3QWX X;  3CCM Q;  1YIT Q;  2DYI A;  3T9N A;  3MCA B;  5I21 A;  3TRE A;  2E6Z A;  2CT3 A;  2XID A;  1KC8 R;  5CQX A;  5GMK h;  2L0A A;  3CXC P;  4M7A B;  1VQ7 Q;  5A0L A;  3E9G A;  4E7I A;  4QKU A;  3BDL A;  1JXM A;  3VV0 A;  2PUO B;  3QKJ A;  2RI5 A;  3CC7 Q;  1WLP B;  2AT1 B;  2YLC A;  1K0S A;  3EGD A;  4A63 B;  2SEM A;  4OML A;  4F7U E;  2EYY A;  1FMV A;  3URG A;  2EBP A;  4M7D F;  2YUQ A;  3FIF A;  1JJ2 P;  5L23 A;  3JCM W;  2FYK A;  1OQK A;  4BDZ A;  2EWN A;  4FIB A;  1UJ0 A;  2GGR A;  4WCI A;  3G6E Q;  3UA6 A;  5IN1 A;  2OX7 A;  2AIR B;  5J26 A;  3DLM A;  4XTY A;  3V8L A;  2DXB A;  5KYX B;  5GMK e;  5GAN 7;  2CH4 A;  5IHI A;  4M7A A;  2NYS A;  1QLY A;  2LRQ A;  2DJQ A;  4LDW A;  4AG1 C;  5CO7 A;  1YBY A;  3SD4 A;  1K73 R;  2J7I A;  3JB9 H;  2X51 A;  2E5K A;  4RTY A;  4J6Y A;  4Y91 A;  4F17 A;  2QDL A;  2K3B A;  1ARK A;  3FDR A;  2L3S A;  2W10 A;  2FL7 A;  3REB B;  3ME9 A;  4DOW A;  1NEG A;  4PJL A;  3BY7 A;  2CT4 A;  1Y0M A;  3O8V A;  3JB9 G;  3JSC A;  2HAX A;  5GAN 4;  2LP5 A;  2HQH A;  3UF4 A;  1WHL A;  1WA7 A;  2BE7 D;  1UG1 A;  3JCM f;  1QKW A;  1M5Q 1;  4RG8 A;  5GAN 6;  5KE3 A;  1UGR B;  3JCM c;  2DD4 A;  3LLR A;  1LPL A;  1G3S A;  3QWY A;  4J5Y A;  4DBR A;  2DZC A;  1Q82 U;  1I4K 1;  3H8Z A;  3M0U A;  3VS3 A;  2YUP A;  4C0Z A;  4AFQ C;  5CKE A;  4FM4 B;  2M16 A;  1NPR A;  2VYT A;  5FU7 C;  4PFO A;  2L89 A;  2HKQ B;  3H6Z A;  3GPL A;  1WXB A;  2X3X D;  2COW A;  1SRM A;  1QP3 A;  2LNV A;  4C8Q C;  1TUC A;  1VQ6 T;  4JS5 A;  4C0F A;  2F2W A;  1VIF A;  2GCX A;  2DL4 A;  9ATC B;  1W70 A;  1M4Z A;  1KHC A;  5A0G A;  4RTU A;  3OSV A;  1WI7 A;  1N5Z A;  4QT7 A;  3QPH A;  4Z02 A;  1BKB A;  4JJN K;  2KT8 A;  2DL8 A;  4ATO A;  2WAC A;  2K6D A;  1UGS B;  1ZA1 B;  1VQN T;  3RDV A;  1W4S A;  5GAM h;  3CCR A;  3PMI A;  2QG9 B;  3FEO A;  4PFP A;  3QZ5 B;  1D3B B;  4HT8 A;  1TUG B;  1Q95 G;  2EGC A;  5C6S A;  2DER A;  2JTF A;  1UUE A;  2AZS A;  2QYZ A;  1M3A A;  2RNA A;  2KRS A;  4J9B A;  2DVE A;  2O4X B;  1GCP A;  2MOX A;  4PFZ A;  3RUX A;  1PC0 A;  2JM9 A;  4N4G A;  1YJ9 T;  2LQ8 A;  1PD1 A;  2XHC A;  3SWN C;  1YJN T;  3LH0 A;  3I56 A;  3JCM P;  4BE0 A;  3OS0 A;  2VWF A;  2IIM A;  5D6Y A;  2KQW A;  1WNL A;  4HCZ A;  2KDS A;  1YIJ T;  3ZBD A;  3S3M A;  1RI9 A;  1R0C B;  2VB6 A;  2K3X A;  3E9F A;  4M7A E;  3MO8 A;  2K57 A;  2YT6 A;  1NLP C;  3KUF A;  3UPU A;  1PRL C;  4XTX A;  1KQS P;  1WJQ A;  5HK3 A;  5D6X A;  5GAN 3;  2KXD A;  1ZUK A;  3CC2 T;  2HQE A;  1OI1 A;  1M30 A;  3QDR B;  3PVL A;  4FYW B;  4LXC A;  1D3B A;  2LT1 A;  5GAM e;  1KQ1 A;  1WHM A;  1J3T A;  1C6V X;  5KE2 A;  2A37 A;  1BI0 A;  2LCS A;  4BUG A;  3S3O A;  4LN2 A;  3VRZ A;  2K79 A;  3CPW S;  5DM7 R;  4C8Q F;  3EHR A;  4QVD A;  1PG5 B;  5GAN d;  1QVG P;  2CP5 A;  2BIV A;  5LJ5 e;  1YI2 A;  2LX9 A;  1YWP A;  2DBK A;  4ZGE B;  1CKA A;  2F69 A;  3IQL A;  2QI2 A;  2DAQ A;  4QVZ A;  4L6V 5;  3LGL A;  1OZ2 A;  3OYJ A;  2Y90 A;  1N8R U;  1PKT A;  2PVG B;  2BZ8 A;  4EPC A;  1Q7Y U;  4JLG A;  5GMK l;  2EYQ A;  3G4S A;  3PIP A;  1BCO A;  4V2S A;  2K4Y A;  2EQI A;  1FMK A;  3VS0 A;  2EYZ A;  2D6F A;  4A4K A;  4DEY A;  3CCR Q;  5AYF A;  2NWM A;  4L59 A;  2ZPE B;  1W2B P;  1VQ4 A;  1SEM A;  3JCM b;  3HPW A;  4NS5 A;  3QBY A;  4B6M A;  1TXQ A;  4C0D B;  4ZTJ A;  2BZX A;  2C0I A;  1SHF A;  1RLP C;  2L3Q A;  2O01 E;  4II1 A;  1LNX A;  1QVP A;  4N4I A;  2KNB B;  3RKY A;  3I56 Q;  4O5V A;  1Y96 B;  4M4Z A;  1KK7 A;  2A3L A;  2DEQ A;  2RI2 A;  3OA6 A;  3OQ5 A;  4IUR A;  3L42 A;  2JJ9 A;  4HKE A;  4PJJ A;  4PLI A;  3M55 A;  2CZ6 B;  3J81 E;  4M77 G;  1KFZ A;  3M5A A;  1M1K R;  1VQK T;  4N0A A;  3CCL T;  2KY9 A;  1U5S A;  5D7U A;  2YRD A;  2DYB A;  2AK5 A;  1QCF A;  2IVW A;  3QZ9 B;  5GAN 8;  1GCQ C;  2RK2 A;  1MMN A;  2O31 A;  2JM8 A;  3OBW A;  4J83 A;  4OMF B;  4IUV A;  4NOY A;  1QQJ A;  2X4X A;  5GMK m;  4BY6 C;  1M3B A;  3RMQ A;  4XTU A;  3FJP A;  4FYX B;  1YI2 Q;  2DL5 A;  1K76 A;  2DTO A;  3D7S B;  1D1C A;  2DL3 A;  2P0K A;  4J6X A;  3GBQ A;  4PJO G;  1VQP T;  2BZY A;  2QQR A;  2ED0 A;  2WSE E;  4IUU A;  4M7A C;  3G4S Q;  1RAA B;  1K73 C;  4Y28 E;  2GBQ A;  1TH7 A;  3NTK A;  5GAM g;  1AOJ A;  2J06 A;  2F2V A;  4JUV A;  4JJC A;  1VQO A;  1KJW A;  1X43 A;  1D0Y A;  3CC4 Q;  2DKG A;  4JRQ A;  2P4T A;  1QMC A;  2DIL A;  2I2L A;  4IUQ A;  1VQL T;  5CK9 A;  1YCS B;  1I0C A;  1U3O A;  1VQ5 A;  5LJ5 g;  1VQ4 Q;  5KYU B;  3RKW A;  1VQ8 T;  1NZ9 A;  3HHT B;  3DLL A;  3DB3 A;  3A8L B;  1BU1 A;  1TTH B;  2CSQ A;  4OB2 B;  3C12 A;  1Q86 U;  1IHV A;  1MND A;  2SRC A;  3QDF A;  1Q82 R;  1TS9 A;  3CCQ A;  5DLO A;  1R8O B;  2PVD B;  3H41 A;  3QSU A;  3JCM h;  2FHD A;  2RQT A;  2K5F A;  2XDB A;  2VGM A;  1XNI A;  3PGG A;  3CCS A;  4M77 D;  4X9D A;  2LNH B;  1OYX A;  2X9H A;  2HDA A;  2KXC A;  3H9N A;  1B3Q A;  1AZE A;  1VIE A;  1OZ3 A;  2A0F B;  1QWE A;  3MHX A;  5KYU A;  4BI3 A;  4MMK A;  1SRL A;  4JJD A;  3OYY A;  2K2M A;  4D8D A;  1AWW A;  1SKU B;  2DJZ A;  6AT1 B;  3FRN A;  1QVF S;  3C4S A;  1KD1 R;  1NYG A;  2DX1 A;  2DXT A;  3EG2 A;  3HFN A;  1X75 C;  3A8M B;  2RJF A;  1AZG B;  4M7A F;  2L2P A;  1VYU A;  1N9R A;  4M77 B;  1Q81 U;  1GRI A;  1K9M R;  4X1V A;  5AT1 B;  1W1F A;  1WPY A;  1U1T A;  4C5E A;  1Z9Q A;  2NLU A;  3SDZ A;  1X2Q A;  3EHQ A;  4PJO D;  3OYD A;  1VQO Q;  1OV3 A;  2LQN A;  3QYG B;  4ANJ A;  3JCM e;  1TSF A;  1AWJ A;  1G3T A;  2L5Q A;  3C95 A;  4QQG A;  3G71 A;  2O9V A;  3OYG A;  2HQX A;  2JXB A;  2EKO A;  1VQ5 Q;  5GAN h;  3PTA A;  5I22 A;  5LJ3 j;  1B7T A;  2F5T X;  4OMN A;  2KE9 A;  5FU6 B;  2V26 A;  4MZT A;  3RIR A;  2QEX A;  4AFZ C;  2DE0 X;  1T0J A;  4LDY A;  1BI1 A;  2OTL A;  5GJV B;  4XU0 A;  4ZGJ B;  2M0Y A;  2MMP A;  5LJ5 d;  3MP6 A;  4PJO B;  2DXC A;  1ABO A;  2JW4 A;  1LVK A;  1I5L A;  1WHG A;  4OMP A;  3CCQ Q;  1X6O A;  1QW1 A;  2M0O A;  2RA2 A;  2CUD A;  4OMQ A;  1ACM B;  4JRP A;  1MNE A;  4LNP A;  1JU5 C;  2DTI A;  1EIF A;  4M7A D;  4LDV A;  2EFI A;  4LDX A;  2RQV A;  4M77 A;  2DO3 A;  5A2Q E;  2DNU A;  4R55 A;  2AKL A;  3CCS Q;  3VU3 C;  4E7J A;  4QVC A;  2NUT B;  4ZGD B;  2O2O A;  1Q7Y R;  1S1N A;  3NTH A;  2MK5 A;  3OS5 A;  3U23 A;  2KEA A;  5CIU A;  1NLO C;  3QG1 A;  2LJ0 A;  1BIA A;  2E3I A;  8AT1 B;  3CXC S;  3CBP A;  2EW3 A;  4EMH A;  1D1B A;  1YN8 A;  2VVK A;  2RHY A;  2ENM A;  1KQ2 A;  2VV5 A;  3G1J A;  4Z8A A;  1G5V A;  5GAO p;  2MF2 A;  4M7D G;  2PNI A;  2ZPB B;  1G3Y A;  3CMA A;  4AFS C;  1GFC A;  3X28 B;  2HD0 A;  4WF2 A;  1QVF A;  1S72 T;  4PJO A;  4Q5W A;  2QA4 T;  1GFD A;  4QQD A;  4DBH A;  3QO3 A;  2X4J A;  2EGA A;  2P0Q A;  1ZSG A;  3CMA T;  4GLM A;  2ZCF B;  3G71 Q;  3M56 A;  4RCC A;  2ZPI B;  1PKS A;  3P8B B;  1UFF A;  2NUP B;  3R6O A;  5IHK A;  5KH6 A;  1IZ6 A;  4JZ4 A;  3TQ7 P;  1N6A A;  4D6W A;  2NUT A;  1AD5 A;  2XDD A;  4X9C A;  1K1Z A;  1XTD A;  2CP6 A;  4F16 A;  2GF7 A;  3HTR A;  4C5I A;  2QEX Q;  3SFM A;  3FLG A;  1I5O B;  2OTL Q;  1M1K C;  1YWO A;  2LX7 A;  3QJY A;  1RAF B;  2YDL A;  1ZA2 B;  2J6O A;  3JCM g;  4N0A C;  4MZP A;  4J9F A;  2D0Q B;  2L3P A;  5I11 A;  4AFU C;  5I2S A;  3I55 T;  1G2B A;  3KXT A;  1RLQ C;  1CSK A;  5IXF A;  2ATC B;  4JRI A;  1KSW A;  2FPF A;  2KI7 A;  3M0Q A;  3AT1 B;  1GL5 A;  3QYH B;  3X20 B;  1LCK A;  4BB7 A;  2KBT A;  2E6N A;  4J7F A;  3CCE T;  2EYW A;  4C0D C;  1M27 C;  2VXF A;  1KHI A;  2CZ7 B;  1NBE B;  2OTJ T;  3MJX A;  2V8J A;  1I8F A;  2NUP A;  2ZPF B;  5CCA A;  3PFS A;  2EGE A;  1YJW T;  5CAI A;  4XAX B;  1UTI A;  1HD3 A;  2VGN A;  4RG2 A;  3RKX A;  4R56 A;  3PT9 A;  1QWF A;  1K4U S;  3EAE A;  3CXC A;  4GY5 A;  4M77 E;  3VS2 A;  1FXX A;  8ATC B;  3VUB A;  2YUO A;  1PD0 A;  4BE2 A;  3OYB A;  5DLQ E;  4FU6 A;  1M1G A;  5LJ3 h;  1Y7X A;  1WXU A;  2V8K A;  4CC4 B;  2XG8 D;  4KH1 B;  2HL3 A;  1RAG B;  1XJW B;  2RMO A;  3MPU B;  1VQ6 A;  1KG1 A;  3FC3 A;  5KCO A;  4M75 G;  1ZSZ B;  1D09 B;  2YXY A;  4IUT A;  4ZN3 A;  4OMO A;  3I35 A;  2RJD A;  4MDW A;  4M78 G;  2CRE A;  1LJO A;  1JJ2 A;  1BI3 A;  2I0N A;  2LMJ A;  1OUL A;  4RTT A;  3E1S A;  1PSE A;  2JZ2 A;  4ORZ A;  2OI3 A;  3GP8 A;  1VQN A;  5CR2 A;  1VQM T;  1TWB A;  2AKK A;  3I9Q A;  1XOV A;  3JB9 F;  2VKN A;  2DZ9 A;  5HKC A;  4PJO E;  2RM4 A;  4AG2 C;  1MMG A;  5FRM A;  4A4G A;  1YJ9 A;  1V76 A;  1IXD A;  1TU0 B;  1YJN A;  1HK9 A;  4DBF A;  1WIE A;  4J6W A;  2O88 A;  2ED1 A;  2CZ0 B;  2BKD N;  2R5A A;  2J6F A;  4J9G A;  3OYI A;  2L3R A;  1YIJ A;  2ESW A;  2PTK A;  4F14 A;  2RB6 A;  2RQW A;  5GAN f;  1I07 A;  2BE9 B;  1NJI R;  1UE9 A;  1ZSZ A;  3JCM V;  3EFS A;  1KD1 C;  4OGC A;  3A1P A;  1AT1 B;  4A4H A;  2JS0 A;  2FPD A;  2QXF A;  4KUL A;  3CD6 T;  4KBM B;  1K8A R;  3HRS A;  3CC2 A;  1WFW A;  1K9M C;  2F2X A;  4PLL A;  3REA B;  3JB9 D;  1D1A A;  1ABQ A;  4M7D A;  4LD9 K;  2E64 A;  1WZO A;  2FVU A;  2MAM A;  3H0I A;  5GAO l;  2XK0 A;  2P4R A;  1FX7 A;  1I81 A;  1WHH A;  3F70 A;  3ER0 A;  1O75 A;  1RAC B;  1VQ6 Q;  4VUB A;  2QTV A;  1VYV A;  3TCJ A;  4J9H A;  3EH1 A;  1R0B G;  5GJW B;  1QVG S;  2MWP A;  4FYV B;  1NEB A;  3Q1J A;  1E6H A;  2CP7 A;  2JT4 A;  3M57 A;  2BUD A;  3H0H A;  1AWX A;  4M75 D;  1AVZ C;  2FB7 A;  4NL2 A;  3OYF A;  2H3J A;  4RKU E;  3G7Z A;  1VQ9 T;  3OW2 P;  5EC7 A;  1F1B B;  1VQN Q;  5J3B A;  2GFU A;  1HSQ A;  3GNG A;  1Y07 A;  2LQW A;  4LDU A;  3JCM X;  3AHU A;  3L2U A;  1R77 A;  3CCV A;  3CCU T;  1T0H A;  1D0X A;  4CC3 A;  3OSS C;  4M77 C;  3VKI A;  3CPW P;  3QJ6 A;  1M3C A;  2OJ2 A;  1YJ9 Q;  2X3W D;  1M90 C;  1YJN Q;  1K9A A;  3CCJ T;  3CBO A;  3CCV T;  4M75 B;  2LDM A;  3M0R A;  4F7U F;  2ZAE A;  2NUZ A;  1YIJ Q;  1EZZ B;  1JEG A;  1SSH A;  4IIO A;  1YP5 A;  1VUB A;  2HNI A;  4M78 B;  1KC8 C;  4LUE A;  3MKD A;  2LCC A;  2HZY A;  2M1H A;  3I5S A;  3EG3 A;  3RBB B;  1VQK A;  3CCL A;  1JO8 A;  4L5G A;  1EX4 A;  5FU6 C;  1DJ7 B;  4DOV A;  2V1R A;  4J9D A;  3OYE A;  2X4W A;  1A0N B;  5GAO m;  3CC2 Q;  3CC4 T;  5KYN A;  5GAN j;  4PJM A;  2RQU A;  2K5I A;  1KQS A;  2EIF A;  4OGE A;  1YCY A;  4PJO C;  1OPK A;  2K7A A;  4XK8 E;  3OS2 A;  1V29 B;  4Z88 A;  2FRW A;  4ELY C;  2HL5 C;  1XQH A;  2EKH A;  2K2V A;  2LQK A;  1YHQ T;  4KUD K;  1RAE B;  3BFM A;  1BIB A;  1BBZ A;  5FWB A;  4M75 A;  1OX8 A;  1VQP A;  3EGX A;  1QVG A;  2LJ3 A;  2K5L A;  4E47 A;  5GMK i;  1X01 A;  4M78 A;  4AMC A;  3KBG A;  4M7D E;  3NHN A;  4PKC C;  5FW9 A;  4KUI A;  4K11 A;  1VQL A;  3M53 A;  1OEB A;  1BK2 A;  4JPB W;  1FWZ A;  2FPE A;  2CP2 A;  4M77 F;  5LJ3 f;  1ZUY A;  1VQ8 A;  4FSX A;  2H3E B;  1D0Z A;  5L8R E;  3LX7 A;  3RR6 A;  1UB4 A;  4CRI A;  5FRO A;  4EDU A;  3OYL A;  2PQW A;  1ZQ1 A;  1W2B A;  1G83 A;  2JNG A;  2CH4 W;  2V1Q A;  3RMS A;  2V8I A;  2A7Y A;  3M4Y A;  5C0M A;  4E7H A;  2DXU A;  5GAN 5;  2KMT A;  1WJS A;  2JMA A;  5CQY A;  3JCM Q;  2AZV A;  2D8J A;  4PNO A;  3M59 A;  1UJY A;  4FT4 A;  1VQK Q;  1X6B A;  5HY6 A;  3C94 A;  3CCL Q;  1PHT A;  4YTL A;  1M8V A;  2P84 A;  2DET A;  3OYA A;  3CME T;  1ZBJ A;  2CSI A;  2MCN A;  2JTM A;  4ME7 A;  4PJO F;  4FCY A;  1AWO A;  1ZHI A;  2K9G A;  2DPP B;  1Z9Z A;  1JB0 E;  3JAM E;  1ZX6 A;  3RER A;  2FO0 A;  3VS7 A;  2IPO B;  2B8A A;  4FL6 A;  2QQ9 A;  4QQ6 A;  4DBQ A;  4GBQ A;  4HVU A;  2RK1 A;  4J9E A;  4E7S A;  3TEE A;  1UHC A;  4CC2 A;  1PCX A;  3X24 B;  3OYN A;  3EG9 B;  3LYI A;  4JLI A;  4A54 A;  1SPK A;  2ZPG B;  2MPX C;  4C92 G;  1VQP Q;  3TSW A;  1GXI E;  3OBY A;  1WQW A;  4E7L A;  2YUN A;  3V7C A;  3VS6 A;  3NGP A;  2RHI A;  1BI2 A;  2DMO A;  4BE1 A;  2J6K A;  1H8K A;  1WHK A;  1VQL Q;  3SWN A;  4B9X A;  1CKB A;  1WQ7 A;  4EMK B;  4HVW A;  5D6W A;  1TUD A;  2EQU A;  2E10 A;  2EQJ A;  3VRY A;  2GQV A;  2QDY B;  3TSZ A;  1VQ8 Q;  1WX6 A;  2BTT A;  4M75 E;  5KYY B;  3CQT A;  2DIG A;  3CCM T;  3A8G B;  2VXE A;  1YIT T;  1VYT A;  1NJI C;  5LL6 S;  4OMM A;  1UGQ B;  2KYB A;  2YSQ A;  4JS4 A;  2XIC A;  1ZSZ C;  4M78 E;  2KR3 A;  2VC8 A;  3JB9 J;  5GAM d;  1QKX A;  1K8A C;  4J8O A;  4NL3 A;  2KSS A;  4HCK A;  1VQ7 T;  4XQ3 A;  3EG9 A;  4ZNX A;  2AHJ B;  2RI3 A;  1BCM A;  1I1J A;  1MHN A;  2DK3 A;  2K3Y A;  4E7Z A;  3CC7 T;  1JRI A;  2R58 A;  3J7A F;  2VAS A;  3V7R A;  1T3L A;  2JOY A;  1X2K A;  3VYG A;  4EIK A;  3OS1 A;  3A5Z B;  1OU8 A;  4E6R A;  3INZ A;  4IKF A;  5FLX E;  1OOT A;  4EMK A;  3MET A;  2DL7 A;  4DQ2 A;  4E7K A;  3BE3 A;  4DEX A;  3OYC A;  1GBR A;  1N8R R;  2XDP A;  5KYY A;  4RMO A;  4LUD A;  5GAO q;  1PSF A;  5CKB A;  3G6E T;  3DKM A;  2EPD A;  3A8H B;  3M54 A;  3HRU A;  4FW1 A;  2QAZ A;  3NMZ C;  1P92 A;  1S72 A;  5GAN e;  4J9I A;  2QA4 A;  2F1L A;  4XU1 A;  2RQR A;  2DF6 A;  3HRT A;  1RL2 A;  3FB9 A;  2Y4Y A;  4RTZ A;  5CKF A;  3OYK A;  1WGS A;  1T3S A;  1PM3 A;  1Y57 A;  1IGU A;  5LJ5 j;  4XU3 A;  3S3N A;  3PIO A;  2X35 A;  1JJ2 S;  1SSF A;  2F5K A;  3WVD B;  1N9S A;  3PE0 A;  1AHJ B;  1UDL A;  4C92 B;  2MI6 A;  2RHU A;  1NYF A;  1NG2 A;  2DTH A;  4OB0 B;  4E2F B;  2LT4 A;  1GCQ A;  2LJ1 A;  2FZC B;  1M1K U;  4ESR A;  3OY9 A;  3I55 A;  1K0X A;  4XTW A;  3PNW C;  4CI0 C;  2HKN A;  2QGF B;  3GF5 A;  3V8K A;  2KRM A;  2RF0 A;  2GFA A;  3CCE A;  3WXM B;  4FYY B;  1JQQ A;  2OTJ A;  4FSS A;  4XTZ A;  4HA8 A;  5ECA A;  3GOX A;  1YJW A;  1MGQ A;  2DFU A;  4M75 C;  2JS2 A;  4BAC A;  4HT9 A;  4OP0 A;  3P8H A;  1H64 1;  3L1A A;  2PZ1 A;  2CUB A;  3A98 A;  2QTX A;  1ZBX A;  4R0K A;  3X26 B;  1MUZ A;  4M78 C;  1YFN A;  2PUK B;  1X6G A;  1B07 A;  1IRE B;  1OU9 A;  1S72 Q;  3THK A;  4C92 A;  3NFC A;  2QA4 Q;  1RAD B;  2HBW A;  1IGQ A;  3SEM A;  5M9O A;  2RJE A;  3SHW A;  3CMA Q;  4M7D D;  1IRX A;  1UHF A;  3H0F A;  1N27 A;  3VS1 A;  1BB9 A;  2GNC A;  3UDC A;  2ZZD A;  5GAN 2;  1YNZ A;  1TG0 A;  4A53 A;  2YLB A;  3KFV A;  4F04 B;  1Q86 R;  1VQM A;  4ZN1 A;  4LD6 A;  2JUF A;  2ABL A;  2KYM A;  3HL8 A;  2E70 A;  4B9W A;  5GAN g;  1WYX A;  4XTV A;  5KYX A;  5A0D A;  3EFO B;  1ZUU A;  1Q82 C;  3SB2 A;  4O6J A;  2FRY A;  1QP2 A;  5DY9 A;  1QCO A;  3E2U A;  4PL6 A;  2GQI A;  2HSE B;  2R5M A;  4M7D B;  4BDY A;  2XU8 A;  1U06 A;  4MZM A;  2OAW A;  2XMF A;  3HSB A;  3JRZ A;  3L2Q A;  3I55 Q;  4BI4 A;  1KIK A;  3UA7 A;  3WVE B;  5CKH A;  4OB3 B;  1V1C A;  2A08 A;  1MMA A;  3M0T A;  3CCE Q;  2B86 A;  2J05 A;  2OTJ Q;  1H92 A;  3CD6 A;  2COZ A;  5LJ3 e;  3M0P A;  4XU2 A;  4M75 F;  2RO0 A;  1YJW Q;  3JCM d;  1B34 B;  2VUB A;  1X69 A;  4J7I A;  1PWT A;  1E7O A;  1Q81 R;  2KAF A;  4M78 F;  1KD1 U;  3M4G A;  1KQS S;  3GNF B;  5LJ5 h;  3EFO A;  1K9M U;  4C8Q G;  3CCR T;  1RUW A;  3L2W A;  2RJC A;  4AT1 B;  3QUI A;  4CC7 A;  2JN0 A;  4JDS A;  2ROT A;  1SG5 A;  1UEB A;  1IHW A;  2HBP A;  2DIQ A;  4PJN A;  2CS7 A;  3GLX A;  5GAO n;  1VQ9 A;  3LWI A;  5KCH A;  3I56 T;  3BDU A;  1VQM Q;  3OW2 S;  3NTI A;  3MEU A;  2E3H A;  4WTO B;  4C92 E;  5KYW B;  4HVV A;  3CCU A;  1B34 A;  5CKD A;  4F7U G;  3JB9 I;  1AEY A;  5IXB A;  1LOJ A;  2RN8 A;  4KGX B;  1UGP B;  1PNJ A;  4M78 D;  2Y4X A;  3LW5 E;  2E41 A;  2PVO B;  4MML A;  1U8R A;  3CCJ A;  1EFN A;  2E4H A;  2CZ1 B;  2O4X A;  2LC4 A;  2E1H A;  3VJP A;  2KRO A;  1W2B S;  3FJ5 A;  2KVQ G;  5IH2 A;  3MEV A;  2YRC A;  4KGZ B;  3VS5 A;  2LCL A;  4EMK C;  4Z89 A;  3CEY A;  2HSP A;  1M90 U;  1N8R C;  4A4E A;  1Q7Y C;  3CPF A;  1NE8 A;  1VA7 A;  4MDX A;  2E12 A;  3M58 A;  2L8D A;  3EGX B;  1YI2 T;  4IUP A;  4RTV A;  2CP0 A;  3X25 B;  3CD6 Q;  3EGU A;  2YWW A;  3MEW A;  2QAS A;  4N4H A;  3CC4 A;  1KC8 U;  2P0P A;  1WJR A;  3ZL7 C;  3JV3 A;  4KRT A;  3HKS A;  3L2R A;  2MWO A;  2DRK A;  2DLP A;  3DB4 A;  3G4S T;  2DVJ A;  2Z0W A;  3OMC A;  2IG0 A;  5KYW A;  2WSC E;  2RPN A;  1RAI B;  1G8X A;  3E19 A;  3EG0 A;  1G3W A;  5GAO r;  1RI0 A;  1YHQ A;  1JBM A;  3R6N A;  2EVR A;  1W6X A;  4GLK A;  3OB9 A;  1X27 A;  3C0C A;  2LTO A;  4C8Q D;  5I2M A;  3L2Z A;  1H3H A;  2EJ9 A;  4RTX A;  1VQ4 T;  2ZGW A;  5LJ3 g;  1M2O A;  3VUZ A;  2RD1 A;  1MV3 A;  4HCB A;  3TU4 K;  2G3R A;  1IO6 A;  3I5R A;  1VQ9 Q;  3VS4 A;  2R57 A;  4JZ3 A;  2RHX A;  2OAU A;  2D9T A;  3HP9 A;  2GTJ A;  1M1F A;  3J80 E;  3V8J A;  5FU7 B;  3CCU Q;  3VYH B;  4EMG A;  1ZLM A;  2JTE A;  3OW2 A;  4BD3 A;  1RAB B;  4C8Q B;  4FW2 A;  1C1A A;  2RHZ A;  2DA9 A;  4RCB A;  5CVI A;  3OMG A;  2D1X A;  2FZG B;  2LVM A;  2KRN A;  2QQA A;  2WSF E;  2A28 A;  3CCJ Q;  1WHJ A;  1K73 U;  3CCV Q;  1C0M A;  2C0T A;  3EH2 A;  2FZK B;  1QCN A;  3CPW A;  4HXJ A;  3M9Q A;  3ULR B;  1H3Z A;  3RNJ A;  5IT9 E;  3LH5 A;  4OVA A;  1PRM C;  4OB1 B;  1Y96 A;  2D8H A;  4X34 A;  1HJD A;  1U1S A;  2DBM A;  4IIM A;  2DRM A;  2DEU A;  1MV0 B;  5FRN A;  4LE9 A;  4KT0 E;  4HCC A;  3CME A;  1UGV A;  1E6G A;  2CP3 A;  1HYO A;  1RAH B;  1Y71 A;  2QGG A;  3BW1 A;  5GMK j;  1BYM A;  2CGH A;  1SF9 A;  4F7U B;  5HCK A;  4C92 C;  4JRK A;  2FG0 A;  2ECZ A;  2EQM A;  1HXD A;  4OF1 A;  2JMC A;  3SWN B;  4DA4 A;  1VQO T;  2X4Y A;  3UWN A;  1MMD A;  4C8Q A;  1YHQ Q;  2KT1 A;  3NPF A;  1Q86 C;  1VQ5 T;  1VOM A;  3HFO A; 
#chains in the Genus database with same CATH homology
 2RJD A;  4MDW A;  4BI8 B;  4M78 G;  3HRT A;  3ASK A;  1LJO A;  3A8O B;  1JJ2 A;  1BI3 A;  3UT1 A;  1RL2 A;  4M7A G;  1M9S A;  4L59 A;  3E1S A;  1PSE A;  2ZPE B;  3FB9 A;  2JZ2 A;  2Y4Y A;  1VQN A;  3GP8 A;  1VQ4 A;  5CKF A;  5CR2 A;  3HPW A;  3JCM b;  3OYK A;  4NS5 A;  3V7S A;  1VQM T;  4C5G A;  3QBY A;  1WGS A;  1XOV A;  5GAM f;  2XD0 A;  3JB9 F;  2EQK A;  4C0D B;  4ZTJ A;  5LJ5 j;  4XU3 A;  5HKC A;  2DZ9 A;  2C06 A;  4PJO E;  2O01 E;  3MEA A;  3S3N A;  3PIO A;  4II1 A;  2CKK A;  1LNX A;  3S6W A;  5LJ3 d;  2X35 A;  2RM4 A;  1QVP A;  2RH2 A;  3QHS A;  1SSF A;  4N4I A;  2F5K A;  3CCQ T;  1JJ2 S;  3WVD B;  3RKY A;  2XI9 A;  4O5V A;  2QQS A;  2M9U A;  1Y96 B;  3MP1 A;  2EJG A;  5EG2 A;  4C0G A;  5LJ5 f;  5FRM A;  1O9S A;  2A3L A;  2DEQ A;  4A4G A;  2RI2 A;  1YJ9 A;  2ZPH B;  1N9S A;  3OA6 A;  4F7U A;  3OQ5 A;  1YJN A;  1HK9 A;  4XU1 A;  1AHJ B;  4J6W A;  3CCM A;  4IUR A;  3GIB A;  3L42 A;  2CZ0 B;  4HKE A;  4PLI A;  3CCS T;  1YIT A;  3QII A;  2BKD N;  3M55 A;  2R5A A;  4C92 B;  2CZ6 B;  2YHT A;  3J81 E;  2DD5 A;  2L3R A;  2MI6 A;  3OYI A;  1YIJ A;  4M77 G;  2RHU A;  4P5N A;  3M5A A;  2XKO C;  2DTH A;  4OB0 B;  2RB6 A;  1VQK T;  2LT4 A;  4N0A A;  3CCL T;  2KY9 A;  5GAN f;  3QXE B;  1M1K U;  1VQ7 A;  2KK4 A;  3OY9 A;  3I55 A;  3JCM J;  3LGF A;  3PNW C;  4XTW A;  4CI0 C;  3JCM V;  3L2V A;  3EFS A;  3LWH A;  2IVW A;  3QZ9 B;  5GAN 8;  1KD1 C;  3GF5 A;  1NJI U;  3V8K A;  4OGC A;  3CC7 A;  2RK2 A;  4A4H A;  1Q81 C;  2QQB A;  2QXF A;  4KUL A;  3CD6 T;  4KBM B;  3HRS A;  3CC2 A;  2GFA A;  3OBW A;  3CCE A;  1K9M C;  3OYM A;  3WXM B;  1K8A U;  2OTJ A;  4J83 A;  4OMF B;  4XTZ A;  4IUV A;  4HA8 A;  2X4X A;  4NOY A;  5GMK m;  4PLL A;  4BY6 C;  3JB9 D;  4M7D A;  3RMQ A;  3GOX A;  4C92 F;  1YJW A;  4LD9 K;  4XTU A;  3FJP A;  3PMT A;  1MGQ A;  4M75 C;  4BAC A;  4HT9 A;  2E64 A;  4OP0 A;  3P8H A;  4QW2 A;  2FVU A;  2MAM A;  2DTO A;  1H64 1;  3L1A A;  5HK0 A;  5GAO l;  2XK0 A;  1FX7 A;  4M7D C;  1I81 A;  2P0K A;  2QTX A;  4J6X A;  3F70 A;  3ER0 A;  1ZBX A;  1O75 A;  4VUB A;  3EFR A;  4PJO G;  3X26 B;  4M78 C;  3TCJ A;  2PUK B;  2QQR A;  1VQP T;  3ZFJ A;  2WSE E;  4IUU A;  4M7A C;  3P8D A;  3G71 T;  4ZTF A;  1QVG S;  1K73 C;  2MWP A;  4Y28 E;  4UC4 A;  3RES A;  1IRE B;  1TH7 A;  2E5Q A;  3NTK A;  3Q1J A;  5GAM g;  4JUV A;  1VQO A;  4C92 A;  3NFC A;  3M57 A;  3G6E A;  4ELZ C;  2BUD A;  3N5B B;  2DKG A;  4FT2 A;  4M75 D;  2FB7 A;  4JRQ A;  4NL2 A;  2P4T A;  3OYF A;  5M9O A;  2H3J A;  2RJE A;  2I2L A;  4IUQ A;  4RKU E;  3G7Z A;  1VQ9 T;  1VQL T;  5CK9 A;  4M7D D;  1VQ5 A;  5LJ5 g;  2EAY A;  3OYH A;  5J3B A;  2GFU A;  1N27 A;  3GNG A;  2QEX T;  4A4F A;  3RKW A;  1Y07 A;  2EJF A;  2OTL T;  4LDU A;  2YRV A;  3JCM X;  1NZ9 A;  1NPP A;  3HHT B;  1VQ8 T;  3AHU A;  3L2U A;  3UDC A;  2ZZD A;  5GAN 2;  3DLL A;  3ZEH A;  3DB3 A;  3A8L B;  4A53 A;  2YLB A;  3CCV A;  3CCU T;  1VQM A;  4ZN1 A;  1KD1 U;  4LD6 A;  4OB2 B;  3C12 A;  2JVV A;  3CBM A;  4C8Q E;  2E65 A;  1Q86 U;  3OSS C;  2JUF A;  4M77 C;  3HL8 A;  3VKI A;  2E70 A;  4B9W A;  2PU9 B;  3QJ6 A;  3MP8 A;  4TVR A;  5GAN g;  4C92 D;  5GAM j;  4XTV A;  4BY6 B;  4C5H A;  2CYZ B;  5J39 A;  5A0D A;  3CCQ A;  1M90 C;  5DLO A;  1R8O B;  2PVD B;  3CCJ T;  1Q82 C;  5IAY A;  3CBO A;  3SB2 A;  3CCV T;  4O6J A;  4M75 B;  3JCM h;  3QSU A;  2LDM A;  1QP2 A;  5DY9 A;  2FHD A;  4F7U F;  2K5F A;  1VQ4 T;  2XDB A;  3T9N A;  3MCA B;  5I21 A;  4PL6 A;  2E6Z A;  3TRE A;  2VGM A;  2XID A;  5CQX A;  4M7D B;  2R5M A;  5GMK h;  1XNI A;  4BDY A;  1VUB A;  3PGG A;  3CCS A;  2HNI A;  2XU8 A;  4M78 B;  1KC8 C;  4MZM A;  4M77 D;  4X9D A;  4M7A B;  3HSB A;  3JRZ A;  5A0L A;  2LCC A;  3L2Q A;  2M1H A;  4BI4 A;  3E9G A;  4E7I A;  3BDL A;  1OYX A;  1VQK A;  3VV0 A;  2PUO B;  3CCL A;  3QKJ A;  4L5G A;  5FU6 C;  1DJ7 B;  2RI5 A;  3WVE B;  4DOV A;  5CKH A;  3OYE A;  2X4W A;  4OB3 B;  2YLC A;  5GAO m;  1VIE A;  1OZ3 A;  3CC4 T;  5GAN j;  4F7U E;  3MHX A;  4BI3 A;  2K5I A;  4MMK A;  3OYY A;  1KQS A;  2EIF A;  4OGE A;  4XU2 A;  1YCY A;  5LJ3 e;  3CD6 A;  4M75 F;  4PJO C;  3URG A;  2RO0 A;  2DJZ A;  3FRN A;  3JCM d;  1B34 B;  1QVF S;  3C4S A;  4XK8 E;  2VUB A;  3OS2 A;  1V29 B;  4J7I A;  4M7D F;  4ELY C;  2DXT A;  3FIF A;  1XQH A;  2KAF A;  3HFN A;  4M78 F;  1X75 C;  2FYK A;  3M4G A;  2K2V A;  2LQK A;  2RJF A;  3A8M B;  3JCM W;  1YHQ T;  4BDZ A;  4M7A F;  4KUD K;  2EWN A;  1N9R A;  4M77 B;  1Q81 U;  1KQS S;  4FIB A;  3BFM A;  3GNF B;  1WPY A;  1BIB A;  5LJ5 h;  1U1T A;  4C5E A;  1K9M U;  4C8Q G;  2NLU A;  4M75 A;  3SDZ A;  3CCR T;  4PJO D;  3OYD A;  3QYG B;  3JCM e;  1VQP A;  3L2W A;  5IN1 A;  2L5Q A;  1G3T A;  3C95 A;  4QQG A;  2RJC A;  3G71 A;  5J26 A;  1QVG A;  3QUI A;  2K5L A;  2JN0 A;  3DLM A;  4XTY A;  3V8L A;  2DXB A;  4E47 A;  2HQX A;  1X01 A;  5GMK i;  3OYG A;  4JDS A;  4M78 A;  5GMK e;  5GAN 7;  3KBG A;  2EKO A;  4M7D E;  4M7A A;  1UEB A;  5GAN h;  2HBP A;  2LRQ A;  3PTA A;  4MDX A;  2DIQ A;  4LDW A;  4PKC C;  2CS7 A;  5CO7 A;  1YBY A;  3GLX A;  2F5T X;  3SD4 A;  5LJ3 j;  5GAO n;  4KUI A;  1VQL A;  1VQ9 A;  3JB9 H;  3LWI A;  5KCH A;  3I56 T;  4J6Y A;  3M53 A;  5FU6 B;  4Y91 A;  4MZT A;  3RIR A;  1FWZ A;  3BDU A;  4M77 F;  2QEX A;  4LDY A;  1BI1 A;  5LJ3 f;  2OTL A;  1VQ8 A;  4FSX A;  3OW2 S;  3NTI A;  3MEU A;  5L8R E;  3LX7 A;  3FDR A;  1UB4 A;  4XU0 A;  4ZGJ B;  4CRI A;  2MMP A;  5FRO A;  4C92 E;  2FL7 A;  5LJ5 d;  3MP6 A;  3CCU A;  4EDU A;  3OYL A;  2PQW A;  4PJO B;  3ME9 A;  4DOW A;  1ZQ1 A;  2DXC A;  1B34 A;  5CKD A;  1I5L A;  4F7U G;  3BY7 A;  1W2B A;  3JB9 I;  1X6O A;  3O8V A;  1QW1 A;  1LOJ A;  2JNG A;  2M0O A;  2RA2 A;  1UGP B;  3JB9 G;  4M78 D;  4JRP A;  2Y4X A;  3JSC A;  3LW5 E;  2HAX A;  2DTI A;  1EIF A;  5GAN 4;  4M7A D;  2E41 A;  2PVO B;  2EFI A;  4LDV A;  4MML A;  4M77 A;  2V8I A;  2A7Y A;  2DO3 A;  3M4Y A;  1U8R A;  4LDX A;  3CCJ A;  5C0M A;  5A2Q E;  4E7H A;  2DXU A;  4R55 A;  5GAN 5;  2CZ1 B;  3VU3 C;  2KMT A;  2O4X A;  1WJS A;  2LC4 A;  3JCM f;  4E7J A;  2E1H A;  3VJP A;  5CQY A;  3JCM Q;  1M5Q 1;  4PNO A;  4RG8 A;  2KVQ G;  5GAN 6;  1W2B S;  3M59 A;  3MEV A;  4FT4 A;  4QVC A;  5KE3 A;  5HY6 A;  4ZGD B;  1UGR B;  2LCL A;  3C94 A;  2DD4 A;  3LLR A;  3JCM c;  4EMK C;  4YTL A;  1M8V A;  1G3S A;  4J5Y A;  3CEY A;  3NTH A;  3OS5 A;  1M90 U;  1N8R C;  2DZC A;  5CIU A;  1Q82 U;  3OYA A;  4A4E A;  1Q7Y C;  3QG1 A;  1I4K 1;  3H8Z A;  3CME T;  1BIA A;  3CPF A;  4C0Z A;  1NE8 A;  2JTM A;  5CKE A;  3CXC S;  2E12 A;  3CBP A;  4ME7 A;  4PJO F;  4FM4 B;  4EMH A;  2M16 A;  1NPR A;  3M58 A;  2L8D A;  2VYT A;  5FU7 C;  4IUP A;  1YI2 T;  2RHY A;  1ZHI A;  2L89 A;  2DPP B;  1KQ2 A;  3X25 B;  2VV5 A;  3H6Z A;  1JB0 E;  3MEW A;  4N4H A;  3GPL A;  1G5V A;  3JAM E;  3CC4 A;  5GAO p;  2MF2 A;  3RER A;  1QP3 A;  4M7D G;  2LNV A;  2P0P A;  1KC8 U;  4C8Q C;  1WJR A;  2ZPB B;  2B8A A;  1VQ6 T;  4FL6 A;  4JS5 A;  2QQ9 A;  4QQ6 A;  3HKS A;  4C0F A;  1G3Y A;  3L2R A;  2MWO A;  1VIF A;  3CMA A;  3DB4 A;  3G4S T;  2GCX A;  3OMC A;  2IG0 A;  2RK1 A;  2HD0 A;  3X28 B;  4WF2 A;  1QVF A;  1S72 T;  3TEE A;  3OYN A;  2WSC E;  3X24 B;  1M4Z A;  4PJO A;  1KHC A;  3LYI A;  4Q5W A;  5A0G A;  2QA4 T;  3OSV A;  4JLI A;  3E19 A;  4QQD A;  4A54 A;  1G3W A;  5GAO r;  1RI0 A;  3QO3 A;  1YHQ A;  2ZPG B;  2X4J A;  1JBM A;  3QPH A;  4Z02 A;  1BKB A;  4C92 G;  2P0Q A;  4JJN K;  4ATO A;  4GLK A;  1GXI E;  2WAC A;  3OBY A;  3OB9 A;  3CMA T;  2LTO A;  1WQW A;  4C8Q D;  2ZCF B;  1UGS B;  5I2M A;  3L2Z A;  1VQN T;  2EJ9 A;  3M56 A;  4RCC A;  1W4S A;  2ZPI B;  5GAM h;  2ZGW A;  5LJ3 g;  3CCR A;  3PMI A;  4E7L A;  3FEO A;  3P8B B;  3V7C A;  3VUZ A;  2RHI A;  3QZ5 B;  1D3B B;  2RD1 A;  4HT8 A;  1BI2 A;  3R6O A;  5KH6 A;  1IZ6 A;  4HCB A;  5C6S A;  3TU4 K;  1N6A A;  2JTF A;  4D6W A;  2G3R A;  4BE1 A;  2XDD A;  3SWN A;  4B9X A;  4X9C A;  1XTD A;  2DVE A;  2R57 A;  1WQ7 A;  4EMK B;  2GF7 A;  5D6W A;  2O4X B;  4C5I A;  2RHX A;  3RUX A;  2OAU A;  4N4G A;  3FLG A;  2D9T A;  3SFM A;  2EQU A;  1YJ9 T;  2E10 A;  2EQJ A;  2LQ8 A;  2GQV A;  2QDY B;  3HP9 A;  1M1K C;  2XHC A;  3SWN C;  1YJN T;  1M1F A;  4M75 E;  3LH0 A;  3QJY A;  3J80 E;  3I56 A;  3JCM P;  4BE0 A;  2DIG A;  3OS0 A;  3A8G B;  3V8J A;  3CCM T;  2VXE A;  5FU7 B;  5D6Y A;  3JCM g;  1YIT T;  4N0A C;  3VYH B;  2KQW A;  4EMG A;  1WNL A;  4HCZ A;  1NJI C;  2KDS A;  3OW2 A;  1YIJ T;  5LL6 S;  3ZBD A;  4BD3 A;  4MZP A;  1UGQ B;  4JS4 A;  2D0Q B;  3S3M A;  4C8Q B;  2RHZ A;  2XIC A;  4M78 E;  4RCB A;  2K3X A;  2VC8 A;  3E9F A;  3MO8 A;  3OMG A;  5CVI A;  3JB9 J;  5GAM d;  4M7A E;  2K57 A;  1K8A C;  4J8O A;  4NL3 A;  2KSS A;  1VQ7 T;  2LVM A;  3KUF A;  4XQ3 A;  4XTX A;  5I2S A;  3I55 T;  2QQA A;  2WSF E;  3KXT A;  2AHJ B;  3UPU A;  1K73 U;  2RI3 A;  1WJQ A;  4JRI A;  5HK3 A;  1MHN A;  5D6X A;  2DK3 A;  2K3Y A;  5GAN 3;  3QYH B;  3CC7 T;  3CPW A;  3M9Q A;  1H3Z A;  3X20 B;  1JRI A;  4BB7 A;  2R58 A;  5IT9 E;  3CC2 T;  3J7A F;  2E6N A;  2HQE A;  4OVA A;  3V7R A;  1OI1 A;  2JOY A;  4J7F A;  3QDR B;  4OB1 B;  3CCE T;  4C0D C;  2VXF A;  1KHI A;  1Y96 A;  3VYG A;  2CZ7 B;  2OTJ T;  2V8J A;  4X34 A;  3OS1 A;  1D3B A;  2LT1 A;  1I8F A;  1KQ1 A;  5GAM e;  1U1S A;  3A5Z B;  2ZPF B;  5KE2 A;  5CCA A;  3INZ A;  3PFS A;  1YJW T;  1BI0 A;  4XAX B;  4BUG A;  5CAI A;  3S3O A;  5FRN A;  2VGN A;  4RG2 A;  3CPW S;  4IKF A;  5FLX E;  3RKX A;  4KT0 E;  3PT9 A;  4C8Q F;  5DM7 R;  4R56 A;  4QVD A;  4HCC A;  3CME A;  4EMK A;  5GMK j;  3EAE A;  1Y71 A;  3BW1 A;  4GY5 A;  3MET A;  5GAN d;  3CXC A;  4M77 E;  1BYM A;  1FXX A;  2BIV A;  2CGH A;  3RMS A;  5LJ5 e;  4F7U B;  4DQ2 A;  2LX9 A;  4E7K A;  1YI2 A;  3VUB A;  4BE2 A;  4C92 C;  3OYB A;  4JRK A;  4ZGE B;  2F69 A;  5DLQ E;  3OYC A;  2QI2 A;  2XDP A;  2DAQ A;  2EQM A;  1HXD A;  4FU6 A;  1M1G A;  4OF1 A;  4QVZ A;  5LJ3 h;  1Y7X A;  4RMO A;  2V8K A;  4L6V 5;  3SWN B;  2XG8 D;  1PSF A;  3LGL A;  1OZ2 A;  5GAO q;  3OYJ A;  4DA4 A;  2Y90 A;  1N8R U;  5CKB A;  1VQO T;  1VQ6 A;  1KG1 A;  2PVG B;  3G6E T;  4EPC A;  2X4Y A;  3DKM A;  1Q7Y U;  4JLG A;  3UWN A;  5GMK l;  2EYQ A;  3FC3 A;  3PIP A;  4C8Q A;  3A8H B;  3M54 A;  3HRU A;  3G4S A;  5KCO A;  4M75 G;  4V2S A;  1P92 A;  2K4Y A;  1S72 A;  5GAN e;  2QA4 A;  2D6F A;  4IUT A;  4A4K A;  1Q86 C;  1VQ5 T;  4ZN3 A;  3HFO A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...