4BI4A

Structure and function of amidase toxin - antitoxin combinations associated with the type vi secretion system of serratia marcescens.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
163
structure length
163
Chain Sequence
MKPLYRQLKSSHYSSDYSSPGYLAAEAVYAEIGYELDTLLKQNPGYANTAAVRMSLALLKTGISFKGRLPIKKGAYKGKTIEPGAKLLADQLHRSSSFGKAKIFFNAPDAEKGIGNKKGVVFFNKITNYDGGHIDLIEPENSLLTCHSHCYFNCKEVWFWELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
molecule keywords SSP1 C50A MUTANT
total genus 46
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14113 Tae4 Type VI secretion system (T6SS), amidase effector protein 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1010 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bi4A01
4BI8B 4BI3A 4BI4A
chains in the Genus database with same CATH superfamily
5GAN4 1KQ2A 2RD1A 4IIOA 5GJVB 2Z0WA 4NL2A 2CZ1B 2D0QB 8ATCB 3I56Q 4LD9K 4M77E 2OAUA 1IO6A 1M4ZA 3I5RA 2AK5A 3OMCA 2DVJA 1K8AC 4C92E 1K4US 1G3TA 5KYUA 4JJDA 4OMOA 4J9FA 4ZN3A 2KDSA 3QHSA 2AHJB 4JLGA 1XNIA 3G4SQ 2VWFA 2P84A 1M2VA 2K57A 1T3SA 4C8QB 3CCJQ 1RAHB 3I9QA 3L2ZA 5GANd 2K4YA 1S72Q 4M75G 4A4HA 1M8VA 3UT1A 3MHXA 3CQTA 1OX9A 2ED0A 3CXCS 4E2FB 4LDYA 3CC4T 2DPPB 1K9AA 1ZHIA 2KBTA 5LJ5e 3FRNA 1EZZB 1VQ5A 1YWPA 2E6NA 2E1HA 4AFQC 3TSWA 5HCKA 3CCLQ 3RKYA 2AT1B 3G71T 4M78E 1AT1B 3A8LB 3LGFA 3CCLA 3EHRA 3FLGA 3OYJA 3S3OA 2HDAA 1MMAA 1MV0B 5GAMe 3NPFA 2JVVA 3OYFA 2CP7A 2XD0A 1IGUA 3MKDA 4KUIA 3JB9G 1KG1A 1ZSZA 3X24B 2ZPHB 2E3HA 3QDFA 2XDBA 1DJ7B 2F69A 1TXQA 4MDWA 2XMFA 4MZPA 5FU7B 2K2VA 2KRMA 2KGTA 1N9SA 2LNHB 2KQWA 3PFSA 3QPHA 1VQ9T 4FYVB 1RLQC 2ZZDA 1RAAB 2GF7A 1YJ9Q 1PC0A 4DA4A 2DTHA 3JCMc 1MMNA 1WA7A 2KAFA 4WTOB 2A28A 4XTVA 3RMSA 3JV3A 2O4XA 4RUGA 2ZPIB 4EIKA 1VQ9Q 4KT0E 2JNGA 1IXDA 4AG1C 2ROTA 3DB4A 2D1XA 2B86A 3VV0A 1M1FA 3A98A 2J05A 3SWNC 1OZ2A 2ROLA 2QTXA 3ASKA 3P8DA 4LDWA 3CBMA 1Y96A 1N8RU 1W70A 3GOXA 2R58A 5LJ3h 1YJNQ 4LN2A 3KUFA 4NOYA 4LE9A 2HKNA 2RNAA 4Z02A 1YJNA 4JJNK 2DZ9A 4F16A 1JRIA 2DTIA 1IHVA 3UA7A 3O5ZA 4JUVA 1R0BG 4ELYC 1UGSB 1LNXA 1UJYA 3TCJA 4DOWA 1I81A 5LJ5d 3I35A 3PT9A 2ESWA 2QDLA 4DQ2A 5J3BA 2KK4A 4IUPA 4N4GA 4OGEA 1VQ7A 1YJWA 1NYFA 2DD4A 1X01A 2MF2A 4J9IA 1OOTA 5L8RE 4PFOA 4OGCA 3M0UA 2X35A 4BE0A 2KRSA 4BY6B 3V7RA 4D6WA 3S3NA 2COZA 3VYGA 2JMAA 2FG0A 5GMKl 1QCOA 4E7ZA 1ACMB 1F1BB 2EKOA 1WPYA 2JOYA 3M54A 2PUKB 1LPLA 1X43A 5GAOn 3OQ5A 1UE9A 4KH1B 3GNFB 2HNIA 1NZ9A 1BBZA 1X69A 4M78B 1YHQT 3MPUB 5GAN8 1Q81R 1X2KA 3FC3A 5CR2A 3M58A 2RF0A 4CRIA 4JLIA 4N0AC 3HPWA 3CCLT 4XK8E 3M0QA 1QQJA 3JCMP 2LQNA 2D9TA 3OYMA 2AKKA 4F7UB 4RTWA 3OSSC 5CIUA 1RI0A 4HCKA 3EG2A 3C4SA 5GAOp 3NTIA 3MP6A 3LH0A 3LX7A 3BW1A 1Q86U 4JZ4A 4M7AE 3OS2A 1VQ8A 2DL3A 1I0CA 1N27A 2VXFA 2KXCA 2LJ3A 4ZTFA 1QCNA 2A3LA 2VGMA 2LQKA 2LC4A 1K8AR 3QZ9B 4MMKA 2CSQA 3SWNB 2HCKA 2EQIA 2FRYA 2GCXA 4IUQA 4OMQA 4ZGJB 3CCVT 2OAWA 1WLPB 3E2UA 3RERA 4XU0A 4XTUA 5DLOA 3VS2A 2YUPA 3OYBA 1ZSZC 1VQLT 3URGA 4M77B 3ZL7C 4LXCA 2M0OA 3UF4A 2P0PA 5CQYA 1SEMA 5IHIA 3H6ZA 4JJCA 1VA7A 2MK5A 3QWYA 3PVLA 2KSSA 1BIBA 4QQ6A 2R5AA 3JB9I 3VS3A 3CCRA 1QKWA 1AOJA 2K7AA 4FU6A 4RTUA 3ZFJA 1K73C 5EG2A 1C6VX 1K8AU 4M7AA 1OULA 5I21A 4BE2A 1Y7XA 5D6WA 1ABQA 3X20B 4FCYA 1GCQA 4EMHA 1QVPA 1IGQA 4XTYA 1YJNT 4M7AC 1YFNA 2D8HA 3JSCA 3VS0A 1Y71A 2LDMA 4UC4A 1D09B 2XDDA 1U3OA 4LDUA 1BI0A 2HL3A 2KMTA 2O9SA 2YHTA 4QT7A 3T9NA 2JTMA 1YIJQ 2KI7A 3RKWA 3OYYA 3VS1A 1UDLA 2RI2A 3BDUA 1VQ7Q 2OX7A 3OW2S 3QIIA 1M8MA 2K5FA 2CZ7B 4C5HA 2JT4A 4AFUC 2QYZA 1QMCA 2KVQG 3META 3FJPA 3JCMQ 1QLYA 2CP5A 4L5GA 2PUOB 3TU4K 2OTJQ 3M4GA 2GTOA 1WQ7A 3EGDB 3QYGB 5IXBA 4Z89A 1JBMA 1B07A 3QZ5B 3CD6Q 4J9DA 5IXFA 1KHIA 4XTWA 4OB2B 3CMAT 1FWZA 1H3HA 3NTKA 2J06A 1NYGA 2JS0A 5FWBA 3LLRA 1U1SA 1AZEA 1AEYA 4B9WA 2K9GA 4BI8B 4J6WA 1V29B 1U1TA 3DLLA 1PCXA 5LJ3f 4DEXA 3EH1A 4II1A 2KY9A 5LJ3d 3G4ST 1M30A 4LD6A 3OMGA 2HQEA 3EG0A 4RG8A 2DTOA 4XQ3A 4N0AA 3G1JA 3NGPA 3HRUA 1RAIB 2DETA 3PIOA 2A0FB 3U23A 2H8HA 2CH4W 4C0DC 2DL7A 1M2OA 5CO7A 4JZ3A 2C0OA 2EGCA 1MHNA 2NUTB 3CXCP 1U5SA 5A0DA 4PNOA 1BYMA 1PRLC 2DK3A 2DMOA 4FW1A 2OI3A 1M2VB 5LJ3j 2VYTA 1KSWA 1VYTA 2ENMA 2YLCA 3HHTB 2X4JA 1SKUB 1UGPB 1TUCA 1YITA 2COWA 2A36A 2JUFA 4TVRA 3O8VA 2NUPB 2W10A 2DA9A 3RKXA 4IKFA 3J7AF 1VQOT 1GFCA 4PJOG 4FYXB 5C0MA 2M02A 1VYUA 4XU3A 3VJPA 5GMKj 2KROA 3CD6T 3I55T 4FW2A 1QWEA 5L23A 4A63B 4M7AG 3G6EQ 2I2LA 3UA6A 1OPLA 2EQJA 3VS5A 1I5LA 1OI1A 1H3ZA 2QASA 5CAIA 3OS1A 2GNCA 2D8JA 2DYBA 6AT1B 1NG2A 3CMEA 2L89A 4M7AB 3F70A 3M0PA 2L0AA 3TVTA 2BZ8A 1VQNT 1JEGA 2DVEA 2RJCA 1YBYA 1I8FA 3GP8A 4M7DB 4HCZA 3EG1A 1YHQA 2YUOA 2DM1A 4LUEA 2L5QA 1WJQA 1RAEB 2VUBA 4O5VA 1WYXA 3LYIA 2O2OA 1VQNQ 2GBQA 5HK0A 2EYQA 1YHQQ 2M0YA 2BIVA 4RMOA 2C0IA 3CCVQ 2K3BA 1MNEA 1YNZA 4D8DA 1WHJA 1VQ7T 4OB3B 2ZPEB 4D8KA 1B3QA 4C8QG 3E9FA 2XHCA 3OS5A 4JJBA 4KRTA 5KE2A 3BDLA 1VQ6A 1K73R 1X27A 4X9DA 4M7AD 2CP3A 1PNJA 5AYFA 4PJNA 4Q5WA 4V2SA 2EYWA 2RHYA 2DIQA 3JCMb 4KBMB 2MWPA 2RQVA 3OW2P 4M78G 2MCNA 2L3SA 3CD6A 3D7SB 3TEEA 5A0LA 4PJOD 1YJ9A 2CGHA 2RM4A 3HKSA 1Q7YU 4PFZA 2MIOA 3GF5A 1XQHA 1E7OA 3E1SA 1JB0E 1ZA2B 2E10A 5KYYB 1EX4A 2HKQB 3GIBA 2EWNA 3BY7A 2DFUA 4BB7A 4M77D 2NUTA 1Z9QA 3PNWC 1HD3A 3M5AA 4N4IA 1VQ9A 2DILA 2QA4T 1UHCA 3PMTA 1VQKT 3VRYA 1YIJT 3JAME 5D6XA 4RCBA 3CCRQ 1H8KA 1D3BA 3CC7T 2NWMA 5D7UA 1T0HA 1VQOQ 4OP0A 1FMKA 3FIFA 1QVGP 4PJMA 4MMLA 1OU8A 4IIMA 2EYYA 3EAEA 3UPUA 2ZAEA 3I55Q 3OW2A 2M9UA 2LQ8A 2K3XA 5CQXA 3UDCA 3Q1JA 1B34B 3M0RA 3G6ET 8AT1B 4BD3A 1OPKA 1NPRA 5GAOl 4JRIA 5I2MA 2DXCA 2OTLQ 2YRVA 3REAB 4C0FA 3JCMh 1GBRA 3C12A 2OJ2A 4OVAA 4HKEA 4PJOC 2QK0A 1YN8A 2XKOC 2OTLA 2X4XA 3PVQA 1S1NA 3OSVA 1LVKA 4ZN1A 2CH4A 3CMEQ 5A2QE 3L2VA 2L3RA 1WNLA 5GAOm 3EFSA 2EPDA 5DY9A 1FYNA 1C1AA 2DJQA 3V8KA 3HFOA 4A54A 2R5MA 2K2MA 4MZMA 4M78D 2QGGA 4FYWB 4M75F 2JZ2A 1Q86C 1WZOA 1BK2A 2ABLA 2RI5A 2K3YA 2X9HA 3UWNA 5IAYA 4A4FA 3I56A 2NUZA 5HY6A 3ZEHA 3OYDA 5KYWA 2OTJT 2AZSA 4F7UA 1D1BA 3L2RA 2FRWA 1UFFA 2Y4YA 3JCMg 2V8JA 1BU1A 2YRCA 2EQKA 3OYKA 3VS7A 1Z9ZA 2MWOA 2IVWA 2GQIA 1UG1A 5KYWB 1VIEA 5A0GA 3CMAQ 1HYOA 2LRQA 1JO8A 1D3BB 5FU7C 1FMWA 1WHLA 4J6XA 2DL4A 3OY9A 3H0FA 4R0KA 3JCMV 3JCMf 1N6AA 2PNIA 3QJ6A 4HT8A 4EMKC 4M78A 5HKCA 2E64A 3M4YA 2EW3A 3VRZA 3JB9F 1BB9A 4M7DE 2RQWA 2Y4XA 1AD5A 2JTEA 1B7TA 2DXUA 1VQLA 4AMCA 4XU1A 1IZ6A 1WXTA 1RAGB 2DE0X 5GAN3 2NLUA 3MCAB 1JJ2S 3KXTA 1UJ0A 1MNDA 4R56A 5CVIA 4BE1A 1W1FA 3G7ZA 2RHIA 1ABOA 5KCHA 3HSBA 2KNBB 1T0JA 1TUDA 1XJWB 3AT1B 3A1PA 4AT1B 1PM3A 2QQSA 2DKGA 3CCMQ 2EQUA 4MDXA 3NMZC 3G4SA 5GAN6 5GMKm 5GAMf 1VQ6Q 1B34A 2EAYA 3A8MB 1U06A 5GJWB 2V1RA 3X25B 2KYMA 5CKBA 1GXIE 2W0ZA 4PL6A 3QDRB 2DNUA 2HL5C 2E41A 1KHCA 4QQGA 3BE3A 1BCOA 1KQ1A 3V8JA 3CCQA 4E7KA 4M7DA 1TU0B 2JMCA 1LCKA 3SEMA 1SSFA 1M1KC 4LUDA 4VUBA 2ECZA 2JS2A 4KUDK 1JQQA 2BZXA 3VKIA 1CKAA 4PJOB 3CCUT 1PSFA 5GAOr 4DOVA 5I11A 1D0XA 1KJWA 3QUIA 3RUXA 4R55A 4ESRA 2XIDA 5M9OA 3CCMA 4E6RA 1TSFA 2NYSA 1WHGA 3PE0A 2PVGB 4RKUE 1PRMC 1NEGA 3V7CA 3X26B 5GANj 1M1KR 2DXTA 2VASA 2PZ1A 3A8OB 1M3BA 5J39A 2VC8A 1VQKQ 2RI3A 2ZCFB 4CC3A 3EFRA 1X6GA 2LCLA 1WDXA 2KYBA 4J8OA 2QI2A 1OYXA 3CCQQ 3DLMA 3N5BB 1RACB 1VOMA 2EIFA 4XAXB 1VQ6T 1M5Q1 3LWIA 4CC2A 1M9SA 3SFMA 1ZSZB 4M7DD 1VUBA 3KBGA 4QVCA 5KCOA 2XG8D 1AVZC 3HTRA 1WHHA 1YCSB 2DD5A 1AHJB 2WSCE 1SPKA 2ATCB 3CC2A 1G2BA 2DO3A 3LH5A 2RJFA 4PJOF 2EGAA 2J6KA 3M0SA 1Q7YC 3OS0A 2EJGA 1ZUUA 3OYLA 2BE7D 4M78C 4RTTA 1KFZA 3EHQA 4PJOE 3WXMB 3RIRA 3EG9B 2RHUA 3RNJA 3SHWA 4IUVA 1K73U 4HCBA 2AZVA 4J9GA 4C8QF 2C06A 3GLXA 1SRLA 3MJXA 3QKJA 3J81E 2J6OA 1G3YA 3CCMT 1PG5B 2J6FA 3CCRT 1G8XA 3JCMe 1U8RA 4C0GA 4WF2A 1OEBA 1OX8A 3L2UA 4OF1A 2LCCA 4WCIA 2CS7A 1TG0A 4IURA 1OQKA 1UGVA 2I0NA 4M77A 1VQ5Q 3QWXX 2L3QA 1IB8A 2VKNA 4C92A 3OB9A 3JCMW 3EGUA 5FWCA 1YI2A 3MEUA 2OTLT 1QP3A 2EFIA 1NJIC 1O75A 4QW2A 4JRPA 1VQ5T 4OMPA 4J5YA 3RMQA 4PJOA 2X4YA 4GY5A 2DRKA 1WHMA 2YUQA 1TWBA 1VQPA 2DERA 2D6FA 1PD1A 1QVGS 5D6YA 2HQXA 1HJDA 4LNPA 4QVZA 2X4WA 1Q82C 3E19A 4E7JA 3OYEA 1YCYA 3H8ZA 9ATCB 3DB3A 2JM9A 1R77A 1D0YA 2EJFA 2F2WA 4M4ZA 4E7IA 1T3LA 4DBQA 1G83A 2YDLA 2LZ6B 1KD1R 1W2BP 1ARKA 2F1LA 5CKFA 2YUNA 1SRMA 1A0NB 5HK3A 2CT4A 4AFSC 2KT1A 3P8HA 1NEBA 3PMIA 5AT1B 2F5TX 2QG9B 2QA4Q 1QP2A 4JDSA 3NTHA 4KGXB 2MYSA 3CMAA 1JJ2P 2X3WD 4B6MA 2VV5A 2CDTA 2GFAA 2CREA 2DRMA 3KFVA 2FL7A 4FM4B 4C8QC 2YXYA 2JN0A 4IUUA 3FJ5A 2ED1A 1JU5C 3CCSQ 4X34A 2JW4A 1QVGA 4OB0B 3CC4A 3LGLA 2LTOA 1N8RR 2HBWA 3NFCA 1IRXA 1E6HA 2OTJA 5I22A 1J3TA 3A5ZB 1ZBXA 1I1JA 4KULA 1AWOA 3TSZA 1BIAA 3JCMd 1NM7A 4E7HA 4LDXA 2QEXA 3QO3A 4J9CA 5IH2A 4C92F 4XTXA 2MAMA 1N9RA 4M75A 1KQSS 4C5GA 4JS4A 4M77C 3CMET 1UTIA 1PKTA 4Y91A 4ME7A 1BCMA 4F04B 1SSHA 3REBB 5FRMA 1UGRB 4LDVA 5KE3A 2WSEE 3MP8A 4FT4A 4M7DC 2COYA 2RJEA 1I4K1 4X1VA 1QVFA 2VXEA 2CP6A 1SHFA 1W4SA 1KD1U 2DJZA 3I55A 4BDYA 1FMVA 1AWJA 1AWWA 2PU9B 2FPDA 1YITT 1NJIU 2DEUA 1QWFA 1H641 1M90U 2M1HA 2RB6A 3CCQT 1KC8C 5LJ3g 1QW1A 1OU9A 2L3PA 3OBYA 2LMJA 3I5SA 1Q7YR 4E47A 4FL6A 1VQPQ 5IT9E 1KQSA 4KH0B 2CP0A 3CCUA 4F7UG 1YI2T 4RTZA 3CCSA 1Q82U 5KH6A 3CPWS 5GAN5 2SRCA 3OA6A 2RQRA 5IHNA 2E5KA 1VQPT 2IPOB 1RL2A 1Q95G 3PGGA 4DBFA 1G3WA 4OMFB 1NE8A 2DAQA 2AKLA 2RK2A 1YI2Q 4HT9A 2KR3A 3CCVA 4BI3A 2RO0A 4BI4A 2O88A 2A08A 1M90R 3FDRA 1GRIA 2X3XD 3GBQA 4J9HA 2EKHA 1G3SA 3QG1A 3THKA 3VS6A 1WX6A 5FLXE 2B8AA 3RDVA 3ZBDA 4C8QE 1RLPC 5IN1A 3ULRB 4J7FA 3CC7A 3CCST 1X75C 3X28B 1IHWA 1YJWT 3CC7Q 1WXUA 4NS5A 1ZBJA 2LQWA 2ZGWA 5GAN7 1BKBA 1S72T 4DBHA 4ATOA 3CPWA 1BI1A 4HA8A 5GMKi 2DYIA 3FEOA 3SWNA 3HP9A 1BI3A 2V26A 2RJDA 3M56A 3RBBB 2BE9B 3QXEB 2KT8A 4JRQA 2EVRA 2A7YA 1EFNA 1JJ2A 5GMKe 2P4RA 4NL3A 4CC4B 3MEVA 3EGXA 4HCCA 1NJIR 3M57A 1CKBA 2EYXA 3R6OA 2C0TA 2RHZA 4ANJA 2NUPA 1M1KU 1K0SA 3CCUQ 1C0MA 2HQHA 4B9XA 3NHNA 1VQ4Q 3CC2T 2DLPA 2RH2A 2PTKA 1TUGB 2E3IA 1ZUKA 5FU6C 4YTLA 4M7DG 4CI0C 4Z8AA 2PQWA 3L2QA 4EDUA 3G6EA 5FROA 5FRNA 2FO0A 2DF6A 1WHKA 2P0QA 3MEAA 3LWHA 2LX7A 1RI9A 2BZYA 2VVKA 2JJ9A 1VQMA 3C94A 1M1GA 2DBMA 1ZSGA 4C92D 4P5NA 3H41A 1I5OB 4M75E 5CKHA 2QTVA 1EIFA 3SD4A 3S6WA 1UUEA 2XI9A 1K9MU 2RPNA 4DBRA 2E65A 3EGXB 3MO8A 2J7IA 3VUZA 1D1CA 2FVUA 1S72A 2EJ9A 1K0XA 4EPCA 2KEAA 2E5QA 1PWTA 4EMKB 4A53A 1YWOA 2KXDA 2YT6A 1V76A 2LT4A 2X51A 4FSXA 4J83A 1VQOA 1OV3A 2CZ0B 1TOVA 3H9NA 2KE9A 2A37A 3OBWA 1LJOA 2FZGB 2MMPA 3R6NA 1E6GA 4F7UF 4QQDA 5CCAA 4Z88A 2CZ6B 2E4HA 5KYNA 3JCMX 5GAMd 2LNVA 1RUWA 2AIRB 1MV3A 4FSSA 2YRDA 2GTJA 4C92G 1KQSP 2DL8A 1HK9A 1MGQA 3M0TA 1QCFA 2E6ZA 2FPFA 2O01E 3UATA 3L42A 1X6OA 2RA2A 2DZCA 1ZX6A 1SF9A 4AFZC 4C92C 2EQMA 2FEIA 5CK9A 3EG3A 2CT3A 5FU6B 1YIJA 1NLPC 2L2PA 3JB9D 2K5LA 3ME9A 1KC8R 2QA4A 2O9VA 2E70A 4E7SA 1AZGB 3G71A 1XOVA 3TREA 1YITQ 5KYXA 3CPFA 3M53A 4F14A 4Y28E 1VQ4A 4F7UE 4C8QD 3PIPA 5C6SA 3GNGA 3C0CA 2QEXQ 2LJ1A 2R57A 3OYNA 2RQTA 3EGDA 2EYZA 2JXBA 1QVFP 4RTYA 2CSIA 2HD0A 1TTHB 5LL6S 4OB1B 4C8QA 3OYHA 5GAMh 4F17A 1ZUYA 1PHTA 1D0ZA 1ZA1B 2QQRA 2IIMA 1KK7A 2QGFB 4QKUA 5LJ5j 4J9BA 1NPPA 4BACA 3CPWP 4BDZA 2XU8A 1LOJA 3L2WA 3IQLA 3CCJA 2XK0A 5FW9A 3JB9H 4M75D 4CC7A 2G3RA 1UB4A 1MMGA 2LT1A 1AWXA 2QXFA 4PKCC 1Q81U 4HVUA 1VQ4T 2DEQA 5IHKA 2MPXC 1CSKA 1HXDA 1N5ZA 2YWWA 1M90C 1FX7A 1WGSA 3P8BB 4N4HA 1SHGA 4A4EA 1M27C 3JB9J 1YJWQ 4ZGEB 2M51A 3C95A 1R0CB 2HEQA 4BUGA 1JXOA 1K76A 3GPLA 5KYUB 2XDPA 4PLLA 3CBOA 3EFOA 4M78F 4O6JA 1VQMQ 2PVOB 4FIBA 5GAOq 3PTAA 5LJ3e 2BTTA 5I2SA 4L59A 4JRKA 1VQLQ 1PKSA 3MP1A 2FPEA 1V1CA 4FT2A 4KGVB 1WI7A 3VS4A 2CUDA 4XU2A 1VQKA 1WFWA 3HRTA 2HSEB 2HAXA 4C5IA 4ELZC 5GANf 4M7DF 3A8HB 2FHDA 1Y0MA 4C0DB 3FB9A 1D1AA 2WSFE 2RMOA 5CKEA 2V8KA 3EG9A 2RHXA 2ZPGB 3BFMA 3WVEB 2F5KA 1HSQA 2ZPFB 3JRZA 1JXMA 2Y90A 3HFNA 2DXBA 1KIKA 4PJLA 4M77F 5GANe 2DX1A 7AT1B 4PLIA 1TS9A 2XICA 4XTZA 5LJ5h 3CXCA 3OYIA 4L6V5 3VYHB 2BUDA 4Y92A 4HVWA 2G6FX 4M7AF 1RABB 2DBKA 1I07A 3LW5E 1OZ3A 3CBPA 1NBEB 2EGEA 1GCPA 4ORZA 4MZTA 1RAFB 2CUBA 1Q82R 2F2XA 3CC4Q 1W2BA 3QJYA 1GBQA 3CC2Q 2P4TA 2VGNA 1VYVA 4HVVA 2SEMA 2CYZB 2QEXT 2QQAA 2VB6A 3G71Q 5KYYA 5DM7R 1WQWA 3H0HA 1K1ZA 2M16A 4M75B 3ER0A 1W6XA 1QVFS 4JPBW 1QKXA 1IREB 5LJ5g 4DEYA 4BY6C 3TQ7P 2CP2A 2FZKB 4RG2A 2LX9A 1VQ8Q 1N8RC 4J6YA 2HBPA 5GAMj 4A4KA 1H92A 2HMAA 3VU3C 3J80E 3M9QA 3CCJT 4GBQA 1M3CA 1GL5A 1WIEA 2GQVA 2QQBA 1XTDA 3QSUA 4PK4A 4EMGA 2FZCB 2GGRA 5LJ5f 5GAMg 2DL5A 4J7IA 1PSEA 1K9MC 3I56T 1PD0A 1YP5A 3V7SA 3RR6A 4RCCA 2LCSA 4GLMA 1Q86R 1W2BS 3V8LA 4X9CA 1WJRA 2CKKA 2RN8A 1Y57A 2WACA 4A4GA 2RQUA 1P92A 2JM8A 5J26A 4PFPA 2GFUA 4K11A 5ECAA 2EBPA 5CKDA 3AHUA 1VIFA 4J9EA 2MOXA 3MEWA 3HL8A 4M75C 3M55A 3QYHB 1K9MR 4GLKA 2HZYA 3EFOB 3M59A 5GANh 1MUZA 2FB7A 3CCEA 2YLBA 3QBYA 1X6BA 4OMLA 2ZPBB 1VQNA 2BKDN 3RESA 3E9GA 3CCEQ 1BI2A 1UECA 1RADB 2MI6A 4JS5A 4PJJA 2V1QA 2V8IA 2E12A 1SG5A 5DLQE 2LVMA 1UEBA 1WJSA 1WXBA 3L1AA 2QQ9A 5GMKh 4ZGDB 3CEYA 3OYGA 1MMDA 2LP5A 1UGQB 1VQ8T 1R8OB 2QAZA 3HRSA 5KYXB 4OMMA 1Y07A 3EH2A 4C0ZA 3S3MA 2JTFA 2IG0A 1FXXA 3OYAA 2KRNA 4KGZB 1GFDA 1GCQC 1ZQ1A 2K6DA 3H0IA 1KD1C 1ZLMA 2PVDB 2YSQA 2O31A 2F2VA 4EMKA 2K5IA 3INZA 4RTVA 4RTXA 1G5VA 3JCMJ 3A8GB 4OMNA 5GAN2 2K79A 1KC8U 4IUTA 4C5EA 4ZTJA 2H3JA 2P0KA 1VQMT 3WVDB 1X2QA 4E7LA 2QDYB 5EC7A 4QVDA 3VUBA 4AG2C 4C92B 3SDZA 1TH7A 2LJ0A 1YJ9T 2D0NA 4M77G 1O9SA 4FYYB 2FYKA 1NLOC 5GANg 1UHFA 4HXJA 2H3EB 2DIGA 2O4XB 1Y96B 3CCET 2HSPA 1M3AA 3DKMA 3SB2A 4ZNXA 2L8DA 3OYCA 1Q81C 2RK1A
chains in the Genus database with same CATH topology
5GAN4 1KQ2A 4A53A 4II1A 4J8OA 2QI2A 1OYXA 2RD1A 2KY9A 3DLMA 3N5BB 4NL2A 2EIFA 4XAXB 1VQ6T 1M5Q1 2CZ1B 2D0QB 2LT4A 5LJ3d 3LWIA 1M9SA 4LD6A 3G4ST 3OMGA 2HQEA 3SFMA 4M7DD 1VUBA 3KBGA 4LD9K 4RG8A 4M77E 2DTOA 4FSXA 4J83A 2OAUA 1VQOA 4QVCA 5KCOA 2CZ0B 1M4ZA 2XG8D 4N0AA 3HRUA 4XQ3A 3OMCA 2DD5A 3PIOA 3OBWA 1AHJB 2WSCE 1K8AC 1LJOA 2MMPA 4C0DC 4C92E 1G3TA 5CO7A 4F7UF 3CC2A 2DO3A 4QQDA 2RJFA 4PJOF 1MHNA 5CCAA 4ZN3A 2CZ6B 5A0DA 2KDSA 4PNOA 1BYMA 2DK3A 2AHJB 3QHSA 4JLGA 3JCMX 1Q7YC 3OS0A 5GAMd 1XNIA 2LNVA 2EJGA 5LJ3j 2VYTA 3OYLA 2K57A 4C92G 4C8QB 4M78C 1HK9A 1MGQA 2E6ZA 2O01E 4PJOE 3WXMB 2YLCA 3RIRA 3HHTB 2X4JA 3L2ZA 3L42A 1X6OA 2RA2A 2K4YA 1UGPB 2DZCA 2RHUA 5GANd 1YITA 4IUVA 4M75G 2JUFA 4A4HA 4C92C 1K73U 4TVRA 4HCBA 1M8VA 2EQMA 3O8VA 3UT1A 5CK9A 3MHXA 3RKXA 4C8QF 2C06A 4IKFA 5FU6B 3GLXA 1VQOT 3J7AF 1YIJA 4PJOG 3JB9D 2K5LA 3ME9A 4LDYA 3QKJA 3CXCS 5C0MA 3J81E 1G3YA 2DPPB 3CC4T 3CCMT 4XU3A 1ZHIA 2QA4A 2E70A 3VJPA 5GMKj 3G71A 3CCRT 3CD6T 3I55T 1XOVA 5LJ5e 3TREA 3FRNA 3JCMe 1VQ5A 1U8RA 3CPFA 2E6NA 3M53A 2E1HA 4M7AG 4Y28E 4C0GA 2I2LA 4WF2A 1VQ4A 3RKYA 4OF1A 4F7UE 3L2UA 4C8QD 2EQJA 2LCCA 5C6SA 3PIPA 2CS7A 3GNGA 4M78E 3G71T 1I5LA 1OI1A 4IURA 1H3ZA 2R57A 3A8LB 3OYNA 5CAIA 3OS1A 3LGFA 3CCLA 4M77A 3FLGA 2HD0A 3CMEA 3OYJA 3S3OA 5LL6S 4OB1B 2L89A 4M7AB 4C8QA 3OYHA 3F70A 5GAMh 5GAMe 1VQNT 4C92A 3OB9A 3JCMW 2DVEA 2JVVA 2RJCA 1YBYA 3OYFA 1YI2A 3MEUA 2OTLT 1I8FA 1QP3A 2QQRA 3GP8A 2XD0A 4M7DB 2EFIA 1NJIC 5LJ5j 1O75A 4HCZA 1NPPA 4QW2A 4JRPA 1YHQA 1VQ5T 4BACA 4BDZA 2L5QA 4J5YA 3RMQA 1WJQA 4KUIA 2VUBA 4O5VA 3JB9G 4PJOA 3LYIA 2X4YA 1KG1A 2XU8A 5HK0A 1LOJA 2EYQA 4GY5A 3X24B 3L2WA 2ZPHB 3CCJA 2XK0A 3JB9H 2BIVA 4RMOA 4M75D 1VQPA 1DJ7B 2D6FA 2XDBA 2F69A 2G3RA 1UB4A 4MDWA 1QVGS 5D6YA 2LT1A 2HQXA 4MZPA 5FU7B 2K2VA 2QXFA 4QVZA 1VQ7T 4PKCC 1Q81U 2X4WA 4OB3B 3E19A 2ZPEB 1N9SA 4E7JA 3OYEA 1YCYA 1VQ4T 1Q82C 2KQWA 3PFSA 3H8ZA 3QPHA 1VQ9T 2DEQA 2ZZDA 4BE0A 3DB3A 4C8QG 2GF7A 1HXDA 3E9FA 2XHCA 3OS5A 1VQ6A 5KE2A 4DA4A 2DTHA 3BDLA 3JCMc 4X9DA 4M7AD 1M90C 1FX7A 2EJFA 2KAFA 5AYFA 4XTVA 3RMSA 4E7IA 1WGSA 3P8BB 4Q5WA 4N4HA 2RHYA 3JCMb 2DIQA 2O4XA 4A4EA 4V2SA 4KBMB 2MWPA 5CKFA 2ZPIB 3JB9J 4KT0E 4ZGEB 3C95A 4M78G 2JNGA 5HK3A 3CD6A 3TEEA 4BUGA 5A0LA 4PJOD 1YJ9A 2CGHA 2RM4A 3HKSA 3GPLA 1Q7YU 3P8HA 2XDPA 4PLLA 3GF5A 3CBOA 1XQHA 3DB4A 3PMIA 3VV0A 2F5TX 1M1FA 4M78F 1QP2A 3SWNC 4JDSA 3E1SA 1OZ2A 3NTHA 4O6JA 1JB0E 2QTXA 3ASKA 2PVOB 3CMAA 3P8DA 2E10A 4FIBA 4LDWA 2VV5A 1Q81C 5GAOq 3CBMA 1Y96A 3PTAA 1N8RU 2GFAA 5LJ3e 3GOXA 2FL7A 2R58A 4FM4B 5LJ3h 3GIBA 2EWNA 4C8QC 3KUFA 3BY7A 4NOYA 5I2SA 4L59A 2JN0A 4IUUA 4JRKA 4BB7A 4M77D 3MP1A 4Z02A 4FT2A 4X34A 1YJNA 3PNWC 4JJNK 3M5AA 1QVGA 2DZ9A 4N4IA 4XU2A 1VQ9A 4OB0B 1VQKA 1JRIA 2QA4T 3CC4A 3LGLA 2DTIA 3HRTA 3PMTA 2LTOA 1VQKT 1YIJT 2HAXA 3JAME 3NFCA 4RCBA 5D6XA 4C5IA 4ELZC 5GANf 4M7DF 2OTJA 3A8HB 1D3BA 2FHDA 4JUVA 3CC7T 3A5ZB 1ZBXA 4C0DB 4KULA 4ELYC 3FB9A 1UGSB 1LNXA 2WSFE 1BIAA 4OP0A 1I81A 3TCJA 4DOWA 5LJ5d 3PT9A 5CKEA 3JCMd 3FIFA 4DQ2A 2V8KA 4MMLA 4E7HA 5J3BA 2KK4A 4LDXA 2QEXA 4IUPA 3QO3A 2RHXA 2ZPGB 4N4GA 4OGEA 1VQ7A 1YJWA 2DD4A 1X01A 3BFMA 3EAEA 2F5KA 3WVEB 4C92F 2MF2A 3OW2A 3UPUA 2M9UA 4XTXA 2MAMA 2LQ8A 1N9RA 5L8RE 2K3XA 2ZPFB 4OGCA 4M75A 5CQXA 3UDCA 3Q1JA 2X35A 3JRZA 1KQSS 4C5GA 1B34B 4M77C 4BY6B 4JS4A 2Y90A 3V7RA 3HFNA 2DXBA 3G6ET 4D6WA 4BD3A 3CMET 3S3NA 4M77F 3VYGA 5GANe 1NPRA 4Y91A 5GMKl 5GAOl 4JRIA 4ME7A 5I2MA 2DXCA 4PLIA 2YRVA 2XICA 4XTZA 2EKOA 4C0FA 1WPYA 2JOYA 3M54A 3JCMh 2PUKB 5LJ5h 4L6V5 3VYHB 3OYIA 3C12A 2BUDA 3CXCA 1UGRB 4HKEA 4OVAA 5GAOn 5FRMA 4PJOC 3OQ5A 2XKOC 4LDVA 5KE3A 2WSEE 2OTLA 3GNFB 3MP8A 4M7AF 2X4XA 4FT4A 4M7DC 2HNIA 2RJEA 3OSVA 1I4K1 1NZ9A 4ZN1A 1QVFA 2VXEA 3LW5E 4M78B 1YHQT 1OZ3A 1W4SA 3CBPA 5GAN8 5A2QE 1KD1U 3FC3A 4MZTA 2DJZA 3L2VA 2L3RA 3I55A 1WNLA 5CR2A 4BDYA 3M58A 5GAOm 1W2BA 3EFSA 5DY9A 4CRIA 3QJYA 4JLIA 4N0AC 2PU9B 3HPWA 3HFOA 3V8KA 1YITT 3CCLT 4XK8E 4A54A 2R5MA 1NJIU 2P4TA 2VGNA 4MZMA 4M78D 1H641 1M90U 3JCMP 2M1HA 2CYZB 4M75F 2RB6A 2JZ2A 3CCQT 1Q86C 2QEXT 1KC8C 2D9TA 2QQAA 3OYMA 4F7UB 5LJ3g 1QW1A 5DM7R 3OSSC 1WQWA 2RI5A 5CIUA 2K3YA 1RI0A 3UWNA 5IAYA 3OBYA 4A4FA 3I56A 2M16A 3C4SA 5GAOp 3NTIA 4M75B 5HY6A 4FL6A 3ZEHA 3MP6A 3ER0A 3LH0A 4E47A 3OYDA 3LX7A 5IT9E 3BW1A 1Q86U 2OTJT 1QVFS 4F7UA 3L2RA 4M7AE 1KQSA 3OS2A 1VQ8A 3CCUA 1IREB 2Y4YA 3JCMg 5LJ5g 2V8JA 4F7UG 3CCSA 1YI2T 1Q82U 5KH6A 1N27A 4BY6C 2VXFA 5GAN5 2EQKA 3CPWS 3OYKA 4RG2A 3OA6A 2LX9A 2MWOA 4J6YA 1N8RC 2HBPA 2IVWA 4ZTFA 2A3LA 2VGMA 2LQKA 1VQPT 1RL2A 3PGGA 1VIEA 2LC4A 5A0GA 4A4KA 1G3WA 4OMFB 5GAMj 2LRQA 1D3BB 1NE8A 5FU7C 3QZ9B 2DAQA 4MMKA 4J6XA 2RK2A 3M9QA 3SWNB 3VU3C 3J80E 3CCJT 4HT9A 2GQVA 3OY9A 3CCVA 2QQBA 1XTDA 4BI3A 2GCXA 2RO0A 4IUQA 3QSUA 4EMGA 4BI4A 3JCMV 3JCMf 4ZGJB 1N6AA 5LJ5f 4J7IA 1PSEA 5GAMg 3I56T 3CCVT 3QJ6A 1K9MC 3V7SA 3RERA 4XU0A 4RCCA 4XTUA 4HT8A 5DLOA 1W2BS 3FDRA 3V8LA 4X9CA 1WJRA 4EMKC 4M78A 5HKCA 1G3SA 3QG1A 2E64A 2CKKA 3M4YA 3OYBA 1VQLT 3JB9F 3URGA 4M7DE 2Y4XA 4M77B 5FLXE 2B8AA 2DXUA 2M0OA 2WACA 1VQLA 3ZBDA 4XU1A 4A4GA 4C8QE 5IN1A 1IZ6A 2P0PA 4J7FA 5CQYA 1P92A 3CC7A 5GAN3 3CCST 3H6ZA 2NLUA 1X75C 3MCAB 1JJ2S 5J26A 3KXTA 4R56A 5CVIA 4BE1A 3X28B 2GFUA 1BIBA 2KSSA 4QQ6A 3G7ZA 2RHIA 2R5AA 1YJWT 5CKDA 3JB9I 3AHUA 4NS5A 1VIFA 5KCHA 3CCRA 3HSBA 3MEWA 3HL8A 4M75C 3M55A 3QYHB 4FU6A 1K73C 4GLKA 3ZFJA 2ZGWA 5GAN7 3M59A 5EG2A 5GANh 1K8AU 4M7AA 5I21A 1BKBA 4BE2A 2FB7A 3CCEA 2YLBA 3QBYA 1S72T 4ATOA 3CPWA 1BI1A 1Y7XA 5D6WA 3X20B 2QQSA 4HA8A 5GMKi 2ZPBB 2DKGA 4EMHA 2BKDN 1QVPA 3FEOA 3SWNA 1VQNA 3RESA 3HP9A 3E9GA 4XTYA 1BI3A 2EQUA 1YJNT 1BI2A 4M7AC 2RJDA 4MDXA 3M56A 2MI6A 3G4SA 4JS5A 5GAN6 3QXEB 3JSCA 2V8IA 4JRQA 5GMKm 2E12A 1Y71A 2A7YA 5GAMf 5DLQE 2LDMA 2LVMA 1B34A 1UEBA 1WJSA 2EAYA 3A8MB 1JJ2A 5GMKe 3L1AA 2QQ9A 4UC4A 3X25B 5GMKh 5CKBA 4ZGDB 3CEYA 4NL3A 2XDDA 3OYGA 3MEVA 1GXIE 4HCCA 4LDUA 3M57A 1BI0A 2KMTA 3QDRB 4PL6A 1UGQB 2E41A 1KHCA 2YHTA 4QQGA 3T9NA 1VQ8T 2JTMA 1R8OB 3R6OA 3RKWA 3OYYA 2RI2A 2RHZA 1KQ1A 3BDUA 3HRSA 3V8JA 1Y07A 1M1KU 4C0ZA 3OW2S 4B9XA 3QIIA 3CC2T 3CCQA 3S3MA 2RH2A 2JTFA 4E7KA 2IG0A 4M7DA 1FXXA 2K5FA 3OYAA 5FU6C 2CZ7B 4YTLA 4C5HA 1ZQ1A 4M7DG 4CI0C 3G6EA 2PQWA 3L2QA 4EDUA 5FROA 1KD1C 5FRNA 2PVDB 1SSFA 1M1KC 4VUBA 4KUDK 2P0QA 3MEAA 3LWHA 2KVQG 4EMKA 3META 3FJPA 3JCMQ 2K5IA 3INZA 4L5GA 3VKIA 2PUOB 1VQMA 3TU4K 4PJOB 1G5VA 3CCUT 1PSFA 3M4GA 3C94A 3JCMJ 1M1GA 5GAOr 4DOVA 1WQ7A 3A8GB 5GAN2 3QYGB 4C92D 3QUIA 4P5NA 1KC8U 4IUTA 4C5EA 3RUXA 4R55A 2XIDA 4ZTJA 1JBMA 2H3JA 2P0KA 1VQMT 3WVDB 3QZ5B 5M9OA 3CCMA 4E7LA 4M75E 2QDYB 4QVDA 3VUBA 5CKHA 1KHIA 4XTWA 1EIFA 4OB2B 3SD4A 4C92B 2PVGB 4RKUE 3SDZA 3CMAT 3S6WA 1FWZA 3V7CA 2XI9A 3NTKA 1TH7A 1YJ9T 1K9MU 3X26B 5GANj 4M77G 2DXTA 3LLRA 2E65A 1O9SA 1U1SA 3A8OB 4B9WA 4BI8B 3MO8A 4J6WA 2FYKA 5GANg 2O4XB 2DIGA 3VUZA 5J39A 2VC8A 1V29B 1U1TA 1Y96B 2RI3A 2FVUA 2ZCFB 1S72A 3CCET 3DKMA 3SB2A 3EFRA 2EJ9A 3DLLA 4EPCA 2L8DA 3OYCA 2E5QA 2LCLA 5LJ3f 2RK1A 4EMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BI8 B;  4BI3 A;  4BI4 A; 
#chains in the Genus database with same CATH topology
 5GAN 4;  1KQ2 A;  2RD1 A;  4IIO A;  5GJV B;  2Z0W A;  4NL2 A;  2CZ1 B;  2D0Q B;  8ATC B;  3I56 Q;  4LD9 K;  4M77 E;  2OAU A;  1IO6 A;  1M4Z A;  3I5R A;  2AK5 A;  3OMC A;  2DVJ A;  1K8A C;  4C92 E;  1K4U S;  1G3T A;  5KYU A;  4JJD A;  4OMO A;  4J9F A;  4ZN3 A;  2KDS A;  3QHS A;  2AHJ B;  4JLG A;  1XNI A;  3G4S Q;  2VWF A;  2P84 A;  1M2V A;  2K57 A;  1T3S A;  4C8Q B;  3CCJ Q;  1RAH B;  3I9Q A;  3L2Z A;  5GAN d;  2K4Y A;  1S72 Q;  4M75 G;  4A4H A;  1M8V A;  3UT1 A;  3MHX A;  3CQT A;  1OX9 A;  2ED0 A;  3CXC S;  4E2F B;  4LDY A;  3CC4 T;  2DPP B;  1K9A A;  1ZHI A;  2KBT A;  5LJ5 e;  3FRN A;  1EZZ B;  1VQ5 A;  1YWP A;  2E6N A;  2E1H A;  4AFQ C;  3TSW A;  5HCK A;  3CCL Q;  3RKY A;  2AT1 B;  3G71 T;  4M78 E;  1AT1 B;  3A8L B;  3LGF A;  3CCL A;  3EHR A;  3FLG A;  3OYJ A;  3S3O A;  2HDA A;  1MMA A;  1MV0 B;  5GAM e;  3NPF A;  2JVV A;  3OYF A;  2CP7 A;  2XD0 A;  1IGU A;  3MKD A;  4KUI A;  3JB9 G;  1KG1 A;  1ZSZ A;  3X24 B;  2ZPH B;  2E3H A;  3QDF A;  2XDB A;  1DJ7 B;  2F69 A;  1TXQ A;  4MDW A;  2XMF A;  4MZP A;  5FU7 B;  2K2V A;  2KRM A;  2KGT A;  1N9S A;  2LNH B;  2KQW A;  3PFS A;  3QPH A;  1VQ9 T;  4FYV B;  1RLQ C;  2ZZD A;  1RAA B;  2GF7 A;  1YJ9 Q;  1PC0 A;  4DA4 A;  2DTH A;  3JCM c;  1MMN A;  1WA7 A;  2KAF A;  4WTO B;  2A28 A;  4XTV A;  3RMS A;  3JV3 A;  2O4X A;  4RUG A;  2ZPI B;  4EIK A;  1VQ9 Q;  4KT0 E;  2JNG A;  1IXD A;  4AG1 C;  2ROT A;  3DB4 A;  2D1X A;  2B86 A;  3VV0 A;  1M1F A;  3A98 A;  2J05 A;  3SWN C;  1OZ2 A;  2ROL A;  2QTX A;  3ASK A;  3P8D A;  4LDW A;  3CBM A;  1Y96 A;  1N8R U;  1W70 A;  3GOX A;  2R58 A;  5LJ3 h;  1YJN Q;  4LN2 A;  3KUF A;  4NOY A;  4LE9 A;  2HKN A;  2RNA A;  4Z02 A;  1YJN A;  4JJN K;  2DZ9 A;  4F16 A;  1JRI A;  2DTI A;  1IHV A;  3UA7 A;  3O5Z A;  4JUV A;  1R0B G;  4ELY C;  1UGS B;  1LNX A;  1UJY A;  3TCJ A;  4DOW A;  1I81 A;  5LJ5 d;  3I35 A;  3PT9 A;  2ESW A;  2QDL A;  4DQ2 A;  5J3B A;  2KK4 A;  4IUP A;  4N4G A;  4OGE A;  1VQ7 A;  1YJW A;  1NYF A;  2DD4 A;  1X01 A;  2MF2 A;  4J9I A;  1OOT A;  5L8R E;  4PFO A;  4OGC A;  3M0U A;  2X35 A;  4BE0 A;  2KRS A;  4BY6 B;  3V7R A;  4D6W A;  3S3N A;  2COZ A;  3VYG A;  2JMA A;  2FG0 A;  5GMK l;  1QCO A;  4E7Z A;  1ACM B;  1F1B B;  2EKO A;  1WPY A;  2JOY A;  3M54 A;  2PUK B;  1LPL A;  1X43 A;  5GAO n;  3OQ5 A;  1UE9 A;  4KH1 B;  3GNF B;  2HNI A;  1NZ9 A;  1BBZ A;  1X69 A;  4M78 B;  1YHQ T;  3MPU B;  5GAN 8;  1Q81 R;  1X2K A;  3FC3 A;  5CR2 A;  3M58 A;  2RF0 A;  4CRI A;  4JLI A;  4N0A C;  3HPW A;  3CCL T;  4XK8 E;  3M0Q A;  1QQJ A;  3JCM P;  2LQN A;  2D9T A;  3OYM A;  2AKK A;  4F7U B;  4RTW A;  3OSS C;  5CIU A;  1RI0 A;  4HCK A;  3EG2 A;  3C4S A;  5GAO p;  3NTI A;  3MP6 A;  3LH0 A;  3LX7 A;  3BW1 A;  1Q86 U;  4JZ4 A;  4M7A E;  3OS2 A;  1VQ8 A;  2DL3 A;  1I0C A;  1N27 A;  2VXF A;  2KXC A;  2LJ3 A;  4ZTF A;  1QCN A;  2A3L A;  2VGM A;  2LQK A;  2LC4 A;  1K8A R;  3QZ9 B;  4MMK A;  2CSQ A;  3SWN B;  2HCK A;  2EQI A;  2FRY A;  2GCX A;  4IUQ A;  4OMQ A;  4ZGJ B;  3CCV T;  2OAW A;  1WLP B;  3E2U A;  3RER A;  4XU0 A;  4XTU A;  5DLO A;  3VS2 A;  2YUP A;  3OYB A;  1ZSZ C;  1VQL T;  3URG A;  4M77 B;  3ZL7 C;  4LXC A;  2M0O A;  3UF4 A;  2P0P A;  5CQY A;  1SEM A;  5IHI A;  3H6Z A;  4JJC A;  1VA7 A;  2MK5 A;  3QWY A;  3PVL A;  2KSS A;  1BIB A;  4QQ6 A;  2R5A A;  3JB9 I;  3VS3 A;  3CCR A;  1QKW A;  1AOJ A;  2K7A A;  4FU6 A;  4RTU A;  3ZFJ A;  1K73 C;  5EG2 A;  1C6V X;  1K8A U;  4M7A A;  1OUL A;  5I21 A;  4BE2 A;  1Y7X A;  5D6W A;  1ABQ A;  3X20 B;  4FCY A;  1GCQ A;  4EMH A;  1QVP A;  1IGQ A;  4XTY A;  1YJN T;  4M7A C;  1YFN A;  2D8H A;  3JSC A;  3VS0 A;  1Y71 A;  2LDM A;  4UC4 A;  1D09 B;  2XDD A;  1U3O A;  4LDU A;  1BI0 A;  2HL3 A;  2KMT A;  2O9S A;  2YHT A;  4QT7 A;  3T9N A;  2JTM A;  1YIJ Q;  2KI7 A;  3RKW A;  3OYY A;  3VS1 A;  1UDL A;  2RI2 A;  3BDU A;  1VQ7 Q;  2OX7 A;  3OW2 S;  3QII A;  1M8M A;  2K5F A;  2CZ7 B;  4C5H A;  2JT4 A;  4AFU C;  2QYZ A;  1QMC A;  2KVQ G;  3MET A;  3FJP A;  3JCM Q;  1QLY A;  2CP5 A;  4L5G A;  2PUO B;  3TU4 K;  2OTJ Q;  3M4G A;  2GTO A;  1WQ7 A;  3EGD B;  3QYG B;  5IXB A;  4Z89 A;  1JBM A;  1B07 A;  3QZ5 B;  3CD6 Q;  4J9D A;  5IXF A;  1KHI A;  4XTW A;  4OB2 B;  3CMA T;  1FWZ A;  1H3H A;  3NTK A;  2J06 A;  1NYG A;  2JS0 A;  5FWB A;  3LLR A;  1U1S A;  1AZE A;  1AEY A;  4B9W A;  2K9G A;  4BI8 B;  4J6W A;  1V29 B;  1U1T A;  3DLL A;  1PCX A;  5LJ3 f;  4DEX A;  3EH1 A;  4II1 A;  2KY9 A;  5LJ3 d;  3G4S T;  1M30 A;  4LD6 A;  3OMG A;  2HQE A;  3EG0 A;  4RG8 A;  2DTO A;  4XQ3 A;  4N0A A;  3G1J A;  3NGP A;  3HRU A;  1RAI B;  2DET A;  3PIO A;  2A0F B;  3U23 A;  2H8H A;  2CH4 W;  4C0D C;  2DL7 A;  1M2O A;  5CO7 A;  4JZ3 A;  2C0O A;  2EGC A;  1MHN A;  2NUT B;  3CXC P;  1U5S A;  5A0D A;  4PNO A;  1BYM A;  1PRL C;  2DK3 A;  2DMO A;  4FW1 A;  2OI3 A;  1M2V B;  5LJ3 j;  2VYT A;  1KSW A;  1VYT A;  2ENM A;  2YLC A;  3HHT B;  2X4J A;  1SKU B;  1UGP B;  1TUC A;  1YIT A;  2COW A;  2A36 A;  2JUF A;  4TVR A;  3O8V A;  2NUP B;  2W10 A;  2DA9 A;  3RKX A;  4IKF A;  3J7A F;  1VQO T;  1GFC A;  4PJO G;  4FYX B;  5C0M A;  2M02 A;  1VYU A;  4XU3 A;  3VJP A;  5GMK j;  2KRO A;  3CD6 T;  3I55 T;  4FW2 A;  1QWE A;  5L23 A;  4A63 B;  4M7A G;  3G6E Q;  2I2L A;  3UA6 A;  1OPL A;  2EQJ A;  3VS5 A;  1I5L A;  1OI1 A;  1H3Z A;  2QAS A;  5CAI A;  3OS1 A;  2GNC A;  2D8J A;  2DYB A;  6AT1 B;  1NG2 A;  3CME A;  2L89 A;  4M7A B;  3F70 A;  3M0P A;  2L0A A;  3TVT A;  2BZ8 A;  1VQN T;  1JEG A;  2DVE A;  2RJC A;  1YBY A;  1I8F A;  3GP8 A;  4M7D B;  4HCZ A;  3EG1 A;  1YHQ A;  2YUO A;  2DM1 A;  4LUE A;  2L5Q A;  1WJQ A;  1RAE B;  2VUB A;  4O5V A;  1WYX A;  3LYI A;  2O2O A;  1VQN Q;  2GBQ A;  5HK0 A;  2EYQ A;  1YHQ Q;  2M0Y A;  2BIV A;  4RMO A;  2C0I A;  3CCV Q;  2K3B A;  1MNE A;  1YNZ A;  4D8D A;  1WHJ A;  1VQ7 T;  4OB3 B;  2ZPE B;  4D8K A;  1B3Q A;  4C8Q G;  3E9F A;  2XHC A;  3OS5 A;  4JJB A;  4KRT A;  5KE2 A;  3BDL A;  1VQ6 A;  1K73 R;  1X27 A;  4X9D A;  4M7A D;  2CP3 A;  1PNJ A;  5AYF A;  4PJN A;  4Q5W A;  4V2S A;  2EYW A;  2RHY A;  2DIQ A;  3JCM b;  4KBM B;  2MWP A;  2RQV A;  3OW2 P;  4M78 G;  2MCN A;  2L3S A;  3CD6 A;  3D7S B;  3TEE A;  5A0L A;  4PJO D;  1YJ9 A;  2CGH A;  2RM4 A;  3HKS A;  1Q7Y U;  4PFZ A;  2MIO A;  3GF5 A;  1XQH A;  1E7O A;  3E1S A;  1JB0 E;  1ZA2 B;  2E10 A;  5KYY B;  1EX4 A;  2HKQ B;  3GIB A;  2EWN A;  3BY7 A;  2DFU A;  4BB7 A;  4M77 D;  2NUT A;  1Z9Q A;  3PNW C;  1HD3 A;  3M5A A;  4N4I A;  1VQ9 A;  2DIL A;  2QA4 T;  1UHC A;  3PMT A;  1VQK T;  3VRY A;  1YIJ T;  3JAM E;  5D6X A;  4RCB A;  3CCR Q;  1H8K A;  1D3B A;  3CC7 T;  2NWM A;  5D7U A;  1T0H A;  1VQO Q;  4OP0 A;  1FMK A;  3FIF A;  1QVG P;  4PJM A;  4MML A;  1OU8 A;  4IIM A;  2EYY A;  3EAE A;  3UPU A;  2ZAE A;  3I55 Q;  3OW2 A;  2M9U A;  2LQ8 A;  2K3X A;  5CQX A;  3UDC A;  3Q1J A;  1B34 B;  3M0R A;  3G6E T;  8AT1 B;  4BD3 A;  1OPK A;  1NPR A;  5GAO l;  4JRI A;  5I2M A;  2DXC A;  2OTL Q;  2YRV A;  3REA B;  4C0F A;  3JCM h;  1GBR A;  3C12 A;  2OJ2 A;  4OVA A;  4HKE A;  4PJO C;  2QK0 A;  1YN8 A;  2XKO C;  2OTL A;  2X4X A;  3PVQ A;  1S1N A;  3OSV A;  1LVK A;  4ZN1 A;  2CH4 A;  3CME Q;  5A2Q E;  3L2V A;  2L3R A;  1WNL A;  5GAO m;  3EFS A;  2EPD A;  5DY9 A;  1FYN A;  1C1A A;  2DJQ A;  3V8K A;  3HFO A;  4A54 A;  2R5M A;  2K2M A;  4MZM A;  4M78 D;  2QGG A;  4FYW B;  4M75 F;  2JZ2 A;  1Q86 C;  1WZO A;  1BK2 A;  2ABL A;  2RI5 A;  2K3Y A;  2X9H A;  3UWN A;  5IAY A;  4A4F A;  3I56 A;  2NUZ A;  5HY6 A;  3ZEH A;  3OYD A;  5KYW A;  2OTJ T;  2AZS A;  4F7U A;  1D1B A;  3L2R A;  2FRW A;  1UFF A;  2Y4Y A;  3JCM g;  2V8J A;  1BU1 A;  2YRC A;  2EQK A;  3OYK A;  3VS7 A;  1Z9Z A;  2MWO A;  2IVW A;  2GQI A;  1UG1 A;  5KYW B;  1VIE A;  5A0G A;  3CMA Q;  1HYO A;  2LRQ A;  1JO8 A;  1D3B B;  5FU7 C;  1FMW A;  1WHL A;  4J6X A;  2DL4 A;  3OY9 A;  3H0F A;  4R0K A;  3JCM V;  3JCM f;  1N6A A;  2PNI A;  3QJ6 A;  4HT8 A;  4EMK C;  4M78 A;  5HKC A;  2E64 A;  3M4Y A;  2EW3 A;  3VRZ A;  3JB9 F;  1BB9 A;  4M7D E;  2RQW A;  2Y4X A;  1AD5 A;  2JTE A;  1B7T A;  2DXU A;  1VQL A;  4AMC A;  4XU1 A;  1IZ6 A;  1WXT A;  1RAG B;  2DE0 X;  5GAN 3;  2NLU A;  3MCA B;  1JJ2 S;  3KXT A;  1UJ0 A;  1MND A;  4R56 A;  5CVI A;  4BE1 A;  1W1F A;  3G7Z A;  2RHI A;  1ABO A;  5KCH A;  3HSB A;  2KNB B;  1T0J A;  1TUD A;  1XJW B;  3AT1 B;  3A1P A;  4AT1 B;  1PM3 A;  2QQS A;  2DKG A;  3CCM Q;  2EQU A;  4MDX A;  3NMZ C;  3G4S A;  5GAN 6;  5GMK m;  5GAM f;  1VQ6 Q;  1B34 A;  2EAY A;  3A8M B;  1U06 A;  5GJW B;  2V1R A;  3X25 B;  2KYM A;  5CKB A;  1GXI E;  2W0Z A;  4PL6 A;  3QDR B;  2DNU A;  2HL5 C;  2E41 A;  1KHC A;  4QQG A;  3BE3 A;  1BCO A;  1KQ1 A;  3V8J A;  3CCQ A;  4E7K A;  4M7D A;  1TU0 B;  2JMC A;  1LCK A;  3SEM A;  1SSF A;  1M1K C;  4LUD A;  4VUB A;  2ECZ A;  2JS2 A;  4KUD K;  1JQQ A;  2BZX A;  3VKI A;  1CKA A;  4PJO B;  3CCU T;  1PSF A;  5GAO r;  4DOV A;  5I11 A;  1D0X A;  1KJW A;  3QUI A;  3RUX A;  4R55 A;  4ESR A;  2XID A;  5M9O A;  3CCM A;  4E6R A;  1TSF A;  2NYS A;  1WHG A;  3PE0 A;  2PVG B;  4RKU E;  1PRM C;  1NEG A;  3V7C A;  3X26 B;  5GAN j;  1M1K R;  2DXT A;  2VAS A;  2PZ1 A;  3A8O B;  1M3B A;  5J39 A;  2VC8 A;  1VQK Q;  2RI3 A;  2ZCF B;  4CC3 A;  3EFR A;  1X6G A;  2LCL A;  1WDX A;  2KYB A;  4J8O A;  2QI2 A;  1OYX A;  3CCQ Q;  3DLM A;  3N5B B;  1RAC B;  1VOM A;  2EIF A;  4XAX B;  1VQ6 T;  1M5Q 1;  3LWI A;  4CC2 A;  1M9S A;  3SFM A;  1ZSZ B;  4M7D D;  1VUB A;  3KBG A;  4QVC A;  5KCO A;  2XG8 D;  1AVZ C;  3HTR A;  1WHH A;  1YCS B;  2DD5 A;  1AHJ B;  2WSC E;  1SPK A;  2ATC B;  3CC2 A;  1G2B A;  2DO3 A;  3LH5 A;  2RJF A;  4PJO F;  2EGA A;  2J6K A;  3M0S A;  1Q7Y C;  3OS0 A;  2EJG A;  1ZUU A;  3OYL A;  2BE7 D;  4M78 C;  4RTT A;  1KFZ A;  3EHQ A;  4PJO E;  3WXM B;  3RIR A;  3EG9 B;  2RHU A;  3RNJ A;  3SHW A;  4IUV A;  1K73 U;  4HCB A;  2AZV A;  4J9G A;  4C8Q F;  2C06 A;  3GLX A;  1SRL A;  3MJX A;  3QKJ A;  3J81 E;  2J6O A;  1G3Y A;  3CCM T;  1PG5 B;  2J6F A;  3CCR T;  1G8X A;  3JCM e;  1U8R A;  4C0G A;  4WF2 A;  1OEB A;  1OX8 A;  3L2U A;  4OF1 A;  2LCC A;  4WCI A;  2CS7 A;  1TG0 A;  4IUR A;  1OQK A;  1UGV A;  2I0N A;  4M77 A;  1VQ5 Q;  3QWX X;  2L3Q A;  1IB8 A;  2VKN A;  4C92 A;  3OB9 A;  3JCM W;  3EGU A;  5FWC A;  1YI2 A;  3MEU A;  2OTL T;  1QP3 A;  2EFI A;  1NJI C;  1O75 A;  4QW2 A;  4JRP A;  1VQ5 T;  4OMP A;  4J5Y A;  3RMQ A;  4PJO A;  2X4Y A;  4GY5 A;  2DRK A;  1WHM A;  2YUQ A;  1TWB A;  1VQP A;  2DER A;  2D6F A;  1PD1 A;  1QVG S;  5D6Y A;  2HQX A;  1HJD A;  4LNP A;  4QVZ A;  2X4W A;  1Q82 C;  3E19 A;  4E7J A;  3OYE A;  1YCY A;  3H8Z A;  9ATC B;  3DB3 A;  2JM9 A;  1R77 A;  1D0Y A;  2EJF A;  2F2W A;  4M4Z A;  4E7I A;  1T3L A;  4DBQ A;  1G83 A;  2YDL A;  2LZ6 B;  1KD1 R;  1W2B P;  1ARK A;  2F1L A;  5CKF A;  2YUN A;  1SRM A;  1A0N B;  5HK3 A;  2CT4 A;  4AFS C;  2KT1 A;  3P8H A;  1NEB A;  3PMI A;  5AT1 B;  2F5T X;  2QG9 B;  2QA4 Q;  1QP2 A;  4JDS A;  3NTH A;  4KGX B;  2MYS A;  3CMA A;  1JJ2 P;  2X3W D;  4B6M A;  2VV5 A;  2CDT A;  2GFA A;  2CRE A;  2DRM A;  3KFV A;  2FL7 A;  4FM4 B;  4C8Q C;  2YXY A;  2JN0 A;  4IUU A;  3FJ5 A;  2ED1 A;  1JU5 C;  3CCS Q;  4X34 A;  2JW4 A;  1QVG A;  4OB0 B;  3CC4 A;  3LGL A;  2LTO A;  1N8R R;  2HBW A;  3NFC A;  1IRX A;  1E6H A;  2OTJ A;  5I22 A;  1J3T A;  3A5Z B;  1ZBX A;  1I1J A;  4KUL A;  1AWO A;  3TSZ A;  1BIA A;  3JCM d;  1NM7 A;  4E7H A;  4LDX A;  2QEX A;  3QO3 A;  4J9C A;  5IH2 A;  4C92 F;  4XTX A;  2MAM A;  1N9R A;  4M75 A;  1KQS S;  4C5G A;  4JS4 A;  4M77 C;  3CME T;  1UTI A;  1PKT A;  4Y91 A;  4ME7 A;  1BCM A;  4F04 B;  1SSH A;  3REB B;  5FRM A;  1UGR B;  4LDV A;  5KE3 A;  2WSE E;  3MP8 A;  4FT4 A;  4M7D C;  2COY A;  2RJE A;  1I4K 1;  4X1V A;  1QVF A;  2VXE A;  2CP6 A;  1SHF A;  1W4S A;  1KD1 U;  2DJZ A;  3I55 A;  4BDY A;  1FMV A;  1AWJ A;  1AWW A;  2PU9 B;  2FPD A;  1YIT T;  1NJI U;  2DEU A;  1QWF A;  1H64 1;  1M90 U;  2M1H A;  2RB6 A;  3CCQ T;  1KC8 C;  5LJ3 g;  1QW1 A;  1OU9 A;  2L3P A;  3OBY A;  2LMJ A;  3I5S A;  1Q7Y R;  4E47 A;  4FL6 A;  1VQP Q;  5IT9 E;  1KQS A;  4KH0 B;  2CP0 A;  3CCU A;  4F7U G;  1YI2 T;  4RTZ A;  3CCS A;  1Q82 U;  5KH6 A;  3CPW S;  5GAN 5;  2SRC A;  3OA6 A;  2RQR A;  5IHN A;  2E5K A;  1VQP T;  2IPO B;  1RL2 A;  1Q95 G;  3PGG A;  4DBF A;  1G3W A;  4OMF B;  1NE8 A;  2DAQ A;  2AKL A;  2RK2 A;  1YI2 Q;  4HT9 A;  2KR3 A;  3CCV A;  4BI3 A;  2RO0 A;  4BI4 A;  2O88 A;  2A08 A;  1M90 R;  3FDR A;  1GRI A;  2X3X D;  3GBQ A;  4J9H A;  2EKH A;  1G3S A;  3QG1 A;  3THK A;  3VS6 A;  1WX6 A;  5FLX E;  2B8A A;  3RDV A;  3ZBD A;  4C8Q E;  1RLP C;  5IN1 A;  3ULR B;  4J7F A;  3CC7 A;  3CCS T;  1X75 C;  3X28 B;  1IHW A;  1YJW T;  3CC7 Q;  1WXU A;  4NS5 A;  1ZBJ A;  2LQW A;  2ZGW A;  5GAN 7;  1BKB A;  1S72 T;  4DBH A;  4ATO A;  3CPW A;  1BI1 A;  4HA8 A;  5GMK i;  2DYI A;  3FEO A;  3SWN A;  3HP9 A;  1BI3 A;  2V26 A;  2RJD A;  3M56 A;  3RBB B;  2BE9 B;  3QXE B;  2KT8 A;  4JRQ A;  2EVR A;  2A7Y A;  1EFN A;  1JJ2 A;  5GMK e;  2P4R A;  4NL3 A;  4CC4 B;  3MEV A;  3EGX A;  4HCC A;  1NJI R;  3M57 A;  1CKB A;  2EYX A;  3R6O A;  2C0T A;  2RHZ A;  4ANJ A;  2NUP A;  1M1K U;  1K0S A;  3CCU Q;  1C0M A;  2HQH A;  4B9X A;  3NHN A;  1VQ4 Q;  3CC2 T;  2DLP A;  2RH2 A;  2PTK A;  1TUG B;  2E3I A;  1ZUK A;  5FU6 C;  4YTL A;  4M7D G;  4CI0 C;  4Z8A A;  2PQW A;  3L2Q A;  4EDU A;  3G6E A;  5FRO A;  5FRN A;  2FO0 A;  2DF6 A;  1WHK A;  2P0Q A;  3MEA A;  3LWH A;  2LX7 A;  1RI9 A;  2BZY A;  2VVK A;  2JJ9 A;  1VQM A;  3C94 A;  1M1G A;  2DBM A;  1ZSG A;  4C92 D;  4P5N A;  3H41 A;  1I5O B;  4M75 E;  5CKH A;  2QTV A;  1EIF A;  3SD4 A;  3S6W A;  1UUE A;  2XI9 A;  1K9M U;  2RPN A;  4DBR A;  2E65 A;  3EGX B;  3MO8 A;  2J7I A;  3VUZ A;  1D1C A;  2FVU A;  1S72 A;  2EJ9 A;  1K0X A;  4EPC A;  2KEA A;  2E5Q A;  1PWT A;  4EMK B;  4A53 A;  1YWO A;  2KXD A;  2YT6 A;  1V76 A;  2LT4 A;  2X51 A;  4FSX A;  4J83 A;  1VQO A;  1OV3 A;  2CZ0 B;  1TOV A;  3H9N A;  2KE9 A;  2A37 A;  3OBW A;  1LJO A;  2FZG B;  2MMP A;  3R6N A;  1E6G A;  4F7U F;  4QQD A;  5CCA A;  4Z88 A;  2CZ6 B;  2E4H A;  5KYN A;  3JCM X;  5GAM d;  2LNV A;  1RUW A;  2AIR B;  1MV3 A;  4FSS A;  2YRD A;  2GTJ A;  4C92 G;  1KQS P;  2DL8 A;  1HK9 A;  1MGQ A;  3M0T A;  1QCF A;  2E6Z A;  2FPF A;  2O01 E;  3UAT A;  3L42 A;  1X6O A;  2RA2 A;  2DZC A;  1ZX6 A;  1SF9 A;  4AFZ C;  4C92 C;  2EQM A;  2FEI A;  5CK9 A;  3EG3 A;  2CT3 A;  5FU6 B;  1YIJ A;  1NLP C;  2L2P A;  3JB9 D;  2K5L A;  3ME9 A;  1KC8 R;  2QA4 A;  2O9V A;  2E70 A;  4E7S A;  1AZG B;  3G71 A;  1XOV A;  3TRE A;  1YIT Q;  5KYX A;  3CPF A;  3M53 A;  4F14 A;  4Y28 E;  1VQ4 A;  4F7U E;  4C8Q D;  3PIP A;  5C6S A;  3GNG A;  3C0C A;  2QEX Q;  2LJ1 A;  2R57 A;  3OYN A;  2RQT A;  3EGD A;  2EYZ A;  2JXB A;  1QVF P;  4RTY A;  2CSI A;  2HD0 A;  1TTH B;  5LL6 S;  4OB1 B;  4C8Q A;  3OYH A;  5GAM h;  4F17 A;  1ZUY A;  1PHT A;  1D0Z A;  1ZA1 B;  2QQR A;  2IIM A;  1KK7 A;  2QGF B;  4QKU A;  5LJ5 j;  4J9B A;  1NPP A;  4BAC A;  3CPW P;  4BDZ A;  2XU8 A;  1LOJ A;  3L2W A;  3IQL A;  3CCJ A;  2XK0 A;  5FW9 A;  3JB9 H;  4M75 D;  4CC7 A;  2G3R A;  1UB4 A;  1MMG A;  2LT1 A;  1AWX A;  2QXF A;  4PKC C;  1Q81 U;  4HVU A;  1VQ4 T;  2DEQ A;  5IHK A;  2MPX C;  1CSK A;  1HXD A;  1N5Z A;  2YWW A;  1M90 C;  1FX7 A;  1WGS A;  3P8B B;  4N4H A;  1SHG A;  4A4E A;  1M27 C;  3JB9 J;  1YJW Q;  4ZGE B;  2M51 A;  3C95 A;  1R0C B;  2HEQ A;  4BUG A;  1JXO A;  1K76 A;  3GPL A;  5KYU B;  2XDP A;  4PLL A;  3CBO A;  3EFO A;  4M78 F;  4O6J A;  1VQM Q;  2PVO B;  4FIB A;  5GAO q;  3PTA A;  5LJ3 e;  2BTT A;  5I2S A;  4L59 A;  4JRK A;  1VQL Q;  1PKS A;  3MP1 A;  2FPE A;  1V1C A;  4FT2 A;  4KGV B;  1WI7 A;  3VS4 A;  2CUD A;  4XU2 A;  1VQK A;  1WFW A;  3HRT A;  2HSE B;  2HAX A;  4C5I A;  4ELZ C;  5GAN f;  4M7D F;  3A8H B;  2FHD A;  1Y0M A;  4C0D B;  3FB9 A;  1D1A A;  2WSF E;  2RMO A;  5CKE A;  2V8K A;  3EG9 A;  2RHX A;  2ZPG B;  3BFM A;  3WVE B;  2F5K A;  1HSQ A;  2ZPF B;  3JRZ A;  1JXM A;  2Y90 A;  3HFN A;  2DXB A;  1KIK A;  4PJL A;  4M77 F;  5GAN e;  2DX1 A;  7AT1 B;  4PLI A;  1TS9 A;  2XIC A;  4XTZ A;  5LJ5 h;  3CXC A;  3OYI A;  4L6V 5;  3VYH B;  2BUD A;  4Y92 A;  4HVW A;  2G6F X;  4M7A F;  1RAB B;  2DBK A;  1I07 A;  3LW5 E;  1OZ3 A;  3CBP A;  1NBE B;  2EGE A;  1GCP A;  4ORZ A;  4MZT A;  1RAF B;  2CUB A;  1Q82 R;  2F2X A;  3CC4 Q;  1W2B A;  3QJY A;  1GBQ A;  3CC2 Q;  2P4T A;  2VGN A;  1VYV A;  4HVV A;  2SEM A;  2CYZ B;  2QEX T;  2QQA A;  2VB6 A;  3G71 Q;  5KYY A;  5DM7 R;  1WQW A;  3H0H A;  1K1Z A;  2M16 A;  4M75 B;  3ER0 A;  1W6X A;  1QVF S;  4JPB W;  1QKX A;  1IRE B;  5LJ5 g;  4DEY A;  4BY6 C;  3TQ7 P;  2CP2 A;  2FZK B;  4RG2 A;  2LX9 A;  1VQ8 Q;  1N8R C;  4J6Y A;  2HBP A;  5GAM j;  4A4K A;  1H92 A;  2HMA A;  3VU3 C;  3J80 E;  3M9Q A;  3CCJ T;  4GBQ A;  1M3C A;  1GL5 A;  1WIE A;  2GQV A;  2QQB A;  1XTD A;  3QSU A;  4PK4 A;  4EMG A;  2FZC B;  2GGR A;  5LJ5 f;  5GAM g;  2DL5 A;  4J7I A;  1PSE A;  1K9M C;  3I56 T;  1PD0 A;  1YP5 A;  3V7S A;  3RR6 A;  4RCC A;  2LCS A;  4GLM A;  1Q86 R;  1W2B S;  3V8L A;  4X9C A;  1WJR A;  2CKK A;  2RN8 A;  1Y57 A;  2WAC A;  4A4G A;  2RQU A;  1P92 A;  2JM8 A;  5J26 A;  4PFP A;  2GFU A;  4K11 A;  5ECA A;  2EBP A;  5CKD A;  3AHU A;  1VIF A;  4J9E A;  2MOX A;  3MEW A;  3HL8 A;  4M75 C;  3M55 A;  3QYH B;  1K9M R;  4GLK A;  2HZY A;  3EFO B;  3M59 A;  5GAN h;  1MUZ A;  2FB7 A;  3CCE A;  2YLB A;  3QBY A;  1X6B A;  4OML A;  2ZPB B;  1VQN A;  2BKD N;  3RES A;  3E9G A;  3CCE Q;  1BI2 A;  1UEC A;  1RAD B;  2MI6 A;  4JS5 A;  4PJJ A;  2V1Q A;  2V8I A;  2E12 A;  1SG5 A;  5DLQ E;  2LVM A;  1UEB A;  1WJS A;  1WXB A;  3L1A A;  2QQ9 A;  5GMK h;  4ZGD B;  3CEY A;  3OYG A;  1MMD A;  2LP5 A;  1UGQ B;  1VQ8 T;  1R8O B;  2QAZ A;  3HRS A;  5KYX B;  4OMM A;  1Y07 A;  3EH2 A;  4C0Z A;  3S3M A;  2JTF A;  2IG0 A;  1FXX A;  3OYA A;  2KRN A;  4KGZ B;  1GFD A;  1GCQ C;  1ZQ1 A;  2K6D A;  3H0I A;  1KD1 C;  1ZLM A;  2PVD B;  2YSQ A;  2O31 A;  2F2V A;  4EMK A;  2K5I A;  3INZ A;  4RTV A;  4RTX A;  1G5V A;  3JCM J;  3A8G B;  4OMN A;  5GAN 2;  2K79 A;  1KC8 U;  4IUT A;  4C5E A;  4ZTJ A;  2H3J A;  2P0K A;  1VQM T;  3WVD B;  1X2Q A;  4E7L A;  2QDY B;  5EC7 A;  4QVD A;  3VUB A;  4AG2 C;  4C92 B;  3SDZ A;  1TH7 A;  2LJ0 A;  1YJ9 T;  2D0N A;  4M77 G;  1O9S A;  4FYY B;  2FYK A;  1NLO C;  5GAN g;  1UHF A;  4HXJ A;  2H3E B;  2DIG A;  2O4X B;  1Y96 B;  3CCE T;  2HSP A;  1M3A A;  3DKM A;  3SB2 A;  4ZNX A;  2L8D A;  3OYC A;  1Q81 C;  2RK1 A; 
#chains in the Genus database with same CATH homology
 5GAN 4;  1KQ2 A;  4A53 A;  4II1 A;  4J8O A;  2QI2 A;  1OYX A;  2RD1 A;  2KY9 A;  3DLM A;  3N5B B;  4NL2 A;  2EIF A;  4XAX B;  1VQ6 T;  1M5Q 1;  2CZ1 B;  2D0Q B;  2LT4 A;  5LJ3 d;  3LWI A;  1M9S A;  4LD6 A;  3G4S T;  3OMG A;  2HQE A;  3SFM A;  4M7D D;  1VUB A;  3KBG A;  4LD9 K;  4RG8 A;  4M77 E;  2DTO A;  4FSX A;  4J83 A;  2OAU A;  1VQO A;  4QVC A;  5KCO A;  2CZ0 B;  1M4Z A;  2XG8 D;  4N0A A;  3HRU A;  4XQ3 A;  3OMC A;  2DD5 A;  3PIO A;  3OBW A;  1AHJ B;  2WSC E;  1K8A C;  1LJO A;  2MMP A;  4C0D C;  4C92 E;  1G3T A;  5CO7 A;  4F7U F;  3CC2 A;  2DO3 A;  4QQD A;  2RJF A;  4PJO F;  1MHN A;  5CCA A;  4ZN3 A;  2CZ6 B;  5A0D A;  2KDS A;  4PNO A;  1BYM A;  2DK3 A;  2AHJ B;  3QHS A;  4JLG A;  3JCM X;  1Q7Y C;  3OS0 A;  5GAM d;  1XNI A;  2LNV A;  2EJG A;  5LJ3 j;  2VYT A;  3OYL A;  2K57 A;  4C92 G;  4C8Q B;  4M78 C;  1HK9 A;  1MGQ A;  2E6Z A;  2O01 E;  4PJO E;  3WXM B;  2YLC A;  3RIR A;  3HHT B;  2X4J A;  3L2Z A;  3L42 A;  1X6O A;  2RA2 A;  2K4Y A;  1UGP B;  2DZC A;  2RHU A;  5GAN d;  1YIT A;  4IUV A;  4M75 G;  2JUF A;  4A4H A;  4C92 C;  1K73 U;  4TVR A;  4HCB A;  1M8V A;  2EQM A;  3O8V A;  3UT1 A;  5CK9 A;  3MHX A;  3RKX A;  4C8Q F;  2C06 A;  4IKF A;  5FU6 B;  3GLX A;  1VQO T;  3J7A F;  1YIJ A;  4PJO G;  3JB9 D;  2K5L A;  3ME9 A;  4LDY A;  3QKJ A;  3CXC S;  5C0M A;  3J81 E;  1G3Y A;  2DPP B;  3CC4 T;  3CCM T;  4XU3 A;  1ZHI A;  2QA4 A;  2E70 A;  3VJP A;  5GMK j;  3G71 A;  3CCR T;  3CD6 T;  3I55 T;  1XOV A;  5LJ5 e;  3TRE A;  3FRN A;  3JCM e;  1VQ5 A;  1U8R A;  3CPF A;  2E6N A;  3M53 A;  2E1H A;  4M7A G;  4Y28 E;  4C0G A;  2I2L A;  4WF2 A;  1VQ4 A;  3RKY A;  4OF1 A;  4F7U E;  3L2U A;  4C8Q D;  2EQJ A;  2LCC A;  5C6S A;  3PIP A;  2CS7 A;  3GNG A;  4M78 E;  3G71 T;  1I5L A;  1OI1 A;  4IUR A;  1H3Z A;  2R57 A;  3A8L B;  3OYN A;  5CAI A;  3OS1 A;  3LGF A;  3CCL A;  4M77 A;  3FLG A;  2HD0 A;  3CME A;  3OYJ A;  3S3O A;  5LL6 S;  4OB1 B;  2L89 A;  4M7A B;  4C8Q A;  3OYH A;  3F70 A;  5GAM h;  5GAM e;  1VQN T;  4C92 A;  3OB9 A;  3JCM W;  2DVE A;  2JVV A;  2RJC A;  1YBY A;  3OYF A;  1YI2 A;  3MEU A;  2OTL T;  1I8F A;  1QP3 A;  2QQR A;  3GP8 A;  2XD0 A;  4M7D B;  2EFI A;  1NJI C;  5LJ5 j;  1O75 A;  4HCZ A;  1NPP A;  4QW2 A;  4JRP A;  1YHQ A;  1VQ5 T;  4BAC A;  4BDZ A;  2L5Q A;  4J5Y A;  3RMQ A;  1WJQ A;  4KUI A;  2VUB A;  4O5V A;  3JB9 G;  4PJO A;  3LYI A;  2X4Y A;  1KG1 A;  2XU8 A;  5HK0 A;  1LOJ A;  2EYQ A;  4GY5 A;  3X24 B;  3L2W A;  2ZPH B;  3CCJ A;  2XK0 A;  3JB9 H;  2BIV A;  4RMO A;  4M75 D;  1VQP A;  1DJ7 B;  2D6F A;  2XDB A;  2F69 A;  2G3R A;  1UB4 A;  4MDW A;  1QVG S;  5D6Y A;  2LT1 A;  2HQX A;  4MZP A;  5FU7 B;  2K2V A;  2QXF A;  4QVZ A;  1VQ7 T;  4PKC C;  1Q81 U;  2X4W A;  4OB3 B;  3E19 A;  2ZPE B;  1N9S A;  4E7J A;  3OYE A;  1YCY A;  1VQ4 T;  1Q82 C;  2KQW A;  3PFS A;  3H8Z A;  3QPH A;  1VQ9 T;  2DEQ A;  2ZZD A;  4BE0 A;  3DB3 A;  4C8Q G;  2GF7 A;  1HXD A;  3E9F A;  2XHC A;  3OS5 A;  1VQ6 A;  5KE2 A;  4DA4 A;  2DTH A;  3BDL A;  3JCM c;  4X9D A;  4M7A D;  1M90 C;  1FX7 A;  2EJF A;  2KAF A;  5AYF A;  4XTV A;  3RMS A;  4E7I A;  1WGS A;  3P8B B;  4Q5W A;  4N4H A;  2RHY A;  3JCM b;  2DIQ A;  2O4X A;  4A4E A;  4V2S A;  4KBM B;  2MWP A;  5CKF A;  2ZPI B;  3JB9 J;  4KT0 E;  4ZGE B;  3C95 A;  4M78 G;  2JNG A;  5HK3 A;  3CD6 A;  3TEE A;  4BUG A;  5A0L A;  4PJO D;  1YJ9 A;  2CGH A;  2RM4 A;  3HKS A;  3GPL A;  1Q7Y U;  3P8H A;  2XDP A;  4PLL A;  3GF5 A;  3CBO A;  1XQH A;  3DB4 A;  3PMI A;  3VV0 A;  2F5T X;  1M1F A;  4M78 F;  1QP2 A;  3SWN C;  4JDS A;  3E1S A;  1OZ2 A;  3NTH A;  4O6J A;  1JB0 E;  2QTX A;  3ASK A;  2PVO B;  3CMA A;  3P8D A;  2E10 A;  4FIB A;  4LDW A;  2VV5 A;  1Q81 C;  5GAO q;  3CBM A;  1Y96 A;  3PTA A;  1N8R U;  2GFA A;  5LJ3 e;  3GOX A;  2FL7 A;  2R58 A;  4FM4 B;  5LJ3 h;  3GIB A;  2EWN A;  4C8Q C;  3KUF A;  3BY7 A;  4NOY A;  5I2S A;  4L59 A;  2JN0 A;  4IUU A;  4JRK A;  4BB7 A;  4M77 D;  3MP1 A;  4Z02 A;  4FT2 A;  4X34 A;  1YJN A;  3PNW C;  4JJN K;  3M5A A;  1QVG A;  2DZ9 A;  4N4I A;  4XU2 A;  1VQ9 A;  4OB0 B;  1VQK A;  1JRI A;  2QA4 T;  3CC4 A;  3LGL A;  2DTI A;  3HRT A;  3PMT A;  2LTO A;  1VQK T;  1YIJ T;  2HAX A;  3JAM E;  3NFC A;  4RCB A;  5D6X A;  4C5I A;  4ELZ C;  5GAN f;  4M7D F;  2OTJ A;  3A8H B;  1D3B A;  2FHD A;  4JUV A;  3CC7 T;  3A5Z B;  1ZBX A;  4C0D B;  4KUL A;  4ELY C;  3FB9 A;  1UGS B;  1LNX A;  2WSF E;  1BIA A;  4OP0 A;  1I81 A;  3TCJ A;  4DOW A;  5LJ5 d;  3PT9 A;  5CKE A;  3JCM d;  3FIF A;  4DQ2 A;  2V8K A;  4MML A;  4E7H A;  5J3B A;  2KK4 A;  4LDX A;  2QEX A;  4IUP A;  3QO3 A;  2RHX A;  2ZPG B;  4N4G A;  4OGE A;  1VQ7 A;  1YJW A;  2DD4 A;  1X01 A;  3BFM A;  3EAE A;  2F5K A;  3WVE B;  4C92 F;  2MF2 A;  3OW2 A;  3UPU A;  2M9U A;  4XTX A;  2MAM A;  2LQ8 A;  1N9R A;  5L8R E;  2K3X A;  2ZPF B;  4OGC A;  4M75 A;  5CQX A;  3UDC A;  3Q1J A;  2X35 A;  3JRZ A;  1KQS S;  4C5G A;  1B34 B;  4M77 C;  4BY6 B;  4JS4 A;  2Y90 A;  3V7R A;  3HFN A;  2DXB A;  3G6E T;  4D6W A;  4BD3 A;  3CME T;  3S3N A;  4M77 F;  3VYG A;  5GAN e;  1NPR A;  4Y91 A;  5GMK l;  5GAO l;  4JRI A;  4ME7 A;  5I2M A;  2DXC A;  4PLI A;  2YRV A;  2XIC A;  4XTZ A;  2EKO A;  4C0F A;  1WPY A;  2JOY A;  3M54 A;  3JCM h;  2PUK B;  5LJ5 h;  4L6V 5;  3VYH B;  3OYI A;  3C12 A;  2BUD A;  3CXC A;  1UGR B;  4HKE A;  4OVA A;  5GAO n;  5FRM A;  4PJO C;  3OQ5 A;  2XKO C;  4LDV A;  5KE3 A;  2WSE E;  2OTL A;  3GNF B;  3MP8 A;  4M7A F;  2X4X A;  4FT4 A;  4M7D C;  2HNI A;  2RJE A;  3OSV A;  1I4K 1;  1NZ9 A;  4ZN1 A;  1QVF A;  2VXE A;  3LW5 E;  4M78 B;  1YHQ T;  1OZ3 A;  1W4S A;  3CBP A;  5GAN 8;  5A2Q E;  1KD1 U;  3FC3 A;  4MZT A;  2DJZ A;  3L2V A;  2L3R A;  3I55 A;  1WNL A;  5CR2 A;  4BDY A;  3M58 A;  5GAO m;  1W2B A;  3EFS A;  5DY9 A;  4CRI A;  3QJY A;  4JLI A;  4N0A C;  2PU9 B;  3HPW A;  3HFO A;  3V8K A;  1YIT T;  3CCL T;  4XK8 E;  4A54 A;  2R5M A;  1NJI U;  2P4T A;  2VGN A;  4MZM A;  4M78 D;  1H64 1;  1M90 U;  3JCM P;  2M1H A;  2CYZ B;  4M75 F;  2RB6 A;  2JZ2 A;  3CCQ T;  1Q86 C;  2QEX T;  1KC8 C;  2D9T A;  2QQA A;  3OYM A;  4F7U B;  5LJ3 g;  1QW1 A;  5DM7 R;  3OSS C;  1WQW A;  2RI5 A;  5CIU A;  2K3Y A;  1RI0 A;  3UWN A;  5IAY A;  3OBY A;  4A4F A;  3I56 A;  2M16 A;  3C4S A;  5GAO p;  3NTI A;  4M75 B;  5HY6 A;  4FL6 A;  3ZEH A;  3MP6 A;  3ER0 A;  3LH0 A;  4E47 A;  3OYD A;  3LX7 A;  5IT9 E;  3BW1 A;  1Q86 U;  2OTJ T;  1QVF S;  4F7U A;  3L2R A;  4M7A E;  1KQS A;  3OS2 A;  1VQ8 A;  3CCU A;  1IRE B;  2Y4Y A;  3JCM g;  5LJ5 g;  2V8J A;  4F7U G;  3CCS A;  1YI2 T;  1Q82 U;  5KH6 A;  1N27 A;  4BY6 C;  2VXF A;  5GAN 5;  2EQK A;  3CPW S;  3OYK A;  4RG2 A;  3OA6 A;  2LX9 A;  2MWO A;  4J6Y A;  1N8R C;  2HBP A;  2IVW A;  4ZTF A;  2A3L A;  2VGM A;  2LQK A;  1VQP T;  1RL2 A;  3PGG A;  1VIE A;  2LC4 A;  5A0G A;  4A4K A;  1G3W A;  4OMF B;  5GAM j;  2LRQ A;  1D3B B;  1NE8 A;  5FU7 C;  3QZ9 B;  2DAQ A;  4MMK A;  4J6X A;  2RK2 A;  3M9Q A;  3SWN B;  3VU3 C;  3J80 E;  3CCJ T;  4HT9 A;  2GQV A;  3OY9 A;  3CCV A;  2QQB A;  1XTD A;  4BI3 A;  2GCX A;  2RO0 A;  4IUQ A;  3QSU A;  4EMG A;  4BI4 A;  3JCM V;  3JCM f;  4ZGJ B;  1N6A A;  5LJ5 f;  4J7I A;  1PSE A;  5GAM g;  3I56 T;  3CCV T;  3QJ6 A;  1K9M C;  3V7S A;  3RER A;  4XU0 A;  4RCC A;  4XTU A;  4HT8 A;  5DLO A;  1W2B S;  3FDR A;  3V8L A;  4X9C A;  1WJR A;  4EMK C;  4M78 A;  5HKC A;  1G3S A;  3QG1 A;  2E64 A;  2CKK A;  3M4Y A;  3OYB A;  1VQL T;  3JB9 F;  3URG A;  4M7D E;  2Y4X A;  4M77 B;  5FLX E;  2B8A A;  2DXU A;  2M0O A;  2WAC A;  1VQL A;  3ZBD A;  4XU1 A;  4A4G A;  4C8Q E;  5IN1 A;  1IZ6 A;  2P0P A;  4J7F A;  5CQY A;  1P92 A;  3CC7 A;  5GAN 3;  3CCS T;  3H6Z A;  2NLU A;  1X75 C;  3MCA B;  1JJ2 S;  5J26 A;  3KXT A;  4R56 A;  5CVI A;  4BE1 A;  3X28 B;  2GFU A;  1BIB A;  2KSS A;  4QQ6 A;  3G7Z A;  2RHI A;  2R5A A;  1YJW T;  5CKD A;  3JB9 I;  3AHU A;  4NS5 A;  1VIF A;  5KCH A;  3CCR A;  3HSB A;  3MEW A;  3HL8 A;  4M75 C;  3M55 A;  3QYH B;  4FU6 A;  1K73 C;  4GLK A;  3ZFJ A;  2ZGW A;  5GAN 7;  3M59 A;  5EG2 A;  5GAN h;  1K8A U;  4M7A A;  5I21 A;  1BKB A;  4BE2 A;  2FB7 A;  3CCE A;  2YLB A;  3QBY A;  1S72 T;  4ATO A;  3CPW A;  1BI1 A;  1Y7X A;  5D6W A;  3X20 B;  2QQS A;  4HA8 A;  5GMK i;  2ZPB B;  2DKG A;  4EMH A;  2BKD N;  1QVP A;  3FEO A;  3SWN A;  1VQN A;  3RES A;  3HP9 A;  3E9G A;  4XTY A;  1BI3 A;  2EQU A;  1YJN T;  1BI2 A;  4M7A C;  2RJD A;  4MDX A;  3M56 A;  2MI6 A;  3G4S A;  4JS5 A;  5GAN 6;  3QXE B;  3JSC A;  2V8I A;  4JRQ A;  5GMK m;  2E12 A;  1Y71 A;  2A7Y A;  5GAM f;  5DLQ E;  2LDM A;  2LVM A;  1B34 A;  1UEB A;  1WJS A;  2EAY A;  3A8M B;  1JJ2 A;  5GMK e;  3L1A A;  2QQ9 A;  4UC4 A;  3X25 B;  5GMK h;  5CKB A;  4ZGD B;  3CEY A;  4NL3 A;  2XDD A;  3OYG A;  3MEV A;  1GXI E;  4HCC A;  4LDU A;  3M57 A;  1BI0 A;  2KMT A;  3QDR B;  4PL6 A;  1UGQ B;  2E41 A;  1KHC A;  2YHT A;  4QQG A;  3T9N A;  1VQ8 T;  2JTM A;  1R8O B;  3R6O A;  3RKW A;  3OYY A;  2RI2 A;  2RHZ A;  1KQ1 A;  3BDU A;  3HRS A;  3V8J A;  1Y07 A;  1M1K U;  4C0Z A;  3OW2 S;  4B9X A;  3QII A;  3CC2 T;  3CCQ A;  3S3M A;  2RH2 A;  2JTF A;  4E7K A;  2IG0 A;  4M7D A;  1FXX A;  2K5F A;  3OYA A;  5FU6 C;  2CZ7 B;  4YTL A;  4C5H A;  1ZQ1 A;  4M7D G;  4CI0 C;  3G6E A;  2PQW A;  3L2Q A;  4EDU A;  5FRO A;  1KD1 C;  5FRN A;  2PVD B;  1SSF A;  1M1K C;  4VUB A;  4KUD K;  2P0Q A;  3MEA A;  3LWH A;  2KVQ G;  4EMK A;  3MET A;  3FJP A;  3JCM Q;  2K5I A;  3INZ A;  4L5G A;  3VKI A;  2PUO B;  1VQM A;  3TU4 K;  4PJO B;  1G5V A;  3CCU T;  1PSF A;  3M4G A;  3C94 A;  3JCM J;  1M1G A;  5GAO r;  4DOV A;  1WQ7 A;  3A8G B;  5GAN 2;  3QYG B;  4C92 D;  3QUI A;  4P5N A;  1KC8 U;  4IUT A;  4C5E A;  3RUX A;  4R55 A;  2XID A;  4ZTJ A;  1JBM A;  2H3J A;  2P0K A;  1VQM T;  3WVD B;  3QZ5 B;  5M9O A;  3CCM A;  4E7L A;  4M75 E;  2QDY B;  4QVD A;  3VUB A;  5CKH A;  1KHI A;  4XTW A;  1EIF A;  4OB2 B;  3SD4 A;  4C92 B;  2PVG B;  4RKU E;  3SDZ A;  3CMA T;  3S6W A;  1FWZ A;  3V7C A;  2XI9 A;  3NTK A;  1TH7 A;  1YJ9 T;  1K9M U;  3X26 B;  5GAN j;  4M77 G;  2DXT A;  3LLR A;  2E65 A;  1O9S A;  1U1S A;  3A8O B;  4B9W A;  4BI8 B;  3MO8 A;  4J6W A;  2FYK A;  5GAN g;  2O4X B;  2DIG A;  3VUZ A;  5J39 A;  2VC8 A;  1V29 B;  1U1T A;  1Y96 B;  2RI3 A;  2FVU A;  2ZCF B;  1S72 A;  3CCE T;  3DKM A;  3SB2 A;  3EFR A;  2EJ9 A;  3DLL A;  4EPC A;  2L8D A;  3OYC A;  2E5Q A;  2LCL A;  5LJ3 f;  2RK1 A;  4EMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...