4BJ5C

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords PROTEIN RIF2
total genus 54
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj5C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5C01
3K6GA 4BJTA 3OWTA 4BJ5C 4BJ6C 3CZ6A
chains in the Genus database with same CATH superfamily
2V9KA 5BPIA 3CUQC 1W5TA 3I53A 5D5WB 4DNCA 4HV6A 3ZN0A 1GUUA 1JT0A 3ERED 1AKHA 3RKXA 1HKSA 1EKYA 2XB0X 1VQ7I 2K9SA 2Z9OA 3IWZA 4IQ4A 1YRNA 4FX0A 4L9NA 4PK4A 4AVPA 2FBKA 1PD1A 1MZBA 1YDIA 5JVEA 3OR1C 2CQXA 2ZC2A 3Q0WA 1ZHFA 1H88C 1AWCA 3A0BC 5M5XJ 4ZYGA 3LS1A 3J80Z 2DW4A 2W57A 3I64A 5D8KB 2OU2A 2XLMA 2ELKA 4U0VA 5B1BC 5H6QA 3H5AA 3DM5A 5IP9J 1XSXA 2DOFA 3X1OA 3M1EA 2BXZA 5GADJ 2X48A 1PYVA 3HXLA 4M3DA 4FCYA 3HNJA 1XX5A 4I09A 3R4KA 3ISPA 1O4XA 2DU9A 4XLEA 3IH4A 2F4MB 4HSTA 1AEPA 3G71I 1LVKA 2KL4A 2LQGA 1XZQA 2J9UA 2XS1A 1TC3C 1YJNI 1G5ZA 1OKRA 4DRHB 3RQIA 2NYXA 3RKQA 3ABUA 2DAOA 2LOOA 2LKXA 4XLPF 1ST6A 5BOXA 3QPSA 3DEEA 5CLSA 3WTZA 2NSFA 3ZQHA 5KAFC 3GTQJ 1XWJA 5COMA 4XOTA 1NK3P 3S93A 4ANJA 1KU2A 3G3ZA 3DJNB 3VFZA 5F1JA 2DJNA 3HOTA 2E5ZA 3NG1A 4RDUA 2OJED 1SAUA 3NAUA 1N75A 1YA9A 1QNTA 1C03A 2YRFA 3ZQQA 3H3UA 4DBQA 2NS7A 4KNYA 3GWZA 4LD5A 3V7RA 4I7HA 4BU2A 3EGXB 1MBJA 3DMDA 2F6CA 3QQAA 1QVUA 3GZ6A 2CGEA 3FMSA 4U5FE 4KMUX 4A3IJ 3FVYA 4JKVA 2GQQA 3H2VA 2HFIA 1OQCA 4CIHA 2QNLA 1BW5A 5J3LA 5HDGA 3PDMP 4JQFA 3EJNA 2Y9YA 1QHGA 3NQOA 1MD0A 2VBXA 4XEVA 1D3YA 4MTDA 2AHQA 1ZHXA 4FQGA 2I8DA 1V3FA 1NLXA 2LSEA 2XUBA 3OS0A 4AL1A 3P7NA 2W00A 2R7OA 1KU3A 2C04A 3CCEI 3B0UX 4M9SA 3FOPA 3HLZA 3K0LA 4CGZA 5M5YJ 3A2KA 4EEFG 1FMVA 2UV1A 3K4LA 3KP7A 5KAIC 3WTTC 3C8GB 3R6SA 2M34A 3GM1A 3U2MA 1PDNC 2HJ3A 3BR3A 1FLIA 1EA8A 3VYSB 4S0HB 4XN0A 2VL8A 5T3WA 1HC8A 2O6GE 3CUOA 1QQ3A 2MH2A 4KYWA 4I1OB 3DPLC 4AYBA 1H8AC 1D8KA 4DBRA 2ECBA 3KLOA 2Q1ZB 1OKKA 2KGOA 3S0XA 2HU9A 3IH3A 3ZMDA 4LLNA 2K9MA 1KNYA 5F0HA 5DV5A 3L00A 3TP3A 1IN4A 4BY1J 1QU3A 1VQ9I 5IYCJ 4HEAJ 5F5FA 2OOCA 1D0XA 3SXYA 2LK4A 3MZYA 1D1CA 3FWEA 5DQTA 1GQAA 1LDDA 4DYRA 2G62A 3ULQB 4HF2A 5E3AA 4J30B 1MNDA 4NTAA 5K1YA 3VAYA 3CJRB 1WATA 2GLOA 1Y6DA 3ZWIA 2GOXB 4O3MA 1YI2I 1WGXA 1BOBA 5C44J 2EIJC 4ZLCA 3OL3A 1LJ9A 2DDAA 2AXLA 2OKUA 3FXHA 1POGA 2I15A 1U6GA 1V74B 4YRVA 1TWHA 2XXAB 1U9NA 3RYLA 4IAQA 1YYVA 1CGME 3AG2H 4ZYAA 2AP3A 1ZU4A 3QRFF 4YN0B 2X6XA 1SFXA 4P55A 2GAQA 5K7FA 5D8LB 1K79A 2L9VA 3TQNA 3PO3J 1FEXA 1NU9C 3EFOB 3BR2A 4QPOA 1X19A 4FASD 2LP0A 4IOCF 1Z91A 3BJ6A 3GWNA 1BR4A 4MQ9F 1I3AA 1M6TA 3BJAA 4QI2A 4FAPB 1TNTA 2EA2A 4F93B 5L0DA 2XV4S 1BC8C 5B1BH 5FFXA 3S16J 3BP8A 3LL7A 2YLIA 1EH7A 3K1NA 3KP5A 3M7GA 3QAHA 4CS9A 2JRTA 3EPVA 4Q48A 4AVZA 1JJ6C 1XTAA 1GXPA 1NFNA 3C8GD 3WU2C 1CGPA 3LUTB 1QRYA 2K4JA 3HDDA 1S05A 2XB5A 1OCTC 2Q9CA 1U8BA 2DQRA 2QENA 1E2XA 4B09A 1FBQA 5J1YA 5E18F 3ZSUA 4J19A 5DD4A 4IGGA 2KRCA 5D5XB 2VQHA 2IS1A 5GTIC 2DA5A 5K5RA 1OCRC 3T9OA 1WPKA 2CW8A 1SFEA 3ESWB 4WJ0A 1OR7C 2R92J 1XMKA 2J7PD 5JP7A 4IARA 5E79C 5J40A 1YYJA 2E35A 2QBYB 2GIVA 3K4BA 1G2HA 4IWBA 4PDKA 1BIAA 3KP4A 3L2QA 3M79A 2P8TA 3TGNA 4BHPA 3GZNB 5JHFA 1ONVA 2PJRA 4BEHA 1HLVA 3ZQYA 2EPOA 4ENMA 2ETHA 4U88A 3ATPA 2MWQA 3JSZA 1IDYA 2Y0MA 4IJJA 3SDBA 3JCUC 1USSA 2A6TA 2ZCWA 3HOYJ 3GM3A 1M56C 3K69A 5L3DA 3LWFA 4MIMA 2Y3HA 5F28E 4M6VA 3OSFA 2XSEA 3SFZA 4DXWA 1XGSA 3US6A 1Y56A 3QVZA 3TOMA 4IPAA 3MFKA 4M9XA 4GCVA 3BLYA 1ZKGA 3BQYA 2K5CA 3JTHA 4RAZA 5LEJA 4XKWA 4KDPA 1P92A 3G50A 1V5GA 4ZZDA 5LHIA 3O55A 1WJDA 2PI0A 2A5WA 2L9NA 2M30A 3HBLA 3BWGA 1RRJA 4XMYA 5E8GA 3MAJA 5L0JA 4NC8A 1G59A 2J5PA 4AX2A 2YEVA 1Y39A 2L9SA 4XK4A 3JRHA 1ETKA 4CYCA 5ICEA 4ESJA 2VODA 2Y69H 1J9IA 5C4JJ 1MMNA 1RKCA 2XGEA 2VQLA 3LSPA 3D1NI 2XSJC 4LK0F 3TJ6A 1KTMA 2LCHA 2X6WA 3F23A 5DD8A 3WTWC 2O61A 4E0HA 1Z67A 4CO8A 5COGA 3ABMC 1VMAA 4IJAA 5IYBJ 4Y52J 2K9LA 1R5HA 1R00A 3K7AJ 1OMIA 4U5HA 2X0CA 2BVLA 1E84A 2LG4A 1S72I 3JYYA 5LGNA 2PX0A 3RFYA 5E3CA 3VB2A 3V7CA 4HZFA 2IGMA 2ZMEC 3MCZA 4HLYA 3RZDJ 1P4WA 4II3A 4D1QA 1YIJI 1I5NA 3DE8A 2PF4E 2M9HA 3CCRI 2F5EA 1R5GA 4AIDA 3H5RA 3RZOJ 1JAFA 5EG0B 4N0BA 3B29A 2IS2A 2Q2EA 1NSGB 3NYMA 1QHHD 3AAFA 1FTZA 2E7XA 4MO7A 3L0IA 4BYYA 2JN6A 1CGNA 1YZAA 2KYHA 4ESBA 3JW4A 3S28A 2L9JA 2NNNA 3NEUA 3LLIA 1XDUA 4XR6A 3T8RA 4JEAA 2LH9A 3REOA 4CH7A 5IT3A 3D5LA 3MWMA 3IC7A 2L6HA 2HZDA 4II2A 5GAEJ 5DYMA 3QYBA 2VJ5A 2YPRA 1HKQA 5B1AH 1B6AA 1TW3A 2JSCA 1IUYA 2A68F 3RVYA 2XAUA 3E6MA 3RPUD 3K6GA 4HNUA 3GFIA 2NPUA 4WXCA 4MVMA 1T33A 2KDZA 3ABLC 2BGCA 4OAYA 2OPTA 1FFTC 2RREA 3CF5F 4HFKB 3RDIA 1G6NA 1ETOA 4C3HJ 1ERDA 2IS4A 3QTHA 4Z9IA 2Q8KA 2I10A 3OYAA 4CCKA 5GTHC 2EIMC 3KCCA 1FBUA 2P1AA 2BYVE 4M3GA 2A6HF 4XKVA 3LOCA 4HYEA 1ZRDA 2W24A 3OYNA 4K2EA 3TQOA 2J9BA 4M6XA 3S1MJ 2E2IJ 4QI0A 1IV8A 3OYGA 3O39A 1T9KA 4KC9A 3ECSA 4EJVA 1TT5B 3PIPF 2CNWD 4W97A 4A6DA 4M63A 1R23A 2XKPA 3FF5A 4E7LA 3ZQVA 1F4KA 4CCOA 3DTEA 1MSEC 3DXJF 2M7BA 1YIOA 1X1CA 2LBFA 4G6TB 3M3YJ 3W6JB 2CMPA 2OA4A 5C4XJ 1MQVA 1I39A 3PUFA 4EV0A 3L7WA 5E2QA 2P0WA 4X1EA 1L0OC 4C3JJ 1UB9A 1OCOH 2WV1A 5F27A 3WHBA 1ZHWA 5IP6A 1A04A 3HZJA 2YKZA 5HS9A 2TCTA 3MYFA 1F9NA 2XLVA 3B6AA 5BNGA 1WGWA 2QZ8A 3O8HA 2NOGA 4NDLA 4A3GJ 2A1DD 2WAQN 4KUMA 3AL0B 4DQ2A 3ZRGA 3PFYA 4FWVA 3P9CA 2YUSA 4PGHA 2A5YB 4TV7A 1MBEA 5JSLA 3C18A 1G3SA 1T56A 4I02A 4M3EA 4CSAA 4F55A 4JYKA 1JPJA 2DFFA 4MVZA 3HKZN 4HX4A 2OG2A 3EYYA 3ASNC 2KIUA 1VOMA 1KYWA 4HNTA 3RQEA 5IY5C 2DO7A 2L4AA 3TK0A 2ELHA 1Z05A 4IVNA 3UMKA 4FTHA 5EF6A 2PX3A 2FXAA 3B9QA 2H1KA 1IZMA 2V3CC 1IG7A 4JRZA 1AA7A 3HRMA 3HM5A 3SEOA 4F7ZA 4OIRF 1ENHA 4UHTA 4MHGA 2K40A 3E97A 4DIQA 4ZYHA 1ETVA 5LRRA 1UFMA 3RCOA 4UY8I 4I1MA 3HGGA 3FKJA 2RD9A 2HQNA 2AVKA 1ZHYA 4MEYF 2R0QC 1MDMB 1WHUA 2Z16A 3GEHA 5B3SH 2FOKA 4Y4RA 3OEOA 3LSHA 5F1RA 1UG2A 3F3XA 1B8IA 2BOLA 2VIXA 4HV5A 4JW1A 3S2DJ 1T38A 1RJ9B 5HV9A 4C3EA 4LGWA 4MFDA 2STWA 1AU7A 2M45A 4BGDA 3H3VK 3RQGA 2J45A 2G3VA 4BJ1A 3PM1A 3BDDA 4HPQA 5F6FA 3UKGA 2K02A 2VH3A 2W45A 2QE9A 2ME6A 2HXOA 2ME0A 2HPIA 3PFIA 2FF4A 1J5YA 3G1MA 3AJMA 2G7HA 2XKOA 2M64A 2X1DA 2ZXWC 3ZQLA 4LMYA 1BR2A 2AQFA 2ZJ2A 5D6EA 4F3QA 3RKWA 2E87A 3RH3A 1HW1A 3ECOA 5CQGA 1BI3A 3IQ6A 3VRCA 1D8JA 3HIFA 2NUTA 1VB5A 2MYSA 3GVAA 3U3BA 1EH8A 3DE9A 2P61A 3CSKA 1LKXA 4R79A 1N25A 2MA3A 1R58A 3T5XA 2XGXA 4OOIA 3TO7A 3H65A 3MZHA 1BM9A 1Z7LA 5CI8A 2DPUA 1WJ5A 5D4RA 4Q7CA 1TNSA 2O03A 3V42A 3KZIC 3GODA 5DVWA 1LI5A 5LRSA 2EJRA 2WB1N 2RN7A 3S2WA 3F9KA 2COMA 256BA 4HE8D 2BEOA 4XONA 1MBFA 5KYWA 4AU7A 2QKMB 1FMWA 3P9KA 4PJLA 3H5NA 1SEUA 4ENJA 3PSFA 1VQKI 2HMQA 4RB2C 1WH5A 4AYBN 5JS5A 1VQMI 5KYUB 4XRFA 3VPRA 2M87A 2LTPA 2EZIA 5E1ZB 1QGPA 5LHHA 4CS7A 1T6SA 2J5OA 2CW0F 4LJZF 3U9MA 4YT5A 2RQQA 3IRQA 2HWVA 3UGOA 3B73A 2EH3A 3COAC 2DMTA 5FKNA 4PJMA 5H2FC 3W8HA 4B48A 1HQCA 2YSRA 5HDNA 1YLMA 2F22A 4FE4A 1V5FA 5DDGA 5IP7J 1ZLJA 1YFHA 3Q9SA 4EGZA 4A3LJ 3ZPLA 1A36A 4EKWA 3KETA 1R6RA 1PVEA 3N4MA 2CV1A 2M4KA 3G2BA 2UXNA 2O7OA 1CF7B 1ORYA 2ISZA 2KIFA 5GPAA 1FJLA 2XPUA 3RQ4A 3S1RJ 1OR7A 2VPLA 2IYLD 1H89C 1QQIA 1Z6TA 1I27A 4LIVA 2X4HA 1FIPA 1FTSA 5KYYA 3AGUA 1B72B 4BEHB 1DPUA 4HX7A 5EGOA 1Z3IX 4KISA 2DMUA 3ZP5A 4JK1X 4IOAF 5TJJA 4BE1A 4N4WA 1UHWA 5AIPA 3JSEO 1MIJA 4MLOA 2CYDA 4IHYA 3BY6A 3Q6NA 3MBGA 4HBLA 5ILVA 1CPRA 2MC4A 4XLCA 4S05A 3KP3A 3RTRA 1ULYA 5CVIA 1UG7A 3LSTA 5FLXZ 3M4CA 2KRHA 3J7YJ 4NQWA 4F52A 2HTSA 3SJMA 2E36A 4YJWA 3GMEA 4Y17A 4V19K 3DCFA 4AIHA 2WVQA 1JI8A 1I50J 2JUGA 3GUDA 1TR2A 3ZIBA 1SVOA 1W5SA 4DVYP 5FO5A 2BBYA 2X9DA 3K4JA 2V1DA 3ZOBA 3SXMA 2V7FA 3A0HC 1YW8A 1RNLA 1OXBA 4ZDOA 2DOAA 1QSPA 2AU5A 1Y0UA 5J1UA 5KCMA 3E70C 4JCZA 3K1PA 1HY5A 4IRGA 2DTRA 2NVYJ 2MG4A 2AO9A 3N05A 4DYQA 3CLQA 2GOMA 2OU6A 2HKOA 3H36A 4OMZA 3ABMH 2L0KA 4ESFA 1C0WA 1ZHTA 4JEBA 1QVXA 1SD5A 1FPQA 4H4KC 2XAQA 3BTLA 4EM0B 1QPUA 2PBIA 4JIOA 3KZZA 1DDNA 2FSWA 3D0SA 1Z6RA 3FX3A 2COBA 3CESA 2A07F 3M15A 4O79A 3SNHA 4ZLDA 3H0DA 2QLAA 3J81Z 2R7DA 3H35A 1LQ1A 2R5YB 4BACA 1Z63A 3I4MJ 3RJPA 3PNTA 3Q0UA 2EFWA 3WTVC 2NVXJ 2UUZA 2EFPA 1TTYA 1QZZA 2M4GA 2DYRH 1OJLA 2KJCA 2OF7A 2W4SA 3A1YA 1BA5A 2HSBA 3DJUB 4YG2F 4UUTA 3EH1A 3J7ZI 2VXZA 2GIZA 3A02A 3BTJA 1HW2A 1Y4CA 1GXQA 1WTYA 4OINF 1OW7A 4KMFA 5BMZA 3ELKA 3TW7A 3H0GJ 3AG4C 4ZH4F 1J8MF 2QQ8A 2EILH 2R7TA 2LY9A 2B9SA 2QEXI 2DFEA 2W7NA 2NSGA 2V4JC 4WXHA 1JT6A 3MD2A 1U8RA 2P0NA 3WU0A 1RESA 1DQUA 2DDBA 4CSWA 5A2QK 3H1CA 1K78B 5L0FA 2G9WA 4I0AA 4WXDA 4MTGA 3NMJA 2HQRA 5C3EJ 1QZYA 5JHUA 3EFOA 2OQGA 2OUMA 4HEA2 3GWLA 2HQ5A 2DYSC 2L02A 4DZJA 1S5LC 1Y6IA 4IHVA 5HSWA 2V1UA 1H9GA 4NTFA 3IKVA 1HF0A 4I99C 4CDAA 2QQAA 4WGZA 3EETA 2OV7A 2H6CA 4ZTFA 2Q00A 3ZQCA 3AQBA 5D5UB 1OCPA 3ASOH 1VYKA 2ZO4A 4GXOA 1LFUP 1OW6A 4A6EA 3FDYA 4LK1F 4LDRA 3RKYA 1IRGA 4KA4A 3EHMA 4EBJA 1MJ9A 4BJ5C 1FFHA 4RBOA 4HDUA 2LD6A 3BPVA 3PMRA 1X58A 3WGIA 4CA0A 3J81K 1QZXA 4DRJB 1JOGA 1ZW3A 3U1DA 1NTCA 1U78A 2DLLA 4HX8A 1AVOB 3RW0A 2VUMJ 1L3PA 4XIDA 3S3NA 1OFCX 3C2GA 2HZ8A 4O6NA 1KU9A 4RGSA 3S17J 2E1MC 2KLOA 4PUSA 3SHFA 3ZR8X 3I56I 1M1EB 2G0EA 1JKPC 2KSFA 5HS8A 3S90A 4NHJA 3B71A 5JVTA 3HOZJ 1X1DA 5J8FA 3GW2A 4JBAA 3HOVJ 3G4ZA 4ZZLA 1YQAA 5ILSA 2PJRB 1O87A 2EPKX 2FFHA 2L7ZA 4EM2A 5T3TA 2XGDA 2JVHA 3FHDA 1FOXA 5EJCA 4EJUA 2JK3A 1ZELA 2CW7A 3HOSA 1D1AA 2HS5A 3QU6A 1CQTA 3KEYA 5EGYA 1UMQA 5L3GA 2DYRC 4CCMA 1E86A 2M1BA 3PJRA 1MMDA 4QIWN 2ZJRF 1EKEA 4KIBA 1GVDA 3UGPA 1LPEA 3BG9A 3HHHA 1U3EM 2JA6J 1YO5C 4L0YB 2EPLX 4JE9A 3C1DA 2DXIA 4OIQF 5COFA 5FCLA 3BR0A 4QLCU 2ZXIA 3CDIA 1J8YF 5L3FA 1IRFA 1J2XA 5DCMA 1YS6A 1T5OA 2ZFWA 1TW2A 1W36D 2EFQA 3HRUA 1MDMA 1HA8A 3KH2A 2LREA 3HTUA 5LFAA 3BZKA 3FXLA 5A69A 1RPWA 4YFKF 3HL2A 2VJIA 3POVA 2MH9A 4KN4X 1FIAA 2X1CA 4I6ZA 3NYLA 1MGTA 3IKTA 4BE0A 2EPMX 1X4OA 2MD5A 1IF1A 3K2ZA 2B7EA 2E71A 3FHZA 1ZG3A 2JJ7A 4FHTA 2VC9A 1UELB 4E17A 1YG2A 5ED4A 2HFHA 1OYIA 1SMYF 1V4AA 3DTIA 4E7KA 2LDUA 1TQMA 4ETSA 2RC4A 4GYGA 2WB7A 3E0JB 4P1WA 4MW8A 1W7PD 2JMWA 4G6QA 2GFHA 2XGCA 3ABTA 2V6CA 5F0FA 4IQJA 3ZTZA 4M9ZA 3LSRA 2C03A 1T0FA 3TBIA 3O6XA 3ZQGA 4U5EE 2H8RA 2LR8A 1UAAA 2Q7RA 3HRTA 2DFHA 2XPVA 4WK8F 3OL4A 1K40A 2VKDA 2ZPAA 3NMKA 1E83A 1EH6A 1G4DA 3NARA 4C9YA 4KITB 1S8NA 2Z2SB 1TLHB 4YFNF 3IPMO 3IP4B 2NUTB 1YARO 1S9HA 4PGGA 1TZLA 2PMUA 2XROA 4N9HA 4EJOA 4ZTJA 4R1HA 1I4YA 1KYZA 1QPMA 2A3SA 3DLLF 2H8AA 2Y39A 2LD5A 1T6IA 2HDCA 2NS0A 2J9VA 4W8KA 4D7MA 2LVSA 4DVZA 1ZYRF 3GXOA 3CMYA 2KJBA 2R7FA 3JYHA 3KKBA 2YLGA 2Z99A 4HQMA 3DKXA 2KKOA 1ETWA 1P7IA 4MQVA 2ZXWH 1RCPA 4J7TA 1DU0A 3WAQA 2HI3A 3ZMSA 1XS9A 1QA6A 2D5RB 1R4MB 4EMSA 4BBSJ 4LB5A 2LRDA 3GBGA 3CDLA 1YTYA 3E3VA 3DWLE 1E3HA 5IY5H 5TJ5E 2X51A 3V5XA 3HOWJ 4F92B 4G78A 1FWZA 4U5BE 2OQMA 2DGJA 5FKOA 1BI1A 1SZIA 4CDGA 4EIYA 4UUVA 1FX7A 3A03A 1OYWA 3F8NA 5HLGA 2QSFX 1SC7A 1JE8A 3CMMA 3VM6A 3H9JA 4IL6C 2ACJA 3RYRA 1M57C 5L0IA 1I1SA 3JRFA 2XPWA 4IZZA 3G4SI 1VQNI 2HYFA 2CQNA 1RKWA 2VJ4A 2L6FA 2MD0A 4E6KG 4O6MA 4YIFA 1IV6A 4BKXA 4E7HA 3IEEA 1R36A 1NH3A 4AE4A 2D1VA 1EV7A 4BQQA 1KQ0A 3Q9VA 2A0UA 4LDQA 3CCLI 5IOZA 2RNGA 3ABKC 2PG4A 3AGTA 4I2OA 1XPXA 2KRFA 3QOPA 1B72A 2JA7J 4OIOF 4BHBA 2XS8A 3K1IC 1DGRM 5ERIA 3TDUC 5D4SA 1QBJA 4JP0A 1HSTA 2WC2A 3I9V2 4ZDPA 4L18B 2ZNZA 5LGUA 1ZVZA 1P7JA 2KP6A 3HUGA 3JR9A 3SXKA 2L54A 3E5QA 3W2VA 2N8GA 5J4YA 3EZIA 3JRAA 2DQLA 1IUFA 4MS2A 1ITYA 1YS7A 3EDPA 1L3LA 2ZXOA 2EZHA 2O0YA 2PMHA 5IT9Z 1J59A 2KIMA 1PUFA 4JJGA 5HVQC 1VF9A 2KNHA 3N24A 3ZQFA 4CYCB 3R0AA 1NBBA 4IHTA 2NS8A 1A7VA 1SD7A 3FMQA 3QPTA 3CCJI 4BPMA 2IGKA 5HNFA 2HEOA 2M7AA 3MEXA 4JX5A 3W3CA 2XSDC 3OWTA 3HSRA 2Q9BA 4I44A 1B1BA 2EINH 1O57A 3PNYA 3RPUA 3GFLA 3ZN1A 4D9JA 4YL3A 1IN6A 1MNMC 1I5ZA 1LVAA 1UZCA 3HJEA 2BW3A 1YX5A 2EV0A 5DUIA 3CP8A 5E1WA 2WWYA 1HMOA 2PN6A 4BBRJ 2CV0A 4CHUA 4RAYA 2HOTA 5B3IA 3WG7H 2WTEA 5EEAA 2YZSA 5KYXA 3ZVRA 5K7ZA 2HV6A 3GTGJ 4EM1A 1ZGJA 5GPGB 2HDWA 3CP2A 3I59A 2O8XA 3CC7I 3CF2A 1RETA 3ZQIA 5FLVA 2LFDA 1ZLKA 4MVQA 3LSIA 4KICA 3IV5A 1ORSC 3CTAA 2EQRA 1BIBA 2R3SA 2PFBA 4O5VA 4U0WA 4K1OA 1GGQA 3JAMK 4K7BA 3H9GA 2XC7A 3LLKA 2JD3A 3W6VA 5EYRA 1OQYA 1X1BA 3GFMA 4MTEA 4PSXA 1RJ9A 5KK1A 3ZMTA 4ABZA 1A31A 2DODA 4F4BA 1RR7A 4U5GA 1FYKA 2L9RA 2D4UA 3BJOA 2HVRA 4BE2A 2GWRA 1I4ZA 5K5QA 4P9FA 3KYIA 3G1LA 4HDVA 3D5SC 2M2EA 4B1RA 2NXNB 5BQTA 3CCSI 2VCBA 4R32A 2ZNYA 3MFNA 2KQRA 1ORKA 1WCMJ 3ZTMA 4BJ5A 1KONA 4P9UA 1GT0C 3S84A 5B3SC 3F8BA 5HNHA 4XRMA 3CMEI 4KNVA 3DU6A 1NFOA 2LY2A 3GTKJ 2P7VA 1W2WA 2XVCA 2PJPA 4HNVA 2XXAA 3KE2A 2YL0A 3DPTA 2EPFA 3ZCOA 5CVJA 1YHQI 2P7VB 2JUCA 4ZJZA 5TGTA 2DPDA 1FY7A 3PQKA 1LFBA 1Z5ZA 1FP1D 5K7HA 3LEVA 1TWCA 3NRVA 3PQJA 2CYYA 5HOOA 2RAEA 4IHSA 4DRIB 4YT8A 3VOEA 2H6BA 3TOLA 2RGVA 1A5JA 3T4RA 1MH3A 2ESNA 4XN3A 4PFOA 2UUIA 3DPUA 4WF2A 1VFCA 1OCRH 4Z6YA 2QWWA 1MBHA 4XTKA 3JTLO 3BG6A 3ZMUA 3AQCA 2CUZA 4GQHA 4FX5A 1MW7A 2CWEA 3DU5A 3F8CA 1JHFA 5KYNA 2VOPA 3MVPA 3VYTB 2VQGA 3K33A 2R5ZA 3M07A 1SFKA 4LLGF 3TW6A 5J1RA 3ITFA 1LS4A 2Y31A 4QSHA 2WL8A 2XL6A 1I6HJ 2V9VA 3DQVC 2R5ZB 3WHNA 2LF7A 4DYCA 4A5NA 2JVGA 1WWPA 2RSEB 5EK0A 2F2EA 4PFPA 1TQPA 2EFNA 1F36A 3I5PA 1FR0A 3LS0A 4UUSA 3BEHA 2FUG2 3DEWA 2CUEA 1XGMA 4M3BA 4J7YA 2K7LA 2HTJA 3SQNA 2H7OA 2CG4A 2IOQA 3UR3C 4AIKA 1ZTRA 2E1NA 1OW8A 4XEKA 1FT9A 2G7UA 4MTOA 1HE1A 4C3DA 4RAGA 2Y3DA 2CDQA 4D4NA 2UZKA 2R93J 4WX9A 2WZLA 4CX9A 2GA1A 3AL0C 1BBHA 4CBEA 1GLNA 3AG2C 3ML6A 1O3RA 3S1NJ 1A0BA 4ON0A 5AIQA 3K9TA 3E5UA 1K6YA 4XL9A 4BJ6A 3WTUC 2HZTA 4MFEA 1XC5A 4BY7J 4ULWA 4QTRA 1TP4A 3TKYA 3S8PA 4CYDA 4A93J 1FP2A 3GM2A 2W85A 3BTCA 4A3DJ 3SYNA 1PD0A 3LQQA 3HNKA 1HDDC 3IAS2 1O3SA 1D5YA 1WJAA 2LKPA 1YZCA 4YL1A 2NVTJ 5CIVA 2YR2A 1FBSA 2H1LA 3M4OJ 4B3AA 3RSNA 3S9OA 1VNDA 5FFZA 4CZCA 3TP0A 1T6UA 1A35A 3NWSA 5FGMA 5FRNA 2K3FA 4NQWB 1TWAA 1LDJA 3G1OA 2EK5A 2XAFA 2E60A 3JREA 3L2VA 2VI6A 3BG7A 3E1SA 3S3MA 2EILC 5F5HA 2AQEA 3ZMVA 1GV2A 2CFXA 4OAZA 3LJBA 4RMNA 3FAPB 2Y0SA 2E2HJ 3GTJJ 3HKKA 3KMIA 5DQZA 1IXRC 1OCZH 2FNPA 2H27A 3I55I 4HRIA 1B59A 1RKEB 2VLAA 1ZQ3P 3QWLA 1B9MA 3BOQA 1C02A 2PP4A 2Q9AA 1JHHA 1UJ8A 4D5FA 1B8IB 4Y7NJ 3T6BA 4A5MA 3X2QH 4JVSA 2GM4A 2P5VA 2WY8Q 2G3KA 2DFIA 1R22A 1U0JA 1W0UA 1JMWA 2Z1DA 2WAEA 4FISA 1BZ4A 1IN5A 1X3UA 4BHCA 3AG3C 3SFIA 3KYJA 2M4EA 3DKYA 1C17M 1O7FA 2FRHA 1XGNA 3JAMZ 3JRBA 1ZREA 2FEZA 3HTSB 3QMKA 3H3ZA 2IXOA 2YL7A 1LM3B 1EF4A 2DMNA 2E1OA 2F4IA 2FMYA 1BC7C 2VBYA 3LA2A 1IRXA 2ZMEB 1D0YA 3QP6A 2Z33A 5IT9K 4IEJA 1B68A 1Q0FA 1ORJA 3LESA 5AC5A 2EFOA 1VLSA 3VYWA 1H9TA 5EEGA 4A2NB 3DM9B 3JRTA 5BQGA 3A11A 4UV9A 1K4SA 2W4MA 1Z23A 2F48A 1VTNC 1UG0A 1WOLA 2J46A 2LMDA 4ONSA 3CUQA 3OIPA 3BR5A 2QUFA 2LY1A 4A0YA 3HEFA 4L9VA 1AUEA 2CU7A 2E1MB 3MYIA 2XF5A 3Q0VA 1H6GA 3W4YA 1ZRFA 4OMYA 2ID3A 1SF8A 4BEMJ 4C2TA 5BQHA 2MW8A 3QYFA 1M2VA 3M1CB 1DP7P 2GBYA 4EATA 3JCUQ 2E7WA 1T6QA 1SYQA 3K70C 4UB8C 2O9LA 2WZFA 2F4OB 3EUHC 4XLFA 1IXCA 2HUJA 2A6EF 4Y3OA 4B6IA 2BHYA 4KT6A 5L3EA 3JRMO 1XGOA 2L81A 4D4XA 4YT4A 3TO9A 2CGPA 1OPCA 3E5XA 3QW1A 1BW6A 2E2JJ 3VODA 3PNVA 1Y8RB 2B63J 1E0EA 4A2UA 3VWBA 2DA1A 2ISYA 1CF7A 4IHWA 4E7IA 2K9NA 2LBFB 1WQ2A 5KYYB 4N6HA 2FQ3A 2YLDA 2EWNA 3HRSA 1G3WA 5FLXK 4MNDA 1BI0A 3F72A 4XKCA 5LGTA 3K2AA 1OCCC 4U0YA 2X6OA 3AKZA 5FROA 2R03A 5K0IA 3J80K 2J9WA 3HOXJ 2W9YA 1R1UA 3L2UA 4CS8C 2NOJB 2GXAA 4NNJA 3MX3A 3NMIA 1RKTA 3A01B 1OXKA 3S27A 5EGOB 2XLHA 3EGXA 1UHSA 3TO6A 3G4XA 5IPAA 4Z2YA 2BZTA 4F91B 1LEBA 3S1QJ 4AK9A 1A6QA 4RB3C 9ANTA 1NHAA 1QZEA 1VZ0A 1U9OA 1W7PB 1ZARA 2GZWA 2FBIA 3T8TA 4PSWA 2DA7A 3LAPA 3GTMJ 1K04A 3BCAA 4C3IJ 4HF1A 2TRTA 2NAZA 2QGUA 4BAYA 2CV2A 1J7KA 3T1BA 3TOBA 1VQ6I 1YW9A 4E4HA 1ON1A 4NCQA 3C2BA 4MVSA 1BI2A 1Z1DA 2DOEA 1LB2A 1REPC 1N78A 1TWGA 3BRJA 4NC3A 2BHZA 2FX0A 1J75A 3OYCA 4PCQA 4FETA 4EQQA 5F64A 2FGYA 3I59B 2WA0A 2DCEA 2IEKA 4BQAA 2VASA 1O3QA 4JC7A 1OCZC 2ZB9A 2R7WA 1NZEA 2MBFA 4AC0A 4OD4A 1Z3XA 2L7KA 3CDHA 2VCCA 2DB4A 2AWYA 2XRNA 4AIJA 2CQQA 3RYPA 2DTZA 1PP7U 2KPMA 2YU3A 3QYEA 4RM3A 5E3OA 4ZC3A 3HOUJ 1S29A 4UNOA 3QW0A 3BCBA 4XRSA 1DUXC 5CVVA 2YHSA 4JTDB 4Z9JA 5F08A 1JUSA 4RA2A 3IL2A 1QKRA 1S7AA 4BXUA 5GPCA 2RV8A 3K4KA 2VT2A 5DLJA 4A3MJ 3IQTA 2P7CB 2MC3A 4B44A 3EGDB 4B8XA 2KZGA 4C3BA 2VC0A 3V5YA 3OIOA 5CQEA 2CUJA 2CCYA 3V8KA 4IHXA 4CIPA 1MMSA 2D1HA 5L3QA 1W4MA 2IBFA 3GO5A 3DKAA 3MKLA 3BZCA 1RXQA 1B9NA 1YAUO 3ASNH 2GA0A 1YW7A 4X0GA 3VF0A 2J0WA 3LA7A 4XLNF 3V8JA 2O5RA 2DYSH 4XQFA 3JSOA 2J8WA 5J8CA 2XAJA 3OYJA 2IJLA 4PJNA 1S7OA 4R8HA 3JRIA 5FD6A 1HBXG 2WVOA 4PR9A 3ZC4A 1U6HA 3GORA 2XLEA 5JLXA 3R7CA 3FXUA 2IVMA 2KISA 4A0XA 2HXIA 2DK5A 1JGSA 5LLQA 3CD6I 1ZK8A 4EJWA 4G94A 1VYIA 2F5CA 1BOAA 3G73A 5BQIA 2CJJA 3NKDA 4P6IC 4BS9A 3TD7A 3T0YA 2ELJA 1Y1WJ 4EWCA 2ZXRA 3L1PA 3EHNA 1WSUA 2IS6A 1T01A 4JURI 3CQZA 4BEJA 3O2PE 1R9TJ 1TWHJ 2MABA 1IZ1A 3FMRA 3MMYB 2B0JA 4GO1A 1FOWA 3BG5A 3RIPA 3ZDLA 2ZXPA 3W6KB 4GYTA 1BR1A 1PUEE 4HW0A 4Q4ZF 4ZYDA 2K3PA 1X3ZB 1Z7UA 4RGXA 2TDXA 3I71A 3S2HJ 5DEQA 3SZTA 1PV3A 3K4CA 2OAZA 1WH7A 1YLFA 4YELA 1FSEA 1H7IA 2JA8J 2IGNA 3PHF2 2KIQA 4A3EJ 4DJAA 1DU6A 3CAXA 3JRDA 1ZH5A 2XL8A 2HVQA 1I1GA 1V5EA 4BDYA 3N97A 1STZA 4AM3A 2DT5A 4CS8A 3F8FA 4L5JA 1E17A 4LDKA 1OYYA 2IPQX 3DKWA 5LD2C 3BPXA 3S3OA 3E9VA 3U8PA 1X3WB 3L8IA 2Y48A 3U2RA 5B66C 2FAPB 1Q0KA 4JTCB 4Z9HA 3IRRA 5B5EC 3X2QC 5LHGA 3CC2I 5EHHA 2FQ4A 2FJ1A 3EUHA 3PL8A 4CZZA 1LE4A 3TMOA 2L3DA 4D7NA 3M9AA 5DM7F 2AS5F 2HVSA 1L7CA 1WRJA 4XSZF 3BT9A 2P81A 3ZXSA 3BG3A 3DZAA 3SZRA 4LFUA 2Y3GA 2DJIA 3HJCA 4HOBA 2X1EA 2UUHA 3R61A 3FXJA 4E70A 1JJ8C 3Q6MA 5LBQA 2OZUA 1KGSA 3KZYA 3TJ5A 3IHUA 1SD6A 5AC4A 3F0CA 1HKTA 3ABKH 5JVGF 1ZGWA 4G0HA 4LLCA 2Y75A 4GGGA 4A3JJ 1U2WA 2DMPA 3OYBA 2VC1A 1FOKA 3I4NJ 2CSOA 4X0RA 1IDZA 2AXTC 3OY9A 4AUXA 3U9GA 4JJFA 2FA5A 4I76A 4E18A 4XPWA 2CUFA 2EZLA 2PX9A 3S14J 1WJFA 3O6BB 1WJEA 1Y8QB 4IF4A 1RI7A 4GYIA 3WE2A 2PFDA 5J47A 2XAHA 2DT7B 4B3XA 1TL8A 1DOVA 3BZ6A 2JPBA 4ASNA 1APCA 3J06A 2LKSA 1XMAA 2RKHA 3EYIA 2XF6A 1LE8A 1EA3A 2A61A 2R02A 1S6LA 4N9IA 3DD7A 3K1IA 2VQCA 2EIKH 3CCVI 2FNAA 1IJWC 1DOWA 2I8BA 5L3VA 2JZYA 2E34A 3L09A 3HSEA 1HMDA 2Q3TA 2BE5F 2OD5A 1ETQA 3FZVA 1OCOC 3LQRA 1W36C 2BXYA 5JRAA 4KJZA 1IN7A 3FIWA 3TDZC 1ZGAA 5K5OA 1JUMA 2TMVP 1WJCA 2QTVA 3AG3H 1MMAA 3H9QA 4IRUA 2MSYA 2W25A 1K4TA 6PAXA 5EG0A 1OKKD 1G8XA 3NRHA 4IB4A 4V2FA 4ULVA 2WVNA 1R5ID 2O3FA 3LA3A 4RAFA 5HLHA 4M71A 2MHRA 2Y3BA 3A9CA 3PUBA 2DI3A 3DWWA 2LIGA 4RLFA 1LDKB 2ZMEA 1ZW2A 4BDZA 2E19A 4ZYEA 3UNGC 1IW7F 2XF7A 5HS7A 1QLEC 2VE8A 1XDSA 3KIOA 4EJTA 4NC7A 2C6YA 1X1PA 2BY2A 4FE7A 1YYXA 2XL4A 4XEFA 2HOAA 1F1ZA 2EIJH 4MTFA 1OCCH 3KP2A 3OIQA 3N0TA 2HR3A 4IRIA 1X2MA 1YA7O 2GAUA 2HGCA 1O3TA 3OV8A 3GZ5A 3LSGA 4WCGA 1ZZPA 2IXPA 3KFWX 4DGWB 4S04A 3GEEA 1KA8A 4RDAA 1YITI 2RDPA 5D91A 1WFXA 4M73A 4BQOA 2GWWA 2QKLB 5IOYA 5FLMJ 4BG0A 3FDQA 3BR6A 5CVRA 4RS8A 2Y69C 3SEZA 4NUBA 1P4XA 1WJBA 2HYGD 3PSIA 4Y33A 3QVYA 5DCFA 2FOWA 2O9XA 2LNBA 4KI2A 4XICA 2UWMA 2QSGX 4JOMA 5FRMA 4JX6A 2CFOA 4B4CA 5HDKA 4Q47A 1TQIA 3LSJA 1BN5A 1B4AA 3IQ5A 2HNHA 3CCYA 1XMXA 4RD9A 2OJQA 2BY1A 2X85A 4MVOA 4AE4B 1Q1VA 5E3MA 5FZTA 4HQEA 3OS1A 3TEDA 3K7DA 4DOZA 2W82A 4GFBA 1Z3YA 3JTGA 1UFBA 2KT0A 2A0BA 1ZR2A 2ID6A 2E1CA 1TWCJ 3U3FA 2NUPB 5ICGA 4CDYA 4C7OA 3V5ZA 2HJMA 3MQ0A 3MKYB 4BH9A 1A41A 2EA4A 4G7OF 3I5UA 5CPRB 2Q4FA 5TISC 2IAIA 2OBPA 5LEKA 4MVRA 3K4MA 2PQ8A 4PZJA 1AOYA 1RC9A 2BY0A 2HKVA 4UXNA 2KW3C 4XQ1A 1MJAA 2VN2A 2IXSA 1YX3A 4UVBA 3U21A 3U1KA 2ZXJA 2P5LC 2E5NA 4NBQA 4E7JA 1PJRA 2Z15A 2L01A 2LC2A 3NYJA 3TOAA 1KU7A 3FXOA 4QPQA 1WZ2A 4ENNA 2EB7A 4EGYA 3HUGB 4XM3A 1TWFJ 2VXDA 1RUNA 1WASA 2JA2A 2HPMA 3CCMI 1LEAA 1Q0GA 1N1CA 3HNIA 1XB4A 3RVZA 2WAFA 5BPDA 1T08B 1P4AA 2YS9A 2UXXA 3WODF 1YVIA 1APLC 1MBKA 4P96A 2X6YA 3QPHA 1VQ4I 2KC3A 2AWCA 1Y1VJ 1J0RA 3DP7A 3O3KA 2XLDA 1W0TA 4D0PA 3V8LA 1EI7A 3OOUA 4XLHA 4CCLA 2W1OA 4O7GA 1VQLI 1ZR4A 4KIFA 1UHMA 2W84A 1QVTA 4N6CA 2KZVA 2V1NA 3LNQA 1D1BA 3GTPJ 1K6OA 1O5HA 2R4GA 3EQLF 2LP4A 2WZGA 3IQCA 2IA0A 1SANA 3JRGA 2ASRA 2KHMA 3ASOC 4OWRB 3ONQA 2VB6A 3MLGA 1WWXA 2XM0A 3WGGA 4PJJA 5GAGJ 1HE9A 2OEXA 1FSHA 4LB6B 3K66A 1MNEA 4G7ZF 3F6VA 1KZHA 2H7VC 3MKWB 2KJGA 5KYXB 2QF7A 3CO6C 4N4OB 3RPQA 4CJOA 2I5UA 4E7SA 3FISA 4WABA 2KFDA 4GEHA 3UMHA 3OYMA 5FKMA 4L0ZB 2VBZA 4I98B 2VT3A 2YL3A 3E7LA 4A69C 2FMLA 3G6EI 3KPHA 5DS4A 1TBXA 4U7DA 3W2WA 4C2MJ 2HDDA 1ODDA 2FE3A 3DTKA 1LE2A 3VYRB 3F8MA 2VCAA 3OS2A 2W4BA 4ER9A 2D2WA 4PJ0C 5A6BA 2FBHA 4UV8A 3VDXA 2IP2A 3VEPA 5GAHJ 1AHDP 4W1UA 1AKHB 3GLXA 5F04A 1VQ8I 1UCRA 4HLXA 1SVMA 4V2GA 1W1WE 2WBMA 2H09A 3TL4X 2R7SA 1TWGJ 2Q0OA 2XDVA 3RKOF 2CNWA 4LERA 5FB2A 4IO9F 2JX0A 4J01A 2L6GA 5AONA 3I58A 4IAOA 2B0LA 4KN7X 4M74A 2HV7A 4YIRX 2XRLA 1HDPA 1NG1A 4LLLA 2M5WA 2QLZA 2OTJI 1CPQA 3V7OA 1R1VA 2QM3A 4HFFB 2IW5A 1JPNA 3K1HA 5FKLA 3C8ZA 3KX2A 4O6JA 3EH2A 3KYDB 5TRDA 1E3PA 1U0BB 3CUQB 1JKQC 3BROA 4EBBA 5E3NA 2OCEA 2LFFA 1LFPA 2LK2A 1Z7Qc 3W8IA 2JPCA 4BNCA 4O6YA 5KYWB 4ENKA 2CRGA 1T98A 1T2KA 1MJBA 3ABLH 3EUAA 2VKVA 1LPQA 2Y2ZA 2OC6A 2OZ6A 4LG0A 2KQ9A 1BDJB 1WN0A 2K27A 2W48A 3SZPA 5HODA 4MEXF 1IAWA 2J7PA 1S3JA 1V55H 4BL0B 3QZCA 3GX4X 2R7XA 2A69F 2LSOA 3OMYA 4I3MA 2YQYA 4IRHA 2MLKA 5H6RA 1RIOH 3KL4A 3A4CA 3TULA 1WKMA 4QWQA 1G4WR 1I6XA 5E17F 4QDLA 3GF2A 4K0DA 2V79A 2QYOA 2WB1A 3FKIJ 1LNWA 4OD5A 1JUPA 3DAGA 1ZN2A 3SDGA 1NK2P 1Z9CA 1SFOJ 1RMVA 2QBYA 3ZGKA 4U7BA 1XCBA 2PMZN 4UVCA 3N2ZB 2EIKC 4WGYA 3FK6A 3GTLJ 1FTTA 4U87A 2ETSA 4AL0A 2GXBA 2V26A 3P5JA 4RGUA 1P2FA 3CC4I 1JR8A 1JRAA 1S7ZA 2ZJPF 4HF0A 2QQBA 2YU9J 2HMZA 3FM3A 5BS6A 2EBIA 3OYIA 4YFXF 1G4US 2ZFUA 5DUKA 2MGQA 2P6TA 3QODA 3Q5FA 1VK5A 1ZG5A 1MBGA 4G6DA 1IC8A 4G12A 5DCMB 3EG9A 2RVCA 3C7JA 1PUFB 4XRSG 3OSGA 2DBBA 2Z5UA 1YJ9I 1T8IA 2CS3A 2YL1A 5A6AA 3I0TA 4J00A 3L34A 5AGFA 2CH0A 3WTYC 2IGOA 4U5CE 3M4BA 1FNTc 3GCMA 3V7SA 3FXRA 3LFKA 1IXSB 3CQZJ 4NB5A 1U5TC 4FESA 1JKRC 2VKHA 1F5TA 3I3LA 3IAM2 2R7UA 1KQ8A 5E20A 1R7JA 4FT8A 4A0ZA 4YK5A 1DGWY 3AOUA 3F22A 4I01A 1RR8C 1Z77A 3UMIA 4NTBA 3KLNA 2R7QA 1OR3A 2L5QA 1RKEA 2VJJA 2ZXHA 3M8JA 1U5TB 2H8WA 2KDOA 3R60A 4CUGA 2YVKA 1WI3A 1X1AA 1MMGA 4G9YA 1Q0MA 4P5OA 4NQFA 4XPYA 3HG9A 5CKTA 1BL0A 2Q2EB 3AFHA 3W2AA 1D0ZA 5L0CA 2L4MA 1SMTA 4L5IA 4A3KJ 3HNLA 3MN2A 4Y15A 3ROUA 3WG9A 4CCNA 3IUOA 3NKEA 1GDTA 5DS6A 4XKBA 5DS5A 1SAXA 5CYVA 2PLYA 3HHGA 2M8EA 5FKKA 3S29A 5KVRA 2VKEA 4L9TA 4YEJA 2XRHA 5IYDJ 3B02A 3CCUI 2R5YA 1PP8F 1YOVB 4XORA 2WAQA 2K86A 5JLWA 2ADUA 4RGRA 3CCQI 2P6VA 1W5CC 3C3WA 2RQPA 3EGDA 2EV6A 3S32A 3OYHA 3SXZA 4C30A 1K83J 4EVIA 1FNNA 4LIUA 1SFUA 1YRNB 1MH4A 2IA2A 1ZU5A 2BC5A 4YIIA 3MKZA 3CO7C 1V54C 2HOSA 3QU3A 2P5KA 3Q3SA 3U5SA 2VONA 3M1CA 1LS1A 2NNYA 1TFKB 3DI5A 5M3FJ 1FAPB 1JKOC 3KP6A 4XLAA 1O7LA 5FJ8J 4U5DE 2KK1A 3ZMZA 2R9RB 2MFZA 3BR1A 1M2VB 2XLOA 3OYFA 5B1AC 1NG6A 1K78A 2IBDA 2L7MP 2FD5A 1QPIA 2J0XA 3IH2A 3DAFA 3J7AY 3GANA 1Z6AA 1JGGA 3M8EA 3WG7C 1FYMA 3WE3A 2CQKA 4DJ9A 1MKMA 4Q5SF 2DN0A 1FZPB 1QO0D 3CLOA 1SD4A 2VOOA 5A6JA 1WVRA 2B0HA 4M6YA 5J4VA 3F6OA 3H92A 3ZG1A 1M2OA 1VTMP 4XSXF 3BC8A 1IGNA 2DMQA 5EZHA 2HSQA 3U9JA 4LACB 4U9EA 3RI4A 1EQ1A 3RIRA 4C7OB 2OTLI 4LOCA 3FHNA 4DW6A 5HLTA 5F0CA 3L2RA 1V4RA 5KHDA 4BUPA 4JZAA 4N06A 5CI9A 4YT2A 1GS9A 3SP1A 3B0VC 2K9QA 1ACIA 3M8FA 5E1XA 3FK7A 4D5CA 1OISA 3F47A 3PO2J 2LF8A 2P6SA 5CJ9A 1E3OC 1FYLA 1CGOA 2NG1A 3E6BA 3PIOF 3C63A 4DZPA 5BUOA 4HA8A 3DLAA 1R49A 4UDVA 4A3CJ 2XHKA 2STTA 2XAGA 1IN8A 1HSJA 1JTXA 2L2OA 1Z0XA 1JTYA 3L8JA 1XZPA 3AG1H 3CJNA 1K05A 1BBYA 3T6GB 1OR2A 5E3LA 4M72A 3OYKA 3K6BA 4ZDLA 5L3BA 1Q0DA 3KYLA 4XNFA 3OR2C 2IRFG 2HQAA 4MGRA 2ZJQF 3A01A 3FAJA 2ESHA 3V4GA 1R71A 2Y0SN 1P6RA 2ZSIB 1HW5A 3DFGA 4U9DA 2R25A 4BJTA 3L2CA 1ETXA 2IXMA 3LEOA 2D45A 2Y30A 2JA5J 2XIGA 2MLGA 1TKNA 1LI7A 1TQGA 2JT1A 3C8GA 3OYEA 4MW3A 4W8PA 5JUAA 2ZKZA 3LNRA 5ICFA 4OU0A 2K4BA 2PEXA 3HYIA 3L1MA 4H54A 3J7AO 3EPZA 3F46A 1R1TA 2EZKA 1X4PA 3CZ6A 1YJGA 4E0IA 3SEQA 2R7ZJ 3BQZA 3DBRB 2YX4A 2H7BA 1K61A 4LLEA 3L2WA 5D92A 1G3YA 3Q7LA 4L5EA 1Z21A 4C2UA 2VBWA 3AG4H 4M3FA 4RBNA 1VLTA 2JWTA 2V6EA 1USTA 1FOYA 4CXFA 1G3TA 3VYUB 4A3BJ 5M5WJ 2BV6A 2ECCA 3I4PA 3LAYA 5EZGA 2R05A 3LAJA 2JSPA 1P9QC 3HSFA 3BTIA 2WADA 2OEVA 4YL0A 3ERMA 1RZ4A 3CMAI 4H0EA 1DP3A 3KEQA 1VI0A 3DF8A 2BL2A 5JLIA 4N4NB 4ITVA 3HPGA 5L3CA 3OYDA 3EUKL 1KQ9A 2IA1A 1LIHA 1SVLA 3GLLA 3ECHA 2EIMH 1OLTA 1PCXA 1V55C 4CJGA 2A05A 2EINC 2OCCH 4BJ6C 4NY3A 4KNWA 5H20A 2Z3YA 3HKZA 1N77A 1SR2A 4P9TA 2QA4I 2JPUA 4YWQA 4I0BA 3ZQ7A 2V1XA 3GFJA 5DS9A 4AWXB 1ZHZA 4L9JA 5A6KA 1ON2A 4KT5C 1TFOB 3HTKC 3R2PA 1V54H 1ZG1A 2IT0A 1R4NB 1VQOI 1F43A 1IRZA 1U89A 1FC3A 3L9FA 3AG1C 3WGHA 3CEXA 4IX7A 3OOPA 4OIPF 3LMMA 5E8IA 2QUPA 3U2LA 1E85A 3K1MA 4KIGA 1R4TA 3LFUA 3U0CA 2LYCA 2NRAC 1JXSA 2CQ7A 2WY7Q 3QOEA 3O8GA 2DA6A 3QPLA 4WWCA 3WTSC 3LSMA 3MZ8A 3K70D 5KNLA 3Q7GA 4EHPA 5KYUA 3E6DA 2DK8A 4HG2A 1ZAOA 3JSPA 1XSDA 4B47A 3H2UA 2M3AA 3NDBB 4LG0B 2QSHX 2GXGA 3CJTB 3KYCB 2GA2A 3FOOA 2DA3A 2HYJA 4X6AJ 5A6BD 1NG7A 2P4WA 2JTVA 1GVJA 2O8KA 3RF3A 4EUKB 5L0GA 4G7HF 1Q1HA 2LFBA 4CCJA 5JI6A 1GV5A 5A2QZ 4A4AA 5EEHA 1O3UA 1YJWI 5HLIA 2HKXA 3GEIA 3OA1A 3FXKA 4J32B 3DEUA 3K10A 2L7FP 3VSLA 3WTXC 2R7VA 1DPRA 1BJAA 2JQ7A 4UUSB 5J6XA 4A12A 4A3FJ 2R7RA 1I3QJ 1A7DA 3B0PA 3JT1A 3K4NA 2D5VA 3B6CA 1WI9A 3FXMA 3T6JA 3DBLB 2F5DA 1S7EA 1EJ9A 2BVMA 1HCRA 2XLWA 4KFCA 2DA4A 3SYTA 4HAMA 3SZGA 1H0MA 2NUPA 3WHCA 2QQ9A 3S15J 2ICWG 1TWAJ 2NVQJ 2EV5A 5E33A 3QP5A 1YE9A 2LLKA 4RM2A 5DM6F 1LUJB 5CVUA 2QY9A 2F5FA 2Y9ZA 4B43A 4XPXA 5ILUA 1VQ5I 3F21A 4EBKA 1T39A 3FBNB 3GTOJ 2EPNA 1K7AA 3EZHA 4CS9C 1RUOA 1F1MA 2F5VA 3RQFA 2DT6A 3GEZA 2OCCC 1XSVA 5M3MJ 4BXXJ 1A7EA 3EG9B 2VE9A 4XOPA 4L6RA 2PBEA 2M8GX 5EDNA 5JR3A 2BY3A 2RNJA 2GDCA 4PACA 3HPHA 4LITA 1A6IA 2K85A 2FU4A 2H94A 5GP9A 1XCVA 3JRCA 1GM5A 2PNOA 2X0LA 3I54A 1IO2A 1W7PA 2CO5A 1HOMA 4Y13A 3E6CC 4CDVA 4HSRA 4G8XA 1VQPI 2XASA 4GRIA 3P9IA 2M0CA 3IWFA 4MVUA 3HB9A 1D5VA 3I5QA 4E7ZA 4MNUA 3R0JA 1X2NA 1T95A 1MSFC 4JX4A 2BW3B 2YX7A 4BXFA 4CICA 1LE8B 2KMUA 3DV8A 3HC7A 1U5TA 5DTDA 2ZSHB 3OYLA 3PCVA 2NVUB 3VSKA 2DA2A 3I4UA 5T1DB 2WV0A 3C2HA 4KBLA 1XN7A 3D5RC 4IXAA 2ZBKA 4RB0A 1ETYA 5D5VB 4JTAB 3NWTA 5JT4A 3HGYA 4NC6A 5D6FA 1T0FC 2V9PA 1NU7D 2IXNA 4IKFA 3WU1B 4FX4A 4JCHA 2QCOA 4BQNA 5ICCA 2YWAA 3FBIB 2VPRA 3DBHB 4UVAA 3U8VA 2JRMA 2PMZA 3FM5A 4CSAC 1XG1A 1XD7A 1HXDA 4XWJA 1BJZA 1ZRCA 3CJQB 4AD9A 2HOEA 4GDFA 2XM4A 1TT0A 5JFRA 2IM8A 4XBFA 1GHCA 1J09A 3KEOA 3LSKA 3FXQA 1Y0NA 2QVOA 4LG3A 4RLQA 4RB1A 2OQRA 2L7AA 3O10A 5L0HA 3GYHX 2M0MA 3LNMB 3C62A 2ZD9A 4UB6C 3JZ0A 5FD5A
chains in the Genus database with same CATH topology
4YT5A 4OWRB 2V9KA 2RQQA 2VB6A 3ONQA 3MLGA 4BJ6A 4PJJA 3UGOA 1K6YA 4XL9A 3K66A 4PJMA 3W8HA 1MNEA 4B48A 2H7VC 4ULWA 3S8PA 4G7ZF 3MKWB 2KJGA 1V5FA 4IQ4A 4N4OB 3SYNA 4PK4A 1PD0A 4E7SA 3IAS2 1PD1A 4GEHA 3UMHA 3OYMA 1WJAA 3OR1C 1R6RA 4CS9C 2CV1A 3RSNA 2M4KA 3G2BA 3LS1A 5DS4A 4CZCA 2VPLA 3RQ4A 2IYLD 3W2WA 3NWSA 3DTKA 4LIVA 3VYRB 5B1BC 3H5AA 3DM5A 3OS2A 2W4BA 5FRNA 3X1OA 1GLNA 4NQWB 1TWAA 1FTSA 1PYVA 5KYYA 3HXLA 2E60A 3VDXA 3L2VA 3BG7A 4XLEA 3E1SA 3S3MA 4BEHB 2EILC 5F5HA 4HSTA 2AQEA 1Z3IX 1LVKA 2KL4A 4OAZA 4KISA 4RMNA 2J9UA 2WBMA 2Y0SA 3KMIA 3LJBA 5DQZA 4BE1A 3TL4X 4HRIA 2R7SA 4MLOA 2XDVA 3RKOF 2VLAA 2CNWA 4LERA 3Q6NA 2PP4A 4J01A 2Q9AA 2LOOA 4IAOA 2HV7A 4XLPF 2MC4A 4XLCA 1NG1A 1ST6A 3T6BA 3RTRA 3DEEA 4JVSA 3V7OA 2KRHA 2WY8Q 4XOTA 3S93A 4ANJA 2G3KA 4F52A 1U0JA 1JPNA 1KU2A 3K1HA 4HFFB 2Z1DA 2WAEA 3KX2A 4YJWA 3DJNB 3EH2A 3HOTA 1JI8A 2WVQA 3AG3C 2JUGA 3ZIBA 2E5ZA 3NG1A 4DVYP 1SAUA 2M4EA 1N75A 3DKYA 3K4JA 4EBBA 3ZQQA 1LFPA 2V7FA 4DBQA 3QMKA 2IXOA 3W8IA 4BU2A 3EGXB 2F4IA 4O6YA 4ZDOA 5KYWB 2DOAA 3DMDA 2F6CA 1IRXA 2CGEA 1D0YA 3EUAA 5KCMA 3E70C 3N05A 4U5FE 3FVYA 3LESA 2GOMA 2OC6A 3VYWA 4CIHA 2KQ9A 4A2NB 3DM9B 3JRTA 1ZHTA 2J7PA 4JQFA 2W4MA 1Z23A 3EJNA 1QHGA 4BL0B 3QZCA 2R7XA 1UG0A 2A69F 3OMYA 2J46A 4I3MA 3OIPA 4H4KC 3KL4A 1ZHXA 2LY1A 3A4CA 2I8DA 2LSEA 3OS0A 2V3CC 2E1MB 2XF5A 2W00A 2R7OA 3CESA 1SF8A 4O79A 2C04A 4C2TA 4QDLA 3SNHA 3B0UX 3QYFA 1M2VA 3H0DA 3HLZA 3M1CB 4K0DA 4ZLDA 4EATA 3H35A 3JCUQ 2WB1A 3A2KA 4BACA 1Z63A 4OD5A 1FMVA 2UV1A 3K4LA 3DAGA 3PNTA 3K70C 2WZFA 3ASOC 3ZGKA 4U7BA 2UUZA 3VYSB 3N2ZB 2EIKC 4XN0A 2M4GA 2W4SA 2VL8A 3A1YA 3EUHC 4XLFA 5T3WA 3EH1A 3DJUB 4U87A 4Y3OA 2A6EF 2V26A 4KT6A 2VXZA 4B6IA 2L81A 4YT4A 1S7ZA 4OINF 4I1OB 3DPLC 4AYBA 4DBRA 3PNVA 2Q1ZB 1OKKA 2KGOA 1E0EA 3AG4C 3S0XA 2HU9A 3VWBA 1J8MF 3OYIA 2K9MA 2R7TA 2ZFUA 2W7NA 4HEAJ 2V4JC 3QODA 1QU3A 3MD2A 5F5FA 4E7IA 1VK5A 1D0XA 4XWJA 1DQUA 4CSWA 1D1CA 3EG9A 5DQTA 2G62A 2LBFB 5KYYB 5E3AA 4J30B 1MNDA 2CS3A 3EFOA 4MNDA 3VAYA 3CJRB 2OUMA 4J00A 4HEA2 4XKCA 3L34A 2CH0A 2IGOA 4U5CE 4CBEA 2GOXB 2DYSC 1OCCC 1Y6IA 3AKZA 5HSWA 1BOBA 2EIJC 5FROA 4ZLCA 3OL3A 4FESA 2J9WA 2VKHA 3L2UA 3I3LA 3IAM2 2R7UA 4CS8C 2NOJB 4NNJA 4YRVA 1TWHA 3MX3A 2XXAB 1DGWY 2OV7A 4ZTFA 3AQBA 3RYLA 3EGXA 4ZYAA 1VYKA 1ZU4A 4YN0B 2X6XA 3UMIA 3FDYA 4F91B 2R7QA 4AK9A 2L5QA 2VJJA 2ZXHA 1NU9C 3M8JA 3EHMA 4CUGA 2KDOA 4QPOA 3EFOB 4U5EE 1X1AA 1VZ0A 1MMGA 1X19A 4BJ5C 4P5OA 1FFHA 5KYXB 4FASD 3PMRA 3HG9A 4PSWA 5CKTA 4CA0A 1QZXA 2Q2EB 3AFHA 3W2AA 1D0ZA 3BCAA 1BR4A 4MQ9F 4CCNA 3IUOA 2CV2A 3NKEA 3S3NA 4QI2A 5DS6A 4XKBA 4E4HA 4F93B 3C2GA 5DS5A 1N78A 1TWGA 4O6NA 3LL7A 3S29A 2E1MC 2KLOA 4PUSA 3ZR8X 4CS9A 3EPVA 4AVZA 4YEJA 2XRHA 3OYCA 4I44A 4XORA 4FETA 2WAQA 2FGYA 1X1DA 2Q9CA 2WA0A 2DCEA 2P6VA 1O87A 2VASA 2PJRB 3EGDA 3ZSUA 3S32A 1OCZC 3OYHA 2R7WA 4C30A 1NZEA 2FFHA 4LIUA 4OD4A 1Z3XA 5T3TA 2JVHA 2L7KA 3FHDA 2KRCA 2VQHA 2IS1A 1ZU5A 3MKZA 1V54C 1ZELA 2CW7A 2KPMA 1OCRC 3HOSA 1D1AA 2CW8A 3QYEA 4RM3A 4ZC3A 3KEYA 3M1CA 1LS1A 4WJ0A 1OR7C 2DYRC 4CCMA 5EGYA 3BCBA 2J7PD 2YHSA 4XLAA 3PJRA 1MMDA 4U5DE 3UGPA 3K4BA 5FCLA 3K4KA 2DXIA 2MFZA 4IWBA 5DLJA 4OIQF 2ZXIA 3L2QA 1J8YF 1M2VB 3OYFA 5B1AC 1NG6A 4B44A 5JHFA 2PJRA 3EGDB 4BEHA 2J0XA 1W36D 3DAFA 3JSZA 4C3BA 2MWQA 5CQEA 3J7AY 2CUJA 1HA8A 1Z6AA 2LREA 3GANA 5LFAA 3SDBA 3KH2A 4IJJA 3WG7C 5L3QA 2A6TA 4Q5SF 3HL2A 2VJIA 1M56C 3POVA 2Y3HA 2X1CA 2XSEA 3NYLA 4BE0A 1M2OA 1X4OA 3ZG1A 1Y56A 3BC8A 4X0GA 2J0WA 4LACB 1UELB 4C7OB 3BLYA 4XLNF 2K5CA 2O5RA 4XQFA 3FHNA 4XKWA 5HLTA 3OYJA 3L2RA 1V5GA 1SMYF 4PJNA 3DTIA 5KHDA 4BUPA 1TR2A 2WVOA 4JZAA 4E7KA 1WJDA 4N06A 5CI9A 3ZC4A 2A5WA 4YT2A 2WB7A 3SP1A 3B0VC 2L9NA 3E0JB 4P1WA 3F47A 2GFHA 4XMYA 4IQJA 4NC8A 1VYIA 1G59A 2NG1A 4AX2A 2C03A 2YEVA 2L9SA 3TBIA 5BUOA 3O6XA 3DLAA 1UAAA 3NKDA 4P6IC 1MMNA 4BS9A 3TD7A 3OL4A 2ELJA 2L2OA 2ZPAA 2VKDA 4EWCA 2ZXRA 2VQLA 3EHNA 4C9YA 2XSJC 2IS6A 3CQZA 4KITB 4GYTA 4JURI 4BEJA 2X6WA 2MABA 3MMYB 2B0JA 3RIPA 2Z2SB 2ZXPA 3OYKA 3IP4B 2NUTB 3ABMC 4ZDLA 1BR1A 1S9HA 3KYLA 1TZLA 3OR2C 4XNFA 1VMAA 2W9YA 2K3PA 2K9LA 4Q4ZF 2HQAA 3FAJA 4U5HA 2BVLA 3K4CA 4ZTJA 2LG4A 3RFYA 4YELA 2Y39A 2PX0A 2ZSIB 2J9VA 5E3CA 2IGNA 4W8KA 4DVZA 1ZYRF 3PHF2 2IGMA 4BJTA 4II3A 4D1QA 2IXMA 4DJAA 3JYHA 3KKBA 2PF4E 3H5RA 3DKXA 1TKNA 2HVQA 4BDYA 1V5EA 4CS8A 2IS2A 3OYEA 3NYMA 1QHHD 3LNRA 2D5RB 3L0IA 5LD2C 3S3OA 3E9VA 2LRDA 3S28A 3GBGA 3EPZA 2L9JA 3F46A 3DWLE 3LLIA 2X51A 4XR6A 1X4PA 3CZ6A 3X2QC 4F92B 2LH9A 3SEQA 4U5BE 5EHHA 2DGJA 4CH7A 2H7BA 4LLEA 5D92A 3L2WA 1SZIA 3D5LA 3Q7LA 3PL8A 1Z21A 3TMOA 4C2UA 2HZDA 4II2A 2HVSA 3CMMA 3H9JA 1M57C 4RBNA 3QYBA 3ZXSA 2V6EA 2VJ5A 3DZAA 3SZRA 2Y3GA 3VYUB 2DJIA 4IZZA 3HJCA 2X1EA 2A68F 2VJ4A 2XAUA 3LAYA 3Q6MA 2MD0A 3RPUD 4E6KG 3K6GA 4O6MA 4HNUA 4E7HA 2JSPA 3IEEA 1P9QC 2WADA 4AE4A 3ABLC 4BQQA 4OAYA 1DP3A 1FFTC 2RREA 4HFKB 1ERDA 2RNGA 4N4NB 4ITVA 2IS4A 3HPGA 3ABKC 4G0HA 4LLCA 3OYDA 3EUKL 3OYBA 3OYAA 4X0RA 4CCKA 2EIMC 4OIOF 3OY9A 3K1IC 1DGRM 1OLTA 1PCXA 1V55C 4XKVA 2A6HF 4JJFA 3I9V2 4ZDPA 3OYNA 4NY3A 4BJ6C 4QI0A 4KNWA 3OYGA 3HKZA 1WJFA 2KP6A 1WJEA 1N77A 3K6BA 3ECSA 3O39A 4KC9A 3W2VA 2CNWD 2PFDA 3EZIA 4M63A 2DT7B 4YWQA 4B3XA 4E7LA 4CCOA 3DTEA 2ZXOA 3DXJF 2M7BA 1ZHZA 3HTKC 1X1CA 2LBFA 2XF6A 4G6TB 4JJGA 1EA3A 5HVQC 3AG1C 2CMPA 2VQCA 3DD7A 2I8BA 5L3VA 2KNHA 5E2QA 3N24A 2Q3TA 4IX7A 2P0WA 4OIPF 3LMMA 2BE5F 1ZHWA 1OCOC 1W36C 2IGKA 4KJZA 5HNFA 3LFUA 2M7AA 2Q9BA 2LYCA 3W3CA 1WGWA 3OWTA 2WY7Q 3QOEA 2EINC 1WJCA 3PNYA 4D9JA 2A1DD 3Q7GA 3LSMA 3K70D 2QTVA 1MMAA 5KNLA 3H9QA 4IRUA 5KYUA 3AL0B 4HG2A 2BW3A 1YX5A 1OKKD 1G8XA 4B47A 3NRHA 3CP8A 2M3AA 3ZRGA 3PFYA 4FWVA 3NDBB 2WVNA 2CV0A 2Y3BA 1NG7A 3PUBA 4CSAA 4F55A 4RLFA 1LDKB 1JPJA 2YZSA 4G7HF 5KYXA 4BDZA 4CCJA 3ZVRA 2HV6A 3UNGC 1IW7F 2XF7A 1QLEC 2OG2A 3OA1A 4J32B 3ASNC 2HDWA 3CP2A 1VOMA 3K10A 4HNTA 3CF2A 4NC7A 5IY5C 2R7VA 3VSLA 2XL4A 3LSIA 3UMKA 3OIQA 3N0TA 2R7RA 4K7BA 2PX3A 3H9GA 2XC7A 3K4NA 2JD3A 3B0PA 3LSGA 1IZMA 2IXPA 3B9QA 3JT1A 3LLKA 4DGWB 1X1BA 1AA7A 1RJ9A 4PSXA 4RDAA 3SEOA 3T6JA 5D91A 4OIRF 4F4BA 1WFXA 4U5GA 2BVMA 4BQOA 4BG0A 2QKLB 2HVRA 4BE2A 3FDQA 3SYTA 2NUPA 3SZGA 4DIQA 2Y69C 3SEZA 3D5SC 4NUBA 1WJBA 3RCOA 4Y33A 3PSIA 4I1MA 5E33A 3FKJA 2O9XA 1YE9A 4RM2A 4KI2A 2UWMA 2QY9A 4JOMA 2KQRA 5FRMA 1ZHYA 4B43A 2CFOA 4BJ5A 1KONA 2Z16A 5B3SC 5HNHA 4KNVA 4Y4RA 3OEOA 3DU6A 3FBNB 3LSHA 2HNHA 2LY2A 2P7VA 3EZHA 2BOLA 4RD9A 2VIXA 4JW1A 2F5VA 2X85A 1W2WA 2DT6A 1RJ9B 2OCCC 4AE4B 4C3EA 3EG9B 2XXAA 3OS1A 4BGDA 3K7DA 3DPTA 4XOPA 2W82A 3ZCOA 4DOZA 1Z3YA 4ZJZA 2G3VA 5TGTA 2J45A 4BJ1A 4HPQA 3HPHA 4LITA 2NUPB 4C7OA 2VH3A 2W45A 3MKYB 1Z5ZA 2HPIA 4G7OF 5CPRB 1TWCA 3LEVA 5HOOA 3K4MA 2X1DA 2ZXWC 4YT8A 2KW3C 1BR2A 2AQFA 4F3QA 2E87A 3T4RA 4HSRA 3RH3A 4XN3A 4PFOA 5CQGA 2IXSA 3DPUA 1YX3A 4GRIA 3U21A 4E7JA 2E5NA 1PJRA 2Z15A 2NUTA 3I5QA 4E7ZA 4XTKA 2LC2A 2MYSA 3BG6A 3NYJA 3AQCA 3CSKA 1LKXA 1T95A 2CUZA 1MW7A 3DU5A 4QPQA 4FX5A 2BW3B 3HUGB 4XM3A 4BXFA 4R79A 5KYNA 2VXDA 2KMUA 2JA2A 2HPMA 3HC7A 3VYTB 2ZSHB 3OYLA 3H65A 2VQGA 3VSKA 5T1DB 1N1CA 3I4UA 1Z7LA 3K33A 3S27A 3C2HA 2WAFA 3D5RC 1SFKA 4KBLA 5CI8A 1WJ5A 3NWTA 3ITFA 3WODF 2WL8A 3GODA 3V42A 4Q7CA 5DVWA 1NU7D 3DQVC 1T0FC 2IXNA 2X6YA 4IKFA 2JVGA 4JCHA 3F9KA 4BQNA 4HE8D 4PFPA 3FBIB 4CSAC 4XONA 3OOUA 2PMZA 4XLHA 3I5PA 5KYWA 3LS0A 4CCLA 2W1OA 4AU7A 2FUG2 4O7GA 3CJQB 2QKMB 1FMWA 2H7OA 2IOQA 4PJLA 3H5NA 3UR3C 1TT0A 3PSFA 2KZVA 2V1NA 1D1BA 1J09A 4C3DA 1O5HA 3LSKA 5KYUB 2R4GA 3EQLF 2WZGA 4LG3A 2Y3DA 4RLQA 2CDQA 2M0MA 2WZLA 3AL0C 4CS7A 2CW0F 2KHMA 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJT A;  3OWT A;  4BJ5 C;  4BJ6 C;  3CZ6 A; 
#chains in the Genus database with same CATH topology
 2V9K A;  5BPI A;  3CUQ C;  1W5T A;  3I53 A;  5D5W B;  4DNC A;  4HV6 A;  3ZN0 A;  1GUU A;  1JT0 A;  3ERE D;  1AKH A;  3RKX A;  1HKS A;  1EKY A;  2XB0 X;  1VQ7 I;  2K9S A;  2Z9O A;  3IWZ A;  4IQ4 A;  1YRN A;  4FX0 A;  4L9N A;  4PK4 A;  4AVP A;  2FBK A;  1PD1 A;  1MZB A;  1YDI A;  5JVE A;  3OR1 C;  2CQX A;  2ZC2 A;  3Q0W A;  1ZHF A;  1H88 C;  1AWC A;  3A0B C;  5M5X J;  4ZYG A;  3LS1 A;  3J80 Z;  2DW4 A;  2W57 A;  3I64 A;  5D8K B;  2OU2 A;  2XLM A;  2ELK A;  4U0V A;  5B1B C;  5H6Q A;  3H5A A;  3DM5 A;  5IP9 J;  1XSX A;  2DOF A;  3X1O A;  3M1E A;  2BXZ A;  5GAD J;  2X48 A;  1PYV A;  3HXL A;  4M3D A;  4FCY A;  3HNJ A;  1XX5 A;  4I09 A;  3R4K A;  3ISP A;  1O4X A;  2DU9 A;  4XLE A;  3IH4 A;  2F4M B;  4HST A;  1AEP A;  3G71 I;  1LVK A;  2KL4 A;  2LQG A;  1XZQ A;  2J9U A;  2XS1 A;  1TC3 C;  1YJN I;  1G5Z A;  1OKR A;  4DRH B;  3RQI A;  2NYX A;  3RKQ A;  3ABU A;  2DAO A;  2LOO A;  2LKX A;  4XLP F;  1ST6 A;  5BOX A;  3QPS A;  3DEE A;  5CLS A;  3WTZ A;  2NSF A;  3ZQH A;  5KAF C;  3GTQ J;  1XWJ A;  5COM A;  4XOT A;  1NK3 P;  3S93 A;  4ANJ A;  1KU2 A;  3G3Z A;  3DJN B;  3VFZ A;  5F1J A;  2DJN A;  3HOT A;  2E5Z A;  3NG1 A;  4RDU A;  2OJE D;  1SAU A;  3NAU A;  1N75 A;  1YA9 A;  1QNT A;  1C03 A;  2YRF A;  3ZQQ A;  3H3U A;  4DBQ A;  2NS7 A;  4KNY A;  3GWZ A;  4LD5 A;  3V7R A;  4I7H A;  4BU2 A;  3EGX B;  1MBJ A;  3DMD A;  2F6C A;  3QQA A;  1QVU A;  3GZ6 A;  2CGE A;  3FMS A;  4U5F E;  4KMU X;  4A3I J;  3FVY A;  4JKV A;  2GQQ A;  3H2V A;  2HFI A;  1OQC A;  4CIH A;  2QNL A;  1BW5 A;  5J3L A;  5HDG A;  3PDM P;  4JQF A;  3EJN A;  2Y9Y A;  1QHG A;  3NQO A;  1MD0 A;  2VBX A;  4XEV A;  1D3Y A;  4MTD A;  2AHQ A;  1ZHX A;  4FQG A;  2I8D A;  1V3F A;  1NLX A;  2LSE A;  2XUB A;  3OS0 A;  4AL1 A;  3P7N A;  2W00 A;  2R7O A;  1KU3 A;  2C04 A;  3CCE I;  3B0U X;  4M9S A;  3FOP A;  3HLZ A;  3K0L A;  4CGZ A;  5M5Y J;  3A2K A;  4EEF G;  1FMV A;  2UV1 A;  3K4L A;  3KP7 A;  5KAI C;  3WTT C;  3C8G B;  3R6S A;  2M34 A;  3GM1 A;  3U2M A;  1PDN C;  2HJ3 A;  3BR3 A;  1FLI A;  1EA8 A;  3VYS B;  4S0H B;  4XN0 A;  2VL8 A;  5T3W A;  1HC8 A;  2O6G E;  3CUO A;  1QQ3 A;  2MH2 A;  4KYW A;  4I1O B;  3DPL C;  4AYB A;  1H8A C;  1D8K A;  4DBR A;  2ECB A;  3KLO A;  2Q1Z B;  1OKK A;  2KGO A;  3S0X A;  2HU9 A;  3IH3 A;  3ZMD A;  4LLN A;  2K9M A;  1KNY A;  5F0H A;  5DV5 A;  3L00 A;  3TP3 A;  1IN4 A;  4BY1 J;  1QU3 A;  1VQ9 I;  5IYC J;  4HEA J;  5F5F A;  2OOC A;  1D0X A;  3SXY A;  2LK4 A;  3MZY A;  1D1C A;  3FWE A;  5DQT A;  1GQA A;  1LDD A;  4DYR A;  2G62 A;  3ULQ B;  4HF2 A;  5E3A A;  4J30 B;  1MND A;  4NTA A;  5K1Y A;  3VAY A;  3CJR B;  1WAT A;  2GLO A;  1Y6D A;  3ZWI A;  2GOX B;  4O3M A;  1YI2 I;  1WGX A;  1BOB A;  5C44 J;  2EIJ C;  4ZLC A;  3OL3 A;  1LJ9 A;  2DDA A;  2AXL A;  2OKU A;  3FXH A;  1POG A;  2I15 A;  1U6G A;  1V74 B;  4YRV A;  1TWH A;  2XXA B;  1U9N A;  3RYL A;  4IAQ A;  1YYV A;  1CGM E;  3AG2 H;  4ZYA A;  2AP3 A;  1ZU4 A;  3QRF F;  4YN0 B;  2X6X A;  1SFX A;  4P55 A;  2GAQ A;  5K7F A;  5D8L B;  1K79 A;  2L9V A;  3TQN A;  3PO3 J;  1FEX A;  1NU9 C;  3EFO B;  3BR2 A;  4QPO A;  1X19 A;  4FAS D;  2LP0 A;  4IOC F;  1Z91 A;  3BJ6 A;  3GWN A;  1BR4 A;  4MQ9 F;  1I3A A;  1M6T A;  3BJA A;  4QI2 A;  4FAP B;  1TNT A;  2EA2 A;  4F93 B;  5L0D A;  2XV4 S;  1BC8 C;  5B1B H;  5FFX A;  3S16 J;  3BP8 A;  3LL7 A;  2YLI A;  1EH7 A;  3K1N A;  3KP5 A;  3M7G A;  3QAH A;  4CS9 A;  2JRT A;  3EPV A;  4Q48 A;  4AVZ A;  1JJ6 C;  1XTA A;  1GXP A;  1NFN A;  3C8G D;  3WU2 C;  1CGP A;  3LUT B;  1QRY A;  2K4J A;  3HDD A;  1S05 A;  2XB5 A;  1OCT C;  2Q9C A;  1U8B A;  2DQR A;  2QEN A;  1E2X A;  4B09 A;  1FBQ A;  5J1Y A;  5E18 F;  3ZSU A;  4J19 A;  5DD4 A;  4IGG A;  2KRC A;  5D5X B;  2VQH A;  2IS1 A;  5GTI C;  2DA5 A;  5K5R A;  1OCR C;  3T9O A;  1WPK A;  2CW8 A;  1SFE A;  3ESW B;  4WJ0 A;  1OR7 C;  2R92 J;  1XMK A;  2J7P D;  5JP7 A;  4IAR A;  5E79 C;  5J40 A;  1YYJ A;  2E35 A;  2QBY B;  2GIV A;  3K4B A;  1G2H A;  4IWB A;  4PDK A;  1BIA A;  3KP4 A;  3L2Q A;  3M79 A;  2P8T A;  3TGN A;  4BHP A;  3GZN B;  5JHF A;  1ONV A;  2PJR A;  4BEH A;  1HLV A;  3ZQY A;  2EPO A;  4ENM A;  2ETH A;  4U88 A;  3ATP A;  2MWQ A;  3JSZ A;  1IDY A;  2Y0M A;  4IJJ A;  3SDB A;  3JCU C;  1USS A;  2A6T A;  2ZCW A;  3HOY J;  3GM3 A;  1M56 C;  3K69 A;  5L3D A;  3LWF A;  4MIM A;  2Y3H A;  5F28 E;  4M6V A;  3OSF A;  2XSE A;  3SFZ A;  4DXW A;  1XGS A;  3US6 A;  1Y56 A;  3QVZ A;  3TOM A;  4IPA A;  3MFK A;  4M9X A;  4GCV A;  3BLY A;  1ZKG A;  3BQY A;  2K5C A;  3JTH A;  4RAZ A;  5LEJ A;  4XKW A;  4KDP A;  1P92 A;  3G50 A;  1V5G A;  4ZZD A;  5LHI A;  3O55 A;  1WJD A;  2PI0 A;  2A5W A;  2L9N A;  2M30 A;  3HBL A;  3BWG A;  1RRJ A;  4XMY A;  5E8G A;  3MAJ A;  5L0J A;  4NC8 A;  1G59 A;  2J5P A;  4AX2 A;  2YEV A;  1Y39 A;  2L9S A;  4XK4 A;  3JRH A;  1ETK A;  4CYC A;  5ICE A;  4ESJ A;  2VOD A;  2Y69 H;  1J9I A;  5C4J J;  1MMN A;  1RKC A;  2XGE A;  2VQL A;  3LSP A;  3D1N I;  2XSJ C;  4LK0 F;  3TJ6 A;  1KTM A;  2LCH A;  2X6W A;  3F23 A;  5DD8 A;  3WTW C;  2O61 A;  4E0H A;  1Z67 A;  4CO8 A;  5COG A;  3ABM C;  1VMA A;  4IJA A;  5IYB J;  4Y52 J;  2K9L A;  1R5H A;  1R00 A;  3K7A J;  1OMI A;  4U5H A;  2X0C A;  2BVL A;  1E84 A;  2LG4 A;  1S72 I;  3JYY A;  5LGN A;  2PX0 A;  3RFY A;  5E3C A;  3VB2 A;  3V7C A;  4HZF A;  2IGM A;  2ZME C;  3MCZ A;  4HLY A;  3RZD J;  1P4W A;  4II3 A;  4D1Q A;  1YIJ I;  1I5N A;  3DE8 A;  2PF4 E;  2M9H A;  3CCR I;  2F5E A;  1R5G A;  4AID A;  3H5R A;  3RZO J;  1JAF A;  5EG0 B;  4N0B A;  3B29 A;  2IS2 A;  2Q2E A;  1NSG B;  3NYM A;  1QHH D;  3AAF A;  1FTZ A;  2E7X A;  4MO7 A;  3L0I A;  4BYY A;  2JN6 A;  1CGN A;  1YZA A;  2KYH A;  4ESB A;  3JW4 A;  3S28 A;  2L9J A;  2NNN A;  3NEU A;  3LLI A;  1XDU A;  4XR6 A;  3T8R A;  4JEA A;  2LH9 A;  3REO A;  4CH7 A;  5IT3 A;  3D5L A;  3MWM A;  3IC7 A;  2L6H A;  2HZD A;  4II2 A;  5GAE J;  5DYM A;  3QYB A;  2VJ5 A;  2YPR A;  1HKQ A;  5B1A H;  1B6A A;  1TW3 A;  2JSC A;  1IUY A;  2A68 F;  3RVY A;  2XAU A;  3E6M A;  3RPU D;  3K6G A;  4HNU A;  3GFI A;  2NPU A;  4WXC A;  4MVM A;  1T33 A;  2KDZ A;  3ABL C;  2BGC A;  4OAY A;  2OPT A;  1FFT C;  2RRE A;  3CF5 F;  4HFK B;  3RDI A;  1G6N A;  1ETO A;  4C3H J;  1ERD A;  2IS4 A;  3QTH A;  4Z9I A;  2Q8K A;  2I10 A;  3OYA A;  4CCK A;  5GTH C;  2EIM C;  3KCC A;  1FBU A;  2P1A A;  2BYV E;  4M3G A;  2A6H F;  4XKV A;  3LOC A;  4HYE A;  1ZRD A;  2W24 A;  3OYN A;  4K2E A;  3TQO A;  2J9B A;  4M6X A;  3S1M J;  2E2I J;  4QI0 A;  1IV8 A;  3OYG A;  3O39 A;  1T9K A;  4KC9 A;  3ECS A;  4EJV A;  1TT5 B;  3PIP F;  2CNW D;  4W97 A;  4A6D A;  4M63 A;  1R23 A;  2XKP A;  3FF5 A;  4E7L A;  3ZQV A;  1F4K A;  4CCO A;  3DTE A;  1MSE C;  3DXJ F;  2M7B A;  1YIO A;  1X1C A;  2LBF A;  4G6T B;  3M3Y J;  3W6J B;  2CMP A;  2OA4 A;  5C4X J;  1MQV A;  1I39 A;  3PUF A;  4EV0 A;  3L7W A;  5E2Q A;  2P0W A;  4X1E A;  1L0O C;  4C3J J;  1UB9 A;  1OCO H;  2WV1 A;  5F27 A;  3WHB A;  1ZHW A;  5IP6 A;  1A04 A;  3HZJ A;  2YKZ A;  5HS9 A;  2TCT A;  3MYF A;  1F9N A;  2XLV A;  3B6A A;  5BNG A;  1WGW A;  2QZ8 A;  3O8H A;  2NOG A;  4NDL A;  4A3G J;  2A1D D;  2WAQ N;  4KUM A;  3AL0 B;  4DQ2 A;  3ZRG A;  3PFY A;  4FWV A;  3P9C A;  2YUS A;  4PGH A;  2A5Y B;  4TV7 A;  1MBE A;  5JSL A;  3C18 A;  1G3S A;  1T56 A;  4I02 A;  4M3E A;  4CSA A;  4F55 A;  4JYK A;  1JPJ A;  2DFF A;  4MVZ A;  3HKZ N;  4HX4 A;  2OG2 A;  3EYY A;  3ASN C;  2KIU A;  1VOM A;  1KYW A;  4HNT A;  3RQE A;  5IY5 C;  2DO7 A;  2L4A A;  3TK0 A;  2ELH A;  1Z05 A;  4IVN A;  3UMK A;  4FTH A;  5EF6 A;  2PX3 A;  2FXA A;  3B9Q A;  2H1K A;  1IZM A;  2V3C C;  1IG7 A;  4JRZ A;  1AA7 A;  3HRM A;  3HM5 A;  3SEO A;  4F7Z A;  4OIR F;  1ENH A;  4UHT A;  4MHG A;  2K40 A;  3E97 A;  4DIQ A;  4ZYH A;  1ETV A;  5LRR A;  1UFM A;  3RCO A;  4UY8 I;  4I1M A;  3HGG A;  3FKJ A;  2RD9 A;  2HQN A;  2AVK A;  1ZHY A;  4MEY F;  2R0Q C;  1MDM B;  1WHU A;  2Z16 A;  3GEH A;  5B3S H;  2FOK A;  4Y4R A;  3OEO A;  3LSH A;  5F1R A;  1UG2 A;  3F3X A;  1B8I A;  2BOL A;  2VIX A;  4HV5 A;  4JW1 A;  3S2D J;  1T38 A;  1RJ9 B;  5HV9 A;  4C3E A;  4LGW A;  4MFD A;  2STW A;  1AU7 A;  2M45 A;  4BGD A;  3H3V K;  3RQG A;  2J45 A;  2G3V A;  4BJ1 A;  3PM1 A;  3BDD A;  4HPQ A;  5F6F A;  3UKG A;  2K02 A;  2VH3 A;  2W45 A;  2QE9 A;  2ME6 A;  2HXO A;  2ME0 A;  2HPI A;  3PFI A;  2FF4 A;  1J5Y A;  3G1M A;  3AJM A;  2G7H A;  2XKO A;  2M64 A;  2X1D A;  2ZXW C;  3ZQL A;  4LMY A;  1BR2 A;  2AQF A;  2ZJ2 A;  5D6E A;  4F3Q A;  3RKW A;  2E87 A;  3RH3 A;  1HW1 A;  3ECO A;  5CQG A;  1BI3 A;  3IQ6 A;  3VRC A;  1D8J A;  3HIF A;  2NUT A;  1VB5 A;  2MYS A;  3GVA A;  3U3B A;  1EH8 A;  3DE9 A;  2P61 A;  3CSK A;  1LKX A;  4R79 A;  1N25 A;  2MA3 A;  1R58 A;  3T5X A;  2XGX A;  4OOI A;  3TO7 A;  3H65 A;  3MZH A;  1BM9 A;  1Z7L A;  5CI8 A;  2DPU A;  1WJ5 A;  5D4R A;  4Q7C A;  1TNS A;  2O03 A;  3V42 A;  3KZI C;  3GOD A;  5DVW A;  1LI5 A;  5LRS A;  2EJR A;  2WB1 N;  2RN7 A;  3S2W A;  3F9K A;  2COM A;  256B A;  4HE8 D;  2BEO A;  4XON A;  1MBF A;  5KYW A;  4AU7 A;  2QKM B;  1FMW A;  3P9K A;  4PJL A;  3H5N A;  1SEU A;  4ENJ A;  3PSF A;  1VQK I;  2HMQ A;  4RB2 C;  1WH5 A;  4AYB N;  5JS5 A;  1VQM I;  5KYU B;  4XRF A;  3VPR A;  2M87 A;  2LTP A;  2EZI A;  5E1Z B;  1QGP A;  5LHH A;  4CS7 A;  1T6S A;  2J5O A;  2CW0 F;  4LJZ F;  3U9M A;  4YT5 A;  2RQQ A;  3IRQ A;  2HWV A;  3UGO A;  3B73 A;  2EH3 A;  3COA C;  2DMT A;  5FKN A;  4PJM A;  5H2F C;  3W8H A;  4B48 A;  1HQC A;  2YSR A;  5HDN A;  1YLM A;  2F22 A;  4FE4 A;  1V5F A;  5DDG A;  5IP7 J;  1ZLJ A;  1YFH A;  3Q9S A;  4EGZ A;  4A3L J;  3ZPL A;  1A36 A;  4EKW A;  3KET A;  1R6R A;  1PVE A;  3N4M A;  2CV1 A;  2M4K A;  3G2B A;  2UXN A;  2O7O A;  1CF7 B;  1ORY A;  2ISZ A;  2KIF A;  5GPA A;  1FJL A;  2XPU A;  3RQ4 A;  3S1R J;  1OR7 A;  2VPL A;  2IYL D;  1H89 C;  1QQI A;  1Z6T A;  1I27 A;  4LIV A;  2X4H A;  1FIP A;  1FTS A;  5KYY A;  3AGU A;  1B72 B;  4BEH B;  1DPU A;  4HX7 A;  5EGO A;  1Z3I X;  4KIS A;  2DMU A;  3ZP5 A;  4JK1 X;  4IOA F;  5TJJ A;  4BE1 A;  4N4W A;  1UHW A;  5AIP A;  3JSE O;  1MIJ A;  4MLO A;  2CYD A;  4IHY A;  3BY6 A;  3Q6N A;  3MBG A;  4HBL A;  5ILV A;  1CPR A;  2MC4 A;  4XLC A;  4S05 A;  3KP3 A;  3RTR A;  1ULY A;  5CVI A;  1UG7 A;  3LST A;  5FLX Z;  3M4C A;  2KRH A;  3J7Y J;  4NQW A;  4F52 A;  2HTS A;  3SJM A;  2E36 A;  4YJW A;  3GME A;  4Y17 A;  4V19 K;  3DCF A;  4AIH A;  2WVQ A;  1JI8 A;  1I50 J;  2JUG A;  3GUD A;  1TR2 A;  3ZIB A;  1SVO A;  1W5S A;  4DVY P;  5FO5 A;  2BBY A;  2X9D A;  3K4J A;  2V1D A;  3ZOB A;  3SXM A;  2V7F A;  3A0H C;  1YW8 A;  1RNL A;  1OXB A;  4ZDO A;  2DOA A;  1QSP A;  2AU5 A;  1Y0U A;  5J1U A;  5KCM A;  3E70 C;  4JCZ A;  3K1P A;  1HY5 A;  4IRG A;  2DTR A;  2NVY J;  2MG4 A;  2AO9 A;  3N05 A;  4DYQ A;  3CLQ A;  2GOM A;  2OU6 A;  2HKO A;  3H36 A;  4OMZ A;  3ABM H;  2L0K A;  4ESF A;  1C0W A;  1ZHT A;  4JEB A;  1QVX A;  1SD5 A;  1FPQ A;  4H4K C;  2XAQ A;  3BTL A;  4EM0 B;  1QPU A;  2PBI A;  4JIO A;  3KZZ A;  1DDN A;  2FSW A;  3D0S A;  1Z6R A;  3FX3 A;  2COB A;  3CES A;  2A07 F;  3M15 A;  4O79 A;  3SNH A;  4ZLD A;  3H0D A;  2QLA A;  3J81 Z;  2R7D A;  3H35 A;  1LQ1 A;  2R5Y B;  4BAC A;  1Z63 A;  3I4M J;  3RJP A;  3PNT A;  3Q0U A;  2EFW A;  3WTV C;  2NVX J;  2UUZ A;  2EFP A;  1TTY A;  1QZZ A;  2M4G A;  2DYR H;  1OJL A;  2KJC A;  2OF7 A;  2W4S A;  3A1Y A;  1BA5 A;  2HSB A;  3DJU B;  4YG2 F;  4UUT A;  3EH1 A;  3J7Z I;  2VXZ A;  2GIZ A;  3A02 A;  3BTJ A;  1HW2 A;  1Y4C A;  1GXQ A;  1WTY A;  4OIN F;  1OW7 A;  4KMF A;  5BMZ A;  3ELK A;  3TW7 A;  3H0G J;  3AG4 C;  4ZH4 F;  1J8M F;  2QQ8 A;  2EIL H;  2R7T A;  2LY9 A;  2B9S A;  2QEX I;  2DFE A;  2W7N A;  2NSG A;  2V4J C;  4WXH A;  1JT6 A;  3MD2 A;  1U8R A;  2P0N A;  3WU0 A;  1RES A;  1DQU A;  2DDB A;  4CSW A;  5A2Q K;  3H1C A;  1K78 B;  5L0F A;  2G9W A;  4I0A A;  4WXD A;  4MTG A;  3NMJ A;  2HQR A;  5C3E J;  1QZY A;  5JHU A;  3EFO A;  2OQG A;  2OUM A;  4HEA 2;  3GWL A;  2HQ5 A;  2DYS C;  2L02 A;  4DZJ A;  1S5L C;  1Y6I A;  4IHV A;  5HSW A;  2V1U A;  1H9G A;  4NTF A;  3IKV A;  1HF0 A;  4I99 C;  4CDA A;  2QQA A;  4WGZ A;  3EET A;  2OV7 A;  2H6C A;  4ZTF A;  2Q00 A;  3ZQC A;  3AQB A;  5D5U B;  1OCP A;  3ASO H;  1VYK A;  2ZO4 A;  4GXO A;  1LFU P;  1OW6 A;  4A6E A;  3FDY A;  4LK1 F;  4LDR A;  3RKY A;  1IRG A;  4KA4 A;  3EHM A;  4EBJ A;  1MJ9 A;  4BJ5 C;  1FFH A;  4RBO A;  4HDU A;  2LD6 A;  3BPV A;  3PMR A;  1X58 A;  3WGI A;  4CA0 A;  3J81 K;  1QZX A;  4DRJ B;  1JOG A;  1ZW3 A;  3U1D A;  1NTC A;  1U78 A;  2DLL A;  4HX8 A;  1AVO B;  3RW0 A;  2VUM J;  1L3P A;  4XID A;  3S3N A;  1OFC X;  3C2G A;  2HZ8 A;  4O6N A;  1KU9 A;  4RGS A;  3S17 J;  2E1M C;  2KLO A;  4PUS A;  3SHF A;  3ZR8 X;  3I56 I;  1M1E B;  2G0E A;  1JKP C;  2KSF A;  5HS8 A;  3S90 A;  4NHJ A;  3B71 A;  5JVT A;  3HOZ J;  1X1D A;  5J8F A;  3GW2 A;  4JBA A;  3HOV J;  3G4Z A;  4ZZL A;  1YQA A;  5ILS A;  2PJR B;  1O87 A;  2EPK X;  2FFH A;  2L7Z A;  4EM2 A;  5T3T A;  2XGD A;  2JVH A;  3FHD A;  1FOX A;  5EJC A;  4EJU A;  2JK3 A;  1ZEL A;  2CW7 A;  3HOS A;  1D1A A;  2HS5 A;  3QU6 A;  1CQT A;  3KEY A;  5EGY A;  1UMQ A;  5L3G A;  2DYR C;  4CCM A;  1E86 A;  2M1B A;  3PJR A;  1MMD A;  4QIW N;  2ZJR F;  1EKE A;  4KIB A;  1GVD A;  3UGP A;  1LPE A;  3BG9 A;  3HHH A;  1U3E M;  2JA6 J;  1YO5 C;  4L0Y B;  2EPL X;  4JE9 A;  3C1D A;  2DXI A;  4OIQ F;  5COF A;  5FCL A;  3BR0 A;  4QLC U;  2ZXI A;  3CDI A;  1J8Y F;  5L3F A;  1IRF A;  1J2X A;  5DCM A;  1YS6 A;  1T5O A;  2ZFW A;  1TW2 A;  1W36 D;  2EFQ A;  3HRU A;  1MDM A;  1HA8 A;  3KH2 A;  2LRE A;  3HTU A;  5LFA A;  3BZK A;  3FXL A;  5A69 A;  1RPW A;  4YFK F;  3HL2 A;  2VJI A;  3POV A;  2MH9 A;  4KN4 X;  1FIA A;  2X1C A;  4I6Z A;  3NYL A;  1MGT A;  3IKT A;  4BE0 A;  2EPM X;  1X4O A;  2MD5 A;  1IF1 A;  3K2Z A;  2B7E A;  2E71 A;  3FHZ A;  1ZG3 A;  2JJ7 A;  4FHT A;  2VC9 A;  1UEL B;  4E17 A;  1YG2 A;  5ED4 A;  2HFH A;  1OYI A;  1SMY F;  1V4A A;  3DTI A;  4E7K A;  2LDU A;  1TQM A;  4ETS A;  2RC4 A;  4GYG A;  2WB7 A;  3E0J B;  4P1W A;  4MW8 A;  1W7P D;  2JMW A;  4G6Q A;  2GFH A;  2XGC A;  3ABT A;  2V6C A;  5F0F A;  4IQJ A;  3ZTZ A;  4M9Z A;  3LSR A;  2C03 A;  1T0F A;  3TBI A;  3O6X A;  3ZQG A;  4U5E E;  2H8R A;  2LR8 A;  1UAA A;  2Q7R A;  3HRT A;  2DFH A;  2XPV A;  4WK8 F;  3OL4 A;  1K40 A;  2VKD A;  2ZPA A;  3NMK A;  1E83 A;  1EH6 A;  1G4D A;  3NAR A;  4C9Y A;  4KIT B;  1S8N A;  2Z2S B;  1TLH B;  4YFN F;  3IPM O;  3IP4 B;  2NUT B;  1YAR O;  1S9H A;  4PGG A;  1TZL A;  2PMU A;  2XRO A;  4N9H A;  4EJO A;  4ZTJ A;  4R1H A;  1I4Y A;  1KYZ A;  1QPM A;  2A3S A;  3DLL F;  2H8A A;  2Y39 A;  2LD5 A;  1T6I A;  2HDC A;  2NS0 A;  2J9V A;  4W8K A;  4D7M A;  2LVS A;  4DVZ A;  1ZYR F;  3GXO A;  3CMY A;  2KJB A;  2R7F A;  3JYH A;  3KKB A;  2YLG A;  2Z99 A;  4HQM A;  3DKX A;  2KKO A;  1ETW A;  1P7I A;  4MQV A;  2ZXW H;  1RCP A;  4J7T A;  1DU0 A;  3WAQ A;  2HI3 A;  3ZMS A;  1XS9 A;  1QA6 A;  2D5R B;  1R4M B;  4EMS A;  4BBS J;  4LB5 A;  2LRD A;  3GBG A;  3CDL A;  1YTY A;  3E3V A;  3DWL E;  1E3H A;  5IY5 H;  5TJ5 E;  2X51 A;  3V5X A;  3HOW J;  4F92 B;  4G78 A;  1FWZ A;  4U5B E;  2OQM A;  2DGJ A;  5FKO A;  1BI1 A;  1SZI A;  4CDG A;  4EIY A;  4UUV A;  1FX7 A;  3A03 A;  1OYW A;  3F8N A;  5HLG A;  2QSF X;  1SC7 A;  1JE8 A;  3CMM A;  3VM6 A;  3H9J A;  4IL6 C;  2ACJ A;  3RYR A;  1M57 C;  5L0I A;  1I1S A;  3JRF A;  2XPW A;  4IZZ A;  3G4S I;  1VQN I;  2HYF A;  2CQN A;  1RKW A;  2VJ4 A;  2L6F A;  2MD0 A;  4E6K G;  4O6M A;  4YIF A;  1IV6 A;  4BKX A;  4E7H A;  3IEE A;  1R36 A;  1NH3 A;  4AE4 A;  2D1V A;  1EV7 A;  4BQQ A;  1KQ0 A;  3Q9V A;  2A0U A;  4LDQ A;  3CCL I;  5IOZ A;  2RNG A;  3ABK C;  2PG4 A;  3AGT A;  4I2O A;  1XPX A;  2KRF A;  3QOP A;  1B72 A;  2JA7 J;  4OIO F;  4BHB A;  2XS8 A;  3K1I C;  1DGR M;  5ERI A;  3TDU C;  5D4S A;  1QBJ A;  4JP0 A;  1HST A;  2WC2 A;  3I9V 2;  4ZDP A;  4L18 B;  2ZNZ A;  5LGU A;  1ZVZ A;  1P7J A;  2KP6 A;  3HUG A;  3JR9 A;  3SXK A;  2L54 A;  3E5Q A;  3W2V A;  2N8G A;  5J4Y A;  3EZI A;  3JRA A;  2DQL A;  1IUF A;  4MS2 A;  1ITY A;  1YS7 A;  3EDP A;  1L3L A;  2ZXO A;  2EZH A;  2O0Y A;  2PMH A;  5IT9 Z;  1J59 A;  2KIM A;  1PUF A;  4JJG A;  5HVQ C;  1VF9 A;  2KNH A;  3N24 A;  3ZQF A;  4CYC B;  3R0A A;  1NBB A;  4IHT A;  2NS8 A;  1A7V A;  1SD7 A;  3FMQ A;  3QPT A;  3CCJ I;  4BPM A;  2IGK A;  5HNF A;  2HEO A;  2M7A A;  3MEX A;  4JX5 A;  3W3C A;  2XSD C;  3OWT A;  3HSR A;  2Q9B A;  4I44 A;  1B1B A;  2EIN H;  1O57 A;  3PNY A;  3RPU A;  3GFL A;  3ZN1 A;  4D9J A;  4YL3 A;  1IN6 A;  1MNM C;  1I5Z A;  1LVA A;  1UZC A;  3HJE A;  2BW3 A;  1YX5 A;  2EV0 A;  5DUI A;  3CP8 A;  5E1W A;  2WWY A;  1HMO A;  2PN6 A;  4BBR J;  2CV0 A;  4CHU A;  4RAY A;  2HOT A;  5B3I A;  3WG7 H;  2WTE A;  5EEA A;  2YZS A;  5KYX A;  3ZVR A;  5K7Z A;  2HV6 A;  3GTG J;  4EM1 A;  1ZGJ A;  5GPG B;  2HDW A;  3CP2 A;  3I59 A;  2O8X A;  3CC7 I;  3CF2 A;  1RET A;  3ZQI A;  5FLV A;  2LFD A;  1ZLK A;  4MVQ A;  3LSI A;  4KIC A;  3IV5 A;  1ORS C;  3CTA A;  2EQR A;  1BIB A;  2R3S A;  2PFB A;  4O5V A;  4U0W A;  4K1O A;  1GGQ A;  3JAM K;  4K7B A;  3H9G A;  2XC7 A;  3LLK A;  2JD3 A;  3W6V A;  5EYR A;  1OQY A;  1X1B A;  3GFM A;  4MTE A;  4PSX A;  1RJ9 A;  5KK1 A;  3ZMT A;  4ABZ A;  1A31 A;  2DOD A;  4F4B A;  1RR7 A;  4U5G A;  1FYK A;  2L9R A;  2D4U A;  3BJO A;  2HVR A;  4BE2 A;  2GWR A;  1I4Z A;  5K5Q A;  4P9F A;  3KYI A;  3G1L A;  4HDV A;  3D5S C;  2M2E A;  4B1R A;  2NXN B;  5BQT A;  3CCS I;  2VCB A;  4R32 A;  2ZNY A;  3MFN A;  2KQR A;  1ORK A;  1WCM J;  3ZTM A;  4BJ5 A;  1KON A;  4P9U A;  1GT0 C;  3S84 A;  5B3S C;  3F8B A;  5HNH A;  4XRM A;  3CME I;  4KNV A;  3DU6 A;  1NFO A;  2LY2 A;  3GTK J;  2P7V A;  1W2W A;  2XVC A;  2PJP A;  4HNV A;  2XXA A;  3KE2 A;  2YL0 A;  3DPT A;  2EPF A;  3ZCO A;  5CVJ A;  1YHQ I;  2P7V B;  2JUC A;  4ZJZ A;  5TGT A;  2DPD A;  1FY7 A;  3PQK A;  1LFB A;  1Z5Z A;  1FP1 D;  5K7H A;  3LEV A;  1TWC A;  3NRV A;  3PQJ A;  2CYY A;  5HOO A;  2RAE A;  4IHS A;  4DRI B;  4YT8 A;  3VOE A;  2H6B A;  3TOL A;  2RGV A;  1A5J A;  3T4R A;  1MH3 A;  2ESN A;  4XN3 A;  4PFO A;  2UUI A;  3DPU A;  4WF2 A;  1VFC A;  1OCR H;  4Z6Y A;  2QWW A;  1MBH A;  4XTK A;  3JTL O;  3BG6 A;  3ZMU A;  3AQC A;  2CUZ A;  4GQH A;  4FX5 A;  1MW7 A;  2CWE A;  3DU5 A;  3F8C A;  1JHF A;  5KYN A;  2VOP A;  3MVP A;  3VYT B;  2VQG A;  3K33 A;  2R5Z A;  3M07 A;  1SFK A;  4LLG F;  3TW6 A;  5J1R A;  3ITF A;  1LS4 A;  2Y31 A;  4QSH A;  2WL8 A;  2XL6 A;  1I6H J;  2V9V A;  3DQV C;  2R5Z B;  3WHN A;  2LF7 A;  4DYC A;  4A5N A;  2JVG A;  1WWP A;  2RSE B;  5EK0 A;  2F2E A;  4PFP A;  1TQP A;  2EFN A;  1F36 A;  3I5P A;  1FR0 A;  3LS0 A;  4UUS A;  3BEH A;  2FUG 2;  3DEW A;  2CUE A;  1XGM A;  4M3B A;  4J7Y A;  2K7L A;  2HTJ A;  3SQN A;  2H7O A;  2CG4 A;  2IOQ A;  3UR3 C;  4AIK A;  1ZTR A;  2E1N A;  1OW8 A;  4XEK A;  1FT9 A;  2G7U A;  4MTO A;  1HE1 A;  4C3D A;  4RAG A;  2Y3D A;  2CDQ A;  4D4N A;  2UZK A;  2R93 J;  4WX9 A;  2WZL A;  4CX9 A;  2GA1 A;  3AL0 C;  1BBH A;  4CBE A;  1GLN A;  3AG2 C;  3ML6 A;  1O3R A;  3S1N J;  1A0B A;  4ON0 A;  5AIQ A;  3K9T A;  3E5U A;  1K6Y A;  4XL9 A;  4BJ6 A;  3WTU C;  2HZT A;  4MFE A;  1XC5 A;  4BY7 J;  4ULW A;  4QTR A;  1TP4 A;  3TKY A;  3S8P A;  4CYD A;  4A93 J;  1FP2 A;  3GM2 A;  2W85 A;  3BTC A;  4A3D J;  3SYN A;  1PD0 A;  3LQQ A;  3HNK A;  1HDD C;  3IAS 2;  1O3S A;  1D5Y A;  1WJA A;  2LKP A;  1YZC A;  4YL1 A;  2NVT J;  5CIV A;  2YR2 A;  1FBS A;  2H1L A;  3M4O J;  4B3A A;  3RSN A;  3S9O A;  1VND A;  5FFZ A;  4CZC A;  3TP0 A;  1T6U A;  1A35 A;  3NWS A;  5FGM A;  5FRN A;  2K3F A;  4NQW B;  1TWA A;  1LDJ A;  3G1O A;  2EK5 A;  2XAF A;  2E60 A;  3JRE A;  3L2V A;  2VI6 A;  3BG7 A;  3E1S A;  3S3M A;  2EIL C;  5F5H A;  2AQE A;  3ZMV A;  1GV2 A;  2CFX A;  4OAZ A;  3LJB A;  4RMN A;  3FAP B;  2Y0S A;  2E2H J;  3GTJ J;  3HKK A;  3KMI A;  5DQZ A;  1IXR C;  1OCZ H;  2FNP A;  2H27 A;  3I55 I;  4HRI A;  1B59 A;  1RKE B;  2VLA A;  1ZQ3 P;  3QWL A;  1B9M A;  3BOQ A;  1C02 A;  2PP4 A;  2Q9A A;  1JHH A;  1UJ8 A;  4D5F A;  1B8I B;  4Y7N J;  3T6B A;  4A5M A;  3X2Q H;  4JVS A;  2GM4 A;  2P5V A;  2WY8 Q;  2G3K A;  2DFI A;  1R22 A;  1U0J A;  1W0U A;  1JMW A;  2Z1D A;  2WAE A;  4FIS A;  1BZ4 A;  1IN5 A;  1X3U A;  4BHC A;  3AG3 C;  3SFI A;  3KYJ A;  2M4E A;  3DKY A;  1C17 M;  1O7F A;  2FRH A;  1XGN A;  3JAM Z;  3JRB A;  1ZRE A;  2FEZ A;  3HTS B;  3QMK A;  3H3Z A;  2IXO A;  2YL7 A;  1LM3 B;  1EF4 A;  2DMN A;  2E1O A;  2F4I A;  2FMY A;  1BC7 C;  2VBY A;  3LA2 A;  1IRX A;  2ZME B;  1D0Y A;  3QP6 A;  2Z33 A;  5IT9 K;  4IEJ A;  1B68 A;  1Q0F A;  1ORJ A;  3LES A;  5AC5 A;  2EFO A;  1VLS A;  3VYW A;  1H9T A;  5EEG A;  4A2N B;  3DM9 B;  3JRT A;  5BQG A;  3A11 A;  4UV9 A;  1K4S A;  2W4M A;  1Z23 A;  2F48 A;  1VTN C;  1UG0 A;  1WOL A;  2J46 A;  2LMD A;  4ONS A;  3CUQ A;  3OIP A;  3BR5 A;  2QUF A;  2LY1 A;  4A0Y A;  3HEF A;  4L9V A;  1AUE A;  2CU7 A;  2E1M B;  3MYI A;  2XF5 A;  3Q0V A;  1H6G A;  3W4Y A;  1ZRF A;  4OMY A;  2ID3 A;  1SF8 A;  4BEM J;  4C2T A;  5BQH A;  2MW8 A;  3QYF A;  1M2V A;  3M1C B;  1DP7 P;  2GBY A;  4EAT A;  3JCU Q;  2E7W A;  1T6Q A;  1SYQ A;  3K70 C;  4UB8 C;  2O9L A;  2WZF A;  2F4O B;  3EUH C;  4XLF A;  1IXC A;  2HUJ A;  2A6E F;  4Y3O A;  4B6I A;  2BHY A;  4KT6 A;  5L3E A;  3JRM O;  1XGO A;  2L81 A;  4D4X A;  4YT4 A;  3TO9 A;  2CGP A;  1OPC A;  3E5X A;  3QW1 A;  1BW6 A;  2E2J J;  3VOD A;  3PNV A;  1Y8R B;  2B63 J;  1E0E A;  4A2U A;  3VWB A;  2DA1 A;  2ISY A;  1CF7 A;  4IHW A;  4E7I A;  2K9N A;  2LBF B;  1WQ2 A;  5KYY B;  4N6H A;  2FQ3 A;  2YLD A;  2EWN A;  3HRS A;  1G3W A;  5FLX K;  4MND A;  1BI0 A;  3F72 A;  4XKC A;  5LGT A;  3K2A A;  1OCC C;  4U0Y A;  2X6O A;  3AKZ A;  5FRO A;  2R03 A;  5K0I A;  3J80 K;  2J9W A;  3HOX J;  2W9Y A;  1R1U A;  3L2U A;  4CS8 C;  2NOJ B;  2GXA A;  4NNJ A;  3MX3 A;  3NMI A;  1RKT A;  3A01 B;  1OXK A;  3S27 A;  5EGO B;  2XLH A;  3EGX A;  1UHS A;  3TO6 A;  3G4X A;  5IPA A;  4Z2Y A;  2BZT A;  4F91 B;  1LEB A;  3S1Q J;  4AK9 A;  1A6Q A;  4RB3 C;  9ANT A;  1NHA A;  1QZE A;  1VZ0 A;  1U9O A;  1W7P B;  1ZAR A;  2GZW A;  2FBI A;  3T8T A;  4PSW A;  2DA7 A;  3LAP A;  3GTM J;  1K04 A;  3BCA A;  4C3I J;  4HF1 A;  2TRT A;  2NAZ A;  2QGU A;  4BAY A;  2CV2 A;  1J7K A;  3T1B A;  3TOB A;  1VQ6 I;  1YW9 A;  4E4H A;  1ON1 A;  4NCQ A;  3C2B A;  4MVS A;  1BI2 A;  1Z1D A;  2DOE A;  1LB2 A;  1REP C;  1N78 A;  1TWG A;  3BRJ A;  4NC3 A;  2BHZ A;  2FX0 A;  1J75 A;  3OYC A;  4PCQ A;  4FET A;  4EQQ A;  5F64 A;  2FGY A;  3I59 B;  2WA0 A;  2DCE A;  2IEK A;  4BQA A;  2VAS A;  1O3Q A;  4JC7 A;  1OCZ C;  2ZB9 A;  2R7W A;  1NZE A;  2MBF A;  4AC0 A;  4OD4 A;  1Z3X A;  2L7K A;  3CDH A;  2VCC A;  2DB4 A;  2AWY A;  2XRN A;  4AIJ A;  2CQQ A;  3RYP A;  2DTZ A;  1PP7 U;  2KPM A;  2YU3 A;  3QYE A;  4RM3 A;  5E3O A;  4ZC3 A;  3HOU J;  1S29 A;  4UNO A;  3QW0 A;  3BCB A;  4XRS A;  1DUX C;  5CVV A;  2YHS A;  4JTD B;  4Z9J A;  5F08 A;  1JUS A;  4RA2 A;  3IL2 A;  1QKR A;  1S7A A;  4BXU A;  5GPC A;  2RV8 A;  3K4K A;  2VT2 A;  5DLJ A;  4A3M J;  3IQT A;  2P7C B;  2MC3 A;  4B44 A;  3EGD B;  4B8X A;  2KZG A;  4C3B A;  2VC0 A;  3V5Y A;  3OIO A;  5CQE A;  2CUJ A;  2CCY A;  3V8K A;  4IHX A;  4CIP A;  1MMS A;  2D1H A;  5L3Q A;  1W4M A;  2IBF A;  3GO5 A;  3DKA A;  3MKL A;  3BZC A;  1RXQ A;  1B9N A;  1YAU O;  3ASN H;  2GA0 A;  1YW7 A;  4X0G A;  3VF0 A;  2J0W A;  3LA7 A;  4XLN F;  3V8J A;  2O5R A;  2DYS H;  4XQF A;  3JSO A;  2J8W A;  5J8C A;  2XAJ A;  3OYJ A;  2IJL A;  4PJN A;  1S7O A;  4R8H A;  3JRI A;  5FD6 A;  1HBX G;  2WVO A;  4PR9 A;  3ZC4 A;  1U6H A;  3GOR A;  2XLE A;  5JLX A;  3R7C A;  3FXU A;  2IVM A;  2KIS A;  4A0X A;  2HXI A;  2DK5 A;  1JGS A;  5LLQ A;  3CD6 I;  1ZK8 A;  4EJW A;  4G94 A;  1VYI A;  2F5C A;  1BOA A;  3G73 A;  5BQI A;  2CJJ A;  3NKD A;  4P6I C;  4BS9 A;  3TD7 A;  3T0Y A;  2ELJ A;  1Y1W J;  4EWC A;  2ZXR A;  3L1P A;  3EHN A;  1WSU A;  2IS6 A;  1T01 A;  4JUR I;  3CQZ A;  4BEJ A;  3O2P E;  1R9T J;  1TWH J;  2MAB A;  1IZ1 A;  3FMR A;  3MMY B;  2B0J A;  4GO1 A;  1FOW A;  3BG5 A;  3RIP A;  3ZDL A;  2ZXP A;  3W6K B;  4GYT A;  1BR1 A;  1PUE E;  4HW0 A;  4Q4Z F;  4ZYD A;  2K3P A;  1X3Z B;  1Z7U A;  4RGX A;  2TDX A;  3I71 A;  3S2H J;  5DEQ A;  3SZT A;  1PV3 A;  3K4C A;  2OAZ A;  1WH7 A;  1YLF A;  4YEL A;  1FSE A;  1H7I A;  2JA8 J;  2IGN A;  3PHF 2;  2KIQ A;  4A3E J;  4DJA A;  1DU6 A;  3CAX A;  3JRD A;  1ZH5 A;  2XL8 A;  2HVQ A;  1I1G A;  1V5E A;  4BDY A;  3N97 A;  1STZ A;  4AM3 A;  2DT5 A;  4CS8 A;  3F8F A;  4L5J A;  1E17 A;  4LDK A;  1OYY A;  2IPQ X;  3DKW A;  5LD2 C;  3BPX A;  3S3O A;  3E9V A;  3U8P A;  1X3W B;  3L8I A;  2Y48 A;  3U2R A;  5B66 C;  2FAP B;  1Q0K A;  4JTC B;  4Z9H A;  3IRR A;  5B5E C;  3X2Q C;  5LHG A;  3CC2 I;  5EHH A;  2FQ4 A;  2FJ1 A;  3EUH A;  3PL8 A;  4CZZ A;  1LE4 A;  3TMO A;  2L3D A;  4D7N A;  3M9A A;  5DM7 F;  2AS5 F;  2HVS A;  1L7C A;  1WRJ A;  4XSZ F;  3BT9 A;  2P81 A;  3ZXS A;  3BG3 A;  3DZA A;  3SZR A;  4LFU A;  2Y3G A;  2DJI A;  3HJC A;  4HOB A;  2X1E A;  2UUH A;  3R61 A;  3FXJ A;  4E70 A;  1JJ8 C;  3Q6M A;  5LBQ A;  2OZU A;  1KGS A;  3KZY A;  3TJ5 A;  3IHU A;  1SD6 A;  5AC4 A;  3F0C A;  1HKT A;  3ABK H;  5JVG F;  1ZGW A;  4G0H A;  4LLC A;  2Y75 A;  4GGG A;  4A3J J;  1U2W A;  2DMP A;  3OYB A;  2VC1 A;  1FOK A;  3I4N J;  2CSO A;  4X0R A;  1IDZ A;  2AXT C;  3OY9 A;  4AUX A;  3U9G A;  4JJF A;  2FA5 A;  4I76 A;  4E18 A;  4XPW A;  2CUF A;  2EZL A;  2PX9 A;  3S14 J;  1WJF A;  3O6B B;  1WJE A;  1Y8Q B;  4IF4 A;  1RI7 A;  4GYI A;  3WE2 A;  2PFD A;  5J47 A;  2XAH A;  2DT7 B;  4B3X A;  1TL8 A;  1DOV A;  3BZ6 A;  2JPB A;  4ASN A;  1APC A;  3J06 A;  2LKS A;  1XMA A;  2RKH A;  3EYI A;  2XF6 A;  1LE8 A;  1EA3 A;  2A61 A;  2R02 A;  1S6L A;  4N9I A;  3DD7 A;  3K1I A;  2VQC A;  2EIK H;  3CCV I;  2FNA A;  1IJW C;  1DOW A;  2I8B A;  5L3V A;  2JZY A;  2E34 A;  3L09 A;  3HSE A;  1HMD A;  2Q3T A;  2BE5 F;  2OD5 A;  1ETQ A;  3FZV A;  1OCO C;  3LQR A;  1W36 C;  2BXY A;  5JRA A;  4KJZ A;  1IN7 A;  3FIW A;  3TDZ C;  1ZGA A;  5K5O A;  1JUM A;  2TMV P;  1WJC A;  2QTV A;  3AG3 H;  1MMA A;  3H9Q A;  4IRU A;  2MSY A;  2W25 A;  1K4T A;  6PAX A;  5EG0 A;  1OKK D;  1G8X A;  3NRH A;  4IB4 A;  4V2F A;  4ULV A;  2WVN A;  1R5I D;  2O3F A;  3LA3 A;  4RAF A;  5HLH A;  4M71 A;  2MHR A;  2Y3B A;  3A9C A;  3PUB A;  2DI3 A;  3DWW A;  2LIG A;  4RLF A;  1LDK B;  2ZME A;  1ZW2 A;  4BDZ A;  2E19 A;  4ZYE A;  3UNG C;  1IW7 F;  2XF7 A;  5HS7 A;  1QLE C;  2VE8 A;  1XDS A;  3KIO A;  4EJT A;  4NC7 A;  2C6Y A;  1X1P A;  2BY2 A;  4FE7 A;  1YYX A;  2XL4 A;  4XEF A;  2HOA A;  1F1Z A;  2EIJ H;  4MTF A;  1OCC H;  3KP2 A;  3OIQ A;  3N0T A;  2HR3 A;  4IRI A;  1X2M A;  1YA7 O;  2GAU A;  2HGC A;  1O3T A;  3OV8 A;  3GZ5 A;  3LSG A;  4WCG A;  1ZZP A;  2IXP A;  3KFW X;  4DGW B;  4S04 A;  3GEE A;  1KA8 A;  4RDA A;  1YIT I;  2RDP A;  5D91 A;  1WFX A;  4M73 A;  4BQO A;  2GWW A;  2QKL B;  5IOY A;  5FLM J;  4BG0 A;  3FDQ A;  3BR6 A;  5CVR A;  4RS8 A;  2Y69 C;  3SEZ A;  4NUB A;  1P4X A;  1WJB A;  2HYG D;  3PSI A;  4Y33 A;  3QVY A;  5DCF A;  2FOW A;  2O9X A;  2LNB A;  4KI2 A;  4XIC A;  2UWM A;  2QSG X;  4JOM A;  5FRM A;  4JX6 A;  2CFO A;  4B4C A;  5HDK A;  4Q47 A;  1TQI A;  3LSJ A;  1BN5 A;  1B4A A;  3IQ5 A;  2HNH A;  3CCY A;  1XMX A;  4RD9 A;  2OJQ A;  2BY1 A;  2X85 A;  4MVO A;  4AE4 B;  1Q1V A;  5E3M A;  5FZT A;  4HQE A;  3OS1 A;  3TED A;  3K7D A;  4DOZ A;  2W82 A;  4GFB A;  1Z3Y A;  3JTG A;  1UFB A;  2KT0 A;  2A0B A;  1ZR2 A;  2ID6 A;  2E1C A;  1TWC J;  3U3F A;  2NUP B;  5ICG A;  4CDY A;  4C7O A;  3V5Z A;  2HJM A;  3MQ0 A;  3MKY B;  4BH9 A;  1A41 A;  2EA4 A;  4G7O F;  3I5U A;  5CPR B;  2Q4F A;  5TIS C;  2IAI A;  2OBP A;  5LEK A;  4MVR A;  3K4M A;  2PQ8 A;  4PZJ A;  1AOY A;  1RC9 A;  2BY0 A;  2HKV A;  4UXN A;  2KW3 C;  4XQ1 A;  1MJA A;  2VN2 A;  2IXS A;  1YX3 A;  4UVB A;  3U21 A;  3U1K A;  2ZXJ A;  2P5L C;  2E5N A;  4NBQ A;  4E7J A;  1PJR A;  2Z15 A;  2L01 A;  2LC2 A;  3NYJ A;  3TOA A;  1KU7 A;  3FXO A;  4QPQ A;  1WZ2 A;  4ENN A;  2EB7 A;  4EGY A;  3HUG B;  4XM3 A;  1TWF J;  2VXD A;  1RUN A;  1WAS A;  2JA2 A;  2HPM A;  3CCM I;  1LEA A;  1Q0G A;  1N1C A;  3HNI A;  1XB4 A;  3RVZ A;  2WAF A;  5BPD A;  1T08 B;  1P4A A;  2YS9 A;  2UXX A;  3WOD F;  1YVI A;  1APL C;  1MBK A;  4P96 A;  2X6Y A;  3QPH A;  1VQ4 I;  2KC3 A;  2AWC A;  1Y1V J;  1J0R A;  3DP7 A;  3O3K A;  2XLD A;  1W0T A;  4D0P A;  3V8L A;  1EI7 A;  3OOU A;  4XLH A;  4CCL A;  2W1O A;  4O7G A;  1VQL I;  1ZR4 A;  4KIF A;  1UHM A;  2W84 A;  1QVT A;  4N6C A;  2KZV A;  2V1N A;  3LNQ A;  1D1B A;  3GTP J;  1K6O A;  1O5H A;  2R4G A;  3EQL F;  2LP4 A;  2WZG A;  3IQC A;  2IA0 A;  1SAN A;  3JRG A;  2ASR A;  2KHM A;  3ASO C;  4OWR B;  3ONQ A;  2VB6 A;  3MLG A;  1WWX A;  2XM0 A;  3WGG A;  4PJJ A;  5GAG J;  1HE9 A;  2OEX A;  1FSH A;  4LB6 B;  3K66 A;  1MNE A;  4G7Z F;  3F6V A;  1KZH A;  2H7V C;  3MKW B;  2KJG A;  5KYX B;  2QF7 A;  3CO6 C;  4N4O B;  3RPQ A;  4CJO A;  2I5U A;  4E7S A;  3FIS A;  4WAB A;  2KFD A;  4GEH A;  3UMH A;  3OYM A;  5FKM A;  4L0Z B;  2VBZ A;  4I98 B;  2VT3 A;  2YL3 A;  3E7L A;  4A69 C;  2FML A;  3G6E I;  3KPH A;  5DS4 A;  1TBX A;  4U7D A;  3W2W A;  4C2M J;  2HDD A;  1ODD A;  2FE3 A;  3DTK A;  1LE2 A;  3VYR B;  3F8M A;  2VCA A;  3OS2 A;  2W4B A;  4ER9 A;  2D2W A;  4PJ0 C;  5A6B A;  2FBH A;  4UV8 A;  3VDX A;  2IP2 A;  3VEP A;  5GAH J;  1AHD P;  4W1U A;  1AKH B;  3GLX A;  5F04 A;  1VQ8 I;  1UCR A;  4HLX A;  1SVM A;  4V2G A;  1W1W E;  2WBM A;  2H09 A;  3TL4 X;  2R7S A;  1TWG J;  2Q0O A;  2XDV A;  3RKO F;  2CNW A;  4LER A;  5FB2 A;  4IO9 F;  2JX0 A;  4J01 A;  2L6G A;  5AON A;  3I58 A;  4IAO A;  2B0L A;  4KN7 X;  4M74 A;  2HV7 A;  4YIR X;  2XRL A;  1HDP A;  1NG1 A;  4LLL A;  2M5W A;  2QLZ A;  2OTJ I;  1CPQ A;  3V7O A;  1R1V A;  2QM3 A;  4HFF B;  2IW5 A;  1JPN A;  3K1H A;  5FKL A;  3C8Z A;  3KX2 A;  4O6J A;  3EH2 A;  3KYD B;  5TRD A;  1E3P A;  1U0B B;  3CUQ B;  1JKQ C;  3BRO A;  4EBB A;  5E3N A;  2OCE A;  2LFF A;  1LFP A;  2LK2 A;  1Z7Q c;  3W8I A;  2JPC A;  4BNC A;  4O6Y A;  5KYW B;  4ENK A;  2CRG A;  1T98 A;  1T2K A;  1MJB A;  3ABL H;  3EUA A;  2VKV A;  1LPQ A;  2Y2Z A;  2OC6 A;  2OZ6 A;  4LG0 A;  2KQ9 A;  1BDJ B;  1WN0 A;  2K27 A;  2W48 A;  3SZP A;  5HOD A;  4MEX F;  1IAW A;  2J7P A;  1S3J A;  1V55 H;  4BL0 B;  3QZC A;  3GX4 X;  2R7X A;  2A69 F;  2LSO A;  3OMY A;  4I3M A;  2YQY A;  4IRH A;  2MLK A;  5H6R A;  1RIO H;  3KL4 A;  3A4C A;  3TUL A;  1WKM A;  4QWQ A;  1G4W R;  1I6X A;  5E17 F;  4QDL A;  3GF2 A;  4K0D A;  2V79 A;  2QYO A;  2WB1 A;  3FKI J;  1LNW A;  4OD5 A;  1JUP A;  3DAG A;  1ZN2 A;  3SDG A;  1NK2 P;  1Z9C A;  1SFO J;  1RMV A;  2QBY A;  3ZGK A;  4U7B A;  1XCB A;  2PMZ N;  4UVC A;  3N2Z B;  2EIK C;  4WGY A;  3FK6 A;  3GTL J;  1FTT A;  4U87 A;  2ETS A;  4AL0 A;  2GXB A;  2V26 A;  3P5J A;  4RGU A;  1P2F A;  3CC4 I;  1JR8 A;  1JRA A;  1S7Z A;  2ZJP F;  4HF0 A;  2QQB A;  2YU9 J;  2HMZ A;  3FM3 A;  5BS6 A;  2EBI A;  3OYI A;  4YFX F;  1G4U S;  2ZFU A;  5DUK A;  2MGQ A;  2P6T A;  3QOD A;  3Q5F A;  1VK5 A;  1ZG5 A;  1MBG A;  4G6D A;  1IC8 A;  4G12 A;  5DCM B;  3EG9 A;  2RVC A;  3C7J A;  1PUF B;  4XRS G;  3OSG A;  2DBB A;  2Z5U A;  1YJ9 I;  1T8I A;  2CS3 A;  2YL1 A;  5A6A A;  3I0T A;  4J00 A;  3L34 A;  5AGF A;  2CH0 A;  3WTY C;  2IGO A;  4U5C E;  3M4B A;  1FNT c;  3GCM A;  3V7S A;  3FXR A;  3LFK A;  1IXS B;  3CQZ J;  4NB5 A;  1U5T C;  4FES A;  1JKR C;  2VKH A;  1F5T A;  3I3L A;  3IAM 2;  2R7U A;  1KQ8 A;  5E20 A;  1R7J A;  4FT8 A;  4A0Z A;  4YK5 A;  1DGW Y;  3AOU A;  3F22 A;  4I01 A;  1RR8 C;  1Z77 A;  3UMI A;  4NTB A;  3KLN A;  2R7Q A;  1OR3 A;  2L5Q A;  1RKE A;  2VJJ A;  2ZXH A;  3M8J A;  1U5T B;  2H8W A;  2KDO A;  3R60 A;  4CUG A;  2YVK A;  1WI3 A;  1X1A A;  1MMG A;  4G9Y A;  1Q0M A;  4P5O A;  4NQF A;  4XPY A;  3HG9 A;  5CKT A;  1BL0 A;  2Q2E B;  3AFH A;  3W2A A;  1D0Z A;  5L0C A;  2L4M A;  1SMT A;  4L5I A;  4A3K J;  3HNL A;  3MN2 A;  4Y15 A;  3ROU A;  3WG9 A;  4CCN A;  3IUO A;  3NKE A;  1GDT A;  5DS6 A;  4XKB A;  5DS5 A;  1SAX A;  5CYV A;  2PLY A;  3HHG A;  2M8E A;  5FKK A;  3S29 A;  5KVR A;  2VKE A;  4L9T A;  4YEJ A;  2XRH A;  5IYD J;  3B02 A;  3CCU I;  2R5Y A;  1PP8 F;  1YOV B;  4XOR A;  2WAQ A;  2K86 A;  5JLW A;  2ADU A;  4RGR A;  3CCQ I;  2P6V A;  1W5C C;  3C3W A;  2RQP A;  3EGD A;  2EV6 A;  3S32 A;  3OYH A;  3SXZ A;  4C30 A;  1K83 J;  4EVI A;  1FNN A;  4LIU A;  1SFU A;  1YRN B;  1MH4 A;  2IA2 A;  1ZU5 A;  2BC5 A;  4YII A;  3MKZ A;  3CO7 C;  1V54 C;  2HOS A;  3QU3 A;  2P5K A;  3Q3S A;  3U5S A;  2VON A;  3M1C A;  1LS1 A;  2NNY A;  1TFK B;  3DI5 A;  5M3F J;  1FAP B;  1JKO C;  3KP6 A;  4XLA A;  1O7L A;  5FJ8 J;  4U5D E;  2KK1 A;  3ZMZ A;  2R9R B;  2MFZ A;  3BR1 A;  1M2V B;  2XLO A;  3OYF A;  5B1A C;  1NG6 A;  1K78 A;  2IBD A;  2L7M P;  2FD5 A;  1QPI A;  2J0X A;  3IH2 A;  3DAF A;  3J7A Y;  3GAN A;  1Z6A A;  1JGG A;  3M8E A;  3WG7 C;  1FYM A;  3WE3 A;  2CQK A;  4DJ9 A;  1MKM A;  4Q5S F;  2DN0 A;  1FZP B;  1QO0 D;  3CLO A;  1SD4 A;  2VOO A;  5A6J A;  1WVR A;  2B0H A;  4M6Y A;  5J4V A;  3F6O A;  3H92 A;  3ZG1 A;  1M2O A;  1VTM P;  4XSX F;  3BC8 A;  1IGN A;  2DMQ A;  5EZH A;  2HSQ A;  3U9J A;  4LAC B;  4U9E A;  3RI4 A;  1EQ1 A;  3RIR A;  4C7O B;  2OTL I;  4LOC A;  3FHN A;  4DW6 A;  5HLT A;  5F0C A;  3L2R A;  1V4R A;  5KHD A;  4BUP A;  4JZA A;  4N06 A;  5CI9 A;  4YT2 A;  1GS9 A;  3SP1 A;  3B0V C;  2K9Q A;  1ACI A;  3M8F A;  5E1X A;  3FK7 A;  4D5C A;  1OIS A;  3F47 A;  3PO2 J;  2LF8 A;  2P6S A;  5CJ9 A;  1E3O C;  1FYL A;  1CGO A;  2NG1 A;  3E6B A;  3PIO F;  3C63 A;  4DZP A;  5BUO A;  4HA8 A;  3DLA A;  1R49 A;  4UDV A;  4A3C J;  2XHK A;  2STT A;  2XAG A;  1IN8 A;  1HSJ A;  1JTX A;  2L2O A;  1Z0X A;  1JTY A;  3L8J A;  1XZP A;  3AG1 H;  3CJN A;  1K05 A;  1BBY A;  3T6G B;  1OR2 A;  5E3L A;  4M72 A;  3OYK A;  3K6B A;  4ZDL A;  5L3B A;  1Q0D A;  3KYL A;  4XNF A;  3OR2 C;  2IRF G;  2HQA A;  4MGR A;  2ZJQ F;  3A01 A;  3FAJ A;  2ESH A;  3V4G A;  1R71 A;  2Y0S N;  1P6R A;  2ZSI B;  1HW5 A;  3DFG A;  4U9D A;  2R25 A;  4BJT A;  3L2C A;  1ETX A;  2IXM A;  3LEO A;  2D45 A;  2Y30 A;  2JA5 J;  2XIG A;  2MLG A;  1TKN A;  1LI7 A;  1TQG A;  2JT1 A;  3C8G A;  3OYE A;  4MW3 A;  4W8P A;  5JUA A;  2ZKZ A;  3LNR A;  5ICF A;  4OU0 A;  2K4B A;  2PEX A;  3HYI A;  3L1M A;  4H54 A;  3J7A O;  3EPZ A;  3F46 A;  1R1T A;  2EZK A;  1X4P A;  3CZ6 A;  1YJG A;  4E0I A;  3SEQ A;  2R7Z J;  3BQZ A;  3DBR B;  2YX4 A;  2H7B A;  1K61 A;  4LLE A;  3L2W A;  5D92 A;  1G3Y A;  3Q7L A;  4L5E A;  1Z21 A;  4C2U A;  2VBW A;  3AG4 H;  4M3F A;  4RBN A;  1VLT A;  2JWT A;  2V6E A;  1UST A;  1FOY A;  4CXF A;  1G3T A;  3VYU B;  4A3B J;  5M5W J;  2BV6 A;  2ECC A;  3I4P A;  3LAY A;  5EZG A;  2R05 A;  3LAJ A;  2JSP A;  1P9Q C;  3HSF A;  3BTI A;  2WAD A;  2OEV A;  4YL0 A;  3ERM A;  1RZ4 A;  3CMA I;  4H0E A;  1DP3 A;  3KEQ A;  1VI0 A;  3DF8 A;  2BL2 A;  5JLI A;  4N4N B;  4ITV A;  3HPG A;  5L3C A;  3OYD A;  3EUK L;  1KQ9 A;  2IA1 A;  1LIH A;  1SVL A;  3GLL A;  3ECH A;  2EIM H;  1OLT A;  1PCX A;  1V55 C;  4CJG A;  2A05 A;  2EIN C;  2OCC H;  4BJ6 C;  4NY3 A;  4KNW A;  5H20 A;  2Z3Y A;  3HKZ A;  1N77 A;  1SR2 A;  4P9T A;  2QA4 I;  2JPU A;  4YWQ A;  4I0B A;  3ZQ7 A;  2V1X A;  3GFJ A;  5DS9 A;  4AWX B;  1ZHZ A;  4L9J A;  5A6K A;  1ON2 A;  4KT5 C;  1TFO B;  3HTK C;  3R2P A;  1V54 H;  1ZG1 A;  2IT0 A;  1R4N B;  1VQO I;  1F43 A;  1IRZ A;  1U89 A;  1FC3 A;  3L9F A;  3AG1 C;  3WGH A;  3CEX A;  4IX7 A;  3OOP A;  4OIP F;  3LMM A;  5E8I A;  2QUP A;  3U2L A;  1E85 A;  3K1M A;  4KIG A;  1R4T A;  3LFU A;  3U0C A;  2LYC A;  2NRA C;  1JXS A;  2CQ7 A;  2WY7 Q;  3QOE A;  3O8G A;  2DA6 A;  3QPL A;  4WWC A;  3WTS C;  3LSM A;  3MZ8 A;  3K70 D;  5KNL A;  3Q7G A;  4EHP A;  5KYU A;  3E6D A;  2DK8 A;  4HG2 A;  1ZAO A;  3JSP A;  1XSD A;  4B47 A;  3H2U A;  2M3A A;  3NDB B;  4LG0 B;  2QSH X;  2GXG A;  3CJT B;  3KYC B;  2GA2 A;  3FOO A;  2DA3 A;  2HYJ A;  4X6A J;  5A6B D;  1NG7 A;  2P4W A;  2JTV A;  1GVJ A;  2O8K A;  3RF3 A;  4EUK B;  5L0G A;  4G7H F;  1Q1H A;  2LFB A;  4CCJ A;  5JI6 A;  1GV5 A;  5A2Q Z;  4A4A A;  5EEH A;  1O3U A;  1YJW I;  5HLI A;  2HKX A;  3GEI A;  3OA1 A;  3FXK A;  4J32 B;  3DEU A;  3K10 A;  2L7F P;  3VSL A;  3WTX C;  2R7V A;  1DPR A;  1BJA A;  2JQ7 A;  4UUS B;  5J6X A;  4A12 A;  4A3F J;  2R7R A;  1I3Q J;  1A7D A;  3B0P A;  3JT1 A;  3K4N A;  2D5V A;  3B6C A;  1WI9 A;  3FXM A;  3T6J A;  3DBL B;  2F5D A;  1S7E A;  1EJ9 A;  2BVM A;  1HCR A;  2XLW A;  4KFC A;  2DA4 A;  3SYT A;  4HAM A;  3SZG A;  1H0M A;  2NUP A;  3WHC A;  2QQ9 A;  3S15 J;  2ICW G;  1TWA J;  2NVQ J;  2EV5 A;  5E33 A;  3QP5 A;  1YE9 A;  2LLK A;  4RM2 A;  5DM6 F;  1LUJ B;  5CVU A;  2QY9 A;  2F5F A;  2Y9Z A;  4B43 A;  4XPX A;  5ILU A;  1VQ5 I;  3F21 A;  4EBK A;  1T39 A;  3FBN B;  3GTO J;  2EPN A;  1K7A A;  3EZH A;  4CS9 C;  1RUO A;  1F1M A;  2F5V A;  3RQF A;  2DT6 A;  3GEZ A;  2OCC C;  1XSV A;  5M3M J;  4BXX J;  1A7E A;  3EG9 B;  2VE9 A;  4XOP A;  4L6R A;  2PBE A;  2M8G X;  5EDN A;  5JR3 A;  2BY3 A;  2RNJ A;  2GDC A;  4PAC A;  3HPH A;  4LIT A;  1A6I A;  2K85 A;  2FU4 A;  2H94 A;  5GP9 A;  1XCV A;  3JRC A;  1GM5 A;  2PNO A;  2X0L A;  3I54 A;  1IO2 A;  1W7P A;  2CO5 A;  1HOM A;  4Y13 A;  3E6C C;  4CDV A;  4HSR A;  4G8X A;  1VQP I;  2XAS A;  4GRI A;  3P9I A;  2M0C A;  3IWF A;  4MVU A;  3HB9 A;  1D5V A;  3I5Q A;  4E7Z A;  4MNU A;  3R0J A;  1X2N A;  1T95 A;  1MSF C;  4JX4 A;  2BW3 B;  2YX7 A;  4BXF A;  4CIC A;  1LE8 B;  2KMU A;  3DV8 A;  3HC7 A;  1U5T A;  5DTD A;  2ZSH B;  3OYL A;  3PCV A;  2NVU B;  3VSK A;  2DA2 A;  3I4U A;  5T1D B;  2WV0 A;  3C2H A;  4KBL A;  1XN7 A;  3D5R C;  4IXA A;  2ZBK A;  4RB0 A;  1ETY A;  5D5V B;  4JTA B;  3NWT A;  5JT4 A;  3HGY A;  4NC6 A;  5D6F A;  1T0F C;  2V9P A;  1NU7 D;  2IXN A;  4IKF A;  3WU1 B;  4FX4 A;  4JCH A;  2QCO A;  4BQN A;  5ICC A;  2YWA A;  3FBI B;  2VPR A;  3DBH B;  4UVA A;  3U8V A;  2JRM A;  2PMZ A;  3FM5 A;  4CSA C;  1XG1 A;  1XD7 A;  1HXD A;  4XWJ A;  1BJZ A;  1ZRC A;  3CJQ B;  4AD9 A;  2HOE A;  4GDF A;  2XM4 A;  1TT0 A;  5JFR A;  2IM8 A;  4XBF A;  1GHC A;  1J09 A;  3KEO A;  3LSK A;  3FXQ A;  1Y0N A;  2QVO A;  4LG3 A;  4RLQ A;  4RB1 A;  2OQR A;  2L7A A;  3O10 A;  5L0H A;  3GYH X;  2M0M A;  3LNM B;  3C62 A;  2ZD9 A;  4UB6 C;  3JZ0 A;  5FD5 A; 
#chains in the Genus database with same CATH homology
 4YT5 A;  4OWR B;  2V9K A;  2RQQ A;  2VB6 A;  3ONQ A;  3MLG A;  4BJ6 A;  4PJJ A;  3UGO A;  1K6Y A;  4XL9 A;  3K66 A;  4PJM A;  3W8H A;  1MNE A;  4B48 A;  2H7V C;  4ULW A;  3S8P A;  4G7Z F;  3MKW B;  2KJG A;  1V5F A;  4IQ4 A;  4N4O B;  3SYN A;  4PK4 A;  1PD0 A;  4E7S A;  3IAS 2;  1PD1 A;  4GEH A;  3UMH A;  3OYM A;  1WJA A;  3OR1 C;  1R6R A;  4CS9 C;  2CV1 A;  3RSN A;  2M4K A;  3G2B A;  3LS1 A;  5DS4 A;  4CZC A;  2VPL A;  3RQ4 A;  2IYL D;  3W2W A;  3NWS A;  3DTK A;  4LIV A;  3VYR B;  5B1B C;  3H5A A;  3DM5 A;  3OS2 A;  2W4B A;  5FRN A;  3X1O A;  1GLN A;  4NQW B;  1TWA A;  1FTS A;  1PYV A;  5KYY A;  3HXL A;  2E60 A;  3VDX A;  3L2V A;  3BG7 A;  4XLE A;  3E1S A;  3S3M A;  4BEH B;  2EIL C;  5F5H A;  4HST A;  2AQE A;  1Z3I X;  1LVK A;  2KL4 A;  4OAZ A;  4KIS A;  4RMN A;  2J9U A;  2WBM A;  2Y0S A;  3KMI A;  3LJB A;  5DQZ A;  4BE1 A;  3TL4 X;  4HRI A;  2R7S A;  4MLO A;  2XDV A;  3RKO F;  2VLA A;  2CNW A;  4LER A;  3Q6N A;  2PP4 A;  4J01 A;  2Q9A A;  2LOO A;  4IAO A;  2HV7 A;  4XLP F;  2MC4 A;  4XLC A;  1NG1 A;  1ST6 A;  3T6B A;  3RTR A;  3DEE A;  4JVS A;  3V7O A;  2KRH A;  2WY8 Q;  4XOT A;  3S93 A;  4ANJ A;  2G3K A;  4F52 A;  1U0J A;  1JPN A;  1KU2 A;  3K1H A;  4HFF B;  2Z1D A;  2WAE A;  3KX2 A;  4YJW A;  3DJN B;  3EH2 A;  3HOT A;  1JI8 A;  2WVQ A;  3AG3 C;  2JUG A;  3ZIB A;  2E5Z A;  3NG1 A;  4DVY P;  1SAU A;  2M4E A;  1N75 A;  3DKY A;  3K4J A;  4EBB A;  3ZQQ A;  1LFP A;  2V7F A;  4DBQ A;  3QMK A;  2IXO A;  3W8I A;  4BU2 A;  3EGX B;  2F4I A;  4O6Y A;  4ZDO A;  5KYW B;  2DOA A;  3DMD A;  2F6C A;  1IRX A;  2CGE A;  1D0Y A;  3EUA A;  5KCM A;  3E70 C;  3N05 A;  4U5F E;  3FVY A;  3LES A;  2GOM A;  2OC6 A;  3VYW A;  4CIH A;  2KQ9 A;  4A2N B;  3DM9 B;  3JRT A;  1ZHT A;  2J7P A;  4JQF A;  2W4M A;  1Z23 A;  3EJN A;  1QHG A;  4BL0 B;  3QZC A;  2R7X A;  1UG0 A;  2A69 F;  3OMY A;  2J46 A;  4I3M A;  3OIP A;  4H4K C;  3KL4 A;  1ZHX A;  2LY1 A;  3A4C A;  2I8D A;  2LSE A;  3OS0 A;  2V3C C;  2E1M B;  2XF5 A;  2W00 A;  2R7O A;  3CES A;  1SF8 A;  4O79 A;  2C04 A;  4C2T A;  4QDL A;  3SNH A;  3B0U X;  3QYF A;  1M2V A;  3H0D A;  3HLZ A;  3M1C B;  4K0D A;  4ZLD A;  4EAT A;  3H35 A;  3JCU Q;  2WB1 A;  3A2K A;  4BAC A;  1Z63 A;  4OD5 A;  1FMV A;  2UV1 A;  3K4L A;  3DAG A;  3PNT A;  3K70 C;  2WZF A;  3ASO C;  3ZGK A;  4U7B A;  2UUZ A;  3VYS B;  3N2Z B;  2EIK C;  4XN0 A;  2M4G A;  2W4S A;  2VL8 A;  3A1Y A;  3EUH C;  4XLF A;  5T3W A;  3EH1 A;  3DJU B;  4U87 A;  4Y3O A;  2A6E F;  2V26 A;  4KT6 A;  2VXZ A;  4B6I A;  2L81 A;  4YT4 A;  1S7Z A;  4OIN F;  4I1O B;  3DPL C;  4AYB A;  4DBR A;  3PNV A;  2Q1Z B;  1OKK A;  2KGO A;  1E0E A;  3AG4 C;  3S0X A;  2HU9 A;  3VWB A;  1J8M F;  3OYI A;  2K9M A;  2R7T A;  2ZFU A;  2W7N A;  4HEA J;  2V4J C;  3QOD A;  1QU3 A;  3MD2 A;  5F5F A;  4E7I A;  1VK5 A;  1D0X A;  4XWJ A;  1DQU A;  4CSW A;  1D1C A;  3EG9 A;  5DQT A;  2G62 A;  2LBF B;  5KYY B;  5E3A A;  4J30 B;  1MND A;  2CS3 A;  3EFO A;  4MND A;  3VAY A;  3CJR B;  2OUM A;  4J00 A;  4HEA 2;  4XKC A;  3L34 A;  2CH0 A;  2IGO A;  4U5C E;  4CBE A;  2GOX B;  2DYS C;  1OCC C;  1Y6I A;  3AKZ A;  5HSW A;  1BOB A;  2EIJ C;  5FRO A;  4ZLC A;  3OL3 A;  4FES A;  2J9W A;  2VKH A;  3L2U A;  3I3L A;  3IAM 2;  2R7U A;  4CS8 C;  2NOJ B;  4NNJ A;  4YRV A;  1TWH A;  3MX3 A;  2XXA B;  1DGW Y;  2OV7 A;  4ZTF A;  3AQB A;  3RYL A;  3EGX A;  4ZYA A;  1VYK A;  1ZU4 A;  4YN0 B;  2X6X A;  3UMI A;  3FDY A;  4F91 B;  2R7Q A;  4AK9 A;  2L5Q A;  2VJJ A;  2ZXH A;  1NU9 C;  3M8J A;  3EHM A;  4CUG A;  2KDO A;  4QPO A;  3EFO B;  4U5E E;  1X1A A;  1VZ0 A;  1MMG A;  1X19 A;  4BJ5 C;  4P5O A;  1FFH A;  5KYX B;  4FAS D;  3PMR A;  3HG9 A;  4PSW A;  5CKT A;  4CA0 A;  1QZX A;  2Q2E B;  3AFH A;  3W2A A;  1D0Z A;  3BCA A;  1BR4 A;  4MQ9 F;  4CCN A;  3IUO A;  2CV2 A;  3NKE A;  3S3N A;  4QI2 A;  5DS6 A;  4XKB A;  4E4H A;  4F93 B;  3C2G A;  5DS5 A;  1N78 A;  1TWG A;  4O6N A;  3LL7 A;  3S29 A;  2E1M C;  2KLO A;  4PUS A;  3ZR8 X;  4CS9 A;  3EPV A;  4AVZ A;  4YEJ A;  2XRH A;  3OYC A;  4I44 A;  4XOR A;  4FET A;  2WAQ A;  2FGY A;  1X1D A;  2Q9C A;  2WA0 A;  2DCE A;  2P6V A;  1O87 A;  2VAS A;  2PJR B;  3EGD A;  3ZSU A;  3S32 A;  1OCZ C;  3OYH A;  2R7W A;  4C30 A;  1NZE A;  2FFH A;  4LIU A;  4OD4 A;  1Z3X A;  5T3T A;  2JVH A;  2L7K A;  3FHD A;  2KRC A;  2VQH A;  2IS1 A;  1ZU5 A;  3MKZ A;  1V54 C;  1ZEL A;  2CW7 A;  2KPM A;  1OCR C;  3HOS A;  1D1A A;  2CW8 A;  3QYE A;  4RM3 A;  4ZC3 A;  3KEY A;  3M1C A;  1LS1 A;  4WJ0 A;  1OR7 C;  2DYR C;  4CCM A;  5EGY A;  3BCB A;  2J7P D;  2YHS A;  4XLA A;  3PJR A;  1MMD A;  4U5D E;  3UGP A;  3K4B A;  5FCL A;  3K4K A;  2DXI A;  2MFZ A;  4IWB A;  5DLJ A;  4OIQ F;  2ZXI A;  3L2Q A;  1J8Y F;  1M2V B;  3OYF A;  5B1A C;  1NG6 A;  4B44 A;  5JHF A;  2PJR A;  3EGD B;  4BEH A;  2J0X A;  1W36 D;  3DAF A;  3JSZ A;  4C3B A;  2MWQ A;  5CQE A;  3J7A Y;  2CUJ A;  1HA8 A;  1Z6A A;  2LRE A;  3GAN A;  5LFA A;  3SDB A;  3KH2 A;  4IJJ A;  3WG7 C;  5L3Q A;  2A6T A;  4Q5S F;  3HL2 A;  2VJI A;  1M56 C;  3POV A;  2Y3H A;  2X1C A;  2XSE A;  3NYL A;  4BE0 A;  1M2O A;  1X4O A;  3ZG1 A;  1Y56 A;  3BC8 A;  4X0G A;  2J0W A;  4LAC B;  1UEL B;  4C7O B;  3BLY A;  4XLN F;  2K5C A;  2O5R A;  4XQF A;  3FHN A;  4XKW A;  5HLT A;  3OYJ A;  3L2R A;  1V5G A;  1SMY F;  4PJN A;  3DTI A;  5KHD A;  4BUP A;  1TR2 A;  2WVO A;  4JZA A;  4E7K A;  1WJD A;  4N06 A;  5CI9 A;  3ZC4 A;  2A5W A;  4YT2 A;  2WB7 A;  3SP1 A;  3B0V C;  2L9N A;  3E0J B;  4P1W A;  3F47 A;  2GFH A;  4XMY A;  4IQJ A;  4NC8 A;  1VYI A;  1G59 A;  2NG1 A;  4AX2 A;  2C03 A;  2YEV A;  2L9S A;  3TBI A;  5BUO A;  3O6X A;  3DLA A;  1UAA A;  3NKD A;  4P6I C;  1MMN A;  4BS9 A;  3TD7 A;  3OL4 A;  2ELJ A;  2L2O A;  2ZPA A;  2VKD A;  4EWC A;  2ZXR A;  2VQL A;  3EHN A;  4C9Y A;  2XSJ C;  2IS6 A;  3CQZ A;  4KIT B;  4GYT A;  4JUR I;  4BEJ A;  2X6W A;  2MAB A;  3MMY B;  2B0J A;  3RIP A;  2Z2S B;  2ZXP A;  3OYK A;  3IP4 B;  2NUT B;  3ABM C;  4ZDL A;  1BR1 A;  1S9H A;  3KYL A;  1TZL A;  3OR2 C;  4XNF A;  1VMA A;  2W9Y A;  2K3P A;  2K9L A;  4Q4Z F;  2HQA A;  3FAJ A;  4U5H A;  2BVL A;  3K4C A;  4ZTJ A;  2LG4 A;  3RFY A;  4YEL A;  2Y39 A;  2PX0 A;  2ZSI B;  2J9V A;  5E3C A;  2IGN A;  4W8K A;  4DVZ A;  1ZYR F;  3PHF 2;  2IGM A;  4BJT A;  4II3 A;  4D1Q A;  2IXM A;  4DJA A;  3JYH A;  3KKB A;  2PF4 E;  3H5R A;  3DKX A;  1TKN A;  2HVQ A;  4BDY A;  1V5E A;  4CS8 A;  2IS2 A;  3OYE A;  3NYM A;  1QHH D;  3LNR A;  2D5R B;  3L0I A;  5LD2 C;  3S3O A;  3E9V A;  2LRD A;  3S28 A;  3GBG A;  3EPZ A;  2L9J A;  3F46 A;  3DWL E;  3LLI A;  2X51 A;  4XR6 A;  1X4P A;  3CZ6 A;  3X2Q C;  4F92 B;  2LH9 A;  3SEQ A;  4U5B E;  5EHH A;  2DGJ A;  4CH7 A;  2H7B A;  4LLE A;  5D92 A;  3L2W A;  1SZI A;  3D5L A;  3Q7L A;  3PL8 A;  1Z21 A;  3TMO A;  4C2U A;  2HZD A;  4II2 A;  2HVS A;  3CMM A;  3H9J A;  1M57 C;  4RBN A;  3QYB A;  3ZXS A;  2V6E A;  2VJ5 A;  3DZA A;  3SZR A;  2Y3G A;  3VYU B;  2DJI A;  4IZZ A;  3HJC A;  2X1E A;  2A68 F;  2VJ4 A;  2XAU A;  3LAY A;  3Q6M A;  2MD0 A;  3RPU D;  4E6K G;  3K6G A;  4O6M A;  4HNU A;  4E7H A;  2JSP A;  3IEE A;  1P9Q C;  2WAD A;  4AE4 A;  3ABL C;  4BQQ A;  4OAY A;  1DP3 A;  1FFT C;  2RRE A;  4HFK B;  1ERD A;  2RNG A;  4N4N B;  4ITV A;  2IS4 A;  3HPG A;  3ABK C;  4G0H A;  4LLC A;  3OYD A;  3EUK L;  3OYB A;  3OYA A;  4X0R A;  4CCK A;  2EIM C;  4OIO F;  3OY9 A;  3K1I C;  1DGR M;  1OLT A;  1PCX A;  1V55 C;  4XKV A;  2A6H F;  4JJF A;  3I9V 2;  4ZDP A;  3OYN A;  4NY3 A;  4BJ6 C;  4QI0 A;  4KNW A;  3OYG A;  3HKZ A;  1WJF A;  2KP6 A;  1WJE A;  1N77 A;  3K6B A;  3ECS A;  3O39 A;  4KC9 A;  3W2V A;  2CNW D;  2PFD A;  3EZI A;  4M63 A;  2DT7 B;  4YWQ A;  4B3X A;  4E7L A;  4CCO A;  3DTE A;  2ZXO A;  3DXJ F;  2M7B A;  1ZHZ A;  3HTK C;  1X1C A;  2LBF A;  2XF6 A;  4G6T B;  4JJG A;  1EA3 A;  5HVQ C;  3AG1 C;  2CMP A;  2VQC A;  3DD7 A;  2I8B A;  5L3V A;  2KNH A;  5E2Q A;  3N24 A;  2Q3T A;  4IX7 A;  2P0W A;  4OIP F;  3LMM A;  2BE5 F;  1ZHW A;  1OCO C;  1W36 C;  2IGK A;  4KJZ A;  5HNF A;  3LFU A;  2M7A A;  2Q9B A;  2LYC A;  3W3C A;  1WGW A;  3OWT A;  2WY7 Q;  3QOE A;  2EIN C;  1WJC A;  3PNY A;  4D9J A;  2A1D D;  3Q7G A;  3LSM A;  3K70 D;  2QTV A;  1MMA A;  5KNL A;  3H9Q A;  4IRU A;  5KYU A;  3AL0 B;  4HG2 A;  2BW3 A;  1YX5 A;  1OKK D;  1G8X A;  4B47 A;  3NRH A;  3CP8 A;  2M3A A;  3ZRG A;  3PFY A;  4FWV A;  3NDB B;  2WVN A;  2CV0 A;  2Y3B A;  1NG7 A;  3PUB A;  4CSA A;  4F55 A;  4RLF A;  1LDK B;  1JPJ A;  2YZS A;  4G7H F;  5KYX A;  4BDZ A;  4CCJ A;  3ZVR A;  2HV6 A;  3UNG C;  1IW7 F;  2XF7 A;  1QLE C;  2OG2 A;  3OA1 A;  4J32 B;  3ASN C;  2HDW A;  3CP2 A;  1VOM A;  3K10 A;  4HNT A;  3CF2 A;  4NC7 A;  5IY5 C;  2R7V A;  3VSL A;  2XL4 A;  3LSI A;  3UMK A;  3OIQ A;  3N0T A;  2R7R A;  4K7B A;  2PX3 A;  3H9G A;  2XC7 A;  3K4N A;  2JD3 A;  3B0P A;  3LSG A;  1IZM A;  2IXP A;  3B9Q A;  3JT1 A;  3LLK A;  4DGW B;  1X1B A;  1AA7 A;  1RJ9 A;  4PSX A;  4RDA A;  3SEO A;  3T6J A;  5D91 A;  4OIR F;  4F4B A;  1WFX A;  4U5G A;  2BVM A;  4BQO A;  4BG0 A;  2QKL B;  2HVR A;  4BE2 A;  3FDQ A;  3SYT A;  2NUP A;  3SZG A;  4DIQ A;  2Y69 C;  3SEZ A;  3D5S C;  4NUB A;  1WJB A;  3RCO A;  4Y33 A;  3PSI A;  4I1M A;  5E33 A;  3FKJ A;  2O9X A;  1YE9 A;  4RM2 A;  4KI2 A;  2UWM A;  2QY9 A;  4JOM A;  2KQR A;  5FRM A;  1ZHY A;  4B43 A;  2CFO A;  4BJ5 A;  1KON A;  2Z16 A;  5B3S C;  5HNH A;  4KNV A;  4Y4R A;  3OEO A;  3DU6 A;  3FBN B;  3LSH A;  2HNH A;  2LY2 A;  2P7V A;  3EZH A;  2BOL A;  4RD9 A;  2VIX A;  4JW1 A;  2F5V A;  2X85 A;  1W2W A;  2DT6 A;  1RJ9 B;  2OCC C;  4AE4 B;  4C3E A;  3EG9 B;  2XXA A;  3OS1 A;  4BGD A;  3K7D A;  3DPT A;  4XOP A;  2W82 A;  3ZCO A;  4DOZ A;  1Z3Y A;  4ZJZ A;  2G3V A;  5TGT A;  2J45 A;  4BJ1 A;  4HPQ A;  3HPH A;  4LIT A;  2NUP B;  4C7O A;  2VH3 A;  2W45 A;  3MKY B;  1Z5Z A;  2HPI A;  4G7O F;  5CPR B;  1TWC A;  3LEV A;  5HOO A;  3K4M A;  2X1D A;  2ZXW C;  4YT8 A;  2KW3 C;  1BR2 A;  2AQF A;  4F3Q A;  2E87 A;  3T4R A;  4HSR A;  3RH3 A;  4XN3 A;  4PFO A;  5CQG A;  2IXS A;  3DPU A;  1YX3 A;  4GRI A;  3U21 A;  4E7J A;  2E5N A;  1PJR A;  2Z15 A;  2NUT A;  3I5Q A;  4E7Z A;  4XTK A;  2LC2 A;  2MYS A;  3BG6 A;  3NYJ A;  3AQC A;  3CSK A;  1LKX A;  1T95 A;  2CUZ A;  1MW7 A;  3DU5 A;  4QPQ A;  4FX5 A;  2BW3 B;  3HUG B;  4XM3 A;  4BXF A;  4R79 A;  5KYN A;  2VXD A;  2KMU A;  2JA2 A;  2HPM A;  3HC7 A;  3VYT B;  2ZSH B;  3OYL A;  3H65 A;  2VQG A;  3VSK A;  5T1D B;  1N1C A;  3I4U A;  1Z7L A;  3K33 A;  3S27 A;  3C2H A;  2WAF A;  3D5R C;  1SFK A;  4KBL A;  5CI8 A;  1WJ5 A;  3NWT A;  3ITF A;  3WOD F;  2WL8 A;  3GOD A;  3V42 A;  4Q7C A;  5DVW A;  1NU7 D;  3DQV C;  1T0F C;  2IXN A;  2X6Y A;  4IKF A;  2JVG A;  4JCH A;  3F9K A;  4BQN A;  4HE8 D;  4PFP A;  3FBI B;  4CSA C;  4XON A;  3OOU A;  2PMZ A;  4XLH A;  3I5P A;  5KYW A;  3LS0 A;  4CCL A;  2W1O A;  4AU7 A;  2FUG 2;  4O7G A;  3CJQ B;  2QKM B;  1FMW A;  2H7O A;  2IOQ A;  4PJL A;  3H5N A;  3UR3 C;  1TT0 A;  3PSF A;  2KZV A;  2V1N A;  1D1B A;  1J09 A;  4C3D A;  1O5H A;  3LSK A;  5KYU B;  2R4G A;  3EQL F;  2WZG A;  4LG3 A;  2Y3D A;  4RLQ A;  2CDQ A;  2M0M A;  2WZL A;  3AL0 C;  4CS7 A;  2CW0 F;  2KHM A;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...