4BJ5C

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords PROTEIN RIF2
total genus 54
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj5C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5C01
4BJ5C 3CZ6A 4BJ6C 3OWTA 3K6GA 4BJTA
chains in the Genus database with same CATH superfamily
2DTRA 2MFZA 1U5TC 2L9JA 5HLTA 3D1NI 4RGSA 1J75A 4AM3A 1BW5A 4JJGA 3WTXC 1YAUO 1ODDA 1ZW2A 1R1TA 1RRJA 5A6AA 3B0UX 2XLWA 4KN7X 3PO2J 2EZIA 2DQRA 5HS7A 4AX2A 2CSOA 1V54H 2VC1A 4CBEA 3QP6A 4JQFA 5HLIA 4BDZA 1IZ1A 2E1MB 2X6XA 4LOCA 4L9TA 1FAPB 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3NWTA 2M64A 3DWWA 3NYMA 3CCEI 3PQKA 1FBSA 3Q0WA 1YIOA 2X4HA 4WF2A 3MZYA 4CA0A 5CIVA 2JZYA 3UMHA 2V4JC 1B72A 4ENKA 2A07F 3QQAA 3W6KB 1Z23A 1IZMA 1V5EA 4U5CE 5GPCA 4IWBA 4CYCB 4ZZDA 2YVKA 2E87A 3LSGA 1RR7A 1K79A 3L9FA 1MJBA 2PJRB 5DD8A 1JI8A 3EGDA 3NDBB 1RCPA 3RVYA 3D5LA 2WB1N 1R71A 3L09A 5DM7F 2IAIA 3AG2H 1USTA 5IP9J 1IDZA 1EH8A 2XHKA 1CGPA 3S2HJ 2QWWA 2STTA 3ZWIA 3SXYA 2EPFA 4B47A 4JK1X 1TR2A 4IAQA 1CQTA 2R5YA 3JYYA 2NNYA 4J30B 3EUKL 1XGNA 2CW7A 3LWFA 3HRMA 1YARO 3QVYA 3TOBA 1E0EA 4C3EA 3J81Z 3TKYA 2EZLA 2AWCA 2FMLA 1U89A 1K6YA 1O5HA 2R93J 2YL0A 3GODA 3ZSUA 5J8FA 1MMGA 5E3NA 1GS9A 3CC7I 2OOCA 4MVSA 2LG4A 1ZLKA 4OD5A 2VT2A 1RZ4A 1GXQA 1SVOA 2D45A 3MCZA 1QQIA 2UUIA 1SD7A 4JZAA 3OIPA 4BDYA 1RKEB 2Q9BA 4D1QA 3DLAA 4XN3A 3LMMA 1W5TA 1IN4A 2Y39A 1TNTA 2DJIA 3ZMTA 3DQVC 1HOMA 3WU2C 1PP8F 1X58A 3FXJA 1GM5A 2PX3A 1MH4A 4YFXF 4M3FA 2BBYA 3HOTA 5E1WA 4PGHA 3GMEA 4G6QA 5BQHA 1O7FA 3DFGA 4O79A 3ZMUA 2HJMA 1ST6A 1LFPA 3POVA 3QPSA 1WGXA 2LOOA 5DTDA 5D6FA 2BEOA 3S16J 2FE3A 2M4KA 5LLQA 3S2WA 3FBIB 4E4HA 4M63A 1I1GA 3GM1A 4BPMA 1PVEA 2GQQA 4CCNA 5KVRA 2E19A 3CMMA 1Z7LA 5TJJA 3F22A 2HQNA 4E6KG 1TT0A 5F04A 3B6CA 4NTAA 3LSKA 5JVEA 1WJBA 1T2KA 1MJ9A 3H9GA 4AC0A 2Q2EA 3V4GA 3VPRA 4BS9A 4WXHA 1N77A 2RQQA 5DCFA 1L3PA 3FX3A 2L7MP 1OW6A 1S7EA 3ZQ7A 1LKXA 4GYIA 1P6RA 4IRIA 1R5ID 3Q9VA 3M15A 3H2VA 2XUBA 4KBLA 2M8EA 4B44A 2DW4A 2ZJRF 4HSRA 2GWWA 2HFIA 3G50A 3O10A 4F7ZA 3OIOA 3MKLA 2CYDA 4M73A 2BGCA 2QYOA 3RZDJ 1QO0D 1TWFJ 2ACJA 3KZIC 5KYXB 4A0ZA 1UCRA 9ANTA 4PSWA 3QPHA 4A3DJ 2Z1DA 5IY5H 1I5NA 2LKXA 2YL1A 3EQLF 1LJ9A 2F5DA 4MNUA 5EF6A 2LIGA 3KZYA 1FMWA 4JBAA 1F9NA 2IXOA 3M8EA 5EEGA 2R4GA 1V4AA 2NS8A 4BJ6A 3ECHA 2LK2A 1YITI 1CPRA 1FOYA 4ITVA 1G3TA 4LD5A 4ZYDA 2VCBA 2BHYA 4RGRA 2K9QA 1YO5C 1MQVA 3EH1A 2KT0A 2PMZN 2HOTA 2YQYA 4QI0A 1YJ9I 3BJAA 4IGGA 2G7UA 5BS6A 3MMYB 3U2RA 2JA5J 5FJ8J 2JVHA 2IM8A 1APCA 3BTLA 1N1CA 3SYTA 5CVJA 3LA7A 1TNSA 1OW7A 3H5NA 3G4XA 5F1JA 3A4CA 2DA6A 4ZYAA 3L8IA 1VTNC 2QENA 3JTHA 1Z3XA 3ZQGA 1IV6A 1Y0UA 4IRHA 3T0YA 1Y1VJ 4PJMA 1VQMI 2NSFA 4IRGA 4D7NA 1T33A 4EGYA 1FIPA 2VI6A 4BBSJ 1UJ8A 1JPJA 1VQOI 1JAFA 3SEQA 4LK1F 3FBNB 2OAZA 4YIIA 1I5ZA 3V7SA 1YVIA 3HB9A 1BZ4A 1HKTA 2DFFA 5IT3A 3U3FA 3GZNB 3M7GA 3WE3A 4PK4A 1A6QA 2EB7A 1GUUA 2OG2A 3PJRA 2OD5A 4WX9A 2UXXA 1GV2A 1ETWA 1O57A 3DKYA 4BGDA 3BT9A 5JFRA 5L3FA 1ZU4A 1IUYA 1DPRA 4LACB 2DMQA 3DU5A 1IXRC 2XRLA 2LBFB 3WE2A 1NK3P 4CGZA 2XS8A 3GEIA 3GWLA 4BHPA 2H94A 2M7BA 2Y30A 1O3TA 2UXNA 3J80Z 4KNVA 3KEOA 2KJCA 4XORA 3JSZA 4I3MA 2RVCA 3ZQHA 1VLTA 3VYWA 4DRHB 2LRDA 1R7JA 2M9HA 1WGWA 3COAC 1BR1A 2Y75A 2HQ5A 4X0GA 2K02A 2OEXA 3MKYB 1M2VA 1FMVA 2HSQA 3PL8A 3KP3A 2GWRA 4JTCB 3MD2A 1GHCA 3FHDA 4OMYA 1ZZPA 3D0SA 5FRMA 1B68A 2FFHA 4CICA 2LSOA 1Z63A 3HLZA 4JTDB 4EM0B 3I59B 3M4BA 4AE4B 3PFYA 4G9YA 2DT5A 2E7XA 5AGFA 3NMJA 3P9CA 1P92A 1VMAA 2JX0A 4G0HA 1V55H 1FSEA 4PGGA 4E7LA 2VN2A 3OYLA 3C3WA 2R7RA 2EFWA 4BNCA 1G4US 3E5UA 1Q0GA 3EG9B 1IF1A 2P7VA 2B9SA 1QVXA 3BG9A 1ZG5A 2VOPA 1CGOA 2EPMX 5HS9A 3K2AA 2XF6A 3RSNA 4BEHA 1I6HJ 3E6MA 3CUQA 3DTEA 3SXMA 1WJCA 5LBQA 3IPMO 1LPQA 2J7PA 4XPYA 2QQ8A 2KZVA 3PO3J 4RAGA 2OC6A 3LAJA 4O6YA 3TBIA 4U5DE 3TJ6A 1T6QA 3K4JA 1G59A 1TFKB 3K69A 1QGPA 1A35A 2R7SA 3EGXA 4PDKA 4RB0A 1BA5A 2D1HA 3TDUC 1FOWA 1W7PB 4HQMA 1WTYA 1ZYRF 4WXCA 4XLEA 1ZREA 1V74B 2VXDA 3I64A 3M1CB 4LDKA 1E2XA 5ERIA 4AVPA 4EGZA 4YT5A 3LFUA 2M3AA 1T01A 3NWSA 3HRSA 4CDGA 2KRFA 3I59A 4PJLA 4A6DA 4NY3A 4XQ1A 2EILC 4EWCA 5FB2A 4ZDOA 1IN7A 2ME0A 4IJAA 3CLOA 4S0HB 2JUGA 4NC8A 3W2VA 3F8NA 4EM2A 2XF5A 3EH2A 4CJOA 5LGUA 2ID3A 4CYDA 4E7SA 1A5JA 3H3ZA 3S84A 5JHFA 4XNFA 4C2TA 3HTKC 2VKHA 4NQWB 2HS5A 3E5QA 3ML6A 4N9IA 2EPLX 1R9TJ 3TO7A 4I2OA 2E1OA 3GEHA 2Q1ZB 2EV0A 4FT8A 2MWQA 1ZGAA 4DRJB 3FXLA 5DUKA 1T6SA 3KYLA 4I1MA 3KX2A 3DBRB 3TDZC 3ATPA 2A5YB 3GTGJ 3K4KA 4Z9HA 2R7ZJ 4DZPA 3ZC4A 1B1BA 3HKZA 2XSDC 1AHDP 1Y6IA 1H8AC 1HA8A 1QPUA 2A3SA 2K5CA 3F8BA 2IBDA 2PQ8A 3OYGA 1FJLA 1OCCC 2ZPAA 5HDKA 3L1PA 2X9DA 4IRUA 2QQAA 1UHSA 1W7PA 1OCRH 2ZFWA 1STZA 2UWMA 1GGQA 1TFOB 4ZTJA 1XSDA 4MHGA 1EH6A 2P5VA 4LDQA 1WI3A 5E1XA 3L8JA 4RS8A 3OOPA 2DFIA 1G5ZA 2OCCC 2VLAA 2FNPA 2HTSA 1UFMA 1O3RA 4XEFA 1JUPA 5F64A 2E2HJ 2EFQA 3KYIA 3H36A 2JPCA 2R0QC 4J19A 1R23A 3JW4A 1OQCA 2KC3A 4UDVA 3VEPA 1DOWA 2K86A 3WTZA 2ZXWC 3NG1A 4MTFA 3J80K 3KYJA 4IO9F 1DPUA 3HOYJ 3HNKA 4JEBA 1EKEA 3BDDA 4B1RA 4XBFA 4AD9A 2D5RB 5KK1A 1MIJA 1F1ZA 2ETSA 3R2PA 3A9CA 4GEHA 2K4JA 3L00A 1YFHA 4X6AJ 2W9YA 3QOPA 1H6GA 2DOFA 2DYSH 1G4WR 2HUJA 4IXAA 4OINF 1OCPA 1K05A 2HGCA 3FISA 1RETA 5FKLA 5M5YJ 2Q9AA 4BACA 1Z21A 1V54C 1SAUA 4EVIA 1H88C 3GZ5A 1JPNA 3U8VA 1G3SA 2F5FA 4F92B 2RAEA 4MQVA 3Q0UA 1YLFA 3VSKA 3GM3A 1FNNA 1IRFA 5J3LA 2GXAA 3ELKA 2GAUA 3TULA 1JKPC 4FE7A 3BTJA 3PUFA 4XLNF 5EG0A 4HZFA 4J01A 3LJBA 2VOOA 5BOXA 4MVRA 2HPMA 1IG7A 4ZC3A 3DPLC 1UZCA 1WQ2A 2QM3A 2ZXHA 5E1ZB 1RXQA 2XPWA 2CW0F 1O3QA 5GADJ 1IRGA 2DYSC 2BYVE 2MABA 1U5TB 2VL8A 2WZLA 3DEWA 4XLHA 4YG2F 1ZTRA 4I1OB 1IO2A 3N2ZB 3HOZJ 5IYBJ 4BKXA 3PSIA 3QODA 4L9VA 4ESBA 2DXIA 4AVZA 5D5WB 3MYFA 2IYLD 4M74A 2DQLA 2VCAA 1OCZH 3KEYA 2VASA 3ASNH 1OXBA 3ZQFA 2QCOA 3RKXA 2Q3TA 1I1SA 2KQRA 3IQCA 3K70C 4CSAC 4YL3A 3RCOA 2WADA 4UVAA 4N4NB 2H6CA 2LYCA 3W2AA 1H0MA 4U7DA 2YEVA 5J8CA 3RQFA 1X3WB 2XM4A 4CYCA 3JRFA 3JTGA 5KYYA 3WTWC 1I4ZA 1TQMA 2V6CA 4RBNA 2OA4A 4KITB 3MN2A 2KJGA 3B71A 5E3AA 2BV6A 1XMXA 2WTEA 2QSFX 5LRSA 4ON0A 4KA4A 2F4MB 1WVRA 4UV9A 3G71I 2Z33A 3OYCA 1XWJA 2QTVA 4MNDA 3EZIA 5KYUA 3CF5F 1E3HA 3NMKA 2L5QA 2NPUA 5BUOA 4RBOA 1FNTc 4IL6C 2JPBA 3K6GA 5K7ZA 1KA8A 2R7VA 2XAGA 2LNBA 2VBYA 4OMZA 2F5CA 3EUAA 4Y13A 1W4MA 2LREA 2J9VA 3LEOA 1O3UA 5DS5A 3QTHA 4G6TB 1Z9CA 5ED4A 5DEQA 2EIKC 1JKOC 2M45A 3CCJI 3BQYA 1U0BB 2DGJA 2ZB9A 3KP5A 1OR7A 1NH3A 2WB1A 3VM6A 3L1MA 1BR2A 4Y7NJ 4XM3A 1ZG1A 1K7AA 3GTKJ 4WABA 1BIAA 3HG9A 2ETHA 2MLGA 3KP7A 4XMYA 2ESNA 3ABMH 4PCQA 2X51A 2C03A 2QGUA 5F27A 3ASNC 5DUIA 3Q6NA 4MTOA 1WI9A 3BY6A 1VQNI 2GA1A 5DYMA 3CCSI 1OCOC 3AGTA 4HF1A 3K33A 2J0WA 2J5PA 2ZNZA 1C0WA 2OEVA 1NBBA 3CMEI 1NFNA 1MZBA 1Y1WJ 3CC2I 2B0JA 4O7GA 3IC7A 2RQPA 4DYCA 1IN5A 4IHVA 2DYRH 5IT9K 4CS9A 4ANJA 4A6EA 3X1OA 4G7ZF 2IGKA 4FE4A 2N8GA 5KYYB 3LL7A 1OXKA 4KNYA 3L7WA 4PACA 2WVOA 4PFOA 2ASRA 1Y56A 1FZPB 3LLKA 5B3IA 3U8PA 4XR6A 3EUHA 2EIMH 3ESWB 3IWZA 3MKZA 1QU3A 3EJNA 4JRZA 1FR0A 2E71A 5DCMA 3I4UA 2ZXRA 2NUTA 3ZTMA 2LH9A 3ZGKA 1ZHWA 2CFXA 3TQOA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 3TOLA 4AIDA 4HYEA 4CXFA 5J1YA 1HCRA 4XLPF 2L7AA 3US6A 3LQQA 3GW2A 2L02A 3VYUB 3UGPA 4GO1A 5LD2C 3TO6A 3AG1C 2K9MA 1OYIA 2L54A 1JJ6C 4W8KA 2LKSA 2OCCH 2ESHA 2ZXIA 4B09A 1FLIA 4E17A 1ACIA 1WASA 2Z9OA 2ZXOA 2ISZA 2YR2A 4JKVA 1T08B 4UNOA 2LFBA 2WAQN 3OWTA 2ID6A 4CCJA 5T3TA 4A3EJ 4IOAF 2I15A 2XSEA 2HXIA 2EZKA 1MBJA 4NB5A 3HTSB 1YRNA 1WJDA 3LNQA 2EIMC 3F0CA 4NTFA 3C8GD 1LQ1A 3E5XA 4MVOA 2COBA 4Z6YA 2FAPB 5KAIC 1A7EA 1TQGA 3WTUC 5E3OA 2FGYA 2NUPA 1M1EB 1BBHA 2ECCA 2IGMA 1QBJA 1SR2A 1XGSA 3V8LA 2ZJQF 1XC5A 1YW7A 5J47A 2LVSA 3GBGA 2J46A 1Q0KA 5GPGB 1PD0A 4HX7A 4C9YA 4ZDLA 1G4DA 3DAFA 1APLC 1RI7A 2CUJA 3M07A 4LLLA 3TK0A 3T5XA 1NSGB 3NKDA 2F6CA 5JLWA 4KIGA 5FD5A 5FKOA 2GXGA 3VOEA 2AU5A 3KP6A 5GAGJ 3WHCA 2IRFG 2BVMA 2V1DA 4UUTA 1DU6A 2WV1A 2DODA 3HSEA 1J8YF 2FU4A 2MC3A 5FLXZ 1M57C 3MZHA 1SZIA 4U0YA 2HZTA 4XPXA 2JSCA 1MBHA 5ICFA 3CCQI 3EGDB 3J06A 4CHUA 1W36C 1FYLA 2NSGA 1YQAA 4IQ4A 4YELA 3S28A 2DLLA 4AK9A 1T0FC 4YFNF 2IGNA 2TDXA 5E8GA 2M8GX 3ZP5A 3CUOA 4XKVA 5D6EA 5DM6F 1S05A 4EKWA 3OMYA 4RAZA 5L0JA 4R1HA 2RC4A 1S5LC 4HX4A 3W3CA 5A2QZ 1K83J 4UUSB 4CDVA 1VI0A 3GFIA 1V55C 4CS9C 2DOAA 1LEBA 2K9SA 1XPXA 4NCQA 1P4XA 1FP1D 2CV2A 1OKRA 2VBXA 4O6NA 3I4MJ 3H5AA 3WTSC 3ZPLA 3O8HA 2F4IA 3C8GB 5FFXA 3G2BA 3IL2A 3CO7C 3M4CA 4KYWA 4WGZA 2E34A 3ZOBA 2B63J 3OL3A 2LCHA 3HSRA 3NQOA 4Y17A 2D5VA 4M72A 3FKJA 1E83A 2W48A 2JVGA 4ZTFA 2E1CA 1LEAA 4MTDA 4Q48A 1JKQC 2KIQA 1Z6AA 2R02A 3U1DA 1KYZA 4Y52J 1BI3A 1KGSA 3SJMA 3DM5A 2A6HF 3BR0A 1JT6A 2HQRA 2YHSA 3E6DA 3P7NA 3I4PA 5CI9A 3HOXJ 2E2JJ 2JUCA 1ORJA 2KIMA 2WY7Q 5FO5A 4HW0A 2K85A 2A6TA 3DKWA 1UB9A 2M4GA 3HPGA 2P0NA 3K7AJ 5L3BA 1HSJA 3OYDA 3BZ6A 3GLXA 3FXHA 5ICEA 1FSHA 5IY5C 1JHFA 1ZK8A 3JRBA 1ORYA 2EFOA 3QRFF 3JRMO 4H0EA 1X1DA 1G6NA 3EDPA 2DN0A 5CJ9A 5K5QA 3W4YA 3FOPA 4GYGA 2JRMA 1W5SA 2RV8A 4II3A 2MC4A 2A0BA 2L9SA 2QNLA 4A3BJ 2XVCA 3HRTA 2NVQJ 2EPKX 4K0DA 1MNMC 2CJJA 5ILUA 2EK5A 2CQ7A 5B5EC 1D1AA 4NC6A 2BY3A 2VBZA 2HYFA 2HXOA 1OCCH 3LOCA 2A0UA 4J32B 4G94A 2MH2A 2J5OA 2VE9A 4CSWA 2DMPA 6PAXA 1VQPI 3SDBA 5D8KB 1EJ9A 3JTLO 1E85A 2CV0A 2EA4A 3LSIA 3FXUA 3IRRA 4L5JA 1MNDA 4D5FA 4IHSA 2CFOA 1S7AA 1OKKA 4EHPA 3R4KA 2XKOA 1N78A 3UKGA 3B0VC 1O4XA 4AYBN 4CUGA 1ZQ3P 1MBGA 5HDGA 2VONA 3LAYA 3NMIA 2P5KA 2Y2ZA 3BRJA 2RNJA 2KRHA 3BOQA 3DBLB 2VJJA 2WWYA 3KYCB 1LE8A 3F9KA 1WRJA 3RFYA 3K4MA 2K4BA 3I71A 3KH2A 3HHGA 2BVLA 4W97A 3ZVRA 2YLGA 2XS1A 4GCVA 2CNWA 2L81A 1B6AA 1IRXA 1YS6A 2A05A 3LSPA 2JJ7A 4RB1A 1WH5A 3O8GA 2HMZA 3E6BA 2E5ZA 2NNNA 3GWZA 4E7KA 1RKWA 1SD6A 2CMPA 4KI2A 4LIVA 3OSGA 3V5XA 5E20A 5CPRB 2AXLA 2NG1A 5HNFA 5D5UB 5H2FC 1U8BA 5L3DA 1V5GA 2EPOA 1YX3A 2HPIA 3RYRA 4FX5A 4CS8C 2L9RA 4Z2YA 1Y8RB 1PV3A 2W1OA 3RW0A 3SZPA 2LQGA 2TRTA 3QW0A 1Y0NA 3S14J 4D0PA 2X85A 5D92A 2W25A 2OJED 3N05A 3F8MA 1R22A 4JTAB 4NDLA 4ENMA 4G78A 2LC2A 5EK0A 4A93J 4ASNA 1VQ7I 4KIBA 1G8XA 1EV7A 1PDNC 3AG1H 1X3ZB 3L2QA 2HTJA 4UVBA 3KPHA 3OYMA 2LSEA 3VB2A 2VBWA 1ZGWA 3CJQB 1JMWA 2NUTB 1IW7F 2E36A 1AVOB 2OTLI 4JJFA 2OQMA 4BUPA 3WGGA 3I56I 3K1HA 3M3YJ 1XCVA 4PJ0C 2XSJC 5HV9A 3GO5A 1QPMA 3EPZA 3GZ6A 3BQZA 1E17A 5GTHC 3EUHC 2PLYA 4K7BA 2LDUA 4DIQA 2OJQA 5ICGA 2XL8A 4EM1A 3HNJA 5CVUA 2ZMEA 5K7HA 4XONA 1TL8A 2AP3A 3ZIBA 3RQ4A 2Z99A 1M2OA 3GUDA 1I50J 2HVQA 1SVLA 2BZTA 3T8RA 4B6IA 1POGA 2HU9A 3FDYA 3REOA 1BI1A 2YKZA 2YU3A 5A2QK 2ZO4A 3E3VA 1LS4A 2CU7A 4O6MA 3H92A 3CMYA 5COGA 1WHUA 4OAYA 1TQPA 3I5QA 3FXKA 1I4YA 1S7ZA 1QZZA 5K1YA 2HZ8A 2PNOA 3ISPA 4JYKA 3KMIA 2O6GE 2X6WA 2VODA 2XAFA 1LS1A 4MS2A 4CS8A 4EBKA 2IJLA 1FWZA 1OYWA 4DGWB 3GLLA 2MGQA 2W7NA 3OSFA 2MG4A 2P8TA 2ME6A 3VYSB 2OPTA 1MDMB 3FXOA 4PZJA 3T8TA 1JJ8C 2WL8A 2LY1A 3HIFA 2Q0OA 2HOAA 1I27A 2B0HA 5CQGA 1Z67A 1ZRDA 2TCTA 1KZHA 4CS7A 2HEOA 3IP4B 3HHHA 2EBIA 1DGRM 3LQRA 1C02A 2AVKA 1ZHXA 1VYIA 3AG4H 4HNUA 2LLKA 1D1CA 3GTJJ 2OF7A 2NVXJ 3DJNB 2P0WA 3WG7H 1OCRC 5KYXA 5COFA 2BL2A 3JSEO 3S93A 2XASA 2PN6A 2XIGA 3GTMJ 2AHQA 2DT7B 1DOVA 2M4EA 3RYPA 1WJFA 4XOTA 1VB5A 4JX6A 3FMQA 2W4BA 3FMRA 1IRZA 3HBLA 1J2XA 2R5ZA 1O87A 2KJBA 1YIJI 2F48A 4A5NA 3SXZA 3ZQVA 4UXNA 4X1EA 4KUMA 2DDBA 5BQIA 4CCLA 3U0CA 2HI3A 1FFHA 2O61A 5TJ5E 1D8KA 4BYYA 2G62A 4JCZA 5JUAA 2ZXPA 5LEJA 3AQCA 2W45A 2BE5F 5CI8A 1UG2A 2LTPA 2IPQX 2EQRA 4G6DA 2O9XA 3A01A 2EINH 5CYVA 4MEXF 2DPDA 2OBPA 3MYIA 4CIHA 2NYXA 2CS3A 4IKFA 3AOUA 3KCCA 5B1BH 3BJ6A 3ERED 1WH7A 4K1OA 4R79A 1FC3A 4ZZLA 4A3GJ 4MVZA 3GEZA 4I98B 2D1VA 3WTYC 3RF3A 1WSUA 2A1DD 3DTKA 4C3DA 5BPIA 1EQ1A 4Y15A 1NU7D 1VNDA 1YW9A 3K4CA 4DYQA 3K6BA 4JC7A 5FKKA 2PG4A 3DF8A 2WAFA 2L6FA 2EV6A 4EJWA 3CCUI 4F93B 4ER9A 3B6AA 2QQ9A 3FKIJ 3SDGA 2PBIA 2A5WA 1A0BA 1ZVZA 2PF4E 4WXDA 1F4KA 1D3YA 3AFHA 4JX4A 3DXJF 5FCLA 4BJ5A 1T6UA 4X0RA 1MH3A 3QYFA 5CVRA 5HLHA 4GYTA 4ZLCA 3FDQA 1S3JA 1GVDA 1YRNB 1PJRA 2DCEA 4BU2A 3SXKA 3IEEA 4AIKA 3K1PA 2LP0A 3Q9SA 3BR3A 2GBYA 2KPMA 2WAQA 3EETA 3GVAA 4GFBA 4J7YA 1R58A 3UR3C 3TO9A 4U5GA 1J09A 4ZYGA 2NAZA 2HV6A 2OQGA 2DA4A 2CQXA 1A36A 1A04A 1UG0A 4DOZA 1Z7Qc 3OYNA 3GWNA 4KT6A 4DQ2A 2E5NA 3ULQB 1ZW3A 5HVQC 5K7FA 2QQBA 2L9VA 2QKLB 3CZ6A 3D5RC 4LFUA 3G3ZA 3RKWA 2IXNA 3DE9A 5DVWA 4AE4A 4IHWA 3EHNA 2EIKH 3QYBA 2O03A 5LEKA 2HSBA 2NUPB 1H7IA 1A7VA 3N97A 4Q7CA 4KDPA 2HDWA 4K2EA 4I7HA 2DFEA 2V26A 3GF2A 4N0BA 2GM4A 3BCAA 3ABKC 2K9NA 3JRDA 3J81K 3F3XA 2VPRA 2WVNA 3C2BA 5EEAA 4ULVA 1H9GA 1R00A 3S8PA 3JRIA 2BY2A 3CP2A 2XGXA 2HQAA 2JA8J 3GTOJ 1LE4A 1YX5A 1W1WE 1DGWY 3QU3A 3SYNA 1KU2A 4BHBA 4HDUA 1LPEA 4KC9A 5BQGA 4HX8A 3BG3A 1HXDA 2J45A 4TV7A 2CDQA 2DMTA 4F55A 2OCEA 1X4OA 1DU0A 1VQLI 5JSLA 3VAYA 1B4AA 3WTVC 3HRUA 1Z6RA 1JGGA 3RZOJ 3RQGA 1B9NA 4YL1A 4V19K 3IH4A 4M3GA 3S1RJ 1HDDC 4DJAA 3DEUA 3ITFA 2K3PA 4HV5A 3M9AA 3WGIA 3N0TA 3E7LA 4A5MA 4DJ9A 1SFKA 1H89C 4BEJA 2LF8A 3OYAA 2CQNA 2HDDA 1KU3A 5C4XJ 2F5EA 2P81A 4Y33A 4OD4A 1SFXA 1B9MA 3PSFA 4E7IA 1TTYA 1IC8A 2FRHA 2DYRC 2VC9A 3V5YA 5DS6A 5JS5A 3DKXA 4LB5A 1MDMA 2DB4A 1VQKI 5EZHA 5E17F 4L9JA 4AL1A 1IUFA 2FX0A 3BR6A 3CAXA 1GT0C 1V3FA 2Y9ZA 4FX0A 4E7ZA 1IXCA 2AWYA 4JX5A 1EI7A 3TP3A 3F72A 3U9JA 3O3KA 1XTAA 4NBQA 2A69F 1CGNA 1UHWA 2H7BA 4BQNA 1BI0A 3O39A 4AL0A 2QF7A 2YX4A 3OS2A 2R3SA 4RM2A 1QA6A 5EGOB 2YLDA 1MNEA 1QPIA 3RKOF 3HXLA 4L9NA 1TLHB 4JW1A 3RYLA 1R4MB 3RDIA 4RLQA 3CDLA 2FF4A 2LK4A 2KQ9A 4WJ0A 1ZELA 3AAFA 3BR1A 4XQFA 1RKEA 3LUTB 4ZLDA 4MEYF 4Q47A 3MWMA 4DXWA 5FROA 3JAMZ 4F91B 4IOCF 1A7DA 3ERMA 2R7QA 3HZJA 3RVZA 4ZYHA 3CMAI 3U21A 2R7DA 4B43A 1JXSA 2H8RA 2FMYA 3AL0B 2IS2A 3K7DA 4BL0B 4XSXF 4CH7A 4MVQA 2XXAA 1TW2A 2GA2A 1UG7A 3JCUQ 4CCOA 3V42A 3SFZA 4HAMA 4RM3A 1R1VA 2GDCA 3DMDA 4D4XA 1ULYA 3BTIA 4XKBA 2VQHA 2VQLA 3RJPA 1BDJB 4N4WA 3CCVI 4RB2C 5FLXK 4M9SA 4U5BE 4C3BA 3V5ZA 3A0HC 2JK3A 1R4NB 4GQHA 4O6JA 1CF7B 1RPWA 1UMQA 3ZQCA 5JI6A 1BI2A 3TP0A 2VB6A 5B3SH 1Y6DA 1U3EM 4E18A 5B1BC 2XLOA 1EH7A 1K78A 2CO5A 3D5SC 3L0IA 3TW6A 1VK5A 2JSPA 4OWRB 3A11A 4JURI 1YYVA 5F1RA 1PYVA 2Y48A 1NG1A 3ZG1A 2WZFA 3UMIA 4YJWA 3N4MA 1ZHTA 4GXOA 3FHZA 3JAMK 3ZMZA 1RIOH 1K4SA 4NUBA 1SFUA 3U5SA 2ELHA 1JUSA 5DS4A 4IAOA 3RQEA 2BC5A 1R5HA 3SEZA 1JGSA 1Z3YA 2WV0A 4OIOF 2ELJA 4HRIA 1XSXA 1ON1A 3A02A 1XDSA 3HYIA 4HV6A 4XLAA 4EEFG 3HUGB 1OR3A 3BCBA 4M6VA 3F8FA 1R5GA 1RR8C 2MW8A 1YZCA 5L3GA 3O6XA 3CEXA 2A61A 4HOBA 1MBKA 4OIPF 2VJ4A 2ZBKA 3TGNA 5J1RA 1AUEA 2PP4A 2WVQA 2AQEA 2XM0A 2KLOA 4LMYA 3X2QH 2EIJC 3OEOA 4JP0A 2FOKA 2NVYJ 2XC7A 3OR1C 2HFHA 3SHFA 5E3MA 2HVSA 3DM9B 4CSAA 2QBYB 2QEXI 1KONA 2KIUA 4D4NA 2ZSIB 3C8ZA 2HJ3A 5L0FA 2ZKZA 2J9BA 1MMAA 4M3DA 5J40A 5EDNA 2P6SA 2XLDA 2XB5A 1SD4A 4Z9JA 3OYKA 5FLVA 3ASOC 3ZQQA 1QVUA 4RD9A 1NTCA 3S1MJ 5IYDJ 3L2CA 4IX7A 4YN0B 4WK8F 1BC8C 2WB7A 3JSOA 2FSWA 2HDCA 4P9FA 1JUMA 4L18B 3P5JA 3MKWB 1I3QJ 2L01A 4XRFA 2VPLA 3R0AA 5EJCA 3FAJA 4I76A 4LLGF 5DQZA 5L0GA 3OOUA 4XIDA 4XWJA 3HOUJ 4HA8A 3MZ8A 4HLYA 3C2HA 2D2WA 3K1MA 1BJZA 3CCLI 2Y3DA 5ILVA 2FBKA 2GXBA 2UZKA 3NAUA 1BL0A 4EV0A 4HF0A 4CZCA 2H7VC 2Y0SA 5J4YA 3IKTA 4XRSA 4M6XA 3WTTC 2KHMA 1M6TA 1Z3IX 3N24A 5FD6A 3RKYA 3HUGA 4N6HA 3C18A 3JCUC 1YA9A 4Y4RA 5L0DA 1R1UA 1XS9A 1D0ZA 2CQQA 4RAFA 3JRCA 3NARA 3ZXSA 1BN5A 4J7TA 4UB6C 2X1CA 3SNHA 3V7OA 2DO7A 2TMVP 2KIFA 3GX4X 4D5CA 2RN7A 2H8WA 3PFIA 2ZD9A 3UNGC 5HSWA 2W00A 2KKOA 4G8XA 3ZQLA 2VQGA 1WN0A 3VRCA 2AQFA 1RMVA 1ZN2A 3T4RA 1ZHYA 5COMA 3BTCA 2HV7A 2M5WA 2P5LC 1DQUA 1X2MA 4FESA 2OTJI 1VFCA 5J4VA 4BE2A 1T38A 1PUFA 1HE1A 3EZHA 2I8BA 4EIYA 3UGOA 4EUKB 3ECSA 3S3NA 3K2ZA 5E33A 1IDYA 4FCYA 3IQ6A 1K61A 5EHHA 3I5UA 1SF8A 4A2UA 2KP6A 3R60A 4C3IJ 5HODA 5TISC 3HPHA 1AWCA 4QPQA 3H9QA 2VCCA 2IA1A 2H7OA 3LSTA 4HFFB 3ABTA 2DBBA 1Y8QB 3NRHA 1MW7A 1WWXA 1YOVB 2QVOA 1ZHZA 3ZMVA 3M79A 2R7XA 3OL4A 3KEQA 4MVMA 1FYMA 4I6ZA 2YZSA 1O3SA 1AEPA 3OS0A 4MLOA 5FLMJ 4U9DA 5T3WA 1TQIA 3EPVA 3AL0C 4P1WA 2VXZA 3CTAA 1MD0A 4A3IJ 2J7PD 2H8AA 2CYYA 3H2UA 4PJNA 3W6JB 3RPUA 4DBRA 3DAGA 1I39A 2G0EA 3DCFA 3I53A 2YRFA 1L3LA 4S05A 2MHRA 5A6BA 1IV8A 3DPTA 5TGTA 3DE8A 3F21A 5E79C 2PEXA 3JREA 2OU2A 3L34A 4H4KC 3JZ0A 1WZ2A 3GM2A 4CIPA 5HLGA 5CKTA 1F36A 3CJRB 1VZ0A 2FUG2 2PI0A 4EJTA 2XPUA 2H27A 1LE2A 2FBHA 2NRAC 2CRGA 2R9RB 3HL2A 3ZQYA 5E18F 3BG6A 2R25A 1HQCA 2HYJA 1LVAA 3M8FA 5EG0B 4DVZA 2E7WA 5IPAA 2ZJ2A 5TRDA 2L7KA 2ZFUA 3S0XA 4XLCA 2E1NA 2UV1A 3HGGA 1ITYA 3Q7LA 2PMUA 3A01B 2XRHA 3LSJA 2CGPA 3BC8A 1MBEA 3GFMA 5L3CA 2IXMA 1G2HA 2V3CC 3OYHA 4AUXA 2MYSA 3T6JA 1UAAA 1VQ9I 1SAXA 2DA1A 3AG2C 3VFZA 3K4LA 3CUQC 5AIQA 3JR9A 4KFCA 1OMIA 2W84A 3TOAA 1VQ6I 3DTIA 3GEEA 3CDHA 4ZDPA 2FBIA 1XZQA 2OU6A 2DAOA 1J9IA 2H6BA 1IJWC 3TOMA 2LR8A 1JRAA 2AO9A 2XGCA 1KTMA 2Q4FA 4L6RA 1ENHA 3BR5A 4D7MA 1MSEC 4C7OB 5KHDA 2F2EA 2XLMA 2DA5A 5E8IA 2DFHA 1T5OA 2STWA 4XKCA 1LDKB 4HNTA 1B59A 1XDUA 1Y4CA 2XGEA 4KJZA 1F1MA 5JVGF 2O8KA 2NS0A 4EJVA 1J5YA 1OCOH 5LHGA 2GOMA 4CO8A 4DZJA 3K1IA 4ONSA 2DMUA 1W5CC 3J7YJ 3OYEA 4MO7A 3KLNA 4XN0A 1ETOA 2XLVA 4Y3OA 3I55I 3LSMA 3G4SI 3PUBA 2O0YA 3Q7GA 1E84A 4GRIA 1CGME 1HC8A 2VT3A 4MTEA 1VQ8I 3IQTA 5A6JA 4U88A 1SMTA 1BBYA 1YZAA 2Q7RA 3KKBA 1ETYA 4FQGA 2BHZA 1GLNA 4XLFA 2BXYA 2CQKA 1S72I 2AS5F 4KIFA 2CV1A 3JYHA 4N06A 1EKYA 4OAZA 4KT5C 4H54A 4NQWA 4MVUA 4DW6A 1GV5A 2L0KA 3IH3A 4WCGA 4XOPA 3V7CA 3V8JA 5T1DB 2BW3B 2CNWD 4FWVA 2KDZA 1J8MF 3DI5A 4C7OA 3H1CA 3I54A 4P55A 3S3OA 2XAJA 4I44A 4IB4A 2XRNA 1MSFC 1OR2A 1BR4A 2LY9A 4A12A 1YDIA 5DLJA 1BM9A 1HDPA 2DJNA 1I3AA 2K7LA 4BE1A 1YJNI 2MA3A 1EF4A 2IOQA 2XL6A 5GP9A 1YJWI 3T6BA 1BOBA 2GIZA 2MD5A 2WAEA 2DK5A 4MQ9F 2L3DA 5CLSA 5GPAA 1B8IA 3WHNA 4A3KJ 2XAUA 1R4TA 1XGOA 1H9TA 4A3CJ 1X4PA 1TWCJ 2O5RA 4CJGA 3CD6I 2IA2A 2H1LA 2PFDA 3UMKA 1IGNA 1J0RA 4BG0A 1LVKA 3FF5A 1HLVA 3CCMI 2VE8A 4EMSA 1L7CA 1NG6A 4I0AA 1TBXA 2E2IJ 2W85A 2WA0A 1OR7C 2VIXA 4KISA 1DDNA 3EG9A 4PR9A 1XB4A 1UFBA 4JEAA 4B3XA 3ASOH 3VF0A 3LNRA 1PD1A 4UHTA 4BJ5C 1M56C 1RUOA 4U5FE 1GDTA 1ZKGA 5D4RA 3KETA 1FTTA 1USSA 3P9KA 2FNAA 5IT9Z 5J1UA 3OV8A 4A69C 2P4WA 1N75A 5A6KA 4BXFA 4CDYA 5C4JJ 1VTMP 1RKTA 1KQ9A 3KZZA 4NNJA 1RKCA 2D4UA 1N25A 2DDAA 2NS7A 3MFKA 1C03A 4DBQA 5HDNA 3NKEA 2QUFA 3H3VK 3BPVA 3R7CA 2Y9YA 4U5HA 2Z15A 3E70C 4HFKB 1V5FA 2DTZA 3DD7A 3DBHB 1T56A 2A68F 2WBMA 3K10A 1FOXA 1ZRFA 3ABUA 1PUFB 3IRQA 1YLMA 1MMSA 4PFPA 3EYYA 3HDDA 4HSTA 2LFFA 2RSEB 1DUXC 3QW1A 3ABLC 2KYHA 3O6BB 3PHF2 3G4ZA 3QAHA 4DVYP 2V1UA 4E0IA 3B0PA 2RDPA 2GOXB 2R7OA 3HGYA 4P5OA 2K27A 1S8NA 5GTIC 1K4TA 4AU7A 1Z91A 3CUQB 4AIJA 5AC4A 2L2OA 1XD7A 2LFDA 4XEVA 4O3MA 2E60A 4XKWA 3DPUA 3HSFA 5M5WJ 1XG1A 4U87A 3PCVA 3H9JA 1HE9A 1K04A 4BXXJ 4YT2A 3H35A 3KP2A 4ETSA 3AGUA 4BJTA 4A2NB 2R03A 4A3MJ 1M2VB 4OOIA 5B3SC 2I8DA 2F5VA 2OV7A 3KP4A 2HZDA 4AWXB 3IV5A 1OFCX 4RA2A 4UB8C 1LNWA 2OZUA 3F23A 1UELB 2IA0A 2ZXJA 4U7BA 3EFOB 4YK5A 3SZTA 4DNCA 2WZGA 2IS4A 4BEHB 1AA7A 3BWGA 4M9ZA 4A3LJ 5LRRA 1T0FA 4AYBA 3C62A 2MBFA 5C3EJ 3GTLJ 1G3WA 2R7FA 3QWLA 2NVUB 3HKKA 3C7JA 3R61A 5DD4A 2P61A 4YL0A 3G73A 1XGMA 2EA2A 1HY5A 2Z2SB 1AOYA 2CCYA 3ONQA 4FAPB 1XX5A 3A1YA 3H0GJ 2IW5A 2HOSA 5FZTA 1XSVA 2IP2A 2W4SA 3E1SA 5K5RA 3DWLE 3BEHA 5EYRA 1SANA 3QOEA 4QTRA 1ZG3A 1C17M 4A0XA 2E1MC 4HDVA 2LD6A 3FM5A 3X2QC 1LB2A 1TW3A 1GQAA 2PX0A 2X6OA 1AKHB 2YL3A 4S04A 4KMUX 5IYCJ 1ONVA 3G1OA 3W8HA 1VF9A 1MGTA 3FIWA 4M71A 4HQEA 2O7OA 5JRAA 3QPLA 3CSKA 4C3HJ 1QVTA 3RKQA 4KN4X 5F0HA 2VUMJ 1HKQA 1MMNA 4R8HA 4IHXA 5F5FA 5HS8A 2L4AA 4C2UA 5D5XB 1A31A 5KYUB 3U9GA 2LD5A 3HNIA 4NTBA 2X1DA 4B3AA 1WJAA 5KYNA 2EINC 2XF7A 1BW6A 1Z05A 2LMDA 4LG0B 2YS9A 1JKRC 1IAWA 4LLCA 4QIWN 2LBFA 3ZMSA 1I6XA 2R7UA 3JRAA 3LLIA 1LDJA 4JE9A 2IS6A 3A0BC 1X19A 1NK2P 3DEEA 4MW8A 4KMFA 1RJ9A 1W7PD 1QNTA 2EILH 3RPQA 3DV8A 2CWEA 3PMRA 3PNYA 2FEZA 4M3BA 4FASD 3KFWX 2R5YB 2JQ7A 5M5XJ 4QDLA 5DDGA 2J8WA 2J9WA 4JIOA 4YIRX 1AKHA 3FK7A 1X1CA 1LDDA 3SZGA 2XPVA 3L2UA 3G6EI 4RMNA 4D9JA 1U2WA 5F28E 4ZH4F 1A6IA 3E6CC 2KISA 4G7OF 1OW8A 1ZHFA 4M3EA 2R7WA 3Q6MA 4RGXA 2QKMB 3S9OA 1Q0MA 2JA2A 4M9XA 4NC7A 5DV5A 2UUZA 2NXNB 5BPDA 4W8PA 5KAFC 1QHHD 2Y3BA 1U9OA 3HOWJ 1ETXA 3BZCA 3FM3A 2DA7A 2MSYA 2V1NA 1XMAA 2XB0X 1Q1VA 3F8CA 5FFZA 3CC4I 1G3YA 4LG0A 2PFBA 2BXZA 4A3FJ 1OJLA 2BY1A 2JT1A 1TWAA 3L2WA 4U0WA 1Q0FA 3NYJA 4MFDA 3PQJA 1JHHA 5K5OA 3DLLF 3RPUD 1WKMA 2PMHA 2QSHX 4R32A 4ZJZA 1MBFA 4OIQF 5LHIA 2VKVA 3FXRA 3ZN1A 1LI7A 2MLKA 5LHHA 3F47A 5ICCA 3DZAA 2V9PA 3IKVA 3SP1A 2XAQA 2QY9A 2R92J 4MTGA 4E7JA 5FGMA 2GLOA 3FHNA 3MAJA 4J00A 1JTYA 3ABKH 1X1AA 2Z16A 5L0HA 1DP7P 1WATA 3I3LA 2KMUA 2XROA 2OUMA 4LK0F 2KZGA 1RJ9B 2M30A 3E97A 3AJMA 5E3CA 4BAYA 3CP8A 2P7VB 2V9VA 4YT4A 4JCHA 3LNMB 3HOSA 2EFPA 1AU7A 4XPWA 1X3UA 4Z9IA 3GTQJ 4U9EA 5F6FA 3BZKA 1FYKA 4L0YB 3GTPJ 4QPOA 2HKVA 2W82A 4RB3C 2XLHA 1TC3C 5L3EA 1YJGA 2P7CB 1IXSB 1SD5A 4BXUA 1QZEA 2VC0A 3SZRA 1QRYA 2EIJH 1TWHJ 4PSXA 3RQIA 5D8LB 4UUSA 3E0JB 5M3FJ 4IPAA 3AG3C 3U9MA 2O9LA 5FKNA 1W0TA 1SYQA 4M6YA 1U0JA 5LGTA 1QSPA 4FETA 2Y69C 1DP3A 1T9KA 5LGNA 2B0LA 3T1BA 2KFDA 4ABZA 4ESJA 1D1BA 1PP7U 2KSFA 3OIQA 2PJPA 1HW5A 2ZNYA 2L4MA 1HMDA 2VJIA 3FWEA 5CVIA 3KE2A 3EYIA 2HMQA 3HNLA 2PMZA 2G9WA 5E3LA 1YI2I 1A41A 3ABLH 3OS1A 3OR2C 2XKPA 4HPQA 4OIRF 4F3QA 1OCTC 2F22A 3KL4A 3WAQA 2WY8Q 4EBBA 1YW8A 2VJ5A 4ESFA 2DPUA 3ZCOA 1NFOA 3SQNA 2KL4A 2L6HA 4MW3A 1QZYA 1S9HA 1Z6TA 3DU6A 3O2PE 4O5VA 2CW8A 4LJZF 1O7LA 3FZVA 2L7ZA 5D4SA 2GFHA 2V6EA 3ZR8X 1MJAA 1Z1DA 2VQCA 5EEHA 1TKNA 4G12A 4QSHA 4II2A 2Z3YA 2C6YA 3OYFA 3TL4X 1Q0DA 1SFEA 5L3VA 4GGGA 2ZSHB 1WOLA 1FBUA 1R36A 2E35A 2V1XA 2YSRA 1FIAA 4C30A 5E2QA 3S1NJ 4YWQA 2ISYA 4V2GA 1ZARA 3JRTA 1NLXA 3A03A 3EFOA 5AC5A 5CQEA 4I0BA 1Q1HA 2CUFA 3LESA 3L2RA 2EV5A 2HYGD 3BG7A 4I01A 5J6XA 3AG4C 1OKKD 5KCMA 1BJAA 2JRTA 3TQNA 5K0IA 1VLSA 2DI3A 2YUSA 2OQRA 3HOVJ 3BJOA 3CESA 1SMYF 3WG7C 4L5EA 5L3QA 4ENJA 1RUNA 3ZQIA 2O3FA 1FP2A 3S3MA 3I5PA 3WU1B 5D91A 3HC7A 1YE9A 1P7JA 4UVCA 1K6OA 2R05A 2ICWG 2LKPA 2J0XA 1ETQA 3BPXA 3WODF 1FT9A 2V9KA 5IP6A 3HJEA 1F43A 2RKHA 2JD3A 1FOKA 3J7ZI 4CCKA 3CQZJ 4LB6B 2KNHA 2PX9A 1ZU5A 5AIPA 2XLEA 1D5YA 3B29A 1OQYA 1KU9A 3E9VA 5JVTA 1U8RA 1WPKA 2Y0MA 3CQZA 2F4OB 3B02A 2ZMEB 1ON2A 5M3MJ 3OY9A 4XTKA 5F5HA 4MGRA 2QLAA 3TEDA 1QZXA 2IVMA 2Q00A 4HG2A 3U2LA 5H20A 2L7FP 1WFXA 2OZ6A 3ECOA 1FBQA 1QLEC 5H6RA 4C3JJ 1Z0XA 4E7HA 4UUVA 1KQ8A 1X2NA 2XAHA 1Z7UA 1OYYA 4FISA 4LDRA 5EGYA 2A6EF 3QMKA 1VQ5I 1YG2A 5AONA 4IQJA 3U2MA 3CCYA 1FTSA 4EBJA 4B4CA 2JWTA 4LG3A 2K3FA 3S90A 2RREA 1ETVA 2KRCA 4EJOA 2DK8A 2KDOA 3ABMC 1QHGA 5EGOA 3OYIA 1J59A 4BEMJ 1PCXA 4PUSA 3V7RA 2RD9A 3CDIA 5C44J 5B1AC 3MQ0A 2BOLA 3QPTA 3F46A 5H6QA 2QE9A 3VSLA 5GAHJ 3GXOA 3JRHA 2V7FA 5IOYA 3M1CA 3Q5FA 3IHUA 1YS7A 2NOJB 3IH2A 4EQQA 3CJNA 3PNTA 2W24A 4HEA2 3RI4A 4FHTA 4XK4A 1ZGJA 3WU0A 1ZR2A 3C2GA 3KYDB 4PJJA 5F0FA 1SEUA 2DU9A 2K40A 2ZC2A 2Z5UA 3G1MA 2KW3C 2W4MA 4IJJA 3ZDLA 1SVMA 4Q4ZF 4IARA 2EWNA 3LFKA 3GFLA 1BIBA 3I9V2 3K4BA 3GANA 4CDAA 3K70D 1TWGJ 3L2VA 1W2WA 2KK1A 1T98A 3VODA 3TMOA 4YIFA 4BY7J 3RIPA 1BOAA 2CUZA 5BMZA 1CPQA 1ETKA 1TWGA 3VWBA 2WC2A 1J7KA 3MFNA 2IXPA 1NG7A 3PIOF 4NHJA 2CGEA 5JT4A 1ZH5A 2HNHA 1D0YA 2I10A 3JT1A 4XRSG 1UHMA 2BW3A 3LSHA 3R0JA 3RIRA 3HTUA 4RGUA 1E3PA 3V8KA 1K78B 2JA6J 4ENNA 1XN7A 1QQ3A 2FA5A 1EA3A 3AQBA 4NQFA 1KNYA 3RTRA 1LFUP 4RDUA 1FTZA 1HSTA 3HJCA 3BP8A 3JRGA 2B7EA 4EJUA 2VKEA 4B48A 2X0LA 5DQTA 1XCBA 2Y3HA 1HMOA 5B1AH 2RNGA 3WHBA 1KU7A 4HE8D 3M1EA 5B66C 2YL7A 4IEJA 1ZR4A 4JVSA 4CZZA 2EZHA 1HF0A 3OYBA 2HWVA 3DP7A 3PDMP 5FRNA 1R6RA 2XXAB 3TW7A 3S32A 3CO6C 4A4AA 3KLOA 3IQ5A 2RGVA 2I5UA 2Y69H 3JSPA 3AKZA 2PBEA 3J7AO 3O55A 3H5RA 2C04A 3C63A 1WWPA 4V2FA 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4IZZA 3J7AY 4DRIB 2CUEA 4QLCU 4YFKF 4B8XA 2M7AA 3FAPB 3MBGA 1OCZC 3MX3A 2EJRA 2JN6A 4U5EE 5KYWA 4N4OB 2EH3A 1HKSA 4UY8I 2LF7A 2GA0A 3EHMA 4P96A 1D8JA 2UUHA 1NU9C 4YEJA 3WGHA 1TT5B 3GCMA 1L0OC 1TWCA 2HOEA 4DYRA 2YWAA 2IS1A 1XZPA 5DS9A 2QZ8A 3CLQA 3U3BA 3RH3A 3S15J 1P2FA 3VDXA 1Z5ZA 3ZTZA 4I09A 3W6VA 2FD5A 4MFEA 2G3VA 1FFTC 3HM5A 3FXMA 2ADUA 2ECBA 1GXPA 3ZN0A 5HOOA 5A6BD 3PIPF 2XGDA 1T95A 1U6GA 1YYJA 1BC7C 2YU9J 1YYXA 2O8XA 2DT6A 4BQOA 2IXSA 2V79A 1Z77A 5IOZA 2M0CA 2FJ1A 1IN6A 3C1DA 5EZGA 4P9TA 5KNLA 1OPCA 1TZLA 1NZEA 2MH9A 4A3JJ 1YTYA 1SC7A 4E70A 4XRMA 1VQ4I 3K1IC 4Q5SF 1V4RA 2QUPA 3IAS2 4IVNA 5L0IA 3BR2A 3Q0VA 4KNWA 2H09A 4C2MJ 4MIMA 5JLXA 4BBRJ 3H3UA 1JOGA 3DJUB 3TJ5A 4NC3A 3KIOA 4W1UA 3A2KA 4XL9A 2ZJPF 4ULWA 4IHYA 2XDVA 4BJ6C 1U5TA 3K1NA 1LFBA 3B73A 1KYWA 4BE0A 2HR3A 4BQAA 5JP7A 2XV4S 1TWAJ 1B8IB 2L9NA 2J9UA 2OKUA 2P1AA 1RC9A 3VYTB 3MLGA 3S2DJ 2Y31A 3BG5A 1LE8B 2ZMEC 5F08A 2GIVA 2W57A 4LLNA 1ORSC 2EPNA 3BLYA 4FTHA 3LS1A 2Q9CA 4RLFA 5LFAA 1ERDA 3MVPA 3QU6A 3FVYA 2NOGA 1ORKA 3LEVA 5KYWB 3PNVA 2R5ZB 2K9LA 2LY2A 1P7IA 4RDAA 4HF2A 1VOMA 1FEXA 5A69A 3HKZN 3LAPA 4CCMA 1W36D 2ZCWA 4L0ZB 1FPQA 1MMDA 2JMWA 1HBXG 4YT8A 1F5TA 1U9NA 4BY1J 4OU0A 2X48A 1NHAA 2JTVA 5BQTA 3W2WA 1SFOJ 1CF7A 3GFJA 2COMA 2XL4A 3BROA 1P9QC 1E86A 3FXQA 4BHCA 2ELKA 4A0YA 3FK6A 4U0VA 3M4OJ 4LIUA 5BNGA 5L0CA 3P9IA 2BY0A 4I99C 4XSZF 4P6IC 2X0CA 4LGWA 4UV8A 1HW2A 2YLIA 3ZRGA 3K0LA 3LSRA 2QSGX 4WGYA 1HW1A 1OLTA 2DA3A 1D0XA 2G7HA 2IGOA 2FOWA 4L5IA 1S7OA 4LITA 1YHQI 1T6IA 1TWHA 3QZCA 4F4BA 1ZRCA 3OA1A 3DKAA 1RESA 3Q3SA 4P9UA 1LIHA 3B9QA 3S29A 2AXTC 2DA2A 5JHUA 2PJRA 3GORA 4AIHA 4QI2A 3CJTB 3WG9A 3ZMDA 3CCRI 1XMKA 1ZAOA 2GAQA 4LLEA 3GYHX 5FKMA 4HEAJ 3M8JA 4N9HA 3EGXB 3LS0A 3MEXA 1QKRA 3U1KA 2JA7J 3I0TA 5GAEJ 2G3KA 3SEOA 3H0DA 4HNVA 2QLZA 3TD7A 3S17J 4BQQA 2EFNA 4LERA 1GVJA 1S29A 2Q2EB 2VKDA 3S1QJ 3NYLA 1R49A 2Y3GA 5JLIA 2Y0SN 4HBLA 2IEKA 256BA 2JPUA 3K66A 4N6CA 4CX9A 5CVVA 2CH0A 2NVTJ 3QVZA 1WJ5A 3I4NJ 3T6GB 2R7TA 2HKOA 1D5VA 1P4AA 1JR8A 3C8GA 3NEUA 2M1BA 2FQ4A 4WWCA 2HVRA 1T8IA 4HLXA 1FY7A 4BJ1A 3OYJA 2M0MA 2H1KA 4KICA 2QA4I 4E0HA 3ROUA 2X6YA 4ZYEA 5IP7J 2LP4A 4IHTA 2DMNA 3PM1A 4GDFA 1TP4A 1YA7O 1MKMA 2L6GA 1JTXA 1VYKA 3K9TA 3T9OA 5F0CA 3SFIA 3K4NA 1REPC 2IT0A 2P6VA 1B72B 4BH9A 3CF2A 4XICA 3HEFA 1WJEA 5DCMB 4XEKA 3G1LA 1ZLJA 2M2EA 2X1EA 2YX7A 1PUEE 4F52A 1W0UA 4QWQA 2KGOA 3W8IA 1E3OC 3S27A 2FXAA 5D5VB 3QYEA 1X1BA 2M34A 3R6SA 2GZWA 1JE8A 5HNHA 2VH3A 3H65A 1S6LA 3IUOA 4RAYA 2DOEA 1RNLA 2MD0A 3AG3H 2HKXA 4IF4A 4YRVA 2QBYA 1LM3B 3FOOA 2ZXWH 1KQ0A 4JOMA 5ILSA 1K40A 1U6HA 2IBFA 1IN8A 3IAM2 1OISA 1X1PA 1JT0A 3F6VA 3FMSA 3F6OA 3LA3A 1Y39A 1LUJB 4EATA 4I02A 1EA8A 1LI5A 5JR3A 2M87A 1WCMJ 3VYRB 3QP5A
chains in the Genus database with same CATH topology
2LBFA 2MFZA 4Y33A 3LL7A 4OD4A 5KYYB 2R7UA 3PSFA 4E7IA 2L9JA 3LLIA 5HLTA 2WVOA 4PFOA 2IS6A 1Y56A 2DYRC 3LLKA 4JJGA 5DS6A 4XR6A 3DKXA 1X19A 3DEEA 3B0UX 3MKZA 1QU3A 1RJ9A 3EJNA 3PMRA 3PNYA 4QDLA 4AX2A 4FASD 3I4UA 2ZXRA 2NUTA 2LH9A 3ZGKA 1ZHWA 4CBEA 4JQFA 2J9WA 4E7ZA 4BDZA 2X6XA 2E1MB 3NYMA 3NWTA 1X1CA 3SZGA 3L2UA 2A69F 4RMNA 4D9JA 4XLPF 2H7BA 4BQNA 3O39A 3VYUB 3UGPA 3OS2A 4CA0A 4G7OF 4RM2A 5LD2C 3AG1C 2K9MA 2V4JC 2R7WA 1MNEA 3Q6MA 2QKMB 1Z23A 4W8KA 2ZXIA 3HXLA 3RKOF 1IZMA 2JA2A 4JW1A 1V5EA 4NC7A 2UUZA 4IWBA 4U5CE 4RLQA 3RYLA 2ZXOA 2KQ9A 1QHHD 2Y3BA 4WJ0A 1ZELA 4XQFA 3OWTA 4CCJA 3LSGA 2E87A 4ZLDA 5T3TA 2V1NA 2XSEA 2PJRB 3EGDA 1JI8A 1WJDA 5FROA 3NDBB 2EIMC 4F91B 3D5LA 2R7QA 3U21A 4B43A 1TWAA 3L2WA 3NYJA 3AL0B 2IS2A 3K7DA 3RPUD 4BL0B 4CH7A 2XXAA 4ZJZA 4B47A 1TR2A 4OIQF 3JCUQ 2FGYA 4CCOA 4J30B 3V42A 2NUPA 3EUKL 2CW7A 2IGMA 3F47A 4RM3A 1E0EA 4C3EA 3DZAA 3DMDA 3GBGA 2J46A 3SP1A 4XKBA 2VQHA 1K6YA 2VQLA 4C9YA 1PD0A 4ZDLA 4E7JA 1O5HA 2QY9A 3GODA 3FHNA 4J00A 3DAFA 4U5BE 3ZSUA 1MMGA 4C3BA 1X1AA 2CUJA 2Z16A 2LG4A 3I3LA 2KMUA 2VB6A 3NKDA 4OD5A 2F6CA 5B1BC 2OUMA 3D5SC 1RJ9B 3L0IA 1VK5A 4JZAA 2JSPA 4OWRB 3OIPA 4JURI 5E3CA 4BDYA 3CP8A 2Q9BA 4D1QA 1PYVA 1NG1A 3ZG1A 2BVMA 3DLAA 4JCHA 4XN3A 2WZFA 4YJWA 3LMMA 3UMIA 2Y39A 1ZHTA 4YT4A 2DJIA 3HOSA 1J8YF 1M57C 3DQVC 4NUBA 1SZIA 5DS4A 4IAOA 2PX3A 3SEZA 4QPOA 3EGDB 2W82A 1Z3YA 3HOTA 4OIOF 2ELJA 1W36C 4HRIA 4IQ4A 4XLAA 4YELA 3HUGB 4O79A 3BCBA 4PSXA 3S28A 3SZRA 3AG3C 3E0JB 4AK9A 1T0FC 2IGNA 1ST6A 1LFPA 3O6XA 3POVA 4OIPF 1U0JA 2VJ4A 2LOOA 2PP4A 4FETA 2WVQA 2Y69C 1DP3A 2AQEA 2M4KA 4XKVA 2KLOA 3FBIB 4E4HA 4M63A 3OMYA 1D1BA 3OEOA 2EIJC 3W3CA 3OIQA 4CCNA 1V55C 2XC7A 2VJIA 3CMMA 1Z7LA 3OR1C 2HVSA 3DM9B 4CS9C 2DOAA 4E6KG 1TT0A 2PMZA 4CSAA 1KONA 2ZSIB 3LSKA 3OS1A 1WJBA 2CV2A 3OR2C 3H9GA 4HPQA 4BS9A 4F3QA 3KL4A 1MMAA 4OIRF 4RBNA 3H5AA 2WY8Q 4EBBA 2F4IA 1N77A 2RQQA 2VJ5A 3G2BA 3OYKA 1LKXA 3ZCOA 3ASOC 2KL4A 3ZQQA 4RD9A 1S9HA 3DU6A 4KBLA 3OL3A 2CW8A 4IX7A 4YN0B 2WB7A 4B44A 2GFHA 2V6EA 3ZR8X 2VQCA 3MKWB 3FKJA 4HSRA 2VPLA 1TKNA 2JVGA 3FAJA 4ZTFA 4II2A 5DQZA 3OYFA 3TL4X 5L3VA 2ZSHB 3OOUA 1Z6AA 4C30A 4XWJA 5E2QA 4YWQA 3DM5A 2A6HF 3C2HA 5KYXB 2Y3DA 3JRTA 4PSWA 2YHSA 3EFOA 2Z1DA 5CQEA 5CI9A 4CZCA 3EQLF 3LESA 3L2RA 3BG7A 2H7VC 2WY7Q 2Y0SA 3AG4C 1OKKD 5KCMA 1FMWA 2IXOA 2A6TA 2KHMA 2M4GA 3HPGA 2R4GA 1Z3IX 3N24A 3CESA 1SMYF 3WG7C 4BJ6A 5L3QA 3OYDA 4ITVA 5IY5C 3S3MA 3I5PA 4Y4RA 5D91A 3HC7A 3EH1A 1YE9A 1D0ZA 4QI0A 1X1DA 3ZXSA 2J0XA 3MMYB 3SNHA 2X1CA 3V7OA 3WODF 2JVHA 2V9KA 1N1CA 3SYTA 2JD3A 3H5NA 3A4CA 4ZYAA 3UNGC 4CCKA 5HSWA 2W00A 4II3A 1Z3XA 2MC4A 2L9SA 1ZU5A 2KNHA 4K0DA 2VQGA 2AQFA 3E9VA 4PJMA 1D1AA 1ZHYA 3CQZA 3T4RA 2HV7A 1DQUA 4FESA 3EZHA 3OY9A 1JPJA 4BE2A 4J32B 4XTKA 5F5HA 3SEQA 2I8BA 1QZXA 3UGOA 3FBNB 4HG2A 3ECSA 4CSWA 3S3NA 5E33A 3SDBA 1WFXA 5EHHA 1QLEC 1SF8A 2KP6A 4E7HA 3HPHA 2CV0A 4QPQA 3H9QA 4PK4A 4HFFB 2H7OA 2A6EF 3LSIA 2OG2A 3PJRA 3QMKA 5EGYA 3NRHA 4IQJA 4BGDA 1MW7A 1MNDA 3DKYA 1ZU4A 1FTSA 2CFOA 1ZHZA 2R7XA 3OL4A 4LG3A 1OKKA 4LACB 3DU5A 2RREA 2LBFB 2YZSA 2KRCA 1N78A 2KDOA 3ABMC 3B0VC 3B0PA 1QHGA 4CUGA 3OS0A 4MLOA 2M7BA 3OYIA 1PCXA 4PUSA 5T3WA 3EPVA 3LAYA 3AL0C 4P1WA 2VXZA 5B1AC 2BOLA 3F46A 4KNVA 2KRHA 4XORA 2J7PD 3JSZA 4I3MA 2VJJA 4PJNA 3VSLA 3VYWA 4DBRA 2LRDA 3DAGA 2V7FA 3F9KA 3M1CA 3K4MA 1WGWA 3RFYA 1BR1A 3DPTA 5TGTA 3KH2A 2NOJB 4X0GA 2BVLA 3ZVRA 3PNTA 4HEA2 4F4BA 2CNWA 2L81A 4H4KC 1IRXA 3MKYB 3L34A 3C2GA 1FMVA 4PJJA 1M2VA 3PL8A 5CKTA 3CJRB 1VZ0A 2FUG2 2KW3C 2W4MA 4IJJA 3MD2A 2E5ZA 3FHDA 4E7KA 4Q4ZF 4KI2A 2CMPA 3HL2A 5FRMA 4LIVA 3BG6A 3I9V2 3K4BA 2NG1A 5CPRB 2FFHA 3GANA 3K70D 3L2VA 1W2WA 5HNFA 1Z63A 3HLZA 1V5GA 4AE4B 3TMOA 1YX3A 2HPIA 4FX5A 3RIPA 2CUZA 2L7KA 2ZFUA 3PFYA 4XLCA 4CS8C 3S0XA 2W1OA 1TWGA 2UV1A 3VWBA 1VMAA 4G0HA 3Q7LA 2IXPA 1NG7A 2CGEA 2X85A 2XRHA 5D92A 2HNHA 3BC8A 1D0YA 3N05A 3OYLA 2R7RA 4E7LA 3EG9B 2BW3A 3LSHA 3JT1A 2IXMA 2V3CC 2P7VA 2LC2A 3OYHA 2MYSA 3T6JA 1G8XA 1UAAA 3AG2C 1EA3A 3K4LA 2XF6A 3L2QA 3RSNA 3RTRA 4BEHA 3AQBA 3DTEA 3OYMA 2LSEA 1WJCA 3HJCA 3CJQB 3DTIA 2NUTB 1IW7F 2J7PA 4ZDPA 4B48A 2KZVA 4JJFA 5DQTA 4BUPA 2Y3HA 2OC6A 4O6YA 4U5DE 3TBIA 3K1HA 2RNGA 4HE8D 3K4JA 1G59A 2XSJC 2R7SA 3EPZA 3EGXA 4JVSA 3OYBA 4C7OB 5KHDA 3EUHC 4XLEA 1ZYRF 5FRNA 1R6RA 4K7BA 2XXAB 2VXDA 3S32A 4DIQA 3M1CB 4XKCA 1LDKB 3LFUA 4HNTA 2M3AA 4YT5A 3NWSA 3AKZA 4XONA 4KJZA 3ZIBA 4PJLA 4NY3A 3H5RA 3RQ4A 2C04A 4EWCA 2EILC 1M2OA 4ZDOA 2GOMA 2HVQA 4G7HF 4B6IA 3J7AY 4IZZA 3EH2A 2JUGA 4NC8A 3W2VA 3OYEA 2XF5A 2HU9A 3FDYA 4XN0A 4E7SA 2M7AA 4Y3OA 4U5EE 1OCZC 3LSMA 5KYWA 4N4OB 3PUBA 3EHMA 4O6MA 5JHFA 4XNFA 3Q7GA 4C2TA 3HTKC 4GRIA 2VKHA 1NU9C 4YEJA 4NQWB 4OAYA 1TWCA 3I5QA 2IS1A 1S7ZA 2Q1ZB 2MWQA 3KKBA 3RH3A 4I1MA 3VDXA 3KYLA 3KMIA 4O6NA 1GLNA 4XLFA 1Z5ZA 2X6WA 3KX2A 2CV1A 1LS1A 3JYHA 4N06A 4CS8A 2G3VA 1FFTC 3K4KA 4DGWB 4OAZA 2W7NA 3ZC4A 3VYSB 3HKZA 5HOOA 3UMHA 1Y6IA 5T1DB 1T95A 4XOPA 1HA8A 2LY1A 2K5CA 2WL8A 2BW3B 2CNWD 1OCCC 3OYGA 2ZPAA 4FWVA 5CQGA 2DT6A 1J8MF 4BQOA 2IXSA 4IRUA 4CS7A 4C7OA 3S3OA 3IP4B 5KNLA 2UWMA 1TZLA 4I44A 1NZEA 1DGRM 1BR4A 4ZTJA 1ZHXA 1VYIA 5DLJA 4HNUA 2IOQA 4BE1A 4DVZA 3K1IC 1D1CA 4Q5SF 2OCCC 3IAS2 2VLAA 3T6BA 1BOBA 4MQ9F 3DJNB 2P0WA 2WAEA 1OCRC 4KNWA 5KYXA 2XAUA 3S93A 1X4PA 3NG1A 2O5RA 2ZXWC 3DJUB 2PFDA 3UMKA 3A2KA 4XL9A 4ULWA 2XDVA 2DT7B 4BJ6C 1LVKA 2M4EA 4BG0A 1WJFA 4XOTA 1NG6A 2D5RB 4KISA 2W4BA 2WA0A 4BE0A 1OR7C 2VIXA 3EG9A 4GEHA 2L9NA 4B3XA 2J9UA 1O87A 2W9YA 3MLGA 3VYTB 3LNRA 3LS1A 1PD1A 4CCLA 3BLYA 4BJ5C 1FFHA 1M56C 2Q9CA 4RLFA 5LFAA 4U5FE 4OINF 1ERDA 2G62A 3FVYA 2Q9AA 4BACA 4HFKB 2ZXPA 1Z21A 3AQCA 1V54C 1SAUA 2BE5F 2W45A 3LEVA 1JPNA 1N75A 3PNVA 2K9LA 5CI8A 2LY2A 4BXFA 2O9XA 4RDAA 4F92B 1VOMA 4NNJA 4CIHA 3VSKA 4CCMA 1W36D 1MMDA 4YT8A 2CS3A 4IKFA 4DBQA 3NKEA 4XLNF 3LJBA 4J01A 4U5HA 4R79A 3W2WA 2HPMA 2Z15A 4ZC3A 1V5FA 3DPLC 3DD7A 2XL4A 3E70C 1P9QC 2A1DD 2A68F 2WBMA 3DTKA 2ZXHA 3K10A 4LIUA 4C3DA 1NU7D 2CW0F 4PFPA 4HSTA 3K4CA 2DYSC 3K6BA 4P6IC 3ABLC 2MABA 3ZRGA 2VL8A 2WAFA 2WZLA 3PHF2 4XLHA 4F93B 1OLTA 1D0XA 4I1OB 4DVYP 3N2ZB 2IGOA 4LITA 2PF4E 2A5WA 3PSIA 2GOXB 2R7OA 3QODA 4P5OA 2DXIA 4AVZA 3AFHA 1TWHA 2IYLD 3OA1A 4AU7A 3DXJF 5FCLA 2L2OA 3KEYA 2VASA 4BJ5A 3B9QA 4X0RA 3S29A 3QYFA 3FDQA 3QZCA 4GYTA 4ZLCA 2Q3TA 2KQRA 2E60A 4XKWA 3K70C 2PJRA 4CSAC 4QI2A 3DPUA 1PJRA 2DCEA 3RCOA 2WADA 4BU2A 4LLEA 5KYUA 4N4NB 4U87A 3IEEA 3H9JA 2LYCA 4HEAJ 3W2AA 4YT2A 3M8JA 2YEVA 3H35A 3EGXB 2KPMA 2WAQA 3LS0A 4BJTA 4A2NB 5KYYA 1M2VB 2G3KA 3H0DA 3UR3C 3SEOA 5B3SC 4U5GA 3TD7A 2I8DA 4LERA 1J09A 2F5VA 2OV7A 2HZDA 2Q2EB 4BQQA 2VKDA 4KITB 2HV6A 2KJGA 3NYLA 2Y3GA 5E3AA 3K66A 3EFOB 1UELB 1UG0A 4DOZA 4U7BA 3OYNA 2CH0A 4KT6A 1WJ5A 2WZGA 2E5NA 2R7TA 2IS4A 5HVQC 4BEHB 1AA7A 2QKLB 3CZ6A 3D5RC 3OYCA 2HVRA 2IXNA 2QTVA 4AYBA 3EZIA 4MNDA 5DVWA 4AE4A 3EHNA 3QYBA 4BJ1A 3OYJA 2L5QA 2M0MA 5BUOA 3K6GA 2NUPB 4Q7CA 2R7VA 2X6YA 2HDWA 2Z2SB 2V26A 3ONQA 3BCAA 3EUAA 3ABKC 2LREA 2J9VA 3A1YA 1VYKA 5DS5A 4G6TB 2W4SA 3E1SA 2WVNA 3MX3A 3K4NA 2EIKC 3S8PA 2P6VA 3DWLE 3CF2A 3CP2A 3QOEA 1WJEA 2HQAA 2DGJA 1YX5A 2E1MC 1DGWY 2WB1A 2X1EA 3SYNA 1KU2A 1BR2A 4F52A 2KGOA 4XM3A 4KC9A 3W8IA 3X2QC 2PX0A 3HG9A 2J45A 3S27A 3W8HA 4XMYA 3QYEA 1X1BA 2CDQA 2X51A 2C03A 4F55A 1X4OA 3ASNC 3Q6NA 3VAYA 3CSKA 1OCOC 5HNHA 2VH3A 3K33A 2J0WA 3H65A 3IUOA 5F5FA 1MMNA 4C2UA 5KYUB 2MD0A 4YRVA 2X1DA 2B0JA 4O7GA 4DJAA 1WJAA 4JOMA 2K3PA 2EINC 3ITFA 2XF7A 5KYNA 3IAM2 3N0TA 4CS9A 4ANJA 3X1OA 1SFKA 4EATA 4BEJA 4G7ZF 5KYWB 3OYAA 2IGKA 4LLCA 3VYRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ5 C;  3CZ6 A;  4BJ6 C;  3OWT A;  3K6G A;  4BJT A; 
#chains in the Genus database with same CATH topology
 2DTR A;  2MFZ A;  1U5T C;  2L9J A;  5HLT A;  3D1N I;  4RGS A;  1J75 A;  4AM3 A;  1BW5 A;  4JJG A;  3WTX C;  1YAU O;  1ODD A;  1ZW2 A;  1R1T A;  1RRJ A;  5A6A A;  3B0U X;  2XLW A;  4KN7 X;  3PO2 J;  2EZI A;  2DQR A;  5HS7 A;  4AX2 A;  2CSO A;  1V54 H;  2VC1 A;  4CBE A;  3QP6 A;  4JQF A;  5HLI A;  4BDZ A;  1IZ1 A;  2E1M B;  2X6X A;  4LOC A;  4L9T A;  1FAP B;  1FX7 A;  2Q8K A;  1P4W A;  1U78 A;  2CG4 A;  3NWT A;  2M64 A;  3DWW A;  3NYM A;  3CCE I;  3PQK A;  1FBS A;  3Q0W A;  1YIO A;  2X4H A;  4WF2 A;  3MZY A;  4CA0 A;  5CIV A;  2JZY A;  3UMH A;  2V4J C;  1B72 A;  4ENK A;  2A07 F;  3QQA A;  3W6K B;  1Z23 A;  1IZM A;  1V5E A;  4U5C E;  5GPC A;  4IWB A;  4CYC B;  4ZZD A;  2YVK A;  2E87 A;  3LSG A;  1RR7 A;  1K79 A;  3L9F A;  1MJB A;  2PJR B;  5DD8 A;  1JI8 A;  3EGD A;  3NDB B;  1RCP A;  3RVY A;  3D5L A;  2WB1 N;  1R71 A;  3L09 A;  5DM7 F;  2IAI A;  3AG2 H;  1UST A;  5IP9 J;  1IDZ A;  1EH8 A;  2XHK A;  1CGP A;  3S2H J;  2QWW A;  2STT A;  3ZWI A;  3SXY A;  2EPF A;  4B47 A;  4JK1 X;  1TR2 A;  4IAQ A;  1CQT A;  2R5Y A;  3JYY A;  2NNY A;  4J30 B;  3EUK L;  1XGN A;  2CW7 A;  3LWF A;  3HRM A;  1YAR O;  3QVY A;  3TOB A;  1E0E A;  4C3E A;  3J81 Z;  3TKY A;  2EZL A;  2AWC A;  2FML A;  1U89 A;  1K6Y A;  1O5H A;  2R93 J;  2YL0 A;  3GOD A;  3ZSU A;  5J8F A;  1MMG A;  5E3N A;  1GS9 A;  3CC7 I;  2OOC A;  4MVS A;  2LG4 A;  1ZLK A;  4OD5 A;  2VT2 A;  1RZ4 A;  1GXQ A;  1SVO A;  2D45 A;  3MCZ A;  1QQI A;  2UUI A;  1SD7 A;  4JZA A;  3OIP A;  4BDY A;  1RKE B;  2Q9B A;  4D1Q A;  3DLA A;  4XN3 A;  3LMM A;  1W5T A;  1IN4 A;  2Y39 A;  1TNT A;  2DJI A;  3ZMT A;  3DQV C;  1HOM A;  3WU2 C;  1PP8 F;  1X58 A;  3FXJ A;  1GM5 A;  2PX3 A;  1MH4 A;  4YFX F;  4M3F A;  2BBY A;  3HOT A;  5E1W A;  4PGH A;  3GME A;  4G6Q A;  5BQH A;  1O7F A;  3DFG A;  4O79 A;  3ZMU A;  2HJM A;  1ST6 A;  1LFP A;  3POV A;  3QPS A;  1WGX A;  2LOO A;  5DTD A;  5D6F A;  2BEO A;  3S16 J;  2FE3 A;  2M4K A;  5LLQ A;  3S2W A;  3FBI B;  4E4H A;  4M63 A;  1I1G A;  3GM1 A;  4BPM A;  1PVE A;  2GQQ A;  4CCN A;  5KVR A;  2E19 A;  3CMM A;  1Z7L A;  5TJJ A;  3F22 A;  2HQN A;  4E6K G;  1TT0 A;  5F04 A;  3B6C A;  4NTA A;  3LSK A;  5JVE A;  1WJB A;  1T2K A;  1MJ9 A;  3H9G A;  4AC0 A;  2Q2E A;  3V4G A;  3VPR A;  4BS9 A;  4WXH A;  1N77 A;  2RQQ A;  5DCF A;  1L3P A;  3FX3 A;  2L7M P;  1OW6 A;  1S7E A;  3ZQ7 A;  1LKX A;  4GYI A;  1P6R A;  4IRI A;  1R5I D;  3Q9V A;  3M15 A;  3H2V A;  2XUB A;  4KBL A;  2M8E A;  4B44 A;  2DW4 A;  2ZJR F;  4HSR A;  2GWW A;  2HFI A;  3G50 A;  3O10 A;  4F7Z A;  3OIO A;  3MKL A;  2CYD A;  4M73 A;  2BGC A;  2QYO A;  3RZD J;  1QO0 D;  1TWF J;  2ACJ A;  3KZI C;  5KYX B;  4A0Z A;  1UCR A;  9ANT A;  4PSW A;  3QPH A;  4A3D J;  2Z1D A;  5IY5 H;  1I5N A;  2LKX A;  2YL1 A;  3EQL F;  1LJ9 A;  2F5D A;  4MNU A;  5EF6 A;  2LIG A;  3KZY A;  1FMW A;  4JBA A;  1F9N A;  2IXO A;  3M8E A;  5EEG A;  2R4G A;  1V4A A;  2NS8 A;  4BJ6 A;  3ECH A;  2LK2 A;  1YIT I;  1CPR A;  1FOY A;  4ITV A;  1G3T A;  4LD5 A;  4ZYD A;  2VCB A;  2BHY A;  4RGR A;  2K9Q A;  1YO5 C;  1MQV A;  3EH1 A;  2KT0 A;  2PMZ N;  2HOT A;  2YQY A;  4QI0 A;  1YJ9 I;  3BJA A;  4IGG A;  2G7U A;  5BS6 A;  3MMY B;  3U2R A;  2JA5 J;  5FJ8 J;  2JVH A;  2IM8 A;  1APC A;  3BTL A;  1N1C A;  3SYT A;  5CVJ A;  3LA7 A;  1TNS A;  1OW7 A;  3H5N A;  3G4X A;  5F1J A;  3A4C A;  2DA6 A;  4ZYA A;  3L8I A;  1VTN C;  2QEN A;  3JTH A;  1Z3X A;  3ZQG A;  1IV6 A;  1Y0U A;  4IRH A;  3T0Y A;  1Y1V J;  4PJM A;  1VQM I;  2NSF A;  4IRG A;  4D7N A;  1T33 A;  4EGY A;  1FIP A;  2VI6 A;  4BBS J;  1UJ8 A;  1JPJ A;  1VQO I;  1JAF A;  3SEQ A;  4LK1 F;  3FBN B;  2OAZ A;  4YII A;  1I5Z A;  3V7S A;  1YVI A;  3HB9 A;  1BZ4 A;  1HKT A;  2DFF A;  5IT3 A;  3U3F A;  3GZN B;  3M7G A;  3WE3 A;  4PK4 A;  1A6Q A;  2EB7 A;  1GUU A;  2OG2 A;  3PJR A;  2OD5 A;  4WX9 A;  2UXX A;  1GV2 A;  1ETW A;  1O57 A;  3DKY A;  4BGD A;  3BT9 A;  5JFR A;  5L3F A;  1ZU4 A;  1IUY A;  1DPR A;  4LAC B;  2DMQ A;  3DU5 A;  1IXR C;  2XRL A;  2LBF B;  3WE2 A;  1NK3 P;  4CGZ A;  2XS8 A;  3GEI A;  3GWL A;  4BHP A;  2H94 A;  2M7B A;  2Y30 A;  1O3T A;  2UXN A;  3J80 Z;  4KNV A;  3KEO A;  2KJC A;  4XOR A;  3JSZ A;  4I3M A;  2RVC A;  3ZQH A;  1VLT A;  3VYW A;  4DRH B;  2LRD A;  1R7J A;  2M9H A;  1WGW A;  3COA C;  1BR1 A;  2Y75 A;  2HQ5 A;  4X0G A;  2K02 A;  2OEX A;  3MKY B;  1M2V A;  1FMV A;  2HSQ A;  3PL8 A;  3KP3 A;  2GWR A;  4JTC B;  3MD2 A;  1GHC A;  3FHD A;  4OMY A;  1ZZP A;  3D0S A;  5FRM A;  1B68 A;  2FFH A;  4CIC A;  2LSO A;  1Z63 A;  3HLZ A;  4JTD B;  4EM0 B;  3I59 B;  3M4B A;  4AE4 B;  3PFY A;  4G9Y A;  2DT5 A;  2E7X A;  5AGF A;  3NMJ A;  3P9C A;  1P92 A;  1VMA A;  2JX0 A;  4G0H A;  1V55 H;  1FSE A;  4PGG A;  4E7L A;  2VN2 A;  3OYL A;  3C3W A;  2R7R A;  2EFW A;  4BNC A;  1G4U S;  3E5U A;  1Q0G A;  3EG9 B;  1IF1 A;  2P7V A;  2B9S A;  1QVX A;  3BG9 A;  1ZG5 A;  2VOP A;  1CGO A;  2EPM X;  5HS9 A;  3K2A A;  2XF6 A;  3RSN A;  4BEH A;  1I6H J;  3E6M A;  3CUQ A;  3DTE A;  3SXM A;  1WJC A;  5LBQ A;  3IPM O;  1LPQ A;  2J7P A;  4XPY A;  2QQ8 A;  2KZV A;  3PO3 J;  4RAG A;  2OC6 A;  3LAJ A;  4O6Y A;  3TBI A;  4U5D E;  3TJ6 A;  1T6Q A;  3K4J A;  1G59 A;  1TFK B;  3K69 A;  1QGP A;  1A35 A;  2R7S A;  3EGX A;  4PDK A;  4RB0 A;  1BA5 A;  2D1H A;  3TDU C;  1FOW A;  1W7P B;  4HQM A;  1WTY A;  1ZYR F;  4WXC A;  4XLE A;  1ZRE A;  1V74 B;  2VXD A;  3I64 A;  3M1C B;  4LDK A;  1E2X A;  5ERI A;  4AVP A;  4EGZ A;  4YT5 A;  3LFU A;  2M3A A;  1T01 A;  3NWS A;  3HRS A;  4CDG A;  2KRF A;  3I59 A;  4PJL A;  4A6D A;  4NY3 A;  4XQ1 A;  2EIL C;  4EWC A;  5FB2 A;  4ZDO A;  1IN7 A;  2ME0 A;  4IJA A;  3CLO A;  4S0H B;  2JUG A;  4NC8 A;  3W2V A;  3F8N A;  4EM2 A;  2XF5 A;  3EH2 A;  4CJO A;  5LGU A;  2ID3 A;  4CYD A;  4E7S A;  1A5J A;  3H3Z A;  3S84 A;  5JHF A;  4XNF A;  4C2T A;  3HTK C;  2VKH A;  4NQW B;  2HS5 A;  3E5Q A;  3ML6 A;  4N9I A;  2EPL X;  1R9T J;  3TO7 A;  4I2O A;  2E1O A;  3GEH A;  2Q1Z B;  2EV0 A;  4FT8 A;  2MWQ A;  1ZGA A;  4DRJ B;  3FXL A;  5DUK A;  1T6S A;  3KYL A;  4I1M A;  3KX2 A;  3DBR B;  3TDZ C;  3ATP A;  2A5Y B;  3GTG J;  3K4K A;  4Z9H A;  2R7Z J;  4DZP A;  3ZC4 A;  1B1B A;  3HKZ A;  2XSD C;  1AHD P;  1Y6I A;  1H8A C;  1HA8 A;  1QPU A;  2A3S A;  2K5C A;  3F8B A;  2IBD A;  2PQ8 A;  3OYG A;  1FJL A;  1OCC C;  2ZPA A;  5HDK A;  3L1P A;  2X9D A;  4IRU A;  2QQA A;  1UHS A;  1W7P A;  1OCR H;  2ZFW A;  1STZ A;  2UWM A;  1GGQ A;  1TFO B;  4ZTJ A;  1XSD A;  4MHG A;  1EH6 A;  2P5V A;  4LDQ A;  1WI3 A;  5E1X A;  3L8J A;  4RS8 A;  3OOP A;  2DFI A;  1G5Z A;  2OCC C;  2VLA A;  2FNP A;  2HTS A;  1UFM A;  1O3R A;  4XEF A;  1JUP A;  5F64 A;  2E2H J;  2EFQ A;  3KYI A;  3H36 A;  2JPC A;  2R0Q C;  4J19 A;  1R23 A;  3JW4 A;  1OQC A;  2KC3 A;  4UDV A;  3VEP A;  1DOW A;  2K86 A;  3WTZ A;  2ZXW C;  3NG1 A;  4MTF A;  3J80 K;  3KYJ A;  4IO9 F;  1DPU A;  3HOY J;  3HNK A;  4JEB A;  1EKE A;  3BDD A;  4B1R A;  4XBF A;  4AD9 A;  2D5R B;  5KK1 A;  1MIJ A;  1F1Z A;  2ETS A;  3R2P A;  3A9C A;  4GEH A;  2K4J A;  3L00 A;  1YFH A;  4X6A J;  2W9Y A;  3QOP A;  1H6G A;  2DOF A;  2DYS H;  1G4W R;  2HUJ A;  4IXA A;  4OIN F;  1OCP A;  1K05 A;  2HGC A;  3FIS A;  1RET A;  5FKL A;  5M5Y J;  2Q9A A;  4BAC A;  1Z21 A;  1V54 C;  1SAU A;  4EVI A;  1H88 C;  3GZ5 A;  1JPN A;  3U8V A;  1G3S A;  2F5F A;  4F92 B;  2RAE A;  4MQV A;  3Q0U A;  1YLF A;  3VSK A;  3GM3 A;  1FNN A;  1IRF A;  5J3L A;  2GXA A;  3ELK A;  2GAU A;  3TUL A;  1JKP C;  4FE7 A;  3BTJ A;  3PUF A;  4XLN F;  5EG0 A;  4HZF A;  4J01 A;  3LJB A;  2VOO A;  5BOX A;  4MVR A;  2HPM A;  1IG7 A;  4ZC3 A;  3DPL C;  1UZC A;  1WQ2 A;  2QM3 A;  2ZXH A;  5E1Z B;  1RXQ A;  2XPW A;  2CW0 F;  1O3Q A;  5GAD J;  1IRG A;  2DYS C;  2BYV E;  2MAB A;  1U5T B;  2VL8 A;  2WZL A;  3DEW A;  4XLH A;  4YG2 F;  1ZTR A;  4I1O B;  1IO2 A;  3N2Z B;  3HOZ J;  5IYB J;  4BKX A;  3PSI A;  3QOD A;  4L9V A;  4ESB A;  2DXI A;  4AVZ A;  5D5W B;  3MYF A;  2IYL D;  4M74 A;  2DQL A;  2VCA A;  1OCZ H;  3KEY A;  2VAS A;  3ASN H;  1OXB A;  3ZQF A;  2QCO A;  3RKX A;  2Q3T A;  1I1S A;  2KQR A;  3IQC A;  3K70 C;  4CSA C;  4YL3 A;  3RCO A;  2WAD A;  4UVA A;  4N4N B;  2H6C A;  2LYC A;  3W2A A;  1H0M A;  4U7D A;  2YEV A;  5J8C A;  3RQF A;  1X3W B;  2XM4 A;  4CYC A;  3JRF A;  3JTG A;  5KYY A;  3WTW C;  1I4Z A;  1TQM A;  2V6C A;  4RBN A;  2OA4 A;  4KIT B;  3MN2 A;  2KJG A;  3B71 A;  5E3A A;  2BV6 A;  1XMX A;  2WTE A;  2QSF X;  5LRS A;  4ON0 A;  4KA4 A;  2F4M B;  1WVR A;  4UV9 A;  3G71 I;  2Z33 A;  3OYC A;  1XWJ A;  2QTV A;  4MND A;  3EZI A;  5KYU A;  3CF5 F;  1E3H A;  3NMK A;  2L5Q A;  2NPU A;  5BUO A;  4RBO A;  1FNT c;  4IL6 C;  2JPB A;  3K6G A;  5K7Z A;  1KA8 A;  2R7V A;  2XAG A;  2LNB A;  2VBY A;  4OMZ A;  2F5C A;  3EUA A;  4Y13 A;  1W4M A;  2LRE A;  2J9V A;  3LEO A;  1O3U A;  5DS5 A;  3QTH A;  4G6T B;  1Z9C A;  5ED4 A;  5DEQ A;  2EIK C;  1JKO C;  2M45 A;  3CCJ I;  3BQY A;  1U0B B;  2DGJ A;  2ZB9 A;  3KP5 A;  1OR7 A;  1NH3 A;  2WB1 A;  3VM6 A;  3L1M A;  1BR2 A;  4Y7N J;  4XM3 A;  1ZG1 A;  1K7A A;  3GTK J;  4WAB A;  1BIA A;  3HG9 A;  2ETH A;  2MLG A;  3KP7 A;  4XMY A;  2ESN A;  3ABM H;  4PCQ A;  2X51 A;  2C03 A;  2QGU A;  5F27 A;  3ASN C;  5DUI A;  3Q6N A;  4MTO A;  1WI9 A;  3BY6 A;  1VQN I;  2GA1 A;  5DYM A;  3CCS I;  1OCO C;  3AGT A;  4HF1 A;  3K33 A;  2J0W A;  2J5P A;  2ZNZ A;  1C0W A;  2OEV A;  1NBB A;  3CME I;  1NFN A;  1MZB A;  1Y1W J;  3CC2 I;  2B0J A;  4O7G A;  3IC7 A;  2RQP A;  4DYC A;  1IN5 A;  4IHV A;  2DYR H;  5IT9 K;  4CS9 A;  4ANJ A;  4A6E A;  3X1O A;  4G7Z F;  2IGK A;  4FE4 A;  2N8G A;  5KYY B;  3LL7 A;  1OXK A;  4KNY A;  3L7W A;  4PAC A;  2WVO A;  4PFO A;  2ASR A;  1Y56 A;  1FZP B;  3LLK A;  5B3I A;  3U8P A;  4XR6 A;  3EUH A;  2EIM H;  3ESW B;  3IWZ A;  3MKZ A;  1QU3 A;  3EJN A;  4JRZ A;  1FR0 A;  2E71 A;  5DCM A;  3I4U A;  2ZXR A;  2NUT A;  3ZTM A;  2LH9 A;  3ZGK A;  1ZHW A;  2CFX A;  3TQO A;  3I58 A;  2FQ3 A;  2YPR A;  3IWF A;  1T39 A;  3TOL A;  4AID A;  4HYE A;  4CXF A;  5J1Y A;  1HCR A;  4XLP F;  2L7A A;  3US6 A;  3LQQ A;  3GW2 A;  2L02 A;  3VYU B;  3UGP A;  4GO1 A;  5LD2 C;  3TO6 A;  3AG1 C;  2K9M A;  1OYI A;  2L54 A;  1JJ6 C;  4W8K A;  2LKS A;  2OCC H;  2ESH A;  2ZXI A;  4B09 A;  1FLI A;  4E17 A;  1ACI A;  1WAS A;  2Z9O A;  2ZXO A;  2ISZ A;  2YR2 A;  4JKV A;  1T08 B;  4UNO A;  2LFB A;  2WAQ N;  3OWT A;  2ID6 A;  4CCJ A;  5T3T A;  4A3E J;  4IOA F;  2I15 A;  2XSE A;  2HXI A;  2EZK A;  1MBJ A;  4NB5 A;  3HTS B;  1YRN A;  1WJD A;  3LNQ A;  2EIM C;  3F0C A;  4NTF A;  3C8G D;  1LQ1 A;  3E5X A;  4MVO A;  2COB A;  4Z6Y A;  2FAP B;  5KAI C;  1A7E A;  1TQG A;  3WTU C;  5E3O A;  2FGY A;  2NUP A;  1M1E B;  1BBH A;  2ECC A;  2IGM A;  1QBJ A;  1SR2 A;  1XGS A;  3V8L A;  2ZJQ F;  1XC5 A;  1YW7 A;  5J47 A;  2LVS A;  3GBG A;  2J46 A;  1Q0K A;  5GPG B;  1PD0 A;  4HX7 A;  4C9Y A;  4ZDL A;  1G4D A;  3DAF A;  1APL C;  1RI7 A;  2CUJ A;  3M07 A;  4LLL A;  3TK0 A;  3T5X A;  1NSG B;  3NKD A;  2F6C A;  5JLW A;  4KIG A;  5FD5 A;  5FKO A;  2GXG A;  3VOE A;  2AU5 A;  3KP6 A;  5GAG J;  3WHC A;  2IRF G;  2BVM A;  2V1D A;  4UUT A;  1DU6 A;  2WV1 A;  2DOD A;  3HSE A;  1J8Y F;  2FU4 A;  2MC3 A;  5FLX Z;  1M57 C;  3MZH A;  1SZI A;  4U0Y A;  2HZT A;  4XPX A;  2JSC A;  1MBH A;  5ICF A;  3CCQ I;  3EGD B;  3J06 A;  4CHU A;  1W36 C;  1FYL A;  2NSG A;  1YQA A;  4IQ4 A;  4YEL A;  3S28 A;  2DLL A;  4AK9 A;  1T0F C;  4YFN F;  2IGN A;  2TDX A;  5E8G A;  2M8G X;  3ZP5 A;  3CUO A;  4XKV A;  5D6E A;  5DM6 F;  1S05 A;  4EKW A;  3OMY A;  4RAZ A;  5L0J A;  4R1H A;  2RC4 A;  1S5L C;  4HX4 A;  3W3C A;  5A2Q Z;  1K83 J;  4UUS B;  4CDV A;  1VI0 A;  3GFI A;  1V55 C;  4CS9 C;  2DOA A;  1LEB A;  2K9S A;  1XPX A;  4NCQ A;  1P4X A;  1FP1 D;  2CV2 A;  1OKR A;  2VBX A;  4O6N A;  3I4M J;  3H5A A;  3WTS C;  3ZPL A;  3O8H A;  2F4I A;  3C8G B;  5FFX A;  3G2B A;  3IL2 A;  3CO7 C;  3M4C A;  4KYW A;  4WGZ A;  2E34 A;  3ZOB A;  2B63 J;  3OL3 A;  2LCH A;  3HSR A;  3NQO A;  4Y17 A;  2D5V A;  4M72 A;  3FKJ A;  1E83 A;  2W48 A;  2JVG A;  4ZTF A;  2E1C A;  1LEA A;  4MTD A;  4Q48 A;  1JKQ C;  2KIQ A;  1Z6A A;  2R02 A;  3U1D A;  1KYZ A;  4Y52 J;  1BI3 A;  1KGS A;  3SJM A;  3DM5 A;  2A6H F;  3BR0 A;  1JT6 A;  2HQR A;  2YHS A;  3E6D A;  3P7N A;  3I4P A;  5CI9 A;  3HOX J;  2E2J J;  2JUC A;  1ORJ A;  2KIM A;  2WY7 Q;  5FO5 A;  4HW0 A;  2K85 A;  2A6T A;  3DKW A;  1UB9 A;  2M4G A;  3HPG A;  2P0N A;  3K7A J;  5L3B A;  1HSJ A;  3OYD A;  3BZ6 A;  3GLX A;  3FXH A;  5ICE A;  1FSH A;  5IY5 C;  1JHF A;  1ZK8 A;  3JRB A;  1ORY A;  2EFO A;  3QRF F;  3JRM O;  4H0E A;  1X1D A;  1G6N A;  3EDP A;  2DN0 A;  5CJ9 A;  5K5Q A;  3W4Y A;  3FOP A;  4GYG A;  2JRM A;  1W5S A;  2RV8 A;  4II3 A;  2MC4 A;  2A0B A;  2L9S A;  2QNL A;  4A3B J;  2XVC A;  3HRT A;  2NVQ J;  2EPK X;  4K0D A;  1MNM C;  2CJJ A;  5ILU A;  2EK5 A;  2CQ7 A;  5B5E C;  1D1A A;  4NC6 A;  2BY3 A;  2VBZ A;  2HYF A;  2HXO A;  1OCC H;  3LOC A;  2A0U A;  4J32 B;  4G94 A;  2MH2 A;  2J5O A;  2VE9 A;  4CSW A;  2DMP A;  6PAX A;  1VQP I;  3SDB A;  5D8K B;  1EJ9 A;  3JTL O;  1E85 A;  2CV0 A;  2EA4 A;  3LSI A;  3FXU A;  3IRR A;  4L5J A;  1MND A;  4D5F A;  4IHS A;  2CFO A;  1S7A A;  1OKK A;  4EHP A;  3R4K A;  2XKO A;  1N78 A;  3UKG A;  3B0V C;  1O4X A;  4AYB N;  4CUG A;  1ZQ3 P;  1MBG A;  5HDG A;  2VON A;  3LAY A;  3NMI A;  2P5K A;  2Y2Z A;  3BRJ A;  2RNJ A;  2KRH A;  3BOQ A;  3DBL B;  2VJJ A;  2WWY A;  3KYC B;  1LE8 A;  3F9K A;  1WRJ A;  3RFY A;  3K4M A;  2K4B A;  3I71 A;  3KH2 A;  3HHG A;  2BVL A;  4W97 A;  3ZVR A;  2YLG A;  2XS1 A;  4GCV A;  2CNW A;  2L81 A;  1B6A A;  1IRX A;  1YS6 A;  2A05 A;  3LSP A;  2JJ7 A;  4RB1 A;  1WH5 A;  3O8G A;  2HMZ A;  3E6B A;  2E5Z A;  2NNN A;  3GWZ A;  4E7K A;  1RKW A;  1SD6 A;  2CMP A;  4KI2 A;  4LIV A;  3OSG A;  3V5X A;  5E20 A;  5CPR B;  2AXL A;  2NG1 A;  5HNF A;  5D5U B;  5H2F C;  1U8B A;  5L3D A;  1V5G A;  2EPO A;  1YX3 A;  2HPI A;  3RYR A;  4FX5 A;  4CS8 C;  2L9R A;  4Z2Y A;  1Y8R B;  1PV3 A;  2W1O A;  3RW0 A;  3SZP A;  2LQG A;  2TRT A;  3QW0 A;  1Y0N A;  3S14 J;  4D0P A;  2X85 A;  5D92 A;  2W25 A;  2OJE D;  3N05 A;  3F8M A;  1R22 A;  4JTA B;  4NDL A;  4ENM A;  4G78 A;  2LC2 A;  5EK0 A;  4A93 J;  4ASN A;  1VQ7 I;  4KIB A;  1G8X A;  1EV7 A;  1PDN C;  3AG1 H;  1X3Z B;  3L2Q A;  2HTJ A;  4UVB A;  3KPH A;  3OYM A;  2LSE A;  3VB2 A;  2VBW A;  1ZGW A;  3CJQ B;  1JMW A;  2NUT B;  1IW7 F;  2E36 A;  1AVO B;  2OTL I;  4JJF A;  2OQM A;  4BUP A;  3WGG A;  3I56 I;  3K1H A;  3M3Y J;  1XCV A;  4PJ0 C;  2XSJ C;  5HV9 A;  3GO5 A;  1QPM A;  3EPZ A;  3GZ6 A;  3BQZ A;  1E17 A;  5GTH C;  3EUH C;  2PLY A;  4K7B A;  2LDU A;  4DIQ A;  2OJQ A;  5ICG A;  2XL8 A;  4EM1 A;  3HNJ A;  5CVU A;  2ZME A;  5K7H A;  4XON A;  1TL8 A;  2AP3 A;  3ZIB A;  3RQ4 A;  2Z99 A;  1M2O A;  3GUD A;  1I50 J;  2HVQ A;  1SVL A;  2BZT A;  3T8R A;  4B6I A;  1POG A;  2HU9 A;  3FDY A;  3REO A;  1BI1 A;  2YKZ A;  2YU3 A;  5A2Q K;  2ZO4 A;  3E3V A;  1LS4 A;  2CU7 A;  4O6M A;  3H92 A;  3CMY A;  5COG A;  1WHU A;  4OAY A;  1TQP A;  3I5Q A;  3FXK A;  1I4Y A;  1S7Z A;  1QZZ A;  5K1Y A;  2HZ8 A;  2PNO A;  3ISP A;  4JYK A;  3KMI A;  2O6G E;  2X6W A;  2VOD A;  2XAF A;  1LS1 A;  4MS2 A;  4CS8 A;  4EBK A;  2IJL A;  1FWZ A;  1OYW A;  4DGW B;  3GLL A;  2MGQ A;  2W7N A;  3OSF A;  2MG4 A;  2P8T A;  2ME6 A;  3VYS B;  2OPT A;  1MDM B;  3FXO A;  4PZJ A;  3T8T A;  1JJ8 C;  2WL8 A;  2LY1 A;  3HIF A;  2Q0O A;  2HOA A;  1I27 A;  2B0H A;  5CQG A;  1Z67 A;  1ZRD A;  2TCT A;  1KZH A;  4CS7 A;  2HEO A;  3IP4 B;  3HHH A;  2EBI A;  1DGR M;  3LQR A;  1C02 A;  2AVK A;  1ZHX A;  1VYI A;  3AG4 H;  4HNU A;  2LLK A;  1D1C A;  3GTJ J;  2OF7 A;  2NVX J;  3DJN B;  2P0W A;  3WG7 H;  1OCR C;  5KYX A;  5COF A;  2BL2 A;  3JSE O;  3S93 A;  2XAS A;  2PN6 A;  2XIG A;  3GTM J;  2AHQ A;  2DT7 B;  1DOV A;  2M4E A;  3RYP A;  1WJF A;  4XOT A;  1VB5 A;  4JX6 A;  3FMQ A;  2W4B A;  3FMR A;  1IRZ A;  3HBL A;  1J2X A;  2R5Z A;  1O87 A;  2KJB A;  1YIJ I;  2F48 A;  4A5N A;  3SXZ A;  3ZQV A;  4UXN A;  4X1E A;  4KUM A;  2DDB A;  5BQI A;  4CCL A;  3U0C A;  2HI3 A;  1FFH A;  2O61 A;  5TJ5 E;  1D8K A;  4BYY A;  2G62 A;  4JCZ A;  5JUA A;  2ZXP A;  5LEJ A;  3AQC A;  2W45 A;  2BE5 F;  5CI8 A;  1UG2 A;  2LTP A;  2IPQ X;  2EQR A;  4G6D A;  2O9X A;  3A01 A;  2EIN H;  5CYV A;  4MEX F;  2DPD A;  2OBP A;  3MYI A;  4CIH A;  2NYX A;  2CS3 A;  4IKF A;  3AOU A;  3KCC A;  5B1B H;  3BJ6 A;  3ERE D;  1WH7 A;  4K1O A;  4R79 A;  1FC3 A;  4ZZL A;  4A3G J;  4MVZ A;  3GEZ A;  4I98 B;  2D1V A;  3WTY C;  3RF3 A;  1WSU A;  2A1D D;  3DTK A;  4C3D A;  5BPI A;  1EQ1 A;  4Y15 A;  1NU7 D;  1VND A;  1YW9 A;  3K4C A;  4DYQ A;  3K6B A;  4JC7 A;  5FKK A;  2PG4 A;  3DF8 A;  2WAF A;  2L6F A;  2EV6 A;  4EJW A;  3CCU I;  4F93 B;  4ER9 A;  3B6A A;  2QQ9 A;  3FKI J;  3SDG A;  2PBI A;  2A5W A;  1A0B A;  1ZVZ A;  2PF4 E;  4WXD A;  1F4K A;  1D3Y A;  3AFH A;  4JX4 A;  3DXJ F;  5FCL A;  4BJ5 A;  1T6U A;  4X0R A;  1MH3 A;  3QYF A;  5CVR A;  5HLH A;  4GYT A;  4ZLC A;  3FDQ A;  1S3J A;  1GVD A;  1YRN B;  1PJR A;  2DCE A;  4BU2 A;  3SXK A;  3IEE A;  4AIK A;  3K1P A;  2LP0 A;  3Q9S A;  3BR3 A;  2GBY A;  2KPM A;  2WAQ A;  3EET A;  3GVA A;  4GFB A;  4J7Y A;  1R58 A;  3UR3 C;  3TO9 A;  4U5G A;  1J09 A;  4ZYG A;  2NAZ A;  2HV6 A;  2OQG A;  2DA4 A;  2CQX A;  1A36 A;  1A04 A;  1UG0 A;  4DOZ A;  1Z7Q c;  3OYN A;  3GWN A;  4KT6 A;  4DQ2 A;  2E5N A;  3ULQ B;  1ZW3 A;  5HVQ C;  5K7F A;  2QQB A;  2L9V A;  2QKL B;  3CZ6 A;  3D5R C;  4LFU A;  3G3Z A;  3RKW A;  2IXN A;  3DE9 A;  5DVW A;  4AE4 A;  4IHW A;  3EHN A;  2EIK H;  3QYB A;  2O03 A;  5LEK A;  2HSB A;  2NUP B;  1H7I A;  1A7V A;  3N97 A;  4Q7C A;  4KDP A;  2HDW A;  4K2E A;  4I7H A;  2DFE A;  2V26 A;  3GF2 A;  4N0B A;  2GM4 A;  3BCA A;  3ABK C;  2K9N A;  3JRD A;  3J81 K;  3F3X A;  2VPR A;  2WVN A;  3C2B A;  5EEA A;  4ULV A;  1H9G A;  1R00 A;  3S8P A;  3JRI A;  2BY2 A;  3CP2 A;  2XGX A;  2HQA A;  2JA8 J;  3GTO J;  1LE4 A;  1YX5 A;  1W1W E;  1DGW Y;  3QU3 A;  3SYN A;  1KU2 A;  4BHB A;  4HDU A;  1LPE A;  4KC9 A;  5BQG A;  4HX8 A;  3BG3 A;  1HXD A;  2J45 A;  4TV7 A;  2CDQ A;  2DMT A;  4F55 A;  2OCE A;  1X4O A;  1DU0 A;  1VQL I;  5JSL A;  3VAY A;  1B4A A;  3WTV C;  3HRU A;  1Z6R A;  1JGG A;  3RZO J;  3RQG A;  1B9N A;  4YL1 A;  4V19 K;  3IH4 A;  4M3G A;  3S1R J;  1HDD C;  4DJA A;  3DEU A;  3ITF A;  2K3P A;  4HV5 A;  3M9A A;  3WGI A;  3N0T A;  3E7L A;  4A5M A;  4DJ9 A;  1SFK A;  1H89 C;  4BEJ A;  2LF8 A;  3OYA A;  2CQN A;  2HDD A;  1KU3 A;  5C4X J;  2F5E A;  2P81 A;  4Y33 A;  4OD4 A;  1SFX A;  1B9M A;  3PSF A;  4E7I A;  1TTY A;  1IC8 A;  2FRH A;  2DYR C;  2VC9 A;  3V5Y A;  5DS6 A;  5JS5 A;  3DKX A;  4LB5 A;  1MDM A;  2DB4 A;  1VQK I;  5EZH A;  5E17 F;  4L9J A;  4AL1 A;  1IUF A;  2FX0 A;  3BR6 A;  3CAX A;  1GT0 C;  1V3F A;  2Y9Z A;  4FX0 A;  4E7Z A;  1IXC A;  2AWY A;  4JX5 A;  1EI7 A;  3TP3 A;  3F72 A;  3U9J A;  3O3K A;  1XTA A;  4NBQ A;  2A69 F;  1CGN A;  1UHW A;  2H7B A;  4BQN A;  1BI0 A;  3O39 A;  4AL0 A;  2QF7 A;  2YX4 A;  3OS2 A;  2R3S A;  4RM2 A;  1QA6 A;  5EGO B;  2YLD A;  1MNE A;  1QPI A;  3RKO F;  3HXL A;  4L9N A;  1TLH B;  4JW1 A;  3RYL A;  1R4M B;  3RDI A;  4RLQ A;  3CDL A;  2FF4 A;  2LK4 A;  2KQ9 A;  4WJ0 A;  1ZEL A;  3AAF A;  3BR1 A;  4XQF A;  1RKE A;  3LUT B;  4ZLD A;  4MEY F;  4Q47 A;  3MWM A;  4DXW A;  5FRO A;  3JAM Z;  4F91 B;  4IOC F;  1A7D A;  3ERM A;  2R7Q A;  3HZJ A;  3RVZ A;  4ZYH A;  3CMA I;  3U21 A;  2R7D A;  4B43 A;  1JXS A;  2H8R A;  2FMY A;  3AL0 B;  2IS2 A;  3K7D A;  4BL0 B;  4XSX F;  4CH7 A;  4MVQ A;  2XXA A;  1TW2 A;  2GA2 A;  1UG7 A;  3JCU Q;  4CCO A;  3V42 A;  3SFZ A;  4HAM A;  4RM3 A;  1R1V A;  2GDC A;  3DMD A;  4D4X A;  1ULY A;  3BTI A;  4XKB A;  2VQH A;  2VQL A;  3RJP A;  1BDJ B;  4N4W A;  3CCV I;  4RB2 C;  5FLX K;  4M9S A;  4U5B E;  4C3B A;  3V5Z A;  3A0H C;  2JK3 A;  1R4N B;  4GQH A;  4O6J A;  1CF7 B;  1RPW A;  1UMQ A;  3ZQC A;  5JI6 A;  1BI2 A;  3TP0 A;  2VB6 A;  5B3S H;  1Y6D A;  1U3E M;  4E18 A;  5B1B C;  2XLO A;  1EH7 A;  1K78 A;  2CO5 A;  3D5S C;  3L0I A;  3TW6 A;  1VK5 A;  2JSP A;  4OWR B;  3A11 A;  4JUR I;  1YYV A;  5F1R A;  1PYV A;  2Y48 A;  1NG1 A;  3ZG1 A;  2WZF A;  3UMI A;  4YJW A;  3N4M A;  1ZHT A;  4GXO A;  3FHZ A;  3JAM K;  3ZMZ A;  1RIO H;  1K4S A;  4NUB A;  1SFU A;  3U5S A;  2ELH A;  1JUS A;  5DS4 A;  4IAO A;  3RQE A;  2BC5 A;  1R5H A;  3SEZ A;  1JGS A;  1Z3Y A;  2WV0 A;  4OIO F;  2ELJ A;  4HRI A;  1XSX A;  1ON1 A;  3A02 A;  1XDS A;  3HYI A;  4HV6 A;  4XLA A;  4EEF G;  3HUG B;  1OR3 A;  3BCB A;  4M6V A;  3F8F A;  1R5G A;  1RR8 C;  2MW8 A;  1YZC A;  5L3G A;  3O6X A;  3CEX A;  2A61 A;  4HOB A;  1MBK A;  4OIP F;  2VJ4 A;  2ZBK A;  3TGN A;  5J1R A;  1AUE A;  2PP4 A;  2WVQ A;  2AQE A;  2XM0 A;  2KLO A;  4LMY A;  3X2Q H;  2EIJ C;  3OEO A;  4JP0 A;  2FOK A;  2NVY J;  2XC7 A;  3OR1 C;  2HFH A;  3SHF A;  5E3M A;  2HVS A;  3DM9 B;  4CSA A;  2QBY B;  2QEX I;  1KON A;  2KIU A;  4D4N A;  2ZSI B;  3C8Z A;  2HJ3 A;  5L0F A;  2ZKZ A;  2J9B A;  1MMA A;  4M3D A;  5J40 A;  5EDN A;  2P6S A;  2XLD A;  2XB5 A;  1SD4 A;  4Z9J A;  3OYK A;  5FLV A;  3ASO C;  3ZQQ A;  1QVU A;  4RD9 A;  1NTC A;  3S1M J;  5IYD J;  3L2C A;  4IX7 A;  4YN0 B;  4WK8 F;  1BC8 C;  2WB7 A;  3JSO A;  2FSW A;  2HDC A;  4P9F A;  1JUM A;  4L18 B;  3P5J A;  3MKW B;  1I3Q J;  2L01 A;  4XRF A;  2VPL A;  3R0A A;  5EJC A;  3FAJ A;  4I76 A;  4LLG F;  5DQZ A;  5L0G A;  3OOU A;  4XID A;  4XWJ A;  3HOU J;  4HA8 A;  3MZ8 A;  4HLY A;  3C2H A;  2D2W A;  3K1M A;  1BJZ A;  3CCL I;  2Y3D A;  5ILV A;  2FBK A;  2GXB A;  2UZK A;  3NAU A;  1BL0 A;  4EV0 A;  4HF0 A;  4CZC A;  2H7V C;  2Y0S A;  5J4Y A;  3IKT A;  4XRS A;  4M6X A;  3WTT C;  2KHM A;  1M6T A;  1Z3I X;  3N24 A;  5FD6 A;  3RKY A;  3HUG A;  4N6H A;  3C18 A;  3JCU C;  1YA9 A;  4Y4R A;  5L0D A;  1R1U A;  1XS9 A;  1D0Z A;  2CQQ A;  4RAF A;  3JRC A;  3NAR A;  3ZXS A;  1BN5 A;  4J7T A;  4UB6 C;  2X1C A;  3SNH A;  3V7O A;  2DO7 A;  2TMV P;  2KIF A;  3GX4 X;  4D5C A;  2RN7 A;  2H8W A;  3PFI A;  2ZD9 A;  3UNG C;  5HSW A;  2W00 A;  2KKO A;  4G8X A;  3ZQL A;  2VQG A;  1WN0 A;  3VRC A;  2AQF A;  1RMV A;  1ZN2 A;  3T4R A;  1ZHY A;  5COM A;  3BTC A;  2HV7 A;  2M5W A;  2P5L C;  1DQU A;  1X2M A;  4FES A;  2OTJ I;  1VFC A;  5J4V A;  4BE2 A;  1T38 A;  1PUF A;  1HE1 A;  3EZH A;  2I8B A;  4EIY A;  3UGO A;  4EUK B;  3ECS A;  3S3N A;  3K2Z A;  5E33 A;  1IDY A;  4FCY A;  3IQ6 A;  1K61 A;  5EHH A;  3I5U A;  1SF8 A;  4A2U A;  2KP6 A;  3R60 A;  4C3I J;  5HOD A;  5TIS C;  3HPH A;  1AWC A;  4QPQ A;  3H9Q A;  2VCC A;  2IA1 A;  2H7O A;  3LST A;  4HFF B;  3ABT A;  2DBB A;  1Y8Q B;  3NRH A;  1MW7 A;  1WWX A;  1YOV B;  2QVO A;  1ZHZ A;  3ZMV A;  3M79 A;  2R7X A;  3OL4 A;  3KEQ A;  4MVM A;  1FYM A;  4I6Z A;  2YZS A;  1O3S A;  1AEP A;  3OS0 A;  4MLO A;  5FLM J;  4U9D A;  5T3W A;  1TQI A;  3EPV A;  3AL0 C;  4P1W A;  2VXZ A;  3CTA A;  1MD0 A;  4A3I J;  2J7P D;  2H8A A;  2CYY A;  3H2U A;  4PJN A;  3W6J B;  3RPU A;  4DBR A;  3DAG A;  1I39 A;  2G0E A;  3DCF A;  3I53 A;  2YRF A;  1L3L A;  4S05 A;  2MHR A;  5A6B A;  1IV8 A;  3DPT A;  5TGT A;  3DE8 A;  3F21 A;  5E79 C;  2PEX A;  3JRE A;  2OU2 A;  3L34 A;  4H4K C;  3JZ0 A;  1WZ2 A;  3GM2 A;  4CIP A;  5HLG A;  5CKT A;  1F36 A;  3CJR B;  1VZ0 A;  2FUG 2;  2PI0 A;  4EJT A;  2XPU A;  2H27 A;  1LE2 A;  2FBH A;  2NRA C;  2CRG A;  2R9R B;  3HL2 A;  3ZQY A;  5E18 F;  3BG6 A;  2R25 A;  1HQC A;  2HYJ A;  1LVA A;  3M8F A;  5EG0 B;  4DVZ A;  2E7W A;  5IPA A;  2ZJ2 A;  5TRD A;  2L7K A;  2ZFU A;  3S0X A;  4XLC A;  2E1N A;  2UV1 A;  3HGG A;  1ITY A;  3Q7L A;  2PMU A;  3A01 B;  2XRH A;  3LSJ A;  2CGP A;  3BC8 A;  1MBE A;  3GFM A;  5L3C A;  2IXM A;  1G2H A;  2V3C C;  3OYH A;  4AUX A;  2MYS A;  3T6J A;  1UAA A;  1VQ9 I;  1SAX A;  2DA1 A;  3AG2 C;  3VFZ A;  3K4L A;  3CUQ C;  5AIQ A;  3JR9 A;  4KFC A;  1OMI A;  2W84 A;  3TOA A;  1VQ6 I;  3DTI A;  3GEE A;  3CDH A;  4ZDP A;  2FBI A;  1XZQ A;  2OU6 A;  2DAO A;  1J9I A;  2H6B A;  1IJW C;  3TOM A;  2LR8 A;  1JRA A;  2AO9 A;  2XGC A;  1KTM A;  2Q4F A;  4L6R A;  1ENH A;  3BR5 A;  4D7M A;  1MSE C;  4C7O B;  5KHD A;  2F2E A;  2XLM A;  2DA5 A;  5E8I A;  2DFH A;  1T5O A;  2STW A;  4XKC A;  1LDK B;  4HNT A;  1B59 A;  1XDU A;  1Y4C A;  2XGE A;  4KJZ A;  1F1M A;  5JVG F;  2O8K A;  2NS0 A;  4EJV A;  1J5Y A;  1OCO H;  5LHG A;  2GOM A;  4CO8 A;  4DZJ A;  3K1I A;  4ONS A;  2DMU A;  1W5C C;  3J7Y J;  3OYE A;  4MO7 A;  3KLN A;  4XN0 A;  1ETO A;  2XLV A;  4Y3O A;  3I55 I;  3LSM A;  3G4S I;  3PUB A;  2O0Y A;  3Q7G A;  1E84 A;  4GRI A;  1CGM E;  1HC8 A;  2VT3 A;  4MTE A;  1VQ8 I;  3IQT A;  5A6J A;  4U88 A;  1SMT A;  1BBY A;  1YZA A;  2Q7R A;  3KKB A;  1ETY A;  4FQG A;  2BHZ A;  1GLN A;  4XLF A;  2BXY A;  2CQK A;  1S72 I;  2AS5 F;  4KIF A;  2CV1 A;  3JYH A;  4N06 A;  1EKY A;  4OAZ A;  4KT5 C;  4H54 A;  4NQW A;  4MVU A;  4DW6 A;  1GV5 A;  2L0K A;  3IH3 A;  4WCG A;  4XOP A;  3V7C A;  3V8J A;  5T1D B;  2BW3 B;  2CNW D;  4FWV A;  2KDZ A;  1J8M F;  3DI5 A;  4C7O A;  3H1C A;  3I54 A;  4P55 A;  3S3O A;  2XAJ A;  4I44 A;  4IB4 A;  2XRN A;  1MSF C;  1OR2 A;  1BR4 A;  2LY9 A;  4A12 A;  1YDI A;  5DLJ A;  1BM9 A;  1HDP A;  2DJN A;  1I3A A;  2K7L A;  4BE1 A;  1YJN I;  2MA3 A;  1EF4 A;  2IOQ A;  2XL6 A;  5GP9 A;  1YJW I;  3T6B A;  1BOB A;  2GIZ A;  2MD5 A;  2WAE A;  2DK5 A;  4MQ9 F;  2L3D A;  5CLS A;  5GPA A;  1B8I A;  3WHN A;  4A3K J;  2XAU A;  1R4T A;  1XGO A;  1H9T A;  4A3C J;  1X4P A;  1TWC J;  2O5R A;  4CJG A;  3CD6 I;  2IA2 A;  2H1L A;  2PFD A;  3UMK A;  1IGN A;  1J0R A;  4BG0 A;  1LVK A;  3FF5 A;  1HLV A;  3CCM I;  2VE8 A;  4EMS A;  1L7C A;  1NG6 A;  4I0A A;  1TBX A;  2E2I J;  2W85 A;  2WA0 A;  1OR7 C;  2VIX A;  4KIS A;  1DDN A;  3EG9 A;  4PR9 A;  1XB4 A;  1UFB A;  4JEA A;  4B3X A;  3ASO H;  3VF0 A;  3LNR A;  1PD1 A;  4UHT A;  4BJ5 C;  1M56 C;  1RUO A;  4U5F E;  1GDT A;  1ZKG A;  5D4R A;  3KET A;  1FTT A;  1USS A;  3P9K A;  2FNA A;  5IT9 Z;  5J1U A;  3OV8 A;  4A69 C;  2P4W A;  1N75 A;  5A6K A;  4BXF A;  4CDY A;  5C4J J;  1VTM P;  1RKT A;  1KQ9 A;  3KZZ A;  4NNJ A;  1RKC A;  2D4U A;  1N25 A;  2DDA A;  2NS7 A;  3MFK A;  1C03 A;  4DBQ A;  5HDN A;  3NKE A;  2QUF A;  3H3V K;  3BPV A;  3R7C A;  2Y9Y A;  4U5H A;  2Z15 A;  3E70 C;  4HFK B;  1V5F A;  2DTZ A;  3DD7 A;  3DBH B;  1T56 A;  2A68 F;  2WBM A;  3K10 A;  1FOX A;  1ZRF A;  3ABU A;  1PUF B;  3IRQ A;  1YLM A;  1MMS A;  4PFP A;  3EYY A;  3HDD A;  4HST A;  2LFF A;  2RSE B;  1DUX C;  3QW1 A;  3ABL C;  2KYH A;  3O6B B;  3PHF 2;  3G4Z A;  3QAH A;  4DVY P;  2V1U A;  4E0I A;  3B0P A;  2RDP A;  2GOX B;  2R7O A;  3HGY A;  4P5O A;  2K27 A;  1S8N A;  5GTI C;  1K4T A;  4AU7 A;  1Z91 A;  3CUQ B;  4AIJ A;  5AC4 A;  2L2O A;  1XD7 A;  2LFD A;  4XEV A;  4O3M A;  2E60 A;  4XKW A;  3DPU A;  3HSF A;  5M5W J;  1XG1 A;  4U87 A;  3PCV A;  3H9J A;  1HE9 A;  1K04 A;  4BXX J;  4YT2 A;  3H35 A;  3KP2 A;  4ETS A;  3AGU A;  4BJT A;  4A2N B;  2R03 A;  4A3M J;  1M2V B;  4OOI A;  5B3S C;  2I8D A;  2F5V A;  2OV7 A;  3KP4 A;  2HZD A;  4AWX B;  3IV5 A;  1OFC X;  4RA2 A;  4UB8 C;  1LNW A;  2OZU A;  3F23 A;  1UEL B;  2IA0 A;  2ZXJ A;  4U7B A;  3EFO B;  4YK5 A;  3SZT A;  4DNC A;  2WZG A;  2IS4 A;  4BEH B;  1AA7 A;  3BWG A;  4M9Z A;  4A3L J;  5LRR A;  1T0F A;  4AYB A;  3C62 A;  2MBF A;  5C3E J;  3GTL J;  1G3W A;  2R7F A;  3QWL A;  2NVU B;  3HKK A;  3C7J A;  3R61 A;  5DD4 A;  2P61 A;  4YL0 A;  3G73 A;  1XGM A;  2EA2 A;  1HY5 A;  2Z2S B;  1AOY A;  2CCY A;  3ONQ A;  4FAP B;  1XX5 A;  3A1Y A;  3H0G J;  2IW5 A;  2HOS A;  5FZT A;  1XSV A;  2IP2 A;  2W4S A;  3E1S A;  5K5R A;  3DWL E;  3BEH A;  5EYR A;  1SAN A;  3QOE A;  4QTR A;  1ZG3 A;  1C17 M;  4A0X A;  2E1M C;  4HDV A;  2LD6 A;  3FM5 A;  3X2Q C;  1LB2 A;  1TW3 A;  1GQA A;  2PX0 A;  2X6O A;  1AKH B;  2YL3 A;  4S04 A;  4KMU X;  5IYC J;  1ONV A;  3G1O A;  3W8H A;  1VF9 A;  1MGT A;  3FIW A;  4M71 A;  4HQE A;  2O7O A;  5JRA A;  3QPL A;  3CSK A;  4C3H J;  1QVT A;  3RKQ A;  4KN4 X;  5F0H A;  2VUM J;  1HKQ A;  1MMN A;  4R8H A;  4IHX A;  5F5F A;  5HS8 A;  2L4A A;  4C2U A;  5D5X B;  1A31 A;  5KYU B;  3U9G A;  2LD5 A;  3HNI A;  4NTB A;  2X1D A;  4B3A A;  1WJA A;  5KYN A;  2EIN C;  2XF7 A;  1BW6 A;  1Z05 A;  2LMD A;  4LG0 B;  2YS9 A;  1JKR C;  1IAW A;  4LLC A;  4QIW N;  2LBF A;  3ZMS A;  1I6X A;  2R7U A;  3JRA A;  3LLI A;  1LDJ A;  4JE9 A;  2IS6 A;  3A0B C;  1X19 A;  1NK2 P;  3DEE A;  4MW8 A;  4KMF A;  1RJ9 A;  1W7P D;  1QNT A;  2EIL H;  3RPQ A;  3DV8 A;  2CWE A;  3PMR A;  3PNY A;  2FEZ A;  4M3B A;  4FAS D;  3KFW X;  2R5Y B;  2JQ7 A;  5M5X J;  4QDL A;  5DDG A;  2J8W A;  2J9W A;  4JIO A;  4YIR X;  1AKH A;  3FK7 A;  1X1C A;  1LDD A;  3SZG A;  2XPV A;  3L2U A;  3G6E I;  4RMN A;  4D9J A;  1U2W A;  5F28 E;  4ZH4 F;  1A6I A;  3E6C C;  2KIS A;  4G7O F;  1OW8 A;  1ZHF A;  4M3E A;  2R7W A;  3Q6M A;  4RGX A;  2QKM B;  3S9O A;  1Q0M A;  2JA2 A;  4M9X A;  4NC7 A;  5DV5 A;  2UUZ A;  2NXN B;  5BPD A;  4W8P A;  5KAF C;  1QHH D;  2Y3B A;  1U9O A;  3HOW J;  1ETX A;  3BZC A;  3FM3 A;  2DA7 A;  2MSY A;  2V1N A;  1XMA A;  2XB0 X;  1Q1V A;  3F8C A;  5FFZ A;  3CC4 I;  1G3Y A;  4LG0 A;  2PFB A;  2BXZ A;  4A3F J;  1OJL A;  2BY1 A;  2JT1 A;  1TWA A;  3L2W A;  4U0W A;  1Q0F A;  3NYJ A;  4MFD A;  3PQJ A;  1JHH A;  5K5O A;  3DLL F;  3RPU D;  1WKM A;  2PMH A;  2QSH X;  4R32 A;  4ZJZ A;  1MBF A;  4OIQ F;  5LHI A;  2VKV A;  3FXR A;  3ZN1 A;  1LI7 A;  2MLK A;  5LHH A;  3F47 A;  5ICC A;  3DZA A;  2V9P A;  3IKV A;  3SP1 A;  2XAQ A;  2QY9 A;  2R92 J;  4MTG A;  4E7J A;  5FGM A;  2GLO A;  3FHN A;  3MAJ A;  4J00 A;  1JTY A;  3ABK H;  1X1A A;  2Z16 A;  5L0H A;  1DP7 P;  1WAT A;  3I3L A;  2KMU A;  2XRO A;  2OUM A;  4LK0 F;  2KZG A;  1RJ9 B;  2M30 A;  3E97 A;  3AJM A;  5E3C A;  4BAY A;  3CP8 A;  2P7V B;  2V9V A;  4YT4 A;  4JCH A;  3LNM B;  3HOS A;  2EFP A;  1AU7 A;  4XPW A;  1X3U A;  4Z9I A;  3GTQ J;  4U9E A;  5F6F A;  3BZK A;  1FYK A;  4L0Y B;  3GTP J;  4QPO A;  2HKV A;  2W82 A;  4RB3 C;  2XLH A;  1TC3 C;  5L3E A;  1YJG A;  2P7C B;  1IXS B;  1SD5 A;  4BXU A;  1QZE A;  2VC0 A;  3SZR A;  1QRY A;  2EIJ H;  1TWH J;  4PSX A;  3RQI A;  5D8L B;  4UUS A;  3E0J B;  5M3F J;  4IPA A;  3AG3 C;  3U9M A;  2O9L A;  5FKN A;  1W0T A;  1SYQ A;  4M6Y A;  1U0J A;  5LGT A;  1QSP A;  4FET A;  2Y69 C;  1DP3 A;  1T9K A;  5LGN A;  2B0L A;  3T1B A;  2KFD A;  4ABZ A;  4ESJ A;  1D1B A;  1PP7 U;  2KSF A;  3OIQ A;  2PJP A;  1HW5 A;  2ZNY A;  2L4M A;  1HMD A;  2VJI A;  3FWE A;  5CVI A;  3KE2 A;  3EYI A;  2HMQ A;  3HNL A;  2PMZ A;  2G9W A;  5E3L A;  1YI2 I;  1A41 A;  3ABL H;  3OS1 A;  3OR2 C;  2XKP A;  4HPQ A;  4OIR F;  4F3Q A;  1OCT C;  2F22 A;  3KL4 A;  3WAQ A;  2WY8 Q;  4EBB A;  1YW8 A;  2VJ5 A;  4ESF A;  2DPU A;  3ZCO A;  1NFO A;  3SQN A;  2KL4 A;  2L6H A;  4MW3 A;  1QZY A;  1S9H A;  1Z6T A;  3DU6 A;  3O2P E;  4O5V A;  2CW8 A;  4LJZ F;  1O7L A;  3FZV A;  2L7Z A;  5D4S A;  2GFH A;  2V6E A;  3ZR8 X;  1MJA A;  1Z1D A;  2VQC A;  5EEH A;  1TKN A;  4G12 A;  4QSH A;  4II2 A;  2Z3Y A;  2C6Y A;  3OYF A;  3TL4 X;  1Q0D A;  1SFE A;  5L3V A;  4GGG A;  2ZSH B;  1WOL A;  1FBU A;  1R36 A;  2E35 A;  2V1X A;  2YSR A;  1FIA A;  4C30 A;  5E2Q A;  3S1N J;  4YWQ A;  2ISY A;  4V2G A;  1ZAR A;  3JRT A;  1NLX A;  3A03 A;  3EFO A;  5AC5 A;  5CQE A;  4I0B A;  1Q1H A;  2CUF A;  3LES A;  3L2R A;  2EV5 A;  2HYG D;  3BG7 A;  4I01 A;  5J6X A;  3AG4 C;  1OKK D;  5KCM A;  1BJA A;  2JRT A;  3TQN A;  5K0I A;  1VLS A;  2DI3 A;  2YUS A;  2OQR A;  3HOV J;  3BJO A;  3CES A;  1SMY F;  3WG7 C;  4L5E A;  5L3Q A;  4ENJ A;  1RUN A;  3ZQI A;  2O3F A;  1FP2 A;  3S3M A;  3I5P A;  3WU1 B;  5D91 A;  3HC7 A;  1YE9 A;  1P7J A;  4UVC A;  1K6O A;  2R05 A;  2ICW G;  2LKP A;  2J0X A;  1ETQ A;  3BPX A;  3WOD F;  1FT9 A;  2V9K A;  5IP6 A;  3HJE A;  1F43 A;  2RKH A;  2JD3 A;  1FOK A;  3J7Z I;  4CCK A;  3CQZ J;  4LB6 B;  2KNH A;  2PX9 A;  1ZU5 A;  5AIP A;  2XLE A;  1D5Y A;  3B29 A;  1OQY A;  1KU9 A;  3E9V A;  5JVT A;  1U8R A;  1WPK A;  2Y0M A;  3CQZ A;  2F4O B;  3B02 A;  2ZME B;  1ON2 A;  5M3M J;  3OY9 A;  4XTK A;  5F5H A;  4MGR A;  2QLA A;  3TED A;  1QZX A;  2IVM A;  2Q00 A;  4HG2 A;  3U2L A;  5H20 A;  2L7F P;  1WFX A;  2OZ6 A;  3ECO A;  1FBQ A;  1QLE C;  5H6R A;  4C3J J;  1Z0X A;  4E7H A;  4UUV A;  1KQ8 A;  1X2N A;  2XAH A;  1Z7U A;  1OYY A;  4FIS A;  4LDR A;  5EGY A;  2A6E F;  3QMK A;  1VQ5 I;  1YG2 A;  5AON A;  4IQJ A;  3U2M A;  3CCY A;  1FTS A;  4EBJ A;  4B4C A;  2JWT A;  4LG3 A;  2K3F A;  3S90 A;  2RRE A;  1ETV A;  2KRC A;  4EJO A;  2DK8 A;  2KDO A;  3ABM C;  1QHG A;  5EGO A;  3OYI A;  1J59 A;  4BEM J;  1PCX A;  4PUS A;  3V7R A;  2RD9 A;  3CDI A;  5C44 J;  5B1A C;  3MQ0 A;  2BOL A;  3QPT A;  3F46 A;  5H6Q A;  2QE9 A;  3VSL A;  5GAH J;  3GXO A;  3JRH A;  2V7F A;  5IOY A;  3M1C A;  3Q5F A;  3IHU A;  1YS7 A;  2NOJ B;  3IH2 A;  4EQQ A;  3CJN A;  3PNT A;  2W24 A;  4HEA 2;  3RI4 A;  4FHT A;  4XK4 A;  1ZGJ A;  3WU0 A;  1ZR2 A;  3C2G A;  3KYD B;  4PJJ A;  5F0F A;  1SEU A;  2DU9 A;  2K40 A;  2ZC2 A;  2Z5U A;  3G1M A;  2KW3 C;  2W4M A;  4IJJ A;  3ZDL A;  1SVM A;  4Q4Z F;  4IAR A;  2EWN A;  3LFK A;  3GFL A;  1BIB A;  3I9V 2;  3K4B A;  3GAN A;  4CDA A;  3K70 D;  1TWG J;  3L2V A;  1W2W A;  2KK1 A;  1T98 A;  3VOD A;  3TMO A;  4YIF A;  4BY7 J;  3RIP A;  1BOA A;  2CUZ A;  5BMZ A;  1CPQ A;  1ETK A;  1TWG A;  3VWB A;  2WC2 A;  1J7K A;  3MFN A;  2IXP A;  1NG7 A;  3PIO F;  4NHJ A;  2CGE A;  5JT4 A;  1ZH5 A;  2HNH A;  1D0Y A;  2I10 A;  3JT1 A;  4XRS G;  1UHM A;  2BW3 A;  3LSH A;  3R0J A;  3RIR A;  3HTU A;  4RGU A;  1E3P A;  3V8K A;  1K78 B;  2JA6 J;  4ENN A;  1XN7 A;  1QQ3 A;  2FA5 A;  1EA3 A;  3AQB A;  4NQF A;  1KNY A;  3RTR A;  1LFU P;  4RDU A;  1FTZ A;  1HST A;  3HJC A;  3BP8 A;  3JRG A;  2B7E A;  4EJU A;  2VKE A;  4B48 A;  2X0L A;  5DQT A;  1XCB A;  2Y3H A;  1HMO A;  5B1A H;  2RNG A;  3WHB A;  1KU7 A;  4HE8 D;  3M1E A;  5B66 C;  2YL7 A;  4IEJ A;  1ZR4 A;  4JVS A;  4CZZ A;  2EZH A;  1HF0 A;  3OYB A;  2HWV A;  3DP7 A;  3PDM P;  5FRN A;  1R6R A;  2XXA B;  3TW7 A;  3S32 A;  3CO6 C;  4A4A A;  3KLO A;  3IQ5 A;  2RGV A;  2I5U A;  2Y69 H;  3JSP A;  3AKZ A;  2PBE A;  3J7A O;  3O55 A;  3H5R A;  2C04 A;  3C63 A;  1WWP A;  4V2F A;  4FX4 A;  3NRV A;  3LA2 A;  4G7H F;  2P6T A;  4IZZ A;  3J7A Y;  4DRI B;  2CUE A;  4QLC U;  4YFK F;  4B8X A;  2M7A A;  3FAP B;  3MBG A;  1OCZ C;  3MX3 A;  2EJR A;  2JN6 A;  4U5E E;  5KYW A;  4N4O B;  2EH3 A;  1HKS A;  4UY8 I;  2LF7 A;  2GA0 A;  3EHM A;  4P96 A;  1D8J A;  2UUH A;  1NU9 C;  4YEJ A;  3WGH A;  1TT5 B;  3GCM A;  1L0O C;  1TWC A;  2HOE A;  4DYR A;  2YWA A;  2IS1 A;  1XZP A;  5DS9 A;  2QZ8 A;  3CLQ A;  3U3B A;  3RH3 A;  3S15 J;  1P2F A;  3VDX A;  1Z5Z A;  3ZTZ A;  4I09 A;  3W6V A;  2FD5 A;  4MFE A;  2G3V A;  1FFT C;  3HM5 A;  3FXM A;  2ADU A;  2ECB A;  1GXP A;  3ZN0 A;  5HOO A;  5A6B D;  3PIP F;  2XGD A;  1T95 A;  1U6G A;  1YYJ A;  1BC7 C;  2YU9 J;  1YYX A;  2O8X A;  2DT6 A;  4BQO A;  2IXS A;  2V79 A;  1Z77 A;  5IOZ A;  2M0C A;  2FJ1 A;  1IN6 A;  3C1D A;  5EZG A;  4P9T A;  5KNL A;  1OPC A;  1TZL A;  1NZE A;  2MH9 A;  4A3J J;  1YTY A;  1SC7 A;  4E70 A;  4XRM A;  1VQ4 I;  3K1I C;  4Q5S F;  1V4R A;  2QUP A;  3IAS 2;  4IVN A;  5L0I A;  3BR2 A;  3Q0V A;  4KNW A;  2H09 A;  4C2M J;  4MIM A;  5JLX A;  4BBR J;  3H3U A;  1JOG A;  3DJU B;  3TJ5 A;  4NC3 A;  3KIO A;  4W1U A;  3A2K A;  4XL9 A;  2ZJP F;  4ULW A;  4IHY A;  2XDV A;  4BJ6 C;  1U5T A;  3K1N A;  1LFB A;  3B73 A;  1KYW A;  4BE0 A;  2HR3 A;  4BQA A;  5JP7 A;  2XV4 S;  1TWA J;  1B8I B;  2L9N A;  2J9U A;  2OKU A;  2P1A A;  1RC9 A;  3VYT B;  3MLG A;  3S2D J;  2Y31 A;  3BG5 A;  1LE8 B;  2ZME C;  5F08 A;  2GIV A;  2W57 A;  4LLN A;  1ORS C;  2EPN A;  3BLY A;  4FTH A;  3LS1 A;  2Q9C A;  4RLF A;  5LFA A;  1ERD A;  3MVP A;  3QU6 A;  3FVY A;  2NOG A;  1ORK A;  3LEV A;  5KYW B;  3PNV A;  2R5Z B;  2K9L A;  2LY2 A;  1P7I A;  4RDA A;  4HF2 A;  1VOM A;  1FEX A;  5A69 A;  3HKZ N;  3LAP A;  4CCM A;  1W36 D;  2ZCW A;  4L0Z B;  1FPQ A;  1MMD A;  2JMW A;  1HBX G;  4YT8 A;  1F5T A;  1U9N A;  4BY1 J;  4OU0 A;  2X48 A;  1NHA A;  2JTV A;  5BQT A;  3W2W A;  1SFO J;  1CF7 A;  3GFJ A;  2COM A;  2XL4 A;  3BRO A;  1P9Q C;  1E86 A;  3FXQ A;  4BHC A;  2ELK A;  4A0Y A;  3FK6 A;  4U0V A;  3M4O J;  4LIU A;  5BNG A;  5L0C A;  3P9I A;  2BY0 A;  4I99 C;  4XSZ F;  4P6I C;  2X0C A;  4LGW A;  4UV8 A;  1HW2 A;  2YLI A;  3ZRG A;  3K0L A;  3LSR A;  2QSG X;  4WGY A;  1HW1 A;  1OLT A;  2DA3 A;  1D0X A;  2G7H A;  2IGO A;  2FOW A;  4L5I A;  1S7O A;  4LIT A;  1YHQ I;  1T6I A;  1TWH A;  3QZC A;  4F4B A;  1ZRC A;  3OA1 A;  3DKA A;  1RES A;  3Q3S A;  4P9U A;  1LIH A;  3B9Q A;  3S29 A;  2AXT C;  2DA2 A;  5JHU A;  2PJR A;  3GOR A;  4AIH A;  4QI2 A;  3CJT B;  3WG9 A;  3ZMD A;  3CCR I;  1XMK A;  1ZAO A;  2GAQ A;  4LLE A;  3GYH X;  5FKM A;  4HEA J;  3M8J A;  4N9H A;  3EGX B;  3LS0 A;  3MEX A;  1QKR A;  3U1K A;  2JA7 J;  3I0T A;  5GAE J;  2G3K A;  3SEO A;  3H0D A;  4HNV A;  2QLZ A;  3TD7 A;  3S17 J;  4BQQ A;  2EFN A;  4LER A;  1GVJ A;  1S29 A;  2Q2E B;  2VKD A;  3S1Q J;  3NYL A;  1R49 A;  2Y3G A;  5JLI A;  2Y0S N;  4HBL A;  2IEK A;  256B A;  2JPU A;  3K66 A;  4N6C A;  4CX9 A;  5CVV A;  2CH0 A;  2NVT J;  3QVZ A;  1WJ5 A;  3I4N J;  3T6G B;  2R7T A;  2HKO A;  1D5V A;  1P4A A;  1JR8 A;  3C8G A;  3NEU A;  2M1B A;  2FQ4 A;  4WWC A;  2HVR A;  1T8I A;  4HLX A;  1FY7 A;  4BJ1 A;  3OYJ A;  2M0M A;  2H1K A;  4KIC A;  2QA4 I;  4E0H A;  3ROU A;  2X6Y A;  4ZYE A;  5IP7 J;  2LP4 A;  4IHT A;  2DMN A;  3PM1 A;  4GDF A;  1TP4 A;  1YA7 O;  1MKM A;  2L6G A;  1JTX A;  1VYK A;  3K9T A;  3T9O A;  5F0C A;  3SFI A;  3K4N A;  1REP C;  2IT0 A;  2P6V A;  1B72 B;  4BH9 A;  3CF2 A;  4XIC A;  3HEF A;  1WJE A;  5DCM B;  4XEK A;  3G1L A;  1ZLJ A;  2M2E A;  2X1E A;  2YX7 A;  1PUE E;  4F52 A;  1W0U A;  4QWQ A;  2KGO A;  3W8I A;  1E3O C;  3S27 A;  2FXA A;  5D5V B;  3QYE A;  1X1B A;  2M34 A;  3R6S A;  2GZW A;  1JE8 A;  5HNH A;  2VH3 A;  3H65 A;  1S6L A;  3IUO A;  4RAY A;  2DOE A;  1RNL A;  2MD0 A;  3AG3 H;  2HKX A;  4IF4 A;  4YRV A;  2QBY A;  1LM3 B;  3FOO A;  2ZXW H;  1KQ0 A;  4JOM A;  5ILS A;  1K40 A;  1U6H A;  2IBF A;  1IN8 A;  3IAM 2;  1OIS A;  1X1P A;  1JT0 A;  3F6V A;  3FMS A;  3F6O A;  3LA3 A;  1Y39 A;  1LUJ B;  4EAT A;  4I02 A;  1EA8 A;  1LI5 A;  5JR3 A;  2M87 A;  1WCM J;  3VYR B;  3QP5 A; 
#chains in the Genus database with same CATH homology
 2LBF A;  2MFZ A;  4Y33 A;  3LL7 A;  4OD4 A;  5KYY B;  2R7U A;  3PSF A;  4E7I A;  2L9J A;  3LLI A;  5HLT A;  2WVO A;  4PFO A;  2IS6 A;  1Y56 A;  2DYR C;  3LLK A;  4JJG A;  5DS6 A;  4XR6 A;  3DKX A;  1X19 A;  3DEE A;  3B0U X;  3MKZ A;  1QU3 A;  1RJ9 A;  3EJN A;  3PMR A;  3PNY A;  4QDL A;  4AX2 A;  4FAS D;  3I4U A;  2ZXR A;  2NUT A;  2LH9 A;  3ZGK A;  1ZHW A;  4CBE A;  4JQF A;  2J9W A;  4E7Z A;  4BDZ A;  2X6X A;  2E1M B;  3NYM A;  3NWT A;  1X1C A;  3SZG A;  3L2U A;  2A69 F;  4RMN A;  4D9J A;  4XLP F;  2H7B A;  4BQN A;  3O39 A;  3VYU B;  3UGP A;  3OS2 A;  4CA0 A;  4G7O F;  4RM2 A;  5LD2 C;  3AG1 C;  2K9M A;  2V4J C;  2R7W A;  1MNE A;  3Q6M A;  2QKM B;  1Z23 A;  4W8K A;  2ZXI A;  3HXL A;  3RKO F;  1IZM A;  2JA2 A;  4JW1 A;  1V5E A;  4NC7 A;  2UUZ A;  4IWB A;  4U5C E;  4RLQ A;  3RYL A;  2ZXO A;  2KQ9 A;  1QHH D;  2Y3B A;  4WJ0 A;  1ZEL A;  4XQF A;  3OWT A;  4CCJ A;  3LSG A;  2E87 A;  4ZLD A;  5T3T A;  2V1N A;  2XSE A;  2PJR B;  3EGD A;  1JI8 A;  1WJD A;  5FRO A;  3NDB B;  2EIM C;  4F91 B;  3D5L A;  2R7Q A;  3U21 A;  4B43 A;  1TWA A;  3L2W A;  3NYJ A;  3AL0 B;  2IS2 A;  3K7D A;  3RPU D;  4BL0 B;  4CH7 A;  2XXA A;  4ZJZ A;  4B47 A;  1TR2 A;  4OIQ F;  3JCU Q;  2FGY A;  4CCO A;  4J30 B;  3V42 A;  2NUP A;  3EUK L;  2CW7 A;  2IGM A;  3F47 A;  4RM3 A;  1E0E A;  4C3E A;  3DZA A;  3DMD A;  3GBG A;  2J46 A;  3SP1 A;  4XKB A;  2VQH A;  1K6Y A;  2VQL A;  4C9Y A;  1PD0 A;  4ZDL A;  4E7J A;  1O5H A;  2QY9 A;  3GOD A;  3FHN A;  4J00 A;  3DAF A;  4U5B E;  3ZSU A;  1MMG A;  4C3B A;  1X1A A;  2CUJ A;  2Z16 A;  2LG4 A;  3I3L A;  2KMU A;  2VB6 A;  3NKD A;  4OD5 A;  2F6C A;  5B1B C;  2OUM A;  3D5S C;  1RJ9 B;  3L0I A;  1VK5 A;  4JZA A;  2JSP A;  4OWR B;  3OIP A;  4JUR I;  5E3C A;  4BDY A;  3CP8 A;  2Q9B A;  4D1Q A;  1PYV A;  1NG1 A;  3ZG1 A;  2BVM A;  3DLA A;  4JCH A;  4XN3 A;  2WZF A;  4YJW A;  3LMM A;  3UMI A;  2Y39 A;  1ZHT A;  4YT4 A;  2DJI A;  3HOS A;  1J8Y F;  1M57 C;  3DQV C;  4NUB A;  1SZI A;  5DS4 A;  4IAO A;  2PX3 A;  3SEZ A;  4QPO A;  3EGD B;  2W82 A;  1Z3Y A;  3HOT A;  4OIO F;  2ELJ A;  1W36 C;  4HRI A;  4IQ4 A;  4XLA A;  4YEL A;  3HUG B;  4O79 A;  3BCB A;  4PSX A;  3S28 A;  3SZR A;  3AG3 C;  3E0J B;  4AK9 A;  1T0F C;  2IGN A;  1ST6 A;  1LFP A;  3O6X A;  3POV A;  4OIP F;  1U0J A;  2VJ4 A;  2LOO A;  2PP4 A;  4FET A;  2WVQ A;  2Y69 C;  1DP3 A;  2AQE A;  2M4K A;  4XKV A;  2KLO A;  3FBI B;  4E4H A;  4M63 A;  3OMY A;  1D1B A;  3OEO A;  2EIJ C;  3W3C A;  3OIQ A;  4CCN A;  1V55 C;  2XC7 A;  2VJI A;  3CMM A;  1Z7L A;  3OR1 C;  2HVS A;  3DM9 B;  4CS9 C;  2DOA A;  4E6K G;  1TT0 A;  2PMZ A;  4CSA A;  1KON A;  2ZSI B;  3LSK A;  3OS1 A;  1WJB A;  2CV2 A;  3OR2 C;  3H9G A;  4HPQ A;  4BS9 A;  4F3Q A;  3KL4 A;  1MMA A;  4OIR F;  4RBN A;  3H5A A;  2WY8 Q;  4EBB A;  2F4I A;  1N77 A;  2RQQ A;  2VJ5 A;  3G2B A;  3OYK A;  1LKX A;  3ZCO A;  3ASO C;  2KL4 A;  3ZQQ A;  4RD9 A;  1S9H A;  3DU6 A;  4KBL A;  3OL3 A;  2CW8 A;  4IX7 A;  4YN0 B;  2WB7 A;  4B44 A;  2GFH A;  2V6E A;  3ZR8 X;  2VQC A;  3MKW B;  3FKJ A;  4HSR A;  2VPL A;  1TKN A;  2JVG A;  3FAJ A;  4ZTF A;  4II2 A;  5DQZ A;  3OYF A;  3TL4 X;  5L3V A;  2ZSH B;  3OOU A;  1Z6A A;  4C30 A;  4XWJ A;  5E2Q A;  4YWQ A;  3DM5 A;  2A6H F;  3C2H A;  5KYX B;  2Y3D A;  3JRT A;  4PSW A;  2YHS A;  3EFO A;  2Z1D A;  5CQE A;  5CI9 A;  4CZC A;  3EQL F;  3LES A;  3L2R A;  3BG7 A;  2H7V C;  2WY7 Q;  2Y0S A;  3AG4 C;  1OKK D;  5KCM A;  1FMW A;  2IXO A;  2A6T A;  2KHM A;  2M4G A;  3HPG A;  2R4G A;  1Z3I X;  3N24 A;  3CES A;  1SMY F;  3WG7 C;  4BJ6 A;  5L3Q A;  3OYD A;  4ITV A;  5IY5 C;  3S3M A;  3I5P A;  4Y4R A;  5D91 A;  3HC7 A;  3EH1 A;  1YE9 A;  1D0Z A;  4QI0 A;  1X1D A;  3ZXS A;  2J0X A;  3MMY B;  3SNH A;  2X1C A;  3V7O A;  3WOD F;  2JVH A;  2V9K A;  1N1C A;  3SYT A;  2JD3 A;  3H5N A;  3A4C A;  4ZYA A;  3UNG C;  4CCK A;  5HSW A;  2W00 A;  4II3 A;  1Z3X A;  2MC4 A;  2L9S A;  1ZU5 A;  2KNH A;  4K0D A;  2VQG A;  2AQF A;  3E9V A;  4PJM A;  1D1A A;  1ZHY A;  3CQZ A;  3T4R A;  2HV7 A;  1DQU A;  4FES A;  3EZH A;  3OY9 A;  1JPJ A;  4BE2 A;  4J32 B;  4XTK A;  5F5H A;  3SEQ A;  2I8B A;  1QZX A;  3UGO A;  3FBN B;  4HG2 A;  3ECS A;  4CSW A;  3S3N A;  5E33 A;  3SDB A;  1WFX A;  5EHH A;  1QLE C;  1SF8 A;  2KP6 A;  4E7H A;  3HPH A;  2CV0 A;  4QPQ A;  3H9Q A;  4PK4 A;  4HFF B;  2H7O A;  2A6E F;  3LSI A;  2OG2 A;  3PJR A;  3QMK A;  5EGY A;  3NRH A;  4IQJ A;  4BGD A;  1MW7 A;  1MND A;  3DKY A;  1ZU4 A;  1FTS A;  2CFO A;  1ZHZ A;  2R7X A;  3OL4 A;  4LG3 A;  1OKK A;  4LAC B;  3DU5 A;  2RRE A;  2LBF B;  2YZS A;  2KRC A;  1N78 A;  2KDO A;  3ABM C;  3B0V C;  3B0P A;  1QHG A;  4CUG A;  3OS0 A;  4MLO A;  2M7B A;  3OYI A;  1PCX A;  4PUS A;  5T3W A;  3EPV A;  3LAY A;  3AL0 C;  4P1W A;  2VXZ A;  5B1A C;  2BOL A;  3F46 A;  4KNV A;  2KRH A;  4XOR A;  2J7P D;  3JSZ A;  4I3M A;  2VJJ A;  4PJN A;  3VSL A;  3VYW A;  4DBR A;  2LRD A;  3DAG A;  2V7F A;  3F9K A;  3M1C A;  3K4M A;  1WGW A;  3RFY A;  1BR1 A;  3DPT A;  5TGT A;  3KH2 A;  2NOJ B;  4X0G A;  2BVL A;  3ZVR A;  3PNT A;  4HEA 2;  4F4B A;  2CNW A;  2L81 A;  4H4K C;  1IRX A;  3MKY B;  3L34 A;  3C2G A;  1FMV A;  4PJJ A;  1M2V A;  3PL8 A;  5CKT A;  3CJR B;  1VZ0 A;  2FUG 2;  2KW3 C;  2W4M A;  4IJJ A;  3MD2 A;  2E5Z A;  3FHD A;  4E7K A;  4Q4Z F;  4KI2 A;  2CMP A;  3HL2 A;  5FRM A;  4LIV A;  3BG6 A;  3I9V 2;  3K4B A;  2NG1 A;  5CPR B;  2FFH A;  3GAN A;  3K70 D;  3L2V A;  1W2W A;  5HNF A;  1Z63 A;  3HLZ A;  1V5G A;  4AE4 B;  3TMO A;  1YX3 A;  2HPI A;  4FX5 A;  3RIP A;  2CUZ A;  2L7K A;  2ZFU A;  3PFY A;  4XLC A;  4CS8 C;  3S0X A;  2W1O A;  1TWG A;  2UV1 A;  3VWB A;  1VMA A;  4G0H A;  3Q7L A;  2IXP A;  1NG7 A;  2CGE A;  2X85 A;  2XRH A;  5D92 A;  2HNH A;  3BC8 A;  1D0Y A;  3N05 A;  3OYL A;  2R7R A;  4E7L A;  3EG9 B;  2BW3 A;  3LSH A;  3JT1 A;  2IXM A;  2V3C C;  2P7V A;  2LC2 A;  3OYH A;  2MYS A;  3T6J A;  1G8X A;  1UAA A;  3AG2 C;  1EA3 A;  3K4L A;  2XF6 A;  3L2Q A;  3RSN A;  3RTR A;  4BEH A;  3AQB A;  3DTE A;  3OYM A;  2LSE A;  1WJC A;  3HJC A;  3CJQ B;  3DTI A;  2NUT B;  1IW7 F;  2J7P A;  4ZDP A;  4B48 A;  2KZV A;  4JJF A;  5DQT A;  4BUP A;  2Y3H A;  2OC6 A;  4O6Y A;  4U5D E;  3TBI A;  3K1H A;  2RNG A;  4HE8 D;  3K4J A;  1G59 A;  2XSJ C;  2R7S A;  3EPZ A;  3EGX A;  4JVS A;  3OYB A;  4C7O B;  5KHD A;  3EUH C;  4XLE A;  1ZYR F;  5FRN A;  1R6R A;  4K7B A;  2XXA B;  2VXD A;  3S32 A;  4DIQ A;  3M1C B;  4XKC A;  1LDK B;  3LFU A;  4HNT A;  2M3A A;  4YT5 A;  3NWS A;  3AKZ A;  4XON A;  4KJZ A;  3ZIB A;  4PJL A;  4NY3 A;  3H5R A;  3RQ4 A;  2C04 A;  4EWC A;  2EIL C;  1M2O A;  4ZDO A;  2GOM A;  2HVQ A;  4G7H F;  4B6I A;  3J7A Y;  4IZZ A;  3EH2 A;  2JUG A;  4NC8 A;  3W2V A;  3OYE A;  2XF5 A;  2HU9 A;  3FDY A;  4XN0 A;  4E7S A;  2M7A A;  4Y3O A;  4U5E E;  1OCZ C;  3LSM A;  5KYW A;  4N4O B;  3PUB A;  3EHM A;  4O6M A;  5JHF A;  4XNF A;  3Q7G A;  4C2T A;  3HTK C;  4GRI A;  2VKH A;  1NU9 C;  4YEJ A;  4NQW B;  4OAY A;  1TWC A;  3I5Q A;  2IS1 A;  1S7Z A;  2Q1Z B;  2MWQ A;  3KKB A;  3RH3 A;  4I1M A;  3VDX A;  3KYL A;  3KMI A;  4O6N A;  1GLN A;  4XLF A;  1Z5Z A;  2X6W A;  3KX2 A;  2CV1 A;  1LS1 A;  3JYH A;  4N06 A;  4CS8 A;  2G3V A;  1FFT C;  3K4K A;  4DGW B;  4OAZ A;  2W7N A;  3ZC4 A;  3VYS B;  3HKZ A;  5HOO A;  3UMH A;  1Y6I A;  5T1D B;  1T95 A;  4XOP A;  1HA8 A;  2LY1 A;  2K5C A;  2WL8 A;  2BW3 B;  2CNW D;  1OCC C;  3OYG A;  2ZPA A;  4FWV A;  5CQG A;  2DT6 A;  1J8M F;  4BQO A;  2IXS A;  4IRU A;  4CS7 A;  4C7O A;  3S3O A;  3IP4 B;  5KNL A;  2UWM A;  1TZL A;  4I44 A;  1NZE A;  1DGR M;  1BR4 A;  4ZTJ A;  1ZHX A;  1VYI A;  5DLJ A;  4HNU A;  2IOQ A;  4BE1 A;  4DVZ A;  3K1I C;  1D1C A;  4Q5S F;  2OCC C;  3IAS 2;  2VLA A;  3T6B A;  1BOB A;  4MQ9 F;  3DJN B;  2P0W A;  2WAE A;  1OCR C;  4KNW A;  5KYX A;  2XAU A;  3S93 A;  1X4P A;  3NG1 A;  2O5R A;  2ZXW C;  3DJU B;  2PFD A;  3UMK A;  3A2K A;  4XL9 A;  4ULW A;  2XDV A;  2DT7 B;  4BJ6 C;  1LVK A;  2M4E A;  4BG0 A;  1WJF A;  4XOT A;  1NG6 A;  2D5R B;  4KIS A;  2W4B A;  2WA0 A;  4BE0 A;  1OR7 C;  2VIX A;  3EG9 A;  4GEH A;  2L9N A;  4B3X A;  2J9U A;  1O87 A;  2W9Y A;  3MLG A;  3VYT B;  3LNR A;  3LS1 A;  1PD1 A;  4CCL A;  3BLY A;  4BJ5 C;  1FFH A;  1M56 C;  2Q9C A;  4RLF A;  5LFA A;  4U5F E;  4OIN F;  1ERD A;  2G62 A;  3FVY A;  2Q9A A;  4BAC A;  4HFK B;  2ZXP A;  1Z21 A;  3AQC A;  1V54 C;  1SAU A;  2BE5 F;  2W45 A;  3LEV A;  1JPN A;  1N75 A;  3PNV A;  2K9L A;  5CI8 A;  2LY2 A;  4BXF A;  2O9X A;  4RDA A;  4F92 B;  1VOM A;  4NNJ A;  4CIH A;  3VSK A;  4CCM A;  1W36 D;  1MMD A;  4YT8 A;  2CS3 A;  4IKF A;  4DBQ A;  3NKE A;  4XLN F;  3LJB A;  4J01 A;  4U5H A;  4R79 A;  3W2W A;  2HPM A;  2Z15 A;  4ZC3 A;  1V5F A;  3DPL C;  3DD7 A;  2XL4 A;  3E70 C;  1P9Q C;  2A1D D;  2A68 F;  2WBM A;  3DTK A;  2ZXH A;  3K10 A;  4LIU A;  4C3D A;  1NU7 D;  2CW0 F;  4PFP A;  4HST A;  3K4C A;  2DYS C;  3K6B A;  4P6I C;  3ABL C;  2MAB A;  3ZRG A;  2VL8 A;  2WAF A;  2WZL A;  3PHF 2;  4XLH A;  4F93 B;  1OLT A;  1D0X A;  4I1O B;  4DVY P;  3N2Z B;  2IGO A;  4LIT A;  2PF4 E;  2A5W A;  3PSI A;  2GOX B;  2R7O A;  3QOD A;  4P5O A;  2DXI A;  4AVZ A;  3AFH A;  1TWH A;  2IYL D;  3OA1 A;  4AU7 A;  3DXJ F;  5FCL A;  2L2O A;  3KEY A;  2VAS A;  4BJ5 A;  3B9Q A;  4X0R A;  3S29 A;  3QYF A;  3FDQ A;  3QZC A;  4GYT A;  4ZLC A;  2Q3T A;  2KQR A;  2E60 A;  4XKW A;  3K70 C;  2PJR A;  4CSA C;  4QI2 A;  3DPU A;  1PJR A;  2DCE A;  3RCO A;  2WAD A;  4BU2 A;  4LLE A;  5KYU A;  4N4N B;  4U87 A;  3IEE A;  3H9J A;  2LYC A;  4HEA J;  3W2A A;  4YT2 A;  3M8J A;  2YEV A;  3H35 A;  3EGX B;  2KPM A;  2WAQ A;  3LS0 A;  4BJT A;  4A2N B;  5KYY A;  1M2V B;  2G3K A;  3H0D A;  3UR3 C;  3SEO A;  5B3S C;  4U5G A;  3TD7 A;  2I8D A;  4LER A;  1J09 A;  2F5V A;  2OV7 A;  2HZD A;  2Q2E B;  4BQQ A;  2VKD A;  4KIT B;  2HV6 A;  2KJG A;  3NYL A;  2Y3G A;  5E3A A;  3K66 A;  3EFO B;  1UEL B;  1UG0 A;  4DOZ A;  4U7B A;  3OYN A;  2CH0 A;  4KT6 A;  1WJ5 A;  2WZG A;  2E5N A;  2R7T A;  2IS4 A;  5HVQ C;  4BEH B;  1AA7 A;  2QKL B;  3CZ6 A;  3D5R C;  3OYC A;  2HVR A;  2IXN A;  2QTV A;  4AYB A;  3EZI A;  4MND A;  5DVW A;  4AE4 A;  3EHN A;  3QYB A;  4BJ1 A;  3OYJ A;  2L5Q A;  2M0M A;  5BUO A;  3K6G A;  2NUP B;  4Q7C A;  2R7V A;  2X6Y A;  2HDW A;  2Z2S B;  2V26 A;  3ONQ A;  3BCA A;  3EUA A;  3ABK C;  2LRE A;  2J9V A;  3A1Y A;  1VYK A;  5DS5 A;  4G6T B;  2W4S A;  3E1S A;  2WVN A;  3MX3 A;  3K4N A;  2EIK C;  3S8P A;  2P6V A;  3DWL E;  3CF2 A;  3CP2 A;  3QOE A;  1WJE A;  2HQA A;  2DGJ A;  1YX5 A;  2E1M C;  1DGW Y;  2WB1 A;  2X1E A;  3SYN A;  1KU2 A;  1BR2 A;  4F52 A;  2KGO A;  4XM3 A;  4KC9 A;  3W8I A;  3X2Q C;  2PX0 A;  3HG9 A;  2J45 A;  3S27 A;  3W8H A;  4XMY A;  3QYE A;  1X1B A;  2CDQ A;  2X51 A;  2C03 A;  4F55 A;  1X4O A;  3ASN C;  3Q6N A;  3VAY A;  3CSK A;  1OCO C;  5HNH A;  2VH3 A;  3K33 A;  2J0W A;  3H65 A;  3IUO A;  5F5F A;  1MMN A;  4C2U A;  5KYU B;  2MD0 A;  4YRV A;  2X1D A;  2B0J A;  4O7G A;  4DJA A;  1WJA A;  4JOM A;  2K3P A;  2EIN C;  3ITF A;  2XF7 A;  5KYN A;  3IAM 2;  3N0T A;  4CS9 A;  4ANJ A;  3X1O A;  1SFK A;  4EAT A;  4BEJ A;  4G7Z F;  5KYW B;  3OYA A;  2IGK A;  4LLC A;  3VYR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...