4BI4A

Structure and function of amidase toxin - antitoxin combinations associated with the type vi secretion system of serratia marcescens.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
163
structure length
163
Chain Sequence
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTAAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSP1 C50A MUTANT
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
total genus 46
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi4A01
4BI8B 4BI4A 4BI3A
chains in the Genus database with same CATH superfamily
1YJWA 2J6KA 1ZBJA 2RJFA 4J6XA 2V26A 4R56A 1YCSB 1T3LA 4OMPA 5I11A 4OF1A 3A5ZB 5FRMA 3H6ZA 2CUBA 2VXEA 4PJOC 1D1CA 2RN8A 4OB2B 3CC2Q 2OX7A 4O5VA 4ZGJB 4J8OA 2X51A 3CCVT 1TTHB 1ZHIA 1N9SA 2JS0A 1W2BP 6AT1B 1VQ7A 3I56T 1TOVA 2X4JA 4PFPA 3R6OA 3JCMd 1Q86C 4M75A 1MMDA 2XU8A 3OMGA 5LJ3e 3JCMW 2LC4A 2YRVA 4JZ4A 4JPBW 3RERA 2M1HA 1VQKT 2V8KA 1I1JA 3DLLA 1FMVA 2DL5A 2OTJT 4C92G 3CCUQ 2C0OA 2PTKA 2EW3A 1BBZA 2RK2A 2P4RA 3JCMe 1PSEA 3PVQA 1YITT 4BACA 1YJ9T 4CC3A 3L2RA 2H8HA 5HK0A 3JAME 3OYNA 4C0DC 2A37A 5IHNA 1KQ2A 3I55Q 4C5HA 3HSBA 3EG2A 2VUBA 2YLCA 2KSSA 1MGQA 4PLLA 2YRDA 3G4SQ 3VS0A 3CCLT 1OEBA 4FIBA 1GCQA 2LJ3A 3UWNA 2JZ2A 3OW2P 3MO8A 3HFNA 1SF9A 1K9MU 2KMTA 1VQ8A 3CC4T 3CBMA 3H0IA 1GFDA 3CC7A 1SRMA 4Y28E 2QAZA 3OS0A 1YWPA 2QASA 1X43A 4FYYB 1Q7YU 3O8VA 2RH2A 3LYIA 4GLKA 2CP2A 4J9CA 1GBQA 1X6GA 2JTMA 3KUFA 3E9FA 3MP6A 2MK5A 4QVDA 3RR6A 3C94A 4M7AG 3JSCA 3NTIA 1HJDA 2X9HA 1UJYA 1OOTA 1Y96B 1TS9A 1WXBA 2E41A 3HHTB 3V8LA 1YJNT 1M8VA 2RNAA 1UECA 3HKSA 4PL6A 2E6NA 5LJ5g 2K57A 4FYWB 1IHWA 1N6AA 2AZSA 1U3OA 2EQIA 3DKMA 3GOXA 7AT1B 5FRNA 4PJOA 3M0QA 1W4SA 3G7ZA 4M7DG 1R0CB 4AFUC 5AT1B 1YI2T 3QKJA 2R5AA 1X2KA 2FPFA 3G71Q 2L5QA 1AD5A 1IGUA 1DJ7B 5KYUA 2QYZA 5J3BA 2ZPIB 1YBYA 1JXOA 4PK4A 2L0AA 3CCEA 2XMFA 1YIJQ 2BIVA 1IRXA 1ZUUA 4OVAA 3TVTA 4IUVA 4JRPA 5D6YA 2E1HA 1NG2A 1JJ2A 3MEWA 2ZZDA 4RCCA 1SKUB 2B8AA 2K5FA 1X2QA 1ZUKA 3T9NA 4DOVA 1WYXA 4HVVA 4A4HA 1HSQA 1QVGS 5D6WA 1AWJA 4NL2A 2QA4A 5GAOp 1QP2A 4PKCC 2PUKB 4QQGA 1WZOA 4HVWA 3CMEQ 4CC7A 3CCRT 2COYA 1NJIC 3QDFA 3CCQQ 5IXFA 3TU4K 2HBPA 2NYSA 2O9VA 2O4XA 4PFZA 3JRZA 1Q81R 1EZZB 2HL3A 4KT0E 4D8KA 5FU7C 4A4FA 3RUXA 5LJ3h 4DEYA 5GAOm 2MI6A 2CZ0B 2P0PA 3HRSA 3QYGB 4PJOG 3I56A 1XJWB 1VQNQ 5FU6B 4EMHA 2QEXT 2QGFB 2DE0X 2DYBA 4C8QF 2CKKA 1VQOT 2LCLA 1AEYA 4YTLA 4M78A 1M1GA 4IKFA 3INZA 1FMKA 1VQKA 4C8QB 3JB9D 3S3OA 3JCMh 1QWEA 2ATCB 1B07A 2PVDB 5IHKA 2GFUA 4DBRA 4RUGA 3H9NA 2AK5A 4PNOA 1YITA 2VXFA 5HY6A 2BZYA 2KQWA 1K73R 4JJBA 3M58A 2A0FB 2E5KA 4X9DA 2YDLA 3CXCP 3ASKA 1VQLQ 1I8FA 5A0GA 1WNLA 1H8KA 1YHQT 3GIBA 2CS7A 2SEMA 3CCLA 1MUZA 2K3BA 2XDPA 3A8HB 2ZPFB 3OBYA 2F1LA 2LQ8A 3OYMA 1OQKA 1W1FA 2LTOA 2QDYB 4IURA 5IH2A 3CC4A 1X6OA 1ZSZC 1WHGA 2YSQA 2COWA 4A4KA 2LJ0A 4Z8AA 4RTTA 4C92B 1OPKA 4RG8A 4LD9K 2LQKA 3NHNA 3L2WA 5D7UA 2D1XA 1UGPB 2D9TA 1YJWQ 3LGLA 2FZGB 2X4YA 2WACA 1M3AA 3BFMA 1ARKA 2R58A 2CT4A 1AT1B 4CC4B 1K1ZA 3PGGA 4GBQA 2D8HA 2CSIA 4E47A 1O9SA 3HP9A 1YJNA 2F2VA 4WCIA 1M3BA 5KYWB 3JCMb 2MIOA 3SWNC 4JS4A 2RF0A 1VQ7Q 3JCMJ 4FYVB 4C8QE 3SFMA 3TSWA 2RQWA 4AG1C 1VQ5Q 1RAIB 1M1KC 5A0DA 4HCBA 2EJGA 3J7AF 1AVZC 2DEQA 2AIRB 4II1A 4F04B 1FWZA 4FCYA 5GANg 2OI3A 1YI2A 3EH1A 2DPPB 4LUDA 1SPKA 2QTXA 2JN0A 3A98A 2QDLA 2RO0A 1MV3A 1UHFA 4KH1B 4AG2C 3RIRA 2FHDA 4WF2A 3AHUA 4M7AB 3MKDA 3VRZA 1BKBA 4JRKA 1TUGB 3FJ5A 2X35A 3CD6T 3MEVA 1KC8C 4JJNK 4F7UA 2YUPA 2BTTA 2QA4T 2Y90A 1HYOA 2DXUA 1QKWA 2DTIA 2RI3A 9ATCB 3LW5E 5L8RE 4HKEA 4C92E 3UPUA 3CCRA 1RADB 3KBGA 1KD1C 4M7DB 3MP1A 1M90R 4M77F 1VQ8Q 1PRMC 4FSSA 4J9IA 3CC7Q 1JJ2S 1VQMQ 2QQRA 2KR3A 2KRNA 4M77B 3M0PA 5KYXB 2MWOA 3LH0A 1VIEA 5I22A 2MCNA 3OB9A 2C0TA 1K9AA 1WHJA 3OY9A 3HFOA 3WXMB 2DVJA 4XAXB 1VQOA 3C0CA 4RTWA 2JMCA 1ABQA 4B6MA 1WHLA 1X6BA 1N27A 4NS5A 2ED1A 2IVWA 1MHNA 5A2QE 1JBMA 4IIMA 2ZPEB 5GAMh 2CSQA 1OZ3A 1OZ2A 4KUDK 2E6ZA 2GFAA 4KRTA 1BK2A 4F7UG 4E7HA 3TCJA 5GMKl 3FRNA 3S6WA 3O5ZA 4LDUA 1S72T 4M7AE 3SWNA 1PKTA 5KE2A 1AHJB 2CP3A 2DD4A 5HK3A 1YHQA 2DM1A 2HQXA 4OMQA 3QHSA 2RM4A 3CCEQ 1IZ6A 2PQWA 4J5YA 4XTUA 3RMQA 4M75C 4DBFA 1P92A 4QVZA 3M0UA 5GAOq 2VGMA 3GLXA 1LOJA 2L3RA 2ZAEA 1HK9A 2BE7D 3D7SB 1LPLA 4M7DE 2HCKA 4XU0A 3QWXX 4QT7A 1WA7A 2YT6A 4IUPA 5KYYB 3V7RA 5GMKe 1M2VB 2XDBA 5J39A 1QVFP 4M77E 3EGDA 1VQ6A 3JB9F 5CR2A 1RAGB 1U1SA 3SDZA 5GMKj 4IUTA 1YWOA 1GCPA 4XTZA 4FM4B 4KGZB 3M0RA 4EMKC 5GANf 3CMAT 4C0DB 4HT9A 3OYKA 2FVUA 1UB4A 2QXFA 2EPDA 4R0KA 2HQHA 2QQ9A 1GCQC 4OMFB 2A3LA 4A4EA 1U06A 1UGVA 4J7FA 4E7IA 3HTRA 1BI0A 2A36A 4KH0B 3C4SA 1BI3A 4GLMA 1QVGA 3RBBB 5L23A 3GF5A 4C8QD 3MEUA 1AWWA 1V29B 3EHRA 2CZ7B 3QJYA 4PFOA 1UJ0A 4ANJA 4J6WA 2KY9A 2EJFA 1N8RR 4OP0A 3VYHB 2HZYA 3PMTA 3JB9I 2GTJA 2NUPA 3L2VA 3VS2A 3CD6A 5FWCA 1AZGB 2RJEA 4D8DA 5IT9E 4R55A 4QQ6A 2KE9A 1GBRA 5ECAA 2M02A 1OYXA 2JTFA 4ESRA 4X1VA 1Q86U 1N5ZA 2RI2A 2W0ZA 3OBWA 1MMAA 4D6WA 3UA7A 4Z88A 1VQ4T 4NOYA 2XICA 3A8LB 3VS7A 2QQBA 2EBPA 4AFQC 1NBEB 2DK3A 1O75A 4FU6A 3REAB 4Q5WA 1M4ZA 5LJ3g 1D3BB 3RDVA 4C92D 5GAN2 5D6XA 2JNGA 2V1QA 1C1AA 3UATA 4Y92A 2DJZA 4E7JA 4J9DA 1ZSGA 3CPWA 3UF4A 1G3TA 1W70A 3CCJT 4LDVA 3JCMg 2VKNA 3V7CA 1YJNQ 3KXTA 2FZKB 4RTVA 3TEEA 1VQPT 4LNPA 4HVUA 2PZ1A 1WDXA 4DOWA 3I35A 1N9RA 2XI9A 3QUIA 2SRCA 1RI0A 4ZN1A 1YI2Q 4EMKA 3CCST 5AYFA 2I2LA 2JTEA 2KYBA 3J80E 1D0ZA 1XNIA 1HD3A 1X75C 3ZL7C 3F70A 3MEAA 1S72A 3NTKA 4AT1B 3I9QA 1LJOA 1VQ9T 1NPRA 1D1BA 3UA6A 4MZMA 2GTOA 1M8MA 1RLPC 2WSEE 2GNCA 5CKFA 1RLQC 4A4GA 1Q81C 4XK8E 1KSWA 4M7AD 5FU7B 4OB1B 1RABB 4M78C 1SHFA 1KK7A 2KRSA 4KBMB 1TUDA 2ABLA 1U5SA 1GL5A 4C5GA 4M75G 2CH4A 2E65A 1RAFB 1TG0A 3CCRQ 3JCMQ 2VB6A 5EG2A 2E4HA 2M51A 2OTLQ 2DIGA 3CC2T 1D09B 4M7DD 4F7UB 4JRQA 4N4GA 2LMJA 4A63B 3BDLA 4E7SA 1Q82R 4RTZA 2KGTA 1H641 3M5AA 1QP3A 1TXQA 5CK9A 1K73C 2DBMA 2X4WA 2DA9A 5KE3A 4M77D 3CMAA 2F2XA 2DL3A 2YWWA 2Z0WA 1PM3A 2L2PA 3J81E 4OB3B 4AMCA 4XTVA 3AT1B 5LJ5d 3VS3A 1ZUYA 3OYLA 1QLYA 5GAN7 4XU2A 4HT8A 2YUOA 3OYDA 3CCUT 2D0QB 4MDXA 2BZ8A 2AHJB 1SSFA 2NUTA 2RK1A 3EFOB 4PJNA 1KQ1A 3IQLA 1K8AR 2OJ2A 1OU9A 1PC0A 1ZSZB 1UHCA 4J6YA 1NJIU 3EGXA 4BD3A 4PJJA 5LJ5j 3PMIA 4O6JA 3MCAB 3NPFA 1J3TA 1UGQB 5FW9A 1YHQQ 3CEYA 3LWHA 2ZCFB 4CI0C 3E1SA 1JB0E 1EFNA 2DL8A 5KCHA 1Z9QA 2EQUA 3META 1VQ4A 1TSFA 3JB9H 1SEMA 3EG3A 3M57A 2O88A 2DNUA 3VRYA 5GAOn 5IAYA 3I5SA 3L2ZA 1VYTA 4WTOB 5CCAA 1D1AA 1B7TA 3CCVA 5DY9A 4F7UE 1PRLC 4IUQA 4C0FA 1KQSA 4LE9A 2L3PA 2DILA 1K0XA 3EG9A 1JO8A 4XTXA 4BUGA 3OSSC 1VQ6Q 4JUVA 4EIKA 3E2UA 1MNEA 3JCMV 3CCJA 4A53A 4MMKA 1BI2A 1NM7A 1PD0A 2DAQA 1SG5A 3G6ET 2OTJA 3M55A 1VQPA 2LVMA 3QWYA 1UDLA 5GAMg 2CYZB 3M0TA 1YJ9A 4DEXA 2LP5A 2X3XD 2E12A 3M53A 2ROLA 2VWFA 4FW1A 2A08A 3G71T 3OYYA 4V2SA 3CPWS 1HXDA 3CCSA 4ZGEB 1UE9A 2VASA 1K9MR 1WI7A 2PVOB 4QQDA 1VQ9A 1NZ9A 2K79A 1OI1A 1M90C 1YIJT 2DKGA 3QJ6A 2DRKA 4HCKA 1D0XA 1EIFA 3PE0A 1B3QA 4KULA 1Q7YR 4BE0A 4C92F 2BZXA 3CD6Q 4JLGA 1MV0B 4IIOA 4KGVB 2W10A 2KDSA 2XDDA 4BE1A 4EMGA 2NWMA 1X27A 5GAN5 3X24B 5LJ5f 3PNWC 4BDYA 4L59A 4CRIA 3ER0A 2LCSA 1B34B 2XHCA 1M1KU 4M78G 1Y71A 2FEIA 2RHZA 2IIMA 1PKSA 1PSFA 1IHVA 1ZA2B 4X34A 1W2BS 1R77A 2F69A 2Y4YA 3JV3A 8ATCB 5FLXE 1M3CA 4GY5A 2MF2A 1OV3A 3CCMT 4B9XA 2KXDA 2PVGB 1WQ7A 3CXCA 3VUZA 1ZA1B 1I4K1 2K6DA 2EJ9A 1BIAA 3TSZA 3VS1A 4E6RA 1CSKA 2G3RA 5GJWB 1ACMB 1JU5C 2EQMA 2HL5C 1KC8U 3CCUA 3ZFJA 1ZBXA 3S3MA 2DMOA 1KHCA 2LX7A 2XD0A 1IB8A 1TH7A 4M75B 5GANd 3M4YA 3OYCA 3SD4A 4M7AF 1U1TA 3QSUA 1EX4A 1KD1U 3C95A 3E19A 3RKXA 4DQ2A 3FB9A 1SSHA 3THKA 2QQAA 2P0KA 4TVRA 1VQLT 3WVEB 5CKBA 2EGAA 2COZA 3N5BB 1S72Q 4P5NA 1UG1A 2AKLA 5GANe 3H0HA 4C8QC 5I2SA 4OMMA 1R0BG 3OW2S 4M7DF 2EYZA 1LCKA 4OGCA 5EC7A 2HAXA 5GANj 3HL8A 4QKUA 2MAMA 5C6SA 5GMKi 3I5RA 1Y57A 1YP5A 1K0SA 4RG2A 1Y96A 3M4GA 3VV0A 2CP7A 2CT3A 3VU3C 4L6V5 3QZ5B 2DEUA 5GAMf 5GAN6 1ZQ1A 4EPCA 2CREA 3C12A 2GBQA 3EG1A 4BI8B 1A0NB 5DLQE 2FZCB 2QEXA 3GPLA 3NFCA 2FYKA 4FYXB 4XQ3A 4ZN3A 4N0AA 1N8RC 3ZBDA 3UDCA 2ENMA 1GXIE 1G8XA 2R5MA 2KT1A 1IGQA 4LXCA 4ZGDB 1QWFA 3CMAQ 1WPYA 3G6EA 1UTIA 1X69A 5HKCA 4RTUA 2RHYA 1VQ5T 2IPOB 1K76A 1KQSS 3VS5A 3V8JA 3L2QA 4M75E 2DRMA 1BYMA 1QMCA 1D0YA 2LX9A 1MMNA 3QYHB 2FRWA 3L42A 5IHIA 1OPLA 2LT1A 4X9CA 4PJOF 4BY6C 2RJCA 2RB6A 2GF7A 3GNGA 1YIJA 2JS2A 4PJOB 4HCZA 2EYYA 1ZLMA 2VGNA 2JJ9A 1WXTA 3RKWA 1OX9A 2DETA 1NE8A 5KYUB 3G1JA 3VKIA 2J06A 3CBPA 5GJVB 5FROA 4UC4A 5CO7A 4KUIA 2CP5A 5GAN4 2A7YA 1BI1A 3REBB 2QA4Q 4IUUA 5KH6A 1QVGP 2J7IA 4XTYA 2VV5A 2RQTA 3SB2A 3EGXB 3FEOA 3SEMA 3UT1A 3PVLA 3CPFA 3OA6A 1VQ4Q 2LDMA 1IO6A 5J26A 4ELYC 2DXCA 4MZTA 2EFIA 2OAUA 1VQMT 4RKUE 4JRIA 3CCVQ 3VUBA 4C8QA 3DB3A 3BY7A 2L3SA 3CCMA 2CDTA 4NL3A 2RA2A 2L89A 2HNIA 1FXXA 1RL2A 3I56Q 1JRIA 2LT4A 2X3WD 2C06A 1AOJA 3OS2A 2P0QA 4HXJA 1M5Q1 1PNJA 2M0OA 3OMCA 2O4XB 2KNBB 3LGFA 1WGSA 1LNXA 4RMOA 1VQKQ 2RD1A 1WHHA 2I0NA 2FO0A 3OYHA 2OTJQ 2LNHB 1VQPQ 5I21A 1RACB 5CIUA 3PFSA 1JEGA 4M77C 3OYBA 1YITQ 1YJ9Q 5CVIA 2L8DA 2DXTA 5GAN8 4M78B 3CXCS 2WSCE 2NUZA 5CKDA 4Z89A 2PUOB 2CZ1B 4PJOE 2EYQA 3BE3A 1QVFA 1VQLA 3CCSQ 2MYSA 2LQNA 1RI9A 4E7ZA 4M4ZA 3VJPA 4ELZC 3CCET 1VQ9Q 4C92A 1E7OA 3CCLQ 1BCOA 3NMZC 2BUDA 4C0GA 4JLIA 2E5QA 2HBWA 1Q82C 3QIIA 3P8HA 5DM7R 1YFNA 2LQWA 4ME7A 3LLRA 3QBYA 2DD5A 2HMAA 1CKBA 4C8QG 3URGA 3CC4Q 2AZVA 4F16A 2K4YA 1WHKA 2L3QA 2HSPA 1WQWA 1WHMA 2RQVA 3EFSA 1I0CA 1I5OB 4LDYA 1T3SA 5KYWA 1TU0B 3RKYA 1QQJA 2DERA 2M9UA 1RAHB 2KYMA 5LJ3d 1QCFA 2LNVA 1TWBA 1CKAA 1AZEA 2G6FX 2XK0A 1K8AC 3QXEB 5IN1A 1Y7XA 1M30A 2RHXA 2CGHA 1PHTA 2KBTA 4FL6A 3MP8A 1G2BA 2CP6A 1VQ5A 3E9GA 2EYWA 2E3IA 2KRMA 2QTVA 1G83A 2LCCA 2KVQG 1Q81U 4FT4A 4ORZA 4M7AA 1MNDA 3KFVA 2HKQB 5LJ3j 4F14A 2MMPA 1T0HA 4M78E 2FL7A 2JT4A 1FX7A 1NLOC 4M75D 8AT1B 1H3ZA 2LZ6B 1C0MA 1IREB 1W2BA 3OYGA 1KG1A 2K3XA 2HSEB 1M9SA 4J9GA 2KAFA 2DFUA 2Y4XA 3MPUB 4M7DA 3MHXA 2XIDA 3L2UA 2KI7A 2H3JA 1K73U 5GMKh 1GRIA 1AWOA 2ECZA 1VUBA 1Y07A 5GAOl 4M77A 3QDRB 5KYXA 4MZPA 3V7SA 2D6FA 1T0JA 4F7UF 3A8GB 2EYXA 4LDWA 5GAOr 1VQMA 4Y91A 3OSVA 1NYGA 1G3SA 4ATOA 1JJ2P 4DBHA 3RESA 1ZX6A 1W6XA 4J83A 4LDXA 2DL4A 5CKEA 2QEXQ 2F5KA 1K9MC 3M56A 1VQOQ 1KIKA 2DLPA 3JB9J 1OU8A 2ZPBB 1NEBA 1G3YA 1Q95G 2R57A 3OW2A 4OMOA 2X4XA 3QO3A 3G6EQ 1Q7YC 1QCNA 3JCMc 4JS5A 1BIBA 3EFRA 4DBQA 5LJ5e 3FIFA 3I55T 3OYFA 2O31A 1UUEA 2IG0A 3QZ9B 1FYNA 1KQSP 3CQTA 2P4TA 3A8OB 1Q86R 4OMLA 2QGGA 4K11A 1WX6A 1Y0MA 4M77G 3G4ST 3GP8A 2EKHA 4BB7A 2LJ1A 2ESWA 4ZTJA 5LJ3f 2AKKA 2DZCA 2BE9B 2FG0A 5KYYA 4RTYA 3TREA 4PJOD 1M2VA 4A54A 3PT9A 3X20B 2FPEA 2QQSA 3SWNB 3GBQA 5KYNA 3MJXA 2KXCA 1KHIA 2DTOA 3JCMf 3EG0A 3EGUA 3WVDB 1E6GA 2K5IA 1QVFS 5DLOA 2DL7A 2YUNA 4ZTFA 1G5VA 2DZ9A 2MOXA 2OTLT 1NPPA 4JDSA 2E10A 2MWPA 1GFCA 4J9HA 4C5EA 3RMSA 1WJSA 2JM8A 1JXMA 2E64A 1S1NA 3SHWA 3H0FA 1M1FA 5HCKA 4BI4A 3FJPA 1E6HA 3OYAA 1LVKA 4C0ZA 4N4IA 3CCMQ 3EGDB 1M90U 2DF6A 5GAMd 2HEQA 5A0LA 2K2MA 2D0NA 2EWNA 2HKNA 4BE2A 4XU1A 2K5LA 1WJQA 3FC3A 2GCXA 1SHGA 4XU3A 2CUDA 3M0SA 2DVEA 1RAAB 4QW2A 5GAMe 3DLMA 2V8IA 4M78D 3VYGA 4B9WA 2DO3A 3JB9G 3A8MB 2J6FA 5GAMj 2A28A 4N0AC 5LL6S 2QG9B 4EDUA 2E3HA 1D3BA 3CMET 1I5LA 1VOMA 2KEAA 2NUPB 2QK0A 4FT2A 2EQKA 3CCQT 5CQYA 2RPNA 1M2OA 3CC2A 1QW1A 2CP0A 2EKOA 4E7KA 3HRUA 1K4US 1PD1A 3TQ7P 4LUEA 2EGCA 3P8DA 1VQNT 1VQ6T 3ME9A 1M27C 3PIPA 4BY6B 3A1PA 1BB9A 3OYIA 2BKDN 1QVPA 1I81A 4M75F 2EGEA 1NJIR 3JCMP 1R8OB 5LJ5h 2CH4W 1TUCA 3P8BB 4BI3A 2K3YA 1RUWA 5I2MA 3Q1JA 1VIFA 1XQHA 2GQVA 5C0MA 1FMWA 2HD0A 2M0YA 3I55A 2K2VA 2K9GA 2J05A 2DXBA 2RQUA 4BDZA 2H3EB 5FU6C 2F2WA 3G4SA 4CC2A 1IXDA 2JOYA 2YHTA 2D8JA 2YXYA 1KJWA 3LH5A 2GQIA 5KCOA 3RNJA 1UGRB 2JVVA 3VS6A 4XTWA 4E2FB 1QCOA 4PJMA 4EMKB 3X28B 1UFFA 3JCMX 1NEGA 2MPXC 2DX1A 2YUQA 1UGSB 4MMLA 1N8RU 1ABOA 3U23A 2RHIA 4E7LA 2ROTA 4HA8A 1YJWT 4MDWA 1I07A 5CAIA 1BU1A 4RCBA 3LWIA 2CZ6B 3H41A 2OAWA 3NGPA 2OTLA 1WFWA 1VA7A 4OB0B 5FWBA 4AFZC 2LRQA 2KK4A 1XTDA 5IXBA 1VYVA 2ED0A 2E70A 1G3WA 3FDRA 4J9FA 3ULRB 3FLGA 1VQ7T 1NYFA 1PG5B 2KT8A 2VYTA 2EQJA 2FB7A 3EH2A 4C92C 3M59A 4PLIA 4VUBA 4DA4A 3EFOA 2V8JA 2KROA 1ZSZA 1RAEB 2FRYA 1MMGA 1WIEA 2V1RA 4JJDA 2RHUA 5GAN3 1OX8A 3G71A 2ZGWA 2RJDA 1H3HA 1WLPB 3OQ5A 3LX7A 1UEBA 2FPDA 2AT1B 2F5TX 1AWXA 3BDUA 1BCMA 1Z9ZA 5CQXA 3X25B 2DJQA 3M54A 4RTXA 2HQEA 2WSFE 3HPWA 4JZ3A 2XG8D 2C0IA 3V8KA 1YNZA 3GNFB 4JJCA 4N4HA 4Z02A 1M1KR 4J7IA 4L5GA 2NUTB 2YLBA 2EIFA 1KFZA 4FW2A 2YRCA 3CMEA 1NLPC 3HRTA 2RI5A 3QG1A 1XOVA 1SRLA 2VC8A 1VQ8T 3CCQA 1H92A 2M16A 3OYEA 3CC7T 4M7AC 3R6NA 2GGRA 1PCXA 3DB4A 1C6VX 3OS1A 2JM9A 2QI2A 4C5IA 1KC8R 2O01E 1VQNA 2DBKA 2K7AA 1X01A 2JMAA 1WJRA 2DTHA 2O2OA 2VVKA 4LD6A 3BW1A 1V76A 3CCJQ 4J9BA 2RMOA 2DYIA 1VYUA 4M7DC 3VS4A 1WXUA 2ZPHB 1V1CA 1YN8A 3ZEHA 1KD1R 4AFSC 3EG9B 3OS5A 2PNIA 1YCYA 4M78F 2RQRA 4F17A 2P84A 1Q82U 4J9EA 4LN2A 1QKXA 3PIOA 3X26B 5CKHA 5M9OA 2EAYA 1F1BB 2JUFA 3OYJA 4ZNXA 3CBOA 2NLUA 3EHQA 1U8RA 5GANh 2JW4A 3M9QA 2JXBA 3CPWP 2HDAA 2J6OA 2PU9B 3NTHA 2EVRA 2DIQA 3S3NA 2O9SA 4KGXB 4OGEA 4OMNA 4FSXA 4HCCA 1B34A 2B86A 4QVCA 2ZPGB 5GMKm 3L1AA 4PJLA 3EAEA 1K8AU 1OULA 3PTAA 3H8ZA 3QPHA 1JQQA 2XKOC 1PWTA
chains in the Genus database with same CATH topology
1JBMA 5GAN5 1YJWA 3X24B 1Q7YC 3JCMc 5LJ5f 4JS5A 1BIBA 4J6XA 2RJFA 3EFRA 2ZPEB 3PNWC 5GAMh 4R56A 4L59A 4CRIA 4BDYA 3ER0A 1OZ3A 5LJ5e 1B34B 1OZ2A 2XHCA 3FIFA 4OF1A 3A5ZB 3OYFA 3I55T 1M1KU 4M78G 4KUDK 1Y71A 2E6ZA 3H6ZA 2IG0A 2RHZA 3QZ9B 5FRMA 2GFAA 2VXEA 1PSFA 4OB2B 4F7UG 4PJOC 4X34A 4E7HA 4O5VA 3TCJA 2P4TA 3A8OB 4J8OA 4ZGJB 5GMKl 1W2BS 3FRNA 3S6WA 3CCVT 2F69A 2Y4YA 1ZHIA 4LDUA 1S72T 1N9SA 3SWNA 5FLXE 4M7AE 4M77G 5KE2A 1AHJB 4GY5A 3G4ST 3GP8A 2MF2A 2DD4A 5HK3A 1YHQA 3CCMT 4BB7A 4B9XA 2HQXA 2PVGB 3QHSA 2RM4A 1WQ7A 3CXCA 4ZTJA 5LJ3f 3I56T 3JCMd 1IZ6A 2X4JA 3R6OA 1VQ7A 2DZCA 1Q86C 3VUZA 4M75A 2PQWA 2XU8A 4J5YA 3OMGA 5LJ3e 3TREA 4PJOD 3JCMW 2LC4A 1I4K1 4XTUA 3RMQA 2YRVA 4A54A 3RERA 4M75C 3PT9A 3X20B 1P92A 2EJ9A 2M1HA 4QVZA 1BIAA 5GAOq 2VGMA 2QQSA 3SWNB 1VQKT 2G3RA 1LOJA 3GLXA 2L3RA 2V8KA 3DLLA 2EQMA 1HK9A 1KC8U 3JB9D 2OTJT 1KHIA 2DTOA 4C92G 3JCMf 1ZBXA 3ZFJA 3CCUA 4M7DE 4XU0A 3WVDB 3S3MA 1KHCA 2XD0A 2K5IA 2RK2A 4IUPA 1QVFS 1TH7A 4M75B 3V7RA 5GMKe 5DLOA 1PSEA 3M4YA 3JCMe 5GANd 3OYCA 4BACA 1YITT 1YJ9T 3SD4A 4M7AF 4ZTFA 2XDBA 3L2RA 1G5VA 5J39A 1U1TA 5HK0A 2DZ9A 3JAME 4M77E 4C0DC 3OYNA 3QSUA 2OTLT 1NPPA 1VQ6A 1KQ2A 3JB9F 4JDSA 5CR2A 1U1SA 4C5HA 3SDZA 2E10A 4IUTA 5GMKj 3HSBA 2MWPA 1KD1U 3C95A 3E19A 3RKXA 4DQ2A 3FB9A 4C5EA 3RMSA 2QQAA 1WJSA 2VUBA 2P0KA 4XTZA 4TVRA 2E64A 3WVEB 1VQLT 4FM4B 2YLCA 5CKBA 2KSSA 3N5BB 1M1FA 1MGQA 4BI4A 4EMKC 5GANf 4PLLA 3FJPA 4P5NA 3CMAT 3OYAA 4C0DB 4HT9A 4C0ZA 4N4IA 5GANe 3CCLT 4FIBA 3OYKA 2FVUA 4C8QC 5I2SA 3OW2S 1M90U 1UB4A 2QXFA 2QQ9A 3UWNA 4OMFB 4M7DF 2JZ2A 2A3LA 4OGCA 2HAXA 3MO8A 4A4EA 4E7IA 4J7FA 5GANj 3HFNA 1BI0A 3HL8A 5GAMd 1K9MU 2KMTA 3C4SA 5A0LA 1BI3A 2MAMA 1VQ8A 3CC4T 1QVGA 2EWNA 4BE2A 3CBMA 5C6SA 4XU1A 5GMKi 3GF5A 4C8QD 4RG2A 3CC7A 1Y96A 3M4GA 3MEUA 2K5LA 1V29B 3VV0A 4Y28E 2CZ7B 3QJYA 1WJQA 4J6WA 3OS0A 3VU3C 2KY9A 1Q7YU 3O8VA 3FC3A 2EJFA 2GCXA 4L6V5 3QZ5B 4XU3A 2RH2A 3LYIA 4GLKA 5GAMf 2JTMA 3KUFA 4OP0A 1ZQ1A 3E9FA 5GAN6 3MP6A 4QVDA 3VYHB 4EPCA 3C94A 2DVEA 3C12A 4QW2A 3PMTA 5GAMe 4M7AG 4BI8B 3DLMA 3JB9I 2V8IA 4M78D 5DLQE 3VYGA 4B9WA 2QEXA 3JSCA 3NTIA 3GPLA 3NFCA 3L2VA 2FYKA 4XQ3A 2DO3A 4ZN3A 1Y96B 4N0AA 3JB9G 1N8RC 3ZBDA 2E41A 3A8MB 3HHTB 3V8LA 3UDCA 1YJNT 2RJEA 3CD6A 1M8VA 3HKSA 4PL6A 5GAMj 5IT9E 4N0AC 5LL6S 1GXIE 4R55A 2E6NA 2R5MA 4QQ6A 5LJ5g 4ZGDB 2K57A 1WPYA 3G6EA 4EDUA 5HKCA 1D3BA 1N6AA 1OYXA 2JTFA 3CMET 2RHYA 1I5LA 3DKMA 3GOXA 1Q86U 1VQ5T 2RI2A 5FRNA 1KQSS 3OBWA 4D6WA 4FT2A 3V8JA 2EQKA 1VQ4T 4NOYA 4M75E 3L2QA 1W4SA 4PJOA 3G7ZA 3CCQT 2XICA 4M7DG 3A8LB 2QQBA 1BYMA 5CQYA 1YI2T 3CC2A 1QW1A 3QKJA 2LX9A 2DK3A 2R5AA 1O75A 2EKOA 3J81E 4FU6A 2L5QA 1DJ7B 3QYHB 4Q5WA 4E7KA 3L42A 1M4ZA 3HRUA 5J3BA 2ZPIB 5LJ3g 1D3BB 2LT1A 5GAN2 4X9CA 4PJOF 4C92D 4BY6C 1YBYA 5D6XA 2RJCA 2JNGA 3CCEA 3P8DA 2RB6A 2GF7A 3GNGA 1YIJA 2BIVA 1VQNT 1VQ6T 4PJOB 2DJZA 4HCZA 4E7JA 4OVAA 2VGNA 4IUVA 4JRPA 3ME9A 5D6YA 2E1HA 3CPWA 1JJ2A 1G3TA 3MEWA 3RKWA 2ZZDA 3PIPA 3CCJT 1NE8A 4LDVA 4BY6B 4RCCA 2B8AA 3VKIA 2K5FA 3JCMg 3OYIA 3CBPA 2BKDN 5FROA 1QVPA 3V7CA 3T9NA 4DOVA 1I81A 4M75F 4UC4A 4A4HA 3KXTA 3TEEA 1QVGS 1VQPT 5CO7A 4KUIA 3JCMP 5D6WA 5GAN4 1R8OB 2A7YA 4NL2A 5LJ5h 1K8AU 1BI1A 3P8BB 5GAOp 4BI3A 2QA4A 4DOWA 1QP2A 4IUUA 2K3YA 2PUKB 4PKCC 1N9RA 4QQGA 3Q1JA 4XTYA 2VV5A 5I2MA 3SB2A 3FEOA 2XI9A 1VIFA 1XQHA 2GQVA 3UT1A 3CCRT 5C0MA 2HD0A 3CPFA 1NJIC 3I55A 3QUIA 2K2VA 3OA6A 2LDMA 5J26A 1RI0A 4ELYC 2DXBA 3TU4K 2DXCA 4MZTA 2HBPA 4ZN1A 4BDZA 2EFIA 4EMKA 5FU6C 3CCST 2OAUA 5AYFA 2I2LA 3J80E 1VQMT 1XNIA 4RKUE 1X75C 4JRIA 2O4XA 3F70A 3MEAA 3VUBA 1S72A 3NTKA 3JRZA 4C8QA 4KT0E 1LJOA 3DB3A 3BY7A 3G4SA 1VQ9T 5FU7C 4A4FA 1NPRA 3RUXA 2JOYA 5LJ3h 3CCMA 2YHTA 5GAOm 2RA2A 2MI6A 4NL3A 2L89A 2HNIA 1FXXA 1RL2A 2CZ0B 2P0PA 3HRSA 3QYGB 4PJOG 3I56A 1JRIA 2LT4A 4MZMA 2C06A 5KCOA 2WSEE 1UGRB 2JVVA 5CKFA 5FU6B 4EMHA 2QEXT 4XTWA 4C8QF 4A4GA 1Q81C 3OS2A 2CKKA 1VQOT 2LCLA 2P0QA 4XK8E 4M7AD 4EMKB 3X28B 1M5Q1 3JCMX 2M0OA 4YTLA 4M78A 1M1GA 3OMCA 1UGSB 2O4XB 4MMLA 3INZA 5FU7B 4IKFA 3LGFA 1N8RU 1VQKA 1WGSA 1LNXA 4C8QB 4RMOA 2RD1A 2RHIA 4M78C 4OB1B 4E7LA 3S3OA 3JCMh 4HA8A 4KBMB 2PVDB 3OYHA 4C5GA 1YJWT 2GFUA 4M75G 4MDWA 5I21A 5CIUA 5CAIA 4PNOA 3PFSA 1YITA 4M77C 3OYBA 2E65A 2VXFA 4RCBA 5HY6A 2KQWA 2CZ6B 3LWIA 5CVIA 2L8DA 3JCMQ 2DXTA 5EG2A 3M58A 5GAN8 4M78B 2OTLA 3CXCS 2WSCE 2DIGA 3CC2T 4OB0B 5CKDA 4M7DD 4F7UB 2LRQA 2PUOB 4JRQA 4N4GA 2KK4A 2CZ1B 4X9DA 2EYQA 3BDLA 4PJOE 1QVFA 3ASKA 1XTDA 1VQLA 1I8FA 5A0GA 1WNLA 3M5AA 1H641 1QP3A 5CK9A 1K73C 1YHQT 2E70A 2X4WA 1G3WA 3GIBA 2CS7A 3FDRA 5KE3A 3FLGA 4M77D 3VJPA 4ELZC 3CMAA 3CCET 1VQ7T 4C92A 3CCLA 2VYTA 2EQJA 2FB7A 2BUDA 4OB3B 3M59A 2E5QA 4JLIA 4C0GA 3QIIA 3P8HA 4C92C 4XTVA 4PLIA 4VUBA 5LJ5d 5DM7R 4DA4A 2XDPA 3A8HB 2ZPFB 4ME7A 2V8JA 3OBYA 1Q82C 3LLRA 2LQ8A 3QBYA 3OYMA 2DD5A 2LTOA 3OYLA 2QDYB 5GAN7 4XU2A 4C8QG 4IURA 3URGA 2RHUA 1X6OA 5GAN3 3CC4A 4HT8A 2K4YA 3G71A 3OYDA 3CCUT 2ZGWA 4A4KA 2D0QB 2RJDA 1WQWA 4C92B 4RG8A 4LD9K 2LQKA 3L2WA 4MDXA 3OQ5A 1UGPB 3EFSA 3LX7A 2D9TA 3LGLA 1UEBA 4LDYA 2AHJB 1SSFA 2RK1A 2X4YA 2F5TX 3RKYA 2WACA 2M9UA 1KQ1A 3BDUA 5CQXA 3BFMA 3X25B 5LJ3d 2LNVA 2R58A 3M54A 2HQEA 4J6YA 2WSFE 3HPWA 1NJIU 2XG8D 2XK0A 4BD3A 5LJ5j 3PGGA 3V8KA 3PMIA 4E47A 3GNFB 1O9SA 4O6JA 3HP9A 3MCAB 1YJNA 1UGQB 4N4HA 4Z02A 1K8AC 3QXEB 4J7IA 4L5GA 1Y7XA 5IN1A 3JCMb 2RHXA 2CGHA 3SWNC 4JS4A 3CEYA 2YLBA 4FL6A 3LWHA 2EIFA 3JCMJ 2ZCFB 4C8QE 3SFMA 3MP8A 4CI0C 3E1SA 1JB0E 3CMEA 3HRTA 5KCHA 2RI5A 3E9GA 1VQ5A 1M1KC 3QG1A 5A0DA 4HCBA 2EJGA 3J7AF 2EQUA 1XOVA 2KVQG 2LCCA 1Q81U 3META 1VQ4A 2VC8A 1VQ8T 4FT4A 3CCQA 3JB9H 2DEQA 4II1A 4M7AA 5LJ3j 1FWZA 2M16A 5GANg 3M57A 1YI2A 5GAOn 3OYEA 3CC7T 2DPPB 5IAYA 2MMPA 4M7AC 3L2ZA 4M78E 5CCAA 2QTXA 2JN0A 3CCVA 5DY9A 2FL7A 3DB4A 4F7UE 4IUQA 4C0FA 1KQSA 1FX7A 2RO0A 4M75D 3OS1A 1H3ZA 2QI2A 4XTXA 4C5IA 3RIRA 4BUGA 3OSSC 1IREB 2FHDA 2O01E 1VQNA 4WF2A 3AHUA 4JUVA 1X01A 4M7AB 1W2BA 3OYGA 1BKBA 1KG1A 4JRKA 1WJRA 2DTHA 3BW1A 4LD6A 2K3XA 3JCMV 1M9SA 3CCJA 3CD6T 2X35A 4MMKA 2KAFA 4A53A 2Y4XA 3MEVA 4M7DA 3MHXA 2XIDA 1BI2A 3L2UA 1KC8C 4JJNK 2H3JA 4F7UA 1K73U 5GMKh 4M7DC 2DAQA 3G6ET 2ZPHB 3ZEHA 2QA4T 2Y90A 2OTJA 1VUBA 3M55A 2LVMA 3OS5A 1Y07A 1VQPA 5GAOl 2DXUA 5GAMg 1YCYA 2CYZB 2DTIA 2RI3A 3QDRB 4M77A 4M78F 4MZPA 3LW5E 5L8RE 3V7SA 4HKEA 2D6FA 4C92E 1YJ9A 1Q82U 4F7UF 3UPUA 3CCRA 3PIOA 3A8GB 3X26B 3KBGA 5CKHA 5M9OA 1KD1C 4M7DB 2EAYA 2JUFA 3MP1A 3OYJA 2E12A 3M53A 4LDWA 4M77F 5GAOr 3CBOA 3G71T 2NLUA 3OYYA 4V2SA 1U8RA 3CPWS 5GANh 1HXDA 5KH6A 3CCSA 1VQMA 1JJ2S 2QQRA 4Y91A 4M77B 4ZGEB 3OSVA 3M9QA 1G3SA 4ATOA 2MWOA 3LH0A 2PVOB 2PU9B 4QQDA 1VQ9A 1NZ9A 1OI1A 1VIEA 3NTHA 3RESA 2DKGA 1YIJT 1M90C 3QJ6A 2DIQA 3OB9A 3S3NA 4OGEA 3OY9A 3HFOA 4J83A 4FSXA 3WXMB 4HCCA 4LDXA 5CKEA 2F5KA 1K9MC 1EIFA 1B34A 3M56A 4KULA 4XAXB 1VQOA 4BE0A 4C92F 3JB9J 2ZPBB 4JLGA 4QVCA 2ZPGB 5GMKm 3L1AA 1G3YA 3EAEA 2KDSA 2XDDA 2R57A 3PTAA 3H8ZA 1N27A 4NS5A 4BE1A 2X4XA 4EMGA 3OW2A 3QO3A 2IVWA 3QPHA 1MHNA 5A2QE 2XKOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI8 B;  4BI4 A;  4BI3 A; 
#chains in the Genus database with same CATH topology
 1YJW A;  2J6K A;  1ZBJ A;  2RJF A;  4J6X A;  2V26 A;  4R56 A;  1YCS B;  1T3L A;  4OMP A;  5I11 A;  4OF1 A;  3A5Z B;  5FRM A;  3H6Z A;  2CUB A;  2VXE A;  4PJO C;  1D1C A;  2RN8 A;  4OB2 B;  3CC2 Q;  2OX7 A;  4O5V A;  4ZGJ B;  4J8O A;  2X51 A;  3CCV T;  1TTH B;  1ZHI A;  1N9S A;  2JS0 A;  1W2B P;  6AT1 B;  1VQ7 A;  3I56 T;  1TOV A;  2X4J A;  4PFP A;  3R6O A;  3JCM d;  1Q86 C;  4M75 A;  1MMD A;  2XU8 A;  3OMG A;  5LJ3 e;  3JCM W;  2LC4 A;  2YRV A;  4JZ4 A;  4JPB W;  3RER A;  2M1H A;  1VQK T;  2V8K A;  1I1J A;  3DLL A;  1FMV A;  2DL5 A;  2OTJ T;  4C92 G;  3CCU Q;  2C0O A;  2PTK A;  2EW3 A;  1BBZ A;  2RK2 A;  2P4R A;  3JCM e;  1PSE A;  3PVQ A;  1YIT T;  4BAC A;  1YJ9 T;  4CC3 A;  3L2R A;  2H8H A;  5HK0 A;  3JAM E;  3OYN A;  4C0D C;  2A37 A;  5IHN A;  1KQ2 A;  3I55 Q;  4C5H A;  3HSB A;  3EG2 A;  2VUB A;  2YLC A;  2KSS A;  1MGQ A;  4PLL A;  2YRD A;  3G4S Q;  3VS0 A;  3CCL T;  1OEB A;  4FIB A;  1GCQ A;  2LJ3 A;  3UWN A;  2JZ2 A;  3OW2 P;  3MO8 A;  3HFN A;  1SF9 A;  1K9M U;  2KMT A;  1VQ8 A;  3CC4 T;  3CBM A;  3H0I A;  1GFD A;  3CC7 A;  1SRM A;  4Y28 E;  2QAZ A;  3OS0 A;  1YWP A;  2QAS A;  1X43 A;  4FYY B;  1Q7Y U;  3O8V A;  2RH2 A;  3LYI A;  4GLK A;  2CP2 A;  4J9C A;  1GBQ A;  1X6G A;  2JTM A;  3KUF A;  3E9F A;  3MP6 A;  2MK5 A;  4QVD A;  3RR6 A;  3C94 A;  4M7A G;  3JSC A;  3NTI A;  1HJD A;  2X9H A;  1UJY A;  1OOT A;  1Y96 B;  1TS9 A;  1WXB A;  2E41 A;  3HHT B;  3V8L A;  1YJN T;  1M8V A;  2RNA A;  1UEC A;  3HKS A;  4PL6 A;  2E6N A;  5LJ5 g;  2K57 A;  4FYW B;  1IHW A;  1N6A A;  2AZS A;  1U3O A;  2EQI A;  3DKM A;  3GOX A;  7AT1 B;  5FRN A;  4PJO A;  3M0Q A;  1W4S A;  3G7Z A;  4M7D G;  1R0C B;  4AFU C;  5AT1 B;  1YI2 T;  3QKJ A;  2R5A A;  1X2K A;  2FPF A;  3G71 Q;  2L5Q A;  1AD5 A;  1IGU A;  1DJ7 B;  5KYU A;  2QYZ A;  5J3B A;  2ZPI B;  1YBY A;  1JXO A;  4PK4 A;  2L0A A;  3CCE A;  2XMF A;  1YIJ Q;  2BIV A;  1IRX A;  1ZUU A;  4OVA A;  3TVT A;  4IUV A;  4JRP A;  5D6Y A;  2E1H A;  1NG2 A;  1JJ2 A;  3MEW A;  2ZZD A;  4RCC A;  1SKU B;  2B8A A;  2K5F A;  1X2Q A;  1ZUK A;  3T9N A;  4DOV A;  1WYX A;  4HVV A;  4A4H A;  1HSQ A;  1QVG S;  5D6W A;  1AWJ A;  4NL2 A;  2QA4 A;  5GAO p;  1QP2 A;  4PKC C;  2PUK B;  4QQG A;  1WZO A;  4HVW A;  3CME Q;  4CC7 A;  3CCR T;  2COY A;  1NJI C;  3QDF A;  3CCQ Q;  5IXF A;  3TU4 K;  2HBP A;  2NYS A;  2O9V A;  2O4X A;  4PFZ A;  3JRZ A;  1Q81 R;  1EZZ B;  2HL3 A;  4KT0 E;  4D8K A;  5FU7 C;  4A4F A;  3RUX A;  5LJ3 h;  4DEY A;  5GAO m;  2MI6 A;  2CZ0 B;  2P0P A;  3HRS A;  3QYG B;  4PJO G;  3I56 A;  1XJW B;  1VQN Q;  5FU6 B;  4EMH A;  2QEX T;  2QGF B;  2DE0 X;  2DYB A;  4C8Q F;  2CKK A;  1VQO T;  2LCL A;  1AEY A;  4YTL A;  4M78 A;  1M1G A;  4IKF A;  3INZ A;  1FMK A;  1VQK A;  4C8Q B;  3JB9 D;  3S3O A;  3JCM h;  1QWE A;  2ATC B;  1B07 A;  2PVD B;  5IHK A;  2GFU A;  4DBR A;  4RUG A;  3H9N A;  2AK5 A;  4PNO A;  1YIT A;  2VXF A;  5HY6 A;  2BZY A;  2KQW A;  1K73 R;  4JJB A;  3M58 A;  2A0F B;  2E5K A;  4X9D A;  2YDL A;  3CXC P;  3ASK A;  1VQL Q;  1I8F A;  5A0G A;  1WNL A;  1H8K A;  1YHQ T;  3GIB A;  2CS7 A;  2SEM A;  3CCL A;  1MUZ A;  2K3B A;  2XDP A;  3A8H B;  2ZPF B;  3OBY A;  2F1L A;  2LQ8 A;  3OYM A;  1OQK A;  1W1F A;  2LTO A;  2QDY B;  4IUR A;  5IH2 A;  3CC4 A;  1X6O A;  1ZSZ C;  1WHG A;  2YSQ A;  2COW A;  4A4K A;  2LJ0 A;  4Z8A A;  4RTT A;  4C92 B;  1OPK A;  4RG8 A;  4LD9 K;  2LQK A;  3NHN A;  3L2W A;  5D7U A;  2D1X A;  1UGP B;  2D9T A;  1YJW Q;  3LGL A;  2FZG B;  2X4Y A;  2WAC A;  1M3A A;  3BFM A;  1ARK A;  2R58 A;  2CT4 A;  1AT1 B;  4CC4 B;  1K1Z A;  3PGG A;  4GBQ A;  2D8H A;  2CSI A;  4E47 A;  1O9S A;  3HP9 A;  1YJN A;  2F2V A;  4WCI A;  1M3B A;  5KYW B;  3JCM b;  2MIO A;  3SWN C;  4JS4 A;  2RF0 A;  1VQ7 Q;  3JCM J;  4FYV B;  4C8Q E;  3SFM A;  3TSW A;  2RQW A;  4AG1 C;  1VQ5 Q;  1RAI B;  1M1K C;  5A0D A;  4HCB A;  2EJG A;  3J7A F;  1AVZ C;  2DEQ A;  2AIR B;  4II1 A;  4F04 B;  1FWZ A;  4FCY A;  5GAN g;  2OI3 A;  1YI2 A;  3EH1 A;  2DPP B;  4LUD A;  1SPK A;  2QTX A;  2JN0 A;  3A98 A;  2QDL A;  2RO0 A;  1MV3 A;  1UHF A;  4KH1 B;  4AG2 C;  3RIR A;  2FHD A;  4WF2 A;  3AHU A;  4M7A B;  3MKD A;  3VRZ A;  1BKB A;  4JRK A;  1TUG B;  3FJ5 A;  2X35 A;  3CD6 T;  3MEV A;  1KC8 C;  4JJN K;  4F7U A;  2YUP A;  2BTT A;  2QA4 T;  2Y90 A;  1HYO A;  2DXU A;  1QKW A;  2DTI A;  2RI3 A;  9ATC B;  3LW5 E;  5L8R E;  4HKE A;  4C92 E;  3UPU A;  3CCR A;  1RAD B;  3KBG A;  1KD1 C;  4M7D B;  3MP1 A;  1M90 R;  4M77 F;  1VQ8 Q;  1PRM C;  4FSS A;  4J9I A;  3CC7 Q;  1JJ2 S;  1VQM Q;  2QQR A;  2KR3 A;  2KRN A;  4M77 B;  3M0P A;  5KYX B;  2MWO A;  3LH0 A;  1VIE A;  5I22 A;  2MCN A;  3OB9 A;  2C0T A;  1K9A A;  1WHJ A;  3OY9 A;  3HFO A;  3WXM B;  2DVJ A;  4XAX B;  1VQO A;  3C0C A;  4RTW A;  2JMC A;  1ABQ A;  4B6M A;  1WHL A;  1X6B A;  1N27 A;  4NS5 A;  2ED1 A;  2IVW A;  1MHN A;  5A2Q E;  1JBM A;  4IIM A;  2ZPE B;  5GAM h;  2CSQ A;  1OZ3 A;  1OZ2 A;  4KUD K;  2E6Z A;  2GFA A;  4KRT A;  1BK2 A;  4F7U G;  4E7H A;  3TCJ A;  5GMK l;  3FRN A;  3S6W A;  3O5Z A;  4LDU A;  1S72 T;  4M7A E;  3SWN A;  1PKT A;  5KE2 A;  1AHJ B;  2CP3 A;  2DD4 A;  5HK3 A;  1YHQ A;  2DM1 A;  2HQX A;  4OMQ A;  3QHS A;  2RM4 A;  3CCE Q;  1IZ6 A;  2PQW A;  4J5Y A;  4XTU A;  3RMQ A;  4M75 C;  4DBF A;  1P92 A;  4QVZ A;  3M0U A;  5GAO q;  2VGM A;  3GLX A;  1LOJ A;  2L3R A;  2ZAE A;  1HK9 A;  2BE7 D;  3D7S B;  1LPL A;  4M7D E;  2HCK A;  4XU0 A;  3QWX X;  4QT7 A;  1WA7 A;  2YT6 A;  4IUP A;  5KYY B;  3V7R A;  5GMK e;  1M2V B;  2XDB A;  5J39 A;  1QVF P;  4M77 E;  3EGD A;  1VQ6 A;  3JB9 F;  5CR2 A;  1RAG B;  1U1S A;  3SDZ A;  5GMK j;  4IUT A;  1YWO A;  1GCP A;  4XTZ A;  4FM4 B;  4KGZ B;  3M0R A;  4EMK C;  5GAN f;  3CMA T;  4C0D B;  4HT9 A;  3OYK A;  2FVU A;  1UB4 A;  2QXF A;  2EPD A;  4R0K A;  2HQH A;  2QQ9 A;  1GCQ C;  4OMF B;  2A3L A;  4A4E A;  1U06 A;  1UGV A;  4J7F A;  4E7I A;  3HTR A;  1BI0 A;  2A36 A;  4KH0 B;  3C4S A;  1BI3 A;  4GLM A;  1QVG A;  3RBB B;  5L23 A;  3GF5 A;  4C8Q D;  3MEU A;  1AWW A;  1V29 B;  3EHR A;  2CZ7 B;  3QJY A;  4PFO A;  1UJ0 A;  4ANJ A;  4J6W A;  2KY9 A;  2EJF A;  1N8R R;  4OP0 A;  3VYH B;  2HZY A;  3PMT A;  3JB9 I;  2GTJ A;  2NUP A;  3L2V A;  3VS2 A;  3CD6 A;  5FWC A;  1AZG B;  2RJE A;  4D8D A;  5IT9 E;  4R55 A;  4QQ6 A;  2KE9 A;  1GBR A;  5ECA A;  2M02 A;  1OYX A;  2JTF A;  4ESR A;  4X1V A;  1Q86 U;  1N5Z A;  2RI2 A;  2W0Z A;  3OBW A;  1MMA A;  4D6W A;  3UA7 A;  4Z88 A;  1VQ4 T;  4NOY A;  2XIC A;  3A8L B;  3VS7 A;  2QQB A;  2EBP A;  4AFQ C;  1NBE B;  2DK3 A;  1O75 A;  4FU6 A;  3REA B;  4Q5W A;  1M4Z A;  5LJ3 g;  1D3B B;  3RDV A;  4C92 D;  5GAN 2;  5D6X A;  2JNG A;  2V1Q A;  1C1A A;  3UAT A;  4Y92 A;  2DJZ A;  4E7J A;  4J9D A;  1ZSG A;  3CPW A;  3UF4 A;  1G3T A;  1W70 A;  3CCJ T;  4LDV A;  3JCM g;  2VKN A;  3V7C A;  1YJN Q;  3KXT A;  2FZK B;  4RTV A;  3TEE A;  1VQP T;  4LNP A;  4HVU A;  2PZ1 A;  1WDX A;  4DOW A;  3I35 A;  1N9R A;  2XI9 A;  3QUI A;  2SRC A;  1RI0 A;  4ZN1 A;  1YI2 Q;  4EMK A;  3CCS T;  5AYF A;  2I2L A;  2JTE A;  2KYB A;  3J80 E;  1D0Z A;  1XNI A;  1HD3 A;  1X75 C;  3ZL7 C;  3F70 A;  3MEA A;  1S72 A;  3NTK A;  4AT1 B;  3I9Q A;  1LJO A;  1VQ9 T;  1NPR A;  1D1B A;  3UA6 A;  4MZM A;  2GTO A;  1M8M A;  1RLP C;  2WSE E;  2GNC A;  5CKF A;  1RLQ C;  4A4G A;  1Q81 C;  4XK8 E;  1KSW A;  4M7A D;  5FU7 B;  4OB1 B;  1RAB B;  4M78 C;  1SHF A;  1KK7 A;  2KRS A;  4KBM B;  1TUD A;  2ABL A;  1U5S A;  1GL5 A;  4C5G A;  4M75 G;  2CH4 A;  2E65 A;  1RAF B;  1TG0 A;  3CCR Q;  3JCM Q;  2VB6 A;  5EG2 A;  2E4H A;  2M51 A;  2OTL Q;  2DIG A;  3CC2 T;  1D09 B;  4M7D D;  4F7U B;  4JRQ A;  4N4G A;  2LMJ A;  4A63 B;  3BDL A;  4E7S A;  1Q82 R;  4RTZ A;  2KGT A;  1H64 1;  3M5A A;  1QP3 A;  1TXQ A;  5CK9 A;  1K73 C;  2DBM A;  2X4W A;  2DA9 A;  5KE3 A;  4M77 D;  3CMA A;  2F2X A;  2DL3 A;  2YWW A;  2Z0W A;  1PM3 A;  2L2P A;  3J81 E;  4OB3 B;  4AMC A;  4XTV A;  3AT1 B;  5LJ5 d;  3VS3 A;  1ZUY A;  3OYL A;  1QLY A;  5GAN 7;  4XU2 A;  4HT8 A;  2YUO A;  3OYD A;  3CCU T;  2D0Q B;  4MDX A;  2BZ8 A;  2AHJ B;  1SSF A;  2NUT A;  2RK1 A;  3EFO B;  4PJN A;  1KQ1 A;  3IQL A;  1K8A R;  2OJ2 A;  1OU9 A;  1PC0 A;  1ZSZ B;  1UHC A;  4J6Y A;  1NJI U;  3EGX A;  4BD3 A;  4PJJ A;  5LJ5 j;  3PMI A;  4O6J A;  3MCA B;  3NPF A;  1J3T A;  1UGQ B;  5FW9 A;  1YHQ Q;  3CEY A;  3LWH A;  2ZCF B;  4CI0 C;  3E1S A;  1JB0 E;  1EFN A;  2DL8 A;  5KCH A;  1Z9Q A;  2EQU A;  3MET A;  1VQ4 A;  1TSF A;  3JB9 H;  1SEM A;  3EG3 A;  3M57 A;  2O88 A;  2DNU A;  3VRY A;  5GAO n;  5IAY A;  3I5S A;  3L2Z A;  1VYT A;  4WTO B;  5CCA A;  1D1A A;  1B7T A;  3CCV A;  5DY9 A;  4F7U E;  1PRL C;  4IUQ A;  4C0F A;  1KQS A;  4LE9 A;  2L3P A;  2DIL A;  1K0X A;  3EG9 A;  1JO8 A;  4XTX A;  4BUG A;  3OSS C;  1VQ6 Q;  4JUV A;  4EIK A;  3E2U A;  1MNE A;  3JCM V;  3CCJ A;  4A53 A;  4MMK A;  1BI2 A;  1NM7 A;  1PD0 A;  2DAQ A;  1SG5 A;  3G6E T;  2OTJ A;  3M55 A;  1VQP A;  2LVM A;  3QWY A;  1UDL A;  5GAM g;  2CYZ B;  3M0T A;  1YJ9 A;  4DEX A;  2LP5 A;  2X3X D;  2E12 A;  3M53 A;  2ROL A;  2VWF A;  4FW1 A;  2A08 A;  3G71 T;  3OYY A;  4V2S A;  3CPW S;  1HXD A;  3CCS A;  4ZGE B;  1UE9 A;  2VAS A;  1K9M R;  1WI7 A;  2PVO B;  4QQD A;  1VQ9 A;  1NZ9 A;  2K79 A;  1OI1 A;  1M90 C;  1YIJ T;  2DKG A;  3QJ6 A;  2DRK A;  4HCK A;  1D0X A;  1EIF A;  3PE0 A;  1B3Q A;  4KUL A;  1Q7Y R;  4BE0 A;  4C92 F;  2BZX A;  3CD6 Q;  4JLG A;  1MV0 B;  4IIO A;  4KGV B;  2W10 A;  2KDS A;  2XDD A;  4BE1 A;  4EMG A;  2NWM A;  1X27 A;  5GAN 5;  3X24 B;  5LJ5 f;  3PNW C;  4BDY A;  4L59 A;  4CRI A;  3ER0 A;  2LCS A;  1B34 B;  2XHC A;  1M1K U;  4M78 G;  1Y71 A;  2FEI A;  2RHZ A;  2IIM A;  1PKS A;  1PSF A;  1IHV A;  1ZA2 B;  4X34 A;  1W2B S;  1R77 A;  2F69 A;  2Y4Y A;  3JV3 A;  8ATC B;  5FLX E;  1M3C A;  4GY5 A;  2MF2 A;  1OV3 A;  3CCM T;  4B9X A;  2KXD A;  2PVG B;  1WQ7 A;  3CXC A;  3VUZ A;  1ZA1 B;  1I4K 1;  2K6D A;  2EJ9 A;  1BIA A;  3TSZ A;  3VS1 A;  4E6R A;  1CSK A;  2G3R A;  5GJW B;  1ACM B;  1JU5 C;  2EQM A;  2HL5 C;  1KC8 U;  3CCU A;  3ZFJ A;  1ZBX A;  3S3M A;  2DMO A;  1KHC A;  2LX7 A;  2XD0 A;  1IB8 A;  1TH7 A;  4M75 B;  5GAN d;  3M4Y A;  3OYC A;  3SD4 A;  4M7A F;  1U1T A;  3QSU A;  1EX4 A;  1KD1 U;  3C95 A;  3E19 A;  3RKX A;  4DQ2 A;  3FB9 A;  1SSH A;  3THK A;  2QQA A;  2P0K A;  4TVR A;  1VQL T;  3WVE B;  5CKB A;  2EGA A;  2COZ A;  3N5B B;  1S72 Q;  4P5N A;  1UG1 A;  2AKL A;  5GAN e;  3H0H A;  4C8Q C;  5I2S A;  4OMM A;  1R0B G;  3OW2 S;  4M7D F;  2EYZ A;  1LCK A;  4OGC A;  5EC7 A;  2HAX A;  5GAN j;  3HL8 A;  4QKU A;  2MAM A;  5C6S A;  5GMK i;  3I5R A;  1Y57 A;  1YP5 A;  1K0S A;  4RG2 A;  1Y96 A;  3M4G A;  3VV0 A;  2CP7 A;  2CT3 A;  3VU3 C;  4L6V 5;  3QZ5 B;  2DEU A;  5GAM f;  5GAN 6;  1ZQ1 A;  4EPC A;  2CRE A;  3C12 A;  2GBQ A;  3EG1 A;  4BI8 B;  1A0N B;  5DLQ E;  2FZC B;  2QEX A;  3GPL A;  3NFC A;  2FYK A;  4FYX B;  4XQ3 A;  4ZN3 A;  4N0A A;  1N8R C;  3ZBD A;  3UDC A;  2ENM A;  1GXI E;  1G8X A;  2R5M A;  2KT1 A;  1IGQ A;  4LXC A;  4ZGD B;  1QWF A;  3CMA Q;  1WPY A;  3G6E A;  1UTI A;  1X69 A;  5HKC A;  4RTU A;  2RHY A;  1VQ5 T;  2IPO B;  1K76 A;  1KQS S;  3VS5 A;  3V8J A;  3L2Q A;  4M75 E;  2DRM A;  1BYM A;  1QMC A;  1D0Y A;  2LX9 A;  1MMN A;  3QYH B;  2FRW A;  3L42 A;  5IHI A;  1OPL A;  2LT1 A;  4X9C A;  4PJO F;  4BY6 C;  2RJC A;  2RB6 A;  2GF7 A;  3GNG A;  1YIJ A;  2JS2 A;  4PJO B;  4HCZ A;  2EYY A;  1ZLM A;  2VGN A;  2JJ9 A;  1WXT A;  3RKW A;  1OX9 A;  2DET A;  1NE8 A;  5KYU B;  3G1J A;  3VKI A;  2J06 A;  3CBP A;  5GJV B;  5FRO A;  4UC4 A;  5CO7 A;  4KUI A;  2CP5 A;  5GAN 4;  2A7Y A;  1BI1 A;  3REB B;  2QA4 Q;  4IUU A;  5KH6 A;  1QVG P;  2J7I A;  4XTY A;  2VV5 A;  2RQT A;  3SB2 A;  3EGX B;  3FEO A;  3SEM A;  3UT1 A;  3PVL A;  3CPF A;  3OA6 A;  1VQ4 Q;  2LDM A;  1IO6 A;  5J26 A;  4ELY C;  2DXC A;  4MZT A;  2EFI A;  2OAU A;  1VQM T;  4RKU E;  4JRI A;  3CCV Q;  3VUB A;  4C8Q A;  3DB3 A;  3BY7 A;  2L3S A;  3CCM A;  2CDT A;  4NL3 A;  2RA2 A;  2L89 A;  2HNI A;  1FXX A;  1RL2 A;  3I56 Q;  1JRI A;  2LT4 A;  2X3W D;  2C06 A;  1AOJ A;  3OS2 A;  2P0Q A;  4HXJ A;  1M5Q 1;  1PNJ A;  2M0O A;  3OMC A;  2O4X B;  2KNB B;  3LGF A;  1WGS A;  1LNX A;  4RMO A;  1VQK Q;  2RD1 A;  1WHH A;  2I0N A;  2FO0 A;  3OYH A;  2OTJ Q;  2LNH B;  1VQP Q;  5I21 A;  1RAC B;  5CIU A;  3PFS A;  1JEG A;  4M77 C;  3OYB A;  1YIT Q;  1YJ9 Q;  5CVI A;  2L8D A;  2DXT A;  5GAN 8;  4M78 B;  3CXC S;  2WSC E;  2NUZ A;  5CKD A;  4Z89 A;  2PUO B;  2CZ1 B;  4PJO E;  2EYQ A;  3BE3 A;  1QVF A;  1VQL A;  3CCS Q;  2MYS A;  2LQN A;  1RI9 A;  4E7Z A;  4M4Z A;  3VJP A;  4ELZ C;  3CCE T;  1VQ9 Q;  4C92 A;  1E7O A;  3CCL Q;  1BCO A;  3NMZ C;  2BUD A;  4C0G A;  4JLI A;  2E5Q A;  2HBW A;  1Q82 C;  3QII A;  3P8H A;  5DM7 R;  1YFN A;  2LQW A;  4ME7 A;  3LLR A;  3QBY A;  2DD5 A;  2HMA A;  1CKB A;  4C8Q G;  3URG A;  3CC4 Q;  2AZV A;  4F16 A;  2K4Y A;  1WHK A;  2L3Q A;  2HSP A;  1WQW A;  1WHM A;  2RQV A;  3EFS A;  1I0C A;  1I5O B;  4LDY A;  1T3S A;  5KYW A;  1TU0 B;  3RKY A;  1QQJ A;  2DER A;  2M9U A;  1RAH B;  2KYM A;  5LJ3 d;  1QCF A;  2LNV A;  1TWB A;  1CKA A;  1AZE A;  2G6F X;  2XK0 A;  1K8A C;  3QXE B;  5IN1 A;  1Y7X A;  1M30 A;  2RHX A;  2CGH A;  1PHT A;  2KBT A;  4FL6 A;  3MP8 A;  1G2B A;  2CP6 A;  1VQ5 A;  3E9G A;  2EYW A;  2E3I A;  2KRM A;  2QTV A;  1G83 A;  2LCC A;  2KVQ G;  1Q81 U;  4FT4 A;  4ORZ A;  4M7A A;  1MND A;  3KFV A;  2HKQ B;  5LJ3 j;  4F14 A;  2MMP A;  1T0H A;  4M78 E;  2FL7 A;  2JT4 A;  1FX7 A;  1NLO C;  4M75 D;  8AT1 B;  1H3Z A;  2LZ6 B;  1C0M A;  1IRE B;  1W2B A;  3OYG A;  1KG1 A;  2K3X A;  2HSE B;  1M9S A;  4J9G A;  2KAF A;  2DFU A;  2Y4X A;  3MPU B;  4M7D A;  3MHX A;  2XID A;  3L2U A;  2KI7 A;  2H3J A;  1K73 U;  5GMK h;  1GRI A;  1AWO A;  2ECZ A;  1VUB A;  1Y07 A;  5GAO l;  4M77 A;  3QDR B;  5KYX A;  4MZP A;  3V7S A;  2D6F A;  1T0J A;  4F7U F;  3A8G B;  2EYX A;  4LDW A;  5GAO r;  1VQM A;  4Y91 A;  3OSV A;  1NYG A;  1G3S A;  4ATO A;  1JJ2 P;  4DBH A;  3RES A;  1ZX6 A;  1W6X A;  4J83 A;  4LDX A;  2DL4 A;  5CKE A;  2QEX Q;  2F5K A;  1K9M C;  3M56 A;  1VQO Q;  1KIK A;  2DLP A;  3JB9 J;  1OU8 A;  2ZPB B;  1NEB A;  1G3Y A;  1Q95 G;  2R57 A;  3OW2 A;  4OMO A;  2X4X A;  3QO3 A;  3G6E Q;  1Q7Y C;  1QCN A;  3JCM c;  4JS5 A;  1BIB A;  3EFR A;  4DBQ A;  5LJ5 e;  3FIF A;  3I55 T;  3OYF A;  2O31 A;  1UUE A;  2IG0 A;  3QZ9 B;  1FYN A;  1KQS P;  3CQT A;  2P4T A;  3A8O B;  1Q86 R;  4OML A;  2QGG A;  4K11 A;  1WX6 A;  1Y0M A;  4M77 G;  3G4S T;  3GP8 A;  2EKH A;  4BB7 A;  2LJ1 A;  2ESW A;  4ZTJ A;  5LJ3 f;  2AKK A;  2DZC A;  2BE9 B;  2FG0 A;  5KYY A;  4RTY A;  3TRE A;  4PJO D;  1M2V A;  4A54 A;  3PT9 A;  3X20 B;  2FPE A;  2QQS A;  3SWN B;  3GBQ A;  5KYN A;  3MJX A;  2KXC A;  1KHI A;  2DTO A;  3JCM f;  3EG0 A;  3EGU A;  3WVD B;  1E6G A;  2K5I A;  1QVF S;  5DLO A;  2DL7 A;  2YUN A;  4ZTF A;  1G5V A;  2DZ9 A;  2MOX A;  2OTL T;  1NPP A;  4JDS A;  2E10 A;  2MWP A;  1GFC A;  4J9H A;  4C5E A;  3RMS A;  1WJS A;  2JM8 A;  1JXM A;  2E64 A;  1S1N A;  3SHW A;  3H0F A;  1M1F A;  5HCK A;  4BI4 A;  3FJP A;  1E6H A;  3OYA A;  1LVK A;  4C0Z A;  4N4I A;  3CCM Q;  3EGD B;  1M90 U;  2DF6 A;  5GAM d;  2HEQ A;  5A0L A;  2K2M A;  2D0N A;  2EWN A;  2HKN A;  4BE2 A;  4XU1 A;  2K5L A;  1WJQ A;  3FC3 A;  2GCX A;  1SHG A;  4XU3 A;  2CUD A;  3M0S A;  2DVE A;  1RAA B;  4QW2 A;  5GAM e;  3DLM A;  2V8I A;  4M78 D;  3VYG A;  4B9W A;  2DO3 A;  3JB9 G;  3A8M B;  2J6F A;  5GAM j;  2A28 A;  4N0A C;  5LL6 S;  2QG9 B;  4EDU A;  2E3H A;  1D3B A;  3CME T;  1I5L A;  1VOM A;  2KEA A;  2NUP B;  2QK0 A;  4FT2 A;  2EQK A;  3CCQ T;  5CQY A;  2RPN A;  1M2O A;  3CC2 A;  1QW1 A;  2CP0 A;  2EKO A;  4E7K A;  3HRU A;  1K4U S;  1PD1 A;  3TQ7 P;  4LUE A;  2EGC A;  3P8D A;  1VQN T;  1VQ6 T;  3ME9 A;  1M27 C;  3PIP A;  4BY6 B;  3A1P A;  1BB9 A;  3OYI A;  2BKD N;  1QVP A;  1I81 A;  4M75 F;  2EGE A;  1NJI R;  3JCM P;  1R8O B;  5LJ5 h;  2CH4 W;  1TUC A;  3P8B B;  4BI3 A;  2K3Y A;  1RUW A;  5I2M A;  3Q1J A;  1VIF A;  1XQH A;  2GQV A;  5C0M A;  1FMW A;  2HD0 A;  2M0Y A;  3I55 A;  2K2V A;  2K9G A;  2J05 A;  2DXB A;  2RQU A;  4BDZ A;  2H3E B;  5FU6 C;  2F2W A;  3G4S A;  4CC2 A;  1IXD A;  2JOY A;  2YHT A;  2D8J A;  2YXY A;  1KJW A;  3LH5 A;  2GQI A;  5KCO A;  3RNJ A;  1UGR B;  2JVV A;  3VS6 A;  4XTW A;  4E2F B;  1QCO A;  4PJM A;  4EMK B;  3X28 B;  1UFF A;  3JCM X;  1NEG A;  2MPX C;  2DX1 A;  2YUQ A;  1UGS B;  4MML A;  1N8R U;  1ABO A;  3U23 A;  2RHI A;  4E7L A;  2ROT A;  4HA8 A;  1YJW T;  4MDW A;  1I07 A;  5CAI A;  1BU1 A;  4RCB A;  3LWI A;  2CZ6 B;  3H41 A;  2OAW A;  3NGP A;  2OTL A;  1WFW A;  1VA7 A;  4OB0 B;  5FWB A;  4AFZ C;  2LRQ A;  2KK4 A;  1XTD A;  5IXB A;  1VYV A;  2ED0 A;  2E70 A;  1G3W A;  3FDR A;  4J9F A;  3ULR B;  3FLG A;  1VQ7 T;  1NYF A;  1PG5 B;  2KT8 A;  2VYT A;  2EQJ A;  2FB7 A;  3EH2 A;  4C92 C;  3M59 A;  4PLI A;  4VUB A;  4DA4 A;  3EFO A;  2V8J A;  2KRO A;  1ZSZ A;  1RAE B;  2FRY A;  1MMG A;  1WIE A;  2V1R A;  4JJD A;  2RHU A;  5GAN 3;  1OX8 A;  3G71 A;  2ZGW A;  2RJD A;  1H3H A;  1WLP B;  3OQ5 A;  3LX7 A;  1UEB A;  2FPD A;  2AT1 B;  2F5T X;  1AWX A;  3BDU A;  1BCM A;  1Z9Z A;  5CQX A;  3X25 B;  2DJQ A;  3M54 A;  4RTX A;  2HQE A;  2WSF E;  3HPW A;  4JZ3 A;  2XG8 D;  2C0I A;  3V8K A;  1YNZ A;  3GNF B;  4JJC A;  4N4H A;  4Z02 A;  1M1K R;  4J7I A;  4L5G A;  2NUT B;  2YLB A;  2EIF A;  1KFZ A;  4FW2 A;  2YRC A;  3CME A;  1NLP C;  3HRT A;  2RI5 A;  3QG1 A;  1XOV A;  1SRL A;  2VC8 A;  1VQ8 T;  3CCQ A;  1H92 A;  2M16 A;  3OYE A;  3CC7 T;  4M7A C;  3R6N A;  2GGR A;  1PCX A;  3DB4 A;  1C6V X;  3OS1 A;  2JM9 A;  2QI2 A;  4C5I A;  1KC8 R;  2O01 E;  1VQN A;  2DBK A;  2K7A A;  1X01 A;  2JMA A;  1WJR A;  2DTH A;  2O2O A;  2VVK A;  4LD6 A;  3BW1 A;  1V76 A;  3CCJ Q;  4J9B A;  2RMO A;  2DYI A;  1VYU A;  4M7D C;  3VS4 A;  1WXU A;  2ZPH B;  1V1C A;  1YN8 A;  3ZEH A;  1KD1 R;  4AFS C;  3EG9 B;  3OS5 A;  2PNI A;  1YCY A;  4M78 F;  2RQR A;  4F17 A;  2P84 A;  1Q82 U;  4J9E A;  4LN2 A;  1QKX A;  3PIO A;  3X26 B;  5CKH A;  5M9O A;  2EAY A;  1F1B B;  2JUF A;  3OYJ A;  4ZNX A;  3CBO A;  2NLU A;  3EHQ A;  1U8R A;  5GAN h;  2JW4 A;  3M9Q A;  2JXB A;  3CPW P;  2HDA A;  2J6O A;  2PU9 B;  3NTH A;  2EVR A;  2DIQ A;  3S3N A;  2O9S A;  4KGX B;  4OGE A;  4OMN A;  4FSX A;  4HCC A;  1B34 A;  2B86 A;  4QVC A;  2ZPG B;  5GMK m;  3L1A A;  4PJL A;  3EAE A;  1K8A U;  1OUL A;  3PTA A;  3H8Z A;  3QPH A;  1JQQ A;  2XKO C;  1PWT A; 
#chains in the Genus database with same CATH homology
 1JBM A;  5GAN 5;  1YJW A;  3X24 B;  1Q7Y C;  3JCM c;  5LJ5 f;  4JS5 A;  1BIB A;  4J6X A;  2RJF A;  3EFR A;  2ZPE B;  3PNW C;  5GAM h;  4R56 A;  4L59 A;  4CRI A;  4BDY A;  3ER0 A;  1OZ3 A;  5LJ5 e;  1B34 B;  1OZ2 A;  2XHC A;  3FIF A;  4OF1 A;  3A5Z B;  3OYF A;  3I55 T;  1M1K U;  4M78 G;  4KUD K;  1Y71 A;  2E6Z A;  3H6Z A;  2IG0 A;  2RHZ A;  3QZ9 B;  5FRM A;  2GFA A;  2VXE A;  1PSF A;  4OB2 B;  4F7U G;  4PJO C;  4X34 A;  4E7H A;  4O5V A;  3TCJ A;  2P4T A;  3A8O B;  4J8O A;  4ZGJ B;  5GMK l;  1W2B S;  3FRN A;  3S6W A;  3CCV T;  2F69 A;  2Y4Y A;  1ZHI A;  4LDU A;  1S72 T;  1N9S A;  3SWN A;  5FLX E;  4M7A E;  4M77 G;  5KE2 A;  1AHJ B;  4GY5 A;  3G4S T;  3GP8 A;  2MF2 A;  2DD4 A;  5HK3 A;  1YHQ A;  3CCM T;  4BB7 A;  4B9X A;  2HQX A;  2PVG B;  3QHS A;  2RM4 A;  1WQ7 A;  3CXC A;  4ZTJ A;  5LJ3 f;  3I56 T;  3JCM d;  1IZ6 A;  2X4J A;  3R6O A;  1VQ7 A;  2DZC A;  1Q86 C;  3VUZ A;  4M75 A;  2PQW A;  2XU8 A;  4J5Y A;  3OMG A;  5LJ3 e;  3TRE A;  4PJO D;  3JCM W;  2LC4 A;  1I4K 1;  4XTU A;  3RMQ A;  2YRV A;  4A54 A;  3RER A;  4M75 C;  3PT9 A;  3X20 B;  1P92 A;  2EJ9 A;  2M1H A;  4QVZ A;  1BIA A;  5GAO q;  2VGM A;  2QQS A;  3SWN B;  1VQK T;  2G3R A;  1LOJ A;  3GLX A;  2L3R A;  2V8K A;  3DLL A;  2EQM A;  1HK9 A;  1KC8 U;  3JB9 D;  2OTJ T;  1KHI A;  2DTO A;  4C92 G;  3JCM f;  1ZBX A;  3ZFJ A;  3CCU A;  4M7D E;  4XU0 A;  3WVD B;  3S3M A;  1KHC A;  2XD0 A;  2K5I A;  2RK2 A;  4IUP A;  1QVF S;  1TH7 A;  4M75 B;  3V7R A;  5GMK e;  5DLO A;  1PSE A;  3M4Y A;  3JCM e;  5GAN d;  3OYC A;  4BAC A;  1YIT T;  1YJ9 T;  3SD4 A;  4M7A F;  4ZTF A;  2XDB A;  3L2R A;  1G5V A;  5J39 A;  1U1T A;  5HK0 A;  2DZ9 A;  3JAM E;  4M77 E;  4C0D C;  3OYN A;  3QSU A;  2OTL T;  1NPP A;  1VQ6 A;  1KQ2 A;  3JB9 F;  4JDS A;  5CR2 A;  1U1S A;  4C5H A;  3SDZ A;  2E10 A;  4IUT A;  5GMK j;  3HSB A;  2MWP A;  1KD1 U;  3C95 A;  3E19 A;  3RKX A;  4DQ2 A;  3FB9 A;  4C5E A;  3RMS A;  2QQA A;  1WJS A;  2VUB A;  2P0K A;  4XTZ A;  4TVR A;  2E64 A;  3WVE B;  1VQL T;  4FM4 B;  2YLC A;  5CKB A;  2KSS A;  3N5B B;  1M1F A;  1MGQ A;  4BI4 A;  4EMK C;  5GAN f;  4PLL A;  3FJP A;  4P5N A;  3CMA T;  3OYA A;  4C0D B;  4HT9 A;  4C0Z A;  4N4I A;  5GAN e;  3CCL T;  4FIB A;  3OYK A;  2FVU A;  4C8Q C;  5I2S A;  3OW2 S;  1M90 U;  1UB4 A;  2QXF A;  2QQ9 A;  3UWN A;  4OMF B;  4M7D F;  2JZ2 A;  2A3L A;  4OGC A;  2HAX A;  3MO8 A;  4A4E A;  4E7I A;  4J7F A;  5GAN j;  3HFN A;  1BI0 A;  3HL8 A;  5GAM d;  1K9M U;  2KMT A;  3C4S A;  5A0L A;  1BI3 A;  2MAM A;  1VQ8 A;  3CC4 T;  1QVG A;  2EWN A;  4BE2 A;  3CBM A;  5C6S A;  4XU1 A;  5GMK i;  3GF5 A;  4C8Q D;  4RG2 A;  3CC7 A;  1Y96 A;  3M4G A;  3MEU A;  2K5L A;  1V29 B;  3VV0 A;  4Y28 E;  2CZ7 B;  3QJY A;  1WJQ A;  4J6W A;  3OS0 A;  3VU3 C;  2KY9 A;  1Q7Y U;  3O8V A;  3FC3 A;  2EJF A;  2GCX A;  4L6V 5;  3QZ5 B;  4XU3 A;  2RH2 A;  3LYI A;  4GLK A;  5GAM f;  2JTM A;  3KUF A;  4OP0 A;  1ZQ1 A;  3E9F A;  5GAN 6;  3MP6 A;  4QVD A;  3VYH B;  4EPC A;  3C94 A;  2DVE A;  3C12 A;  4QW2 A;  3PMT A;  5GAM e;  4M7A G;  4BI8 B;  3DLM A;  3JB9 I;  2V8I A;  4M78 D;  5DLQ E;  3VYG A;  4B9W A;  2QEX A;  3JSC A;  3NTI A;  3GPL A;  3NFC A;  3L2V A;  2FYK A;  4XQ3 A;  2DO3 A;  4ZN3 A;  1Y96 B;  4N0A A;  3JB9 G;  1N8R C;  3ZBD A;  2E41 A;  3A8M B;  3HHT B;  3V8L A;  3UDC A;  1YJN T;  2RJE A;  3CD6 A;  1M8V A;  3HKS A;  4PL6 A;  5GAM j;  5IT9 E;  4N0A C;  5LL6 S;  1GXI E;  4R55 A;  2E6N A;  2R5M A;  4QQ6 A;  5LJ5 g;  4ZGD B;  2K57 A;  1WPY A;  3G6E A;  4EDU A;  5HKC A;  1D3B A;  1N6A A;  1OYX A;  2JTF A;  3CME T;  2RHY A;  1I5L A;  3DKM A;  3GOX A;  1Q86 U;  1VQ5 T;  2RI2 A;  5FRN A;  1KQS S;  3OBW A;  4D6W A;  4FT2 A;  3V8J A;  2EQK A;  1VQ4 T;  4NOY A;  4M75 E;  3L2Q A;  1W4S A;  4PJO A;  3G7Z A;  3CCQ T;  2XIC A;  4M7D G;  3A8L B;  2QQB A;  1BYM A;  5CQY A;  1YI2 T;  3CC2 A;  1QW1 A;  3QKJ A;  2LX9 A;  2DK3 A;  2R5A A;  1O75 A;  2EKO A;  3J81 E;  4FU6 A;  2L5Q A;  1DJ7 B;  3QYH B;  4Q5W A;  4E7K A;  3L42 A;  1M4Z A;  3HRU A;  5J3B A;  2ZPI B;  5LJ3 g;  1D3B B;  2LT1 A;  5GAN 2;  4X9C A;  4PJO F;  4C92 D;  4BY6 C;  1YBY A;  5D6X A;  2RJC A;  2JNG A;  3CCE A;  3P8D A;  2RB6 A;  2GF7 A;  3GNG A;  1YIJ A;  2BIV A;  1VQN T;  1VQ6 T;  4PJO B;  2DJZ A;  4HCZ A;  4E7J A;  4OVA A;  2VGN A;  4IUV A;  4JRP A;  3ME9 A;  5D6Y A;  2E1H A;  3CPW A;  1JJ2 A;  1G3T A;  3MEW A;  3RKW A;  2ZZD A;  3PIP A;  3CCJ T;  1NE8 A;  4LDV A;  4BY6 B;  4RCC A;  2B8A A;  3VKI A;  2K5F A;  3JCM g;  3OYI A;  3CBP A;  2BKD N;  5FRO A;  1QVP A;  3V7C A;  3T9N A;  4DOV A;  1I81 A;  4M75 F;  4UC4 A;  4A4H A;  3KXT A;  3TEE A;  1QVG S;  1VQP T;  5CO7 A;  4KUI A;  3JCM P;  5D6W A;  5GAN 4;  1R8O B;  2A7Y A;  4NL2 A;  5LJ5 h;  1K8A U;  1BI1 A;  3P8B B;  5GAO p;  4BI3 A;  2QA4 A;  4DOW A;  1QP2 A;  4IUU A;  2K3Y A;  2PUK B;  4PKC C;  1N9R A;  4QQG A;  3Q1J A;  4XTY A;  2VV5 A;  5I2M A;  3SB2 A;  3FEO A;  2XI9 A;  1VIF A;  1XQH A;  2GQV A;  3UT1 A;  3CCR T;  5C0M A;  2HD0 A;  3CPF A;  1NJI C;  3I55 A;  3QUI A;  2K2V A;  3OA6 A;  2LDM A;  5J26 A;  1RI0 A;  4ELY C;  2DXB A;  3TU4 K;  2DXC A;  4MZT A;  2HBP A;  4ZN1 A;  4BDZ A;  2EFI A;  4EMK A;  5FU6 C;  3CCS T;  2OAU A;  5AYF A;  2I2L A;  3J80 E;  1VQM T;  1XNI A;  4RKU E;  1X75 C;  4JRI A;  2O4X A;  3F70 A;  3MEA A;  3VUB A;  1S72 A;  3NTK A;  3JRZ A;  4C8Q A;  4KT0 E;  1LJO A;  3DB3 A;  3BY7 A;  3G4S A;  1VQ9 T;  5FU7 C;  4A4F A;  1NPR A;  3RUX A;  2JOY A;  5LJ3 h;  3CCM A;  2YHT A;  5GAO m;  2RA2 A;  2MI6 A;  4NL3 A;  2L89 A;  2HNI A;  1FXX A;  1RL2 A;  2CZ0 B;  2P0P A;  3HRS A;  3QYG B;  4PJO G;  3I56 A;  1JRI A;  2LT4 A;  4MZM A;  2C06 A;  5KCO A;  2WSE E;  1UGR B;  2JVV A;  5CKF A;  5FU6 B;  4EMH A;  2QEX T;  4XTW A;  4C8Q F;  4A4G A;  1Q81 C;  3OS2 A;  2CKK A;  1VQO T;  2LCL A;  2P0Q A;  4XK8 E;  4M7A D;  4EMK B;  3X28 B;  1M5Q 1;  3JCM X;  2M0O A;  4YTL A;  4M78 A;  1M1G A;  3OMC A;  1UGS B;  2O4X B;  4MML A;  3INZ A;  5FU7 B;  4IKF A;  3LGF A;  1N8R U;  1VQK A;  1WGS A;  1LNX A;  4C8Q B;  4RMO A;  2RD1 A;  2RHI A;  4M78 C;  4OB1 B;  4E7L A;  3S3O A;  3JCM h;  4HA8 A;  4KBM B;  2PVD B;  3OYH A;  4C5G A;  1YJW T;  2GFU A;  4M75 G;  4MDW A;  5I21 A;  5CIU A;  5CAI A;  4PNO A;  3PFS A;  1YIT A;  4M77 C;  3OYB A;  2E65 A;  2VXF A;  4RCB A;  5HY6 A;  2KQW A;  2CZ6 B;  3LWI A;  5CVI A;  2L8D A;  3JCM Q;  2DXT A;  5EG2 A;  3M58 A;  5GAN 8;  4M78 B;  2OTL A;  3CXC S;  2WSC E;  2DIG A;  3CC2 T;  4OB0 B;  5CKD A;  4M7D D;  4F7U B;  2LRQ A;  2PUO B;  4JRQ A;  4N4G A;  2KK4 A;  2CZ1 B;  4X9D A;  2EYQ A;  3BDL A;  4PJO E;  1QVF A;  3ASK A;  1XTD A;  1VQL A;  1I8F A;  5A0G A;  1WNL A;  3M5A A;  1H64 1;  1QP3 A;  5CK9 A;  1K73 C;  1YHQ T;  2E70 A;  2X4W A;  1G3W A;  3GIB A;  2CS7 A;  3FDR A;  5KE3 A;  3FLG A;  4M77 D;  3VJP A;  4ELZ C;  3CMA A;  3CCE T;  1VQ7 T;  4C92 A;  3CCL A;  2VYT A;  2EQJ A;  2FB7 A;  2BUD A;  4OB3 B;  3M59 A;  2E5Q A;  4JLI A;  4C0G A;  3QII A;  3P8H A;  4C92 C;  4XTV A;  4PLI A;  4VUB A;  5LJ5 d;  5DM7 R;  4DA4 A;  2XDP A;  3A8H B;  2ZPF B;  4ME7 A;  2V8J A;  3OBY A;  1Q82 C;  3LLR A;  2LQ8 A;  3QBY A;  3OYM A;  2DD5 A;  2LTO A;  3OYL A;  2QDY B;  5GAN 7;  4XU2 A;  4C8Q G;  4IUR A;  3URG A;  2RHU A;  1X6O A;  5GAN 3;  3CC4 A;  4HT8 A;  2K4Y A;  3G71 A;  3OYD A;  3CCU T;  2ZGW A;  4A4K A;  2D0Q B;  2RJD A;  1WQW A;  4C92 B;  4RG8 A;  4LD9 K;  2LQK A;  3L2W A;  4MDX A;  3OQ5 A;  1UGP B;  3EFS A;  3LX7 A;  2D9T A;  3LGL A;  1UEB A;  4LDY A;  2AHJ B;  1SSF A;  2RK1 A;  2X4Y A;  2F5T X;  3RKY A;  2WAC A;  2M9U A;  1KQ1 A;  3BDU A;  5CQX A;  3BFM A;  3X25 B;  5LJ3 d;  2LNV A;  2R58 A;  3M54 A;  2HQE A;  4J6Y A;  2WSF E;  3HPW A;  1NJI U;  2XG8 D;  2XK0 A;  4BD3 A;  5LJ5 j;  3PGG A;  3V8K A;  3PMI A;  4E47 A;  3GNF B;  1O9S A;  4O6J A;  3HP9 A;  3MCA B;  1YJN A;  1UGQ B;  4N4H A;  4Z02 A;  1K8A C;  3QXE B;  4J7I A;  4L5G A;  1Y7X A;  5IN1 A;  3JCM b;  2RHX A;  2CGH A;  3SWN C;  4JS4 A;  3CEY A;  2YLB A;  4FL6 A;  3LWH A;  2EIF A;  3JCM J;  2ZCF B;  4C8Q E;  3SFM A;  3MP8 A;  4CI0 C;  3E1S A;  1JB0 E;  3CME A;  3HRT A;  5KCH A;  2RI5 A;  3E9G A;  1VQ5 A;  1M1K C;  3QG1 A;  5A0D A;  4HCB A;  2EJG A;  3J7A F;  2EQU A;  1XOV A;  2KVQ G;  2LCC A;  1Q81 U;  3MET A;  1VQ4 A;  2VC8 A;  1VQ8 T;  4FT4 A;  3CCQ A;  3JB9 H;  2DEQ A;  4II1 A;  4M7A A;  5LJ3 j;  1FWZ A;  2M16 A;  5GAN g;  3M57 A;  1YI2 A;  5GAO n;  3OYE A;  3CC7 T;  2DPP B;  5IAY A;  2MMP A;  4M7A C;  3L2Z A;  4M78 E;  5CCA A;  2QTX A;  2JN0 A;  3CCV A;  5DY9 A;  2FL7 A;  3DB4 A;  4F7U E;  4IUQ A;  4C0F A;  1KQS A;  1FX7 A;  2RO0 A;  4M75 D;  3OS1 A;  1H3Z A;  2QI2 A;  4XTX A;  4C5I A;  3RIR A;  4BUG A;  3OSS C;  1IRE B;  2FHD A;  2O01 E;  1VQN A;  4WF2 A;  3AHU A;  4JUV A;  1X01 A;  4M7A B;  1W2B A;  3OYG A;  1BKB A;  1KG1 A;  4JRK A;  1WJR A;  2DTH A;  3BW1 A;  4LD6 A;  2K3X A;  3JCM V;  1M9S A;  3CCJ A;  3CD6 T;  2X35 A;  4MMK A;  2KAF A;  4A53 A;  2Y4X A;  3MEV A;  4M7D A;  3MHX A;  2XID A;  1BI2 A;  3L2U A;  1KC8 C;  4JJN K;  2H3J A;  4F7U A;  1K73 U;  5GMK h;  4M7D C;  2DAQ A;  3G6E T;  2ZPH B;  3ZEH A;  2QA4 T;  2Y90 A;  2OTJ A;  1VUB A;  3M55 A;  2LVM A;  3OS5 A;  1Y07 A;  1VQP A;  5GAO l;  2DXU A;  5GAM g;  1YCY A;  2CYZ B;  2DTI A;  2RI3 A;  3QDR B;  4M77 A;  4M78 F;  4MZP A;  3LW5 E;  5L8R E;  3V7S A;  4HKE A;  2D6F A;  4C92 E;  1YJ9 A;  1Q82 U;  4F7U F;  3UPU A;  3CCR A;  3PIO A;  3A8G B;  3X26 B;  3KBG A;  5CKH A;  5M9O A;  1KD1 C;  4M7D B;  2EAY A;  2JUF A;  3MP1 A;  3OYJ A;  2E12 A;  3M53 A;  4LDW A;  4M77 F;  5GAO r;  3CBO A;  3G71 T;  2NLU A;  3OYY A;  4V2S A;  1U8R A;  3CPW S;  5GAN h;  1HXD A;  5KH6 A;  3CCS A;  1VQM A;  1JJ2 S;  2QQR A;  4Y91 A;  4M77 B;  4ZGE B;  3OSV A;  3M9Q A;  1G3S A;  4ATO A;  2MWO A;  3LH0 A;  2PVO B;  2PU9 B;  4QQD A;  1VQ9 A;  1NZ9 A;  1OI1 A;  1VIE A;  3NTH A;  3RES A;  2DKG A;  1YIJ T;  1M90 C;  3QJ6 A;  2DIQ A;  3OB9 A;  3S3N A;  4OGE A;  3OY9 A;  3HFO A;  4J83 A;  4FSX A;  3WXM B;  4HCC A;  4LDX A;  5CKE A;  2F5K A;  1K9M C;  1EIF A;  1B34 A;  3M56 A;  4KUL A;  4XAX B;  1VQO A;  4BE0 A;  4C92 F;  3JB9 J;  2ZPB B;  4JLG A;  4QVC A;  2ZPG B;  5GMK m;  3L1A A;  1G3Y A;  3EAE A;  2KDS A;  2XDD A;  2R57 A;  3PTA A;  3H8Z A;  1N27 A;  4NS5 A;  4BE1 A;  2X4X A;  4EMG A;  3OW2 A;  3QO3 A;  2IVW A;  3QPH A;  1MHN A;  5A2Q E;  2XKO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...