4BJ4A

Structure of pseudomonas aeruginosa amidase ampdh2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
246
Chain Sequence
GAFMSSGPRLNTDYTSANQDSRVQFIVLHYTSTDLPHSLGILTHGGVSAHYLIGDDEPATVYRLVDENRRAWHAGVSEWQGRTWLNATSIGIEIVNQGYRDTPQGRVWYPFSEAQIQALIPLLKDIAKRHGITPDRIIGHSDIAPGRKVDPGPLFPWKRLADAGLVPWPKPGELARRLAELNGQLPDVRWFQQQLARHGYLVPQTGELEKDTRDVIGAFQMKYRPARFDGEPDLETAALLLAVPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPDH2
publication title Reaction Products and the X-Ray Structure of Ampdh2, a Virulence Determinant of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 70
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
A PF01510 Amidase_2 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 4bj4A02
3.40.80.10 Alpha Beta 3-Layer(aba) Sandwich Lysozyme-like Peptidoglycan recognition protein-like 4bj4A01
3QS0A 3UILA 2Y2DA 3UMQA 2Y2CA 3OGXA 1YB0A 3T39A 2AR3A 2F2LA 2WKXA 2EAVA 4OPPA 3O4KA 4ZXMA 2R90A 1EAKA 4KNLA 4G54A 3NG4A 3UMLA 1J3GA 2R2KA 4BXJA 3EP1A 1SK3A 2RKQA 2BH7A 3BKVA 4IVVA 3USXA 3NW3A 3CORA 2L47A 3C2XA 3D2ZA 2XZ8A 1SXRA 3HMBA 5CTVA 1AROL 3D2YA 2CB3A 3NNOA 1SK4A 5E0BA 4LPQA 3LATA 2Z9NA 3RDRA 4Q8SA 3CG9A 3QV4A 3RT4A 1LBUA 4BJ4A 4OUGA 1LBAA 1S2JA 4ORVA 5E0AA 3QJ1A 4BOLA 2EAXA 2Y28A 3T2VA 2Y2EA 4X36A 1L6JA 3BKHA 1Z6IA 1OHTA 3TRUA 4OLSA 3CXAA 4GF9A 4BXDA 2APHA 1TWQA 4Q9EA 4BXEA 5DWFA 4Z8IA 2F2LX 4FNNA 1YCKA 2Y2BA 2XZ4A 4KNKA 4BPAA
chains in the Genus database with same CATH superfamily
3QS0A 3UILA 2Y2DA 3UMQA 2Y2CA 3OGXA 1YB0A 3T39A 2AR3A 2F2LA 2WKXA 2EAVA 4OPPA 3O4KA 4ZXMA 2R90A 1EAKA 4KNLA 4G54A 3NG4A 3UMLA 1J3GA 2R2KA 4BXJA 3EP1A 1SK3A 2RKQA 2BH7A 3BKVA 4IVVA 3USXA 3NW3A 3CORA 2L47A 3C2XA 3D2ZA 2XZ8A 1SXRA 3HMBA 5CTVA 1AROL 3D2YA 2CB3A 3NNOA 1SK4A 5E0BA 4LPQA 3LATA 2Z9NA 3RDRA 4Q8SA 3CG9A 3QV4A 3RT4A 1LBUA 4BJ4A 4OUGA 1LBAA 1S2JA 4ORVA 5E0AA 3QJ1A 4BOLA 2EAXA 2Y28A 3T2VA 2Y2EA 4X36A 1L6JA 3BKHA 1Z6IA 1OHTA 3TRUA 4OLSA 3CXAA 4GF9A 4BXDA 2APHA 1TWQA 4Q9EA 4BXEA 5DWFA 4Z8IA 2F2LX 4FNNA 1YCKA 2Y2BA 2XZ4A 4KNKA 4BPAA
chains in the Genus database with same CATH topology
3QS0A 3UILA 2Y2DA 3UMQA 2Y2CA 3OGXA 1YB0A 3T39A 2AR3A 2F2LA 2WKXA 2EAVA 4OPPA 3O4KA 4ZXMA 2R90A 1EAKA 4KNLA 4G54A 3NG4A 3UMLA 1J3GA 2R2KA 4BXJA 3EP1A 1SK3A 2RKQA 2BH7A 3BKVA 4IVVA 3USXA 3NW3A 3CORA 2L47A 3C2XA 3D2ZA 2XZ8A 1SXRA 3HMBA 5CTVA 1AROL 3D2YA 2CB3A 3NNOA 1SK4A 5E0BA 4LPQA 3LATA 2Z9NA 3RDRA 4Q8SA 3CG9A 3QV4A 3RT4A 1LBUA 4BJ4A 4OUGA 1LBAA 1S2JA 4ORVA 5E0AA 3QJ1A 4BOLA 2EAXA 2Y28A 3T2VA 2Y2EA 4X36A 1L6JA 3BKHA 1Z6IA 1OHTA 3TRUA 4OLSA 3CXAA 4GF9A 4BXDA 2APHA 1TWQA 4Q9EA 4BXEA 5DWFA 4Z8IA 2F2LX 4FNNA 1YCKA 2Y2BA 2XZ4A 4KNKA 4BPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QS0 A;  3UIL A;  2Y2D A;  3UMQ A;  2Y2C A;  3OGX A;  1YB0 A;  3T39 A;  2AR3 A;  2F2L A;  2WKX A;  2EAV A;  4OPP A;  3O4K A;  4ZXM A;  2R90 A;  1EAK A;  4KNL A;  4G54 A;  3NG4 A;  3UML A;  1J3G A;  2R2K A;  4BXJ A;  3EP1 A;  1SK3 A;  2RKQ A;  2BH7 A;  3BKV A;  4IVV A;  3USX A;  3NW3 A;  3COR A;  2L47 A;  3C2X A;  3D2Z A;  2XZ8 A;  1SXR A;  3HMB A;  5CTV A;  1ARO L;  3D2Y A;  2CB3 A;  3NNO A;  1SK4 A;  5E0B A;  4LPQ A;  3LAT A;  2Z9N A;  3RDR A;  4Q8S A;  3CG9 A;  3QV4 A;  3RT4 A;  1LBU A;  4BJ4 A;  4OUG A;  1LBA A;  1S2J A;  4ORV A;  5E0A A;  3QJ1 A;  4BOL A;  2EAX A;  2Y28 A;  3T2V A;  2Y2E A;  4X36 A;  1L6J A;  3BKH A;  1Z6I A;  1OHT A;  3TRU A;  4OLS A;  3CXA A;  4GF9 A;  4BXD A;  2APH A;  1TWQ A;  4Q9E A;  4BXE A;  5DWF A;  4Z8I A;  2F2L X;  4FNN A;  1YCK A;  2Y2B A;  2XZ4 A;  4KNK A;  4BPA A; 
#chains in the Genus database with same CATH topology
 3QS0 A;  3UIL A;  2Y2D A;  3UMQ A;  2Y2C A;  3OGX A;  1YB0 A;  3T39 A;  2AR3 A;  2F2L A;  2WKX A;  2EAV A;  4OPP A;  3O4K A;  4ZXM A;  2R90 A;  1EAK A;  4KNL A;  4G54 A;  3NG4 A;  3UML A;  1J3G A;  2R2K A;  4BXJ A;  3EP1 A;  1SK3 A;  2RKQ A;  2BH7 A;  3BKV A;  4IVV A;  3USX A;  3NW3 A;  3COR A;  2L47 A;  3C2X A;  3D2Z A;  2XZ8 A;  1SXR A;  3HMB A;  5CTV A;  1ARO L;  3D2Y A;  2CB3 A;  3NNO A;  1SK4 A;  5E0B A;  4LPQ A;  3LAT A;  2Z9N A;  3RDR A;  4Q8S A;  3CG9 A;  3QV4 A;  3RT4 A;  1LBU A;  4BJ4 A;  4OUG A;  1LBA A;  1S2J A;  4ORV A;  5E0A A;  3QJ1 A;  4BOL A;  2EAX A;  2Y28 A;  3T2V A;  2Y2E A;  4X36 A;  1L6J A;  3BKH A;  1Z6I A;  1OHT A;  3TRU A;  4OLS A;  3CXA A;  4GF9 A;  4BXD A;  2APH A;  1TWQ A;  4Q9E A;  4BXE A;  5DWF A;  4Z8I A;  2F2L X;  4FNN A;  1YCK A;  2Y2B A;  2XZ4 A;  4KNK A;  4BPA A; 
#chains in the Genus database with same CATH homology
 3QS0 A;  3UIL A;  2Y2D A;  3UMQ A;  2Y2C A;  3OGX A;  1YB0 A;  3T39 A;  2AR3 A;  2F2L A;  2WKX A;  2EAV A;  4OPP A;  3O4K A;  4ZXM A;  2R90 A;  1EAK A;  4KNL A;  4G54 A;  3NG4 A;  3UML A;  1J3G A;  2R2K A;  4BXJ A;  3EP1 A;  1SK3 A;  2RKQ A;  2BH7 A;  3BKV A;  4IVV A;  3USX A;  3NW3 A;  3COR A;  2L47 A;  3C2X A;  3D2Z A;  2XZ8 A;  1SXR A;  3HMB A;  5CTV A;  1ARO L;  3D2Y A;  2CB3 A;  3NNO A;  1SK4 A;  5E0B A;  4LPQ A;  3LAT A;  2Z9N A;  3RDR A;  4Q8S A;  3CG9 A;  3QV4 A;  3RT4 A;  1LBU A;  4BJ4 A;  4OUG A;  1LBA A;  1S2J A;  4ORV A;  5E0A A;  3QJ1 A;  4BOL A;  2EAX A;  2Y28 A;  3T2V A;  2Y2E A;  4X36 A;  1L6J A;  3BKH A;  1Z6I A;  1OHT A;  3TRU A;  4OLS A;  3CXA A;  4GF9 A;  4BXD A;  2APH A;  1TWQ A;  4Q9E A;  4BXE A;  5DWF A;  4Z8I A;  2F2L X;  4FNN A;  1YCK A;  2Y2B A;  2XZ4 A;  4KNK A;  4BPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...