4BJ5C

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
b'SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN RIF2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 54
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj5C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5C01
3OWTA 4BJTA 3CZ6A 4BJ6C 4BJ5C 3K6GA
chains in the Genus database with same CATH superfamily
4FHTA 4CDGA 3QYFA 2KRHA 1XG1A 1V5GA 3TOMA 3U2MA 1XS9A 2FXAA 2F5VA 1MJBA 2KT0A 2WAEA 1KYZA 2CGPA 5DEQA 2KIMA 5KNLA 5JVEA 3M1EA 1QQIA 4ZDLA 3EZHA 4UVAA 4BBSJ 1A35A 1O3SA 2EPLX 2W4SA 3OV8A 2MHRA 2UXXA 4PGGA 2CO5A 2EILH 4XLCA 4CICA 2LQGA 2HYFA 1TQIA 1WJFA 2FBIA 1XZPA 4WGZA 2CYYA 2Y9YA 2Y48A 4HW0A 3AG2H 4QWQA 4XR6A 2NUPB 1V3FA 5GPGB 3CMEI 4EEFG 2M0CA 4IRGA 2DMNA 4FX5A 4HE8D 2IA1A 3OS2A 3GX4X 1FR0A 1W36D 3ZMVA 3HHGA 5EGOA 1MMAA 3D5SC 1FPQA 1FWZA 2M4KA 3RSNA 1X58A 2GWRA 4EJUA 5HV9A 2XXAB 3QAHA 2CDQA 4MO7A 4M74A 1OCZC 2WB1A 1IN7A 1TWAJ 3F6VA 4X1EA 1USSA 1JR8A 3HSRA 5JT4A 4C3HJ 1BDJB 1XB4A 5DCMA 1O4XA 2PP4A 1FFHA 4I44A 4NTFA 1BI2A 2JPCA 1DDNA 4C3BA 1ZGWA 4J30B 3UGPA 3AG1H 3TO9A 4KN7X 3BT9A 3VODA 5LFAA 2K9QA 3RPQA 2QCOA 1JKRC 1G6NA 2AO9A 2WA0A 1LQ1A 2EFOA 1M2VB 4P6IC 4XQ1A 3VYWA 2R7FA 2RDPA 1LDDA 4NTAA 5C4XJ 1YI2I 2V1UA 2KW3C 2FSWA 2XF5A 2DOEA 3ZQGA 1T56A 3NEUA 2A0BA 1Y4CA 2PI0A 3JSOA 1MMNA 1OCOH 2Q7RA 2R9RB 4ABZA 2B7EA 5FFXA 3CCRI 4IAQA 4BU2A 4X6AJ 1KTMA 3HBLA 1J09A 2HTJA 3MMYB 2NXNB 1GS9A 4JK1X 5C4JJ 4HAMA 2HWVA 4BEJA 3GWZA 1S7EA 1SVLA 5L0GA 3TP0A 4E7KA 3OYGA 1Y8QB 3BZ6A 4BHPA 1SVOA 4LB5A 3A9CA 3OYBA 1W5CC 1K83J 2L9VA 3GMEA 1EKYA 2QQAA 4QSHA 1LVAA 3LSHA 2JK3A 3S28A 3JRBA 1PVEA 2F6CA 2W85A 3OOUA 1K61A 3S90A 3GFJA 4HEAJ 3UR3C 1ZG1A 4KJZA 4M3DA 2CV0A 2RV8A 3E5QA 1DPUA 1GQAA 1AU7A 1EKEA 3EUAA 4XM3A 2HMZA 2XPWA 2XVCA 1RETA 1K04A 2M7BA 2BYVE 2IA0A 1TR2A 3HOXJ 1V54C 2NPUA 3V8KA 1O3QA 2Z9OA 2MYSA 4LLLA 3QOEA 2RKHA 4D4XA 2BXZA 2FF4A 2IGMA 3BEHA 4KC9A 2PJRA 4YT2A 3K6BA 5F28E 3M4OJ 2LRDA 3ZMUA 3AG1C 4Y3OA 3EETA 2NVYJ 1YA7O 3O8GA 1E3HA 1U8RA 2ELJA 2NNYA 2LREA 2XLEA 2QKLB 5IT9Z 1ST6A 2XLHA 1TWAA 5CLSA 1T01A 2HV7A 2AWCA 3GEEA 2DBBA 2IVMA 1SZIA 4CJOA 1D1AA 1WJCA 2PN6A 1E83A 2JA5J 3P9IA 3GTLJ 5FKNA 1AA7A 4B3AA 1ZGJA 1U5TA 4PK4A 2CYDA 3DBLB 2HSBA 2AXTC 2VKHA 1A6QA 3O6BB 1XDSA 4HSRA 1R5HA 1TQPA 2B0LA 4E4HA 5J47A 1F4KA 4G7OF 3PHF2 2X6WA 2RD9A 4L9JA 4ESBA 2ZKZA 3F8CA 1IN4A 4HX7A 3LLKA 3V7SA 4XLEA 4QDLA 4H54A 3HLZA 5GAGJ 3RKQA 3B29A 4K1OA 5L0FA 2L0KA 4YFXF 2H94A 1LPQA 1ZRCA 5BQIA 3DTEA 3K1HA 5A6KA 2Z33A 2CWEA 3H5NA 1TNTA 4MVZA 2L7AA 3GANA 4YT8A 3HJEA 3MAJA 4XLPF 3CDHA 3CESA 4C2TA 3GTQJ 2LIGA 3LNRA 1TQGA 4A3JJ 4QLCU 1WASA 1MNEA 2I8BA 2XLVA 3T5XA 2VE8A 4IX7A 2XAHA 3I5PA 4GGGA 1X2MA 2OZUA 3H5RA 5ILUA 2EFNA 3ERED 4IHVA 2OQGA 2DPDA 1DUXC 2Y69H 1HMOA 1TWGJ 3ZQYA 4JIOA 3SYNA 5J8FA 3WG9A 1UZCA 2DK8A 4YK5A 2V3CC 1OXKA 3R0JA 2RC4A 4Y17A 1APCA 2BV6A 2AS5F 3C63A 2B63J 4XPYA 4CO8A 2I5UA 3E3VA 3PMRA 3S0XA 4UUTA 2FFHA 2E1CA 4MVRA 5FLMJ 1ZQ3P 4U9DA 4ENJA 4DRHB 3ZPLA 3F6OA 2XGXA 3IH3A 3CD6I 2OCEA 3PFIA 4AUXA 2CS3A 2V1NA 5CPRB 4NC3A 4C3IJ 3U3FA 4EUKB 1BJAA 3RQGA 5DVWA 3PNYA 4GYTA 2CW7A 2EA4A 2RAEA 3H0GJ 2Y75A 1OCTC 3F8FA 3ZMTA 1ZTRA 3ZN1A 2ICWG 3CCJI 2ASRA 3O10A 1YW7A 1VQLI 1SD6A 3N4MA 1H9TA 2EPFA 4K7BA 2IM8A 4I1OB 1QA6A 3FDQA 1ODDA 5J6XA 2IGNA 5D5XB 1VQ7I 4XEKA 4RLQA 3ZCOA 1IAWA 1XC5A 6PAXA 3DD7A 4BJ6C 4UUSB 3HEFA 3PNVA 1RUOA 5L0IA 4LLGF 4JP0A 2JVHA 4NY3A 2VLAA 2ELKA 1BC8C 3GBGA 3KLOA 4OINF 4O6MA 2P7VB 2XF7A 4I02A 3BR0A 2ZSHB 5K5RA 3GTKJ 2D2WA 3MWMA 2HVQA 3OA1A 3K10A 2CUJA 2HKOA 1FFTC 2X4HA 3MEXA 5DQTA 2DYSC 4CS9A 2H7OA 1SD4A 3FXMA 3HYIA 2HKVA 3JRMO 4B48A 3VF0A 1U6HA 2Y69C 2BHYA 4MVSA 4DYQA 1J5YA 1IC8A 1QPIA 2R7TA 2X0CA 1GXPA 1D0YA 3JYYA 2X51A 5CVRA 2P8TA 3BY6A 4QPOA 3WTXC 1J7KA 1LIHA 2LFDA 5L3BA 4G6TB 1P2FA 5FJ8J 3LEOA 2K3FA 3CJTB 1P4WA 4UDVA 3W2VA 4CUGA 1TWGA 1ZAOA 5LGTA 4J01A 3FOOA 3LAPA 3SJMA 1WJDA 4KUMA 4HOBA 3KP2A 5J8CA 1D1CA 2H1LA 3HKZA 2XM4A 3WE3A 5CVJA 4M9SA 4U5DE 2MH9A 3P7NA 2LBFA 1ON2A 2L4MA 3OIPA 2NVXJ 2R7DA 5DS6A 2FBHA 4BHCA 1ORSC 2OQMA 2J45A 3ML6A 1O7FA 5DD4A 4C9YA 2WWYA 4DVZA 5FRNA 1MD0A 2HOEA 1P7JA 3Q0UA 2HZTA 4Y4RA 3JZ0A 1VLTA 2QBYB 2GFHA 4DVYP 4KN4X 1LEAA 2DFHA 3A4CA 4AYBN 1B59A 4ZYGA 3EGXB 4GRIA 4XKCA 5HLHA 3EZIA 2UUIA 2OF7A 3GM1A 1OYIA 3PUFA 4JRZA 1MJ9A 3JREA 1PDNC 2JVGA 1T39A 3NMJA 3US6A 2IP2A 3CCMI 3KP4A 1LE8B 5GTHC 4A69C 3MKWB 4R32A 2M87A 4A0XA 2NAZA 1U2WA 4IHTA 1J2XA 1PP7U 2P5VA 2W57A 3UGOA 5CQEA 4AC0A 2LF7A 2L7KA 3JTLO 4U5BE 1WKMA 3NRHA 2LCHA 2LMDA 3LA3A 2XRNA 1S29A 2DFIA 4XKBA 1F5TA 2OTJI 1A41A 3B0PA 4CDYA 2M45A 2JSCA 2AHQA 4OWRB 1KQ9A 2ELHA 2DA3A 1REPC 2A5YB 3N24A 3QU6A 3OYCA 1Q0FA 1XDUA 1XN7A 2D5RB 2XB0X 2M2EA 2RSEB 1OQYA 1MSFC 2CQ7A 3G73A 1D0ZA 3PO2J 2FAPB 5EJCA 3MQ0A 3MBGA 3QRFF 2A07F 2IXOA 2Z1DA 3K69A 4CHUA 2YL1A 3I53A 5LGNA 1N25A 2E1MC 2P81A 4HG2A 4BL0B 1AOYA 2D4UA 3QODA 3BG3A 3WODF 1V5EA 4L9NA 1WFXA 1MGTA 4A5MA 3HUGB 1O3RA 2MC4A 3LWFA 2Y30A 2XASA 1ETOA 2IRFG 1QVXA 4JJFA 4JVSA 4P9UA 4O7GA 3BRJA 1TQMA 2VJ4A 2PX9A 3WTYC 2IS2A 3OYMA 1FIPA 1N78A 1J0RA 1JKOC 1B72B 2WY8Q 1YW9A 1TL8A 1IXCA 3F47A 1IRXA 2QYOA 2XSJC 1MMDA 2NOJB 4A3GJ 3GORA 3ZDLA 3M8FA 4YRVA 2LKPA 3FXUA 5AIQA 2M3AA 3O6XA 2Z15A 2X85A 4CIPA 1U78A 5A69A 1I4YA 1Y0NA 4PFOA 2NVTJ 2LK2A 1IUFA 3DLAA 4E18A 3TOAA 4HV6A 2L5QA 2VONA 4BEHA 3DM9B 4IRHA 3DQVC 4EJVA 4HYEA 4BXFA 1B9NA 2DDAA 5EF6A 4U7DA 2YLDA 2VXZA 5JLXA 5FRMA 3B6CA 3O39A 1H6GA 3AGTA 1R71A 2OG2A 2J5OA 2M9HA 1Z67A 1LM3B 4PFPA 2HNHA 2YS9A 3TKYA 2LNBA 2V1DA 1CGME 2VPLA 2GAQA 5E3CA 3BQYA 4TV7A 5DTDA 3L2UA 4XLFA 3POVA 3L34A 3G3ZA 1XZQA 1V74B 5AIPA 1ZK8A 3RKXA 2OEVA 3BR1A 4A0ZA 4ASNA 3EH1A 2XKOA 4XL9A 2HQNA 1SF8A 3K7DA 5B3IA 3OYEA 4UXNA 1FT9A 2X1DA 3IWFA 2HZ8A 3FK7A 3ZOBA 5ERIA 1H89C 2VPRA 4F52A 1G3YA 1OYWA 5FKMA 1U6GA 4FAPB 3N2ZB 1Z77A 2LD5A 4D9JA 2NRAC 5L3GA 5CI9A 2MLKA 2YX7A 3ZMZA 1ZHXA 4A3FJ 3JSZA 4RDAA 4A3CJ 2KKOA 1TLHB 3DPUA 5A6JA 1E84A 3C8GD 4RGUA 4OD4A 5JLIA 5HVQC 2O03A 4A0YA 2YSRA 3D0SA 4XKWA 1JUPA 4WWCA 4L18B 5B5EC 2BHZA 5FD6A 4WABA 1LE2A 3I4MJ 1FOWA 2DA5A 2GXBA 2EFQA 5EEHA 4BHBA 5AONA 3EHMA 1B1BA 3B9QA 4XEVA 5ICFA 4BQOA 2O9XA 2MLGA 3ERMA 4IGGA 4B09A 1OCCC 2W9YA 2NS0A 3TOLA 2HVRA 2P5LC 2GA2A 5BMZA 1MIJA 3KEYA 3EYIA 1ZVZA 1SANA 3K4CA 1JKPC 4CA0A 1U9NA 3BPXA 4RAZA 4YIRX 4Z9HA 3TBIA 2DTZA 4XORA 1ZU4A 2FMLA 3L8IA 3EUKL 4MVOA 1BR4A 2E7XA 2M5WA 4N9IA 1A31A 2KIFA 3J81Z 2R7ZJ 2XS8A 4JZAA 2OJED 5IOZA 2EPKX 3D5LA 1ZREA 5GAEJ 1BR1A 1OCRH 2EIJH 2JN6A 1E0EA 1WSUA 2KDZA 4OMYA 1NK2P 2DQRA 3FK6A 2KZGA 4C7OA 1OW8A 5E1ZB 1STZA 1JHFA 1U0JA 1NZEA 3N97A 1U5TC 1LVKA 3EQLF 2CQXA 4KDPA 1HW1A 1Q0GA 3DMDA 5KYWA 3H2VA 3VFZA 2E1MB 1W7PD 3RYLA 3ZR8X 1Z7UA 4A3MJ 3S2HJ 5H6RA 4EQQA 3CQZJ 3CMMA 2QSHX 2L02A 5KHDA 1G3SA 3EYYA 4PDKA 5E20A 1M56C 3TMOA 2L2OA 1CGNA 3TK0A 1G3WA 1R00A 4MVMA 3SNHA 3L00A 4BQQA 3ECSA 5EHHA 1W1WE 3QP5A 1APLC 3JTHA 4Y33A 3A2KA 5LGUA 3OSGA 1BIAA 1HW2A 3S16J 1CQTA 1IV8A 4GXOA 2XSDC 4BEMJ 1Y6IA 2QZ8A 3TW6A 4XKVA 3DCFA 3OYDA 5IYBJ 5F1RA 3L8JA 4B6IA 2JA2A 5DS9A 4RB2C 4DQ2A 3L2QA 4CDVA 4ZLCA 3CCYA 4PSWA 2BEOA 2WL8A 5DS4A 5EEGA 3IAM2 5J40A 2VC1A 4DNCA 1R4TA 4MS2A 1AUEA 3FF5A 2R7VA 1BM9A 1D0XA 3T8RA 3CC7I 5IP9J 2VQLA 2VKVA 2EB7A 2YUSA 1ZH5A 1FNTc 1ZLJA 2P0WA 5EGOB 4HFKB 2CQKA 2XF6A 3IAS2 1BBHA 1UAAA 2R7OA 3L2WA 2STWA 2FNPA 4PCQA 5KYUA 3HRTA 4C2MJ 1H88C 1I3AA 3S2WA 3DJUB 3B73A 1RESA 3KCCA 5DCMB 2JWTA 5DLJA 2EK5A 5JI6A 1H8AC 4KIBA 2DI3A 2XGDA 1Z7LA 2LTPA 4G94A 4XNFA 4J00A 1JMWA 1G4DA 5M5WJ 1YYXA 3K9TA 4KMUX 3RPUD 3QMKA 3F8NA 2MSYA 2YHSA 5K5QA 3ONQA 2FRHA 1V55H 4U87A 1W2WA 1IW7F 1QVTA 1USTA 2XRLA 3B02A 1BW6A 2DMUA 5F04A 1IGNA 2V9PA 1YIJI 2X6XA 2NSFA 2KL4A 3RYPA 4B44A 1VQNI 3BR2A 3CSKA 3Q0VA 3VYTB 2H09A 2D1HA 1A0BA 2HDWA 1Z63A 1OCPA 3GZNB 3W3CA 4CXFA 2L9RA 2MG4A 3CQZA 2W1OA 2VC9A 3KYIA 1YJGA 3E5UA 2GQQA 2GBYA 4Q7CA 2Q1ZB 1WI3A 4CS8A 1YVIA 1ERDA 1S8NA 3KEOA 1TFKB 1O57A 2KMUA 2LG4A 4E7ZA 3PCVA 1D1BA 3T6JA 3GM2A 2QLAA 4CS9C 3K2AA 2J9VA 3EGDB 4G8XA 4FISA 2QVOA 5CYVA 1BR2A 1TZLA 1ZG5A 2ZXPA 4PACA 1P92A 1BIBA 3SFIA 5IT3A 1FYLA 1ZYRF 2KHMA 2RQPA 3M4BA 2CG4A 4W97A 4Z9JA 5CVUA 3EHNA 2W82A 2G7HA 2PJRB 4AM3A 2BGCA 5HLIA 2ZXJA 5K7ZA 1EF4A 2MBFA 3F8MA 4ETSA 1FOKA 4OIOF 3D1NI 2VJJA 2Y3BA 2DMTA 3I9V2 2LH9A 1TFOB 2OV7A 4BNCA 3TQNA 3CCQI 1W36C 2OAZA 1Z21A 4JEAA 2HU9A 5K7HA 1WCMJ 1V55C 5JVGF 1T8IA 2RNGA 2P6VA 2NS8A 5TRDA 2Y3GA 1T6QA 3JRCA 1Y1WJ 1U5TB 3BC8A 5F08A 1YRNA 2PF4E 2J5PA 1JAFA 3C18A 4WXHA 4J32B 5E3LA 4ZDPA 3C2GA 2I10A 3I5UA 3CCEI 3GLLA 4IARA 4L6RA 3K6GA 4X0GA 3FBNB 2OU6A 2G62A 4IB4A 2DGJA 2IOQA 1E3OC 3T9OA 1NG1A 1VQMI 2E35A 2M34A 3CZ6A 4HF2A 2WB1N 3SEZA 4YL0A 4AVPA 5ILVA 4DRIB 1S7OA 5A2QZ 3J80Z 4NUBA 2ESHA 2E2HJ 5F0CA 3BZCA 4M6VA 2WTEA 5FLXK 1I5NA 2L7MP 2GZWA 2UWMA 3HG9A 1L3LA 2Z16A 1XSVA 1I1SA 3DKWA 4CIHA 4IOAF 4HNUA 2HDCA 4M71A 1S9HA 1VQ9I 4ZYEA 2H7VC 4K0DA 3I4NJ 4KMFA 3S1NJ 3C8GA 3L2CA 4UNOA 1PD0A 3HKKA 2DDBA 5CKTA 2WAQA 3ZQCA 1OPCA 1UELB 2XGEA 3CUQA 1B8IA 2K9NA 3QQAA 2LP0A 3HNIA 3H3UA 1I4ZA 1ZELA 1QPMA 2AQFA 4L0YB 1IN5A 2XLWA 2L6HA 3EFOA 4UHTA 2OD5A 5BUOA 1WZ2A 1IRZA 1YITI 2COMA 5H20A 1GM5A 4AK9A 3BTJA 1PCXA 3L1MA 1GXQA 3HXLA 4PJLA 1ZW2A 2F4IA 3DEEA 1Q0DA 2BXYA 2G0EA 3J7ZI 2G9WA 3BG9A 1JTYA 4I7HA 4QPQA 4L0ZB 2QGUA 4O6NA 3QZCA 1P9QC 2ZNZA 3O55A 4BG0A 2EZLA 1OMIA 1W0UA 2EZIA 1HKTA 4WXCA 4G0HA 3FXJA 3GVAA 3OOPA 3G1LA 1H0MA 2QEXI 1ORJA 2WVOA 2KFDA 2WC2A 1RZ4A 3QPLA 2LFFA 2HQ5A 2QQ8A 3CDIA 3IPMO 3K1MA 3NARA 2M8GX 3P9KA 3ECHA 1EV7A 3PM1A 3U3BA 2CU7A 3K0LA 2K3PA 1QZZA 1NHAA 1HKQA 4MQVA 1D8JA 5AC4A 2HGCA 3QPSA 3JSEO 2M1BA 1Z05A 5L0JA 1DGRM 4MHGA 2XLMA 4EM2A 2LY9A 2FD5A 1I5ZA 1L7CA 1HF0A 5D4SA 1OR2A 5LHHA 1N1CA 1G4WR 2Y3DA 1RKTA 4OAYA 2LD6A 3NAUA 4AD9A 3KKBA 1U0BB 1X1CA 2PEXA 3DE9A 3TD7A 1FY7A 1VQ5I 3FWEA 3KE2A 2K9MA 2EIKH 5L3EA 1NTCA 4KA4A 4A3IJ 3KYJA 3M15A 2VE9A 4E0HA 4F3QA 2EILC 1Q0MA 2H8WA 2BY1A 4YFKF 1RRJA 4BDZA 5DV5A 3FMQA 2D5VA 3AG2C 5AGFA 1FMVA 1YTYA 2B0HA 4E17A 4ESJA 3FXLA 3M79A 2LBFB 3VB2A 1UJ8A 2PFDA 4CYCA 3A1YA 3LA2A 2GOXB 2N8GA 3E6MA 3EGDA 3CJRB 4HLXA 3H3VK 3WHNA 3DM5A 2AXLA 2QNLA 2O61A 1X1DA 1R58A 5E2QA 2E19A 2VIXA 2BBYA 2EINH 3FMRA 5E1XA 1H9GA 4U5CE 2OOCA 1RKCA 1IN8A 1OLTA 4MQ9F 2R7UA 2F5EA 1S5LC 4EM1A 1IDYA 4YIFA 1JKQC 2J0WA 2XM0A 2TMVP 3MZHA 2HYJA 3VOEA 2J9BA 2QTVA 3RKOF 4JTCB 2Q00A 1KGSA 2DMPA 4LJZF 5FZTA 1QRYA 4ON0A 1UHMA 3U1DA 3DPTA 1Z1DA 2HYGD 3U21A 4Z9IA 1OCOC 4CSAA 3Q5FA 3M7GA 4JX4A 3HSFA 5HS9A 3W6JB 3MZ8A 2OBPA 3U1KA 2ACJA 2MFZA 4Y15A 3B71A 1J59A 3HTKC 4A5NA 1MDMA 1R6RA 5CJ9A 4WX9A 3RI4A 1MSEC 4A6EA 2EIKC 1HKSA 2Q2EA 2ZJQF 3QYBA 4EWCA 3ASNH 3ZMDA 1G8XA 1ETVA 3LSMA 2IGOA 2GXGA 4JOMA 4HQEA 2CUZA 1K79A 2CFOA 4D7NA 1R4NB 1BN5A 3HSEA 4LFUA 1IRGA 3E5XA 4EBKA 3EDPA 1LDJA 3SEOA 1XGSA 1T0FA 4CCJA 1BW5A 1ZHYA 3K4KA 3PSIA 4BAYA 1SD5A 2PBEA 1QU3A 4QI0A 1UHSA 2FOWA 4XLAA 3CAXA 1N75A 3K1NA 1KZHA 2KJCA 2CNWD 3GYHX 3LSKA 4BACA 1IXSB 2IJLA 3K1IA 3OS0A 3LEVA 3RFYA 5F64A 1NG7A 5F27A 2CSOA 3FHZA 2R5ZA 1UFMA 2F4MB 1JJ8C 2QM3A 3LMMA 1C17M 1J8YF 2AP3A 4YT5A 3FM3A 4CCLA 3X1OA 5EG0A 4NTBA 2HQRA 2X0LA 5E3MA 3KIOA 4MEYF 2DB4A 1A6IA 5L3QA 3Q7GA 5GTIC 1GUUA 3AQBA 4DZJA 1R7JA 2ZB9A 3NMKA 3BR3A 5D5WB 2QQBA 4AE4A 2CW0F 4NC6A 4BEHB 1FLIA 3W2WA 1A7EA 4M63A 4II2A 3SEQA 4AIHA 1WJAA 1S7ZA 2JPUA 3HJCA 3NKDA 5A6BD 2CQQA 1U8BA 2PMZA 4N4NB 5GADJ 5BOXA 3HKZN 2BVLA 4XMYA 2ZO4A 5HLGA 3JRGA 1ZHZA 4ITVA 1R23A 1OKKD 1JRAA 4YG2F 3DU5A 2VQGA 5F5FA 3KH2A 2L81A 5LRRA 4NC8A 3HOWJ 4I76A 1FAPB 3PIPF 1JTXA 3FVYA 3BR5A 3P5JA 5JHFA 4IRUA 2LF8A 4HF0A 1K6YA 3KYLA 1IZ1A 2XUBA 2OZ6A 4MVUA 4FX4A 3GM3A 4KICA 2IW5A 2HEOA 1LB2A 3ELKA 5FKOA 3VPRA 4E7LA 3ZVRA 3S3NA 1HOMA 5LHIA 3BQZA 3ZQVA 3KEQA 2W45A 3H2UA 3PSFA 2STTA 1KA8A 4EJTA 3ITFA 1JE8A 4WGYA 4DRJB 2KQ9A 3NG1A 2ADUA 1GV2A 2ZXWH 3H65A 3U8VA 2NSGA 2QUPA 4XRSA 4RB3C 2OQRA 2QKMB 2GAUA 4A2UA 1AEPA 3BROA 2ME0A 1YLFA 4X0RA 3LSPA 3I64A 1E85A 1FTZA 5BPIA 3DJNB 3Q6MA 5LLQA 4BJ5A 1M1EB 3DWWA 2IBDA 3ZXSA 4HNVA 4CS8C 2RN7A 1XMKA 3KZIC 4F93B 4MTGA 3RVZA 5KYYA 3AL0C 4EVIA 2RNJA 1MNDA 1QBJA 2HSQA 1RKEA 1GVJA 5D92A 3M8JA 1ETWA 2A1DD 1JUMA 4LOCA 1LKXA 1FBSA 1T98A 3TDZC 4AIDA 1PUFA 1FJLA 1VQ6I 3GWNA 3TGNA 5KK1A 4B3XA 1S72I 3A01A 4O79A 1GLNA 2BY0A 2VXDA 2JA7J 1B68A 4ZTJA 1NFNA 1KYWA 2PQ8A 2O7OA 4OIRF 3SZPA 2IAIA 2F5DA 3GXOA 3JAMZ 4KBLA 3TULA 1GGQA 1IJWC 3VYRB 5D8KB 2MC3A 3ZQQA 3BTLA 2JA8J 1R1UA 1DGWY 2IS6A 4XSZF 4E6KG 2ECBA 5HSWA 4HF1A 1O7LA 1XCVA 2DJNA 3HRMA 5E8IA 4WK8F 2CQNA 2YVKA 3JT1A 1XD7A 3LOCA 1HBXG 2ZPAA 5F5HA 3BG7A 4G12A 3H3ZA 1QSPA 5COGA 2F5FA 3HGGA 5GPAA 2P61A 1HE9A 3I59A 3GCMA 4C7OB 2DN0A 4BS9A 2E36A 3CO6C 5KYWB 2V1XA 2VQCA 5JHUA 4NQFA 1OW6A 2HPMA 3UMIA 3GFLA 2ZXWC 3WGIA 4P55A 3ZQ7A 5B1AH 5A6AA 3T6GB 3FXQA 1A04A 1LEBA 3DXJF 3U0CA 5JFRA 4FT8A 2YR2A 3PFYA 4N4OB 4XRFA 1T6IA 1XWJA 2NS7A 1RXQA 2F48A 4H4KC 2E1OA 2YL7A 2ZXIA 2LFBA 3H36A 3VSKA 3OYNA 3H0DA 3BPVA 4OMZA 2NVQJ 3ULQB 1HDPA 4AIJA 4EHPA 1MZBA 3IKVA 3IV5A 4A6DA 4A93J 3S8PA 3U2LA 3JCUC 3LUTB 3NKEA 2CUEA 4IPAA 2IBFA 4UVBA 5IT9K 2RQQA 2PMUA 3F22A 5JSLA 2VBYA 1K6OA 3U9GA 3GZ5A 1HMDA 2WZGA 3DTKA 5E18F 2LVSA 3IQTA 3HRUA 1EH7A 2E1NA 5EDNA 4CDAA 3SXYA 3B6AA 2EPMX 1XTAA 2KPMA 3GFMA 3N0TA 2K40A 4LGWA 2LK4A 4P9FA 1D5VA 4L5JA 2VASA 1MMSA 5E3AA 2Y0SN 5COMA 2HOSA 4JX6A 3CUQC 2ZJ2A 3TO7A 4HBLA 4QIWN 2F2EA 1SAXA 3CMYA 5KYUB 2HVSA 3CCUI 3J06A 2XAFA 2HJMA 4OAZA 3GWLA 3JRAA 3HNJA 2YX4A 3L1PA 4I01A 2K9LA 1IO2A 4GDFA 4C3EA 1XMAA 3V8LA 3S2DJ 3CF5F 3RZDJ 2FA5A 1MQVA 5HOOA 4WXDA 2FU4A 3SXKA 4W1UA 5IYDJ 1YG2A 5HDGA 2NYXA 4EATA 3BTIA 2M4GA 2HFIA 3PDMP 1YZAA 1Z6AA 3MYIA 1MBHA 2WAFA 5B1AC 1QPUA 3MFNA 1GHCA 1HXDA 1BJZA 3KL4A 3LNMB 2KRFA 1X4OA 2JUGA 2HDDA 4UB8C 5JS5A 2XS1A 1V4AA 3ZN0A 4W8KA 3JRIA 4Q4ZF 3M07A 2YWAA 3H9GA 3FX3A 3G1OA 4HPQA 2IGKA 2F5CA 1WH7A 2X1EA 4XICA 4HA8A 3OWTA 3RKYA 3W2AA 3UMKA 5J1UA 1K40A 3HB9A 2E34A 2H6BA 4BPMA 1X1BA 1RKWA 3AL0B 3E6BA 2K4BA 2H8AA 4BXXJ 2JJ7A 2R7SA 4RA2A 4PGHA 2Q8KA 1E2XA 5M5YJ 2A6EF 4QTRA 4U7BA 4IHWA 1KQ0A 3DAGA 5D6EA 4U5GA 1K4TA 3MKYB 2NVUB 2W84A 3LSIA 2V7FA 4BQAA 5GAHJ 5FD5A 4XK4A 4YEJA 2LDUA 3F21A 3WGGA 1T33A 4ER9A 1WWPA 1FP1D 2Y0SA 2BZTA 3CCSI 1G5ZA 2OKUA 1F9NA 3L7WA 5K5OA 3E1SA 3LAYA 2VH3A 3UNGC 3LJBA 1X19A 5J4VA 4YJWA 2JX0A 2PFBA 3MKLA 1W5SA 1LI7A 2DA7A 2KZVA 3H9JA 1YZCA 1LNWA 3BOQA 2L9NA 2FJ1A 4YIIA 4Y52J 1HSTA 3ZG1A 3KYDB 2WZFA 3AG4H 5L3FA 1XSDA 2XC7A 1LE4A 1IXRC 3IKTA 3G71I 2PLYA 1O3UA 5A6BA 1I50J 1LFPA 2DW4A 2Y2ZA 5L3DA 1SEUA 2ZC2A 4NNJA 4DZPA 2PJPA 4EGZA 1YRNB 3G6EI 4M6XA 4M3GA 4XBFA 3DEUA 1R1TA 2RVCA 1JHHA 1R36A 1K78A 1EI7A 4I0BA 4RM2A 3WG7H 5HODA 5EYRA 3KLNA 3RIRA 4S04A 2A3SA 5CVIA 1VK5A 4DJAA 2Q9CA 4UB6C 4AL0A 2UV1A 1ZHWA 1PV3A 2OCCH 3R2PA 3ABUA 2YRFA 3PL8A 4LG3A 3JW4A 3JRHA 1SD7A 1MH3A 5JRAA 4IHXA 3E70C 2UUZA 4BXUA 1POGA 3S14J 4YL3A 3GW2A 1XMXA 2G3VA 1VQ4I 3OYIA 1BBYA 3GZ6A 1B6AA 3FM5A 3K4BA 1FYKA 2EIMH 3LL7A 3ZGKA 1MBGA 1HC8A 3NYLA 2E5NA 3TOBA 2IS4A 4I0AA 1Y56A 4CZCA 2QA4I 4E7JA 3RYRA 1HCRA 1P7IA 4P9TA 2ZXOA 3HOUJ 3C8GB 4DIQA 3JAMK 3E97A 1MBKA 5BQTA 2VN2A 1SC7A 2ISZA 2E71A 2HR3A 3J7AY 3T0YA 4Z6YA 3F46A 3CF2A 1VQKI 1FTSA 2L6FA 3CUQB 1B8IB 2AWYA 2A05A 2HQAA 3DAFA 4RBNA 3BJOA 3QVZA 3P9CA 2IT0A 1B9MA 1Q1HA 2L01A 5BQGA 1EJ9A 1OJLA 3EFOB 2EH3A 2P7CB 2W4MA 3AG4C 2Z3YA 5JR3A 3DE8A 3LNQA 3NMIA 1Z0XA 9ANTA 4NDLA 4IVNA 2W25A 4M3BA 2XLOA 2BW3A 4MW3A 4IKFA 1DOVA 1T0FC 2C6YA 3C2HA 4ZZDA 2IPQX 5ICCA 2JRMA 5E17F 2L6GA 4PSXA 4I98B 1UMQA 1QZEA 4YFNF 3M4CA 1E17A 4L9TA 3MZYA 2JZYA 256BA 3K1IC 4BKXA 3RQFA 4HFFB 2DTRA 2QQ9A 2Z99A 5TJJA 3KZZA 1DU0A 2OCCC 1IZMA 4CBEA 3S3MA 1YJNI 2X1CA 1RNLA 5DCFA 4JJGA 2A0UA 4YWQA 1L3PA 1ONVA 3I54A 4ZYDA 3G4ZA 4LG0A 2ZBKA 3QW1A 1ETKA 1WQ2A 2FUG2 2OA4A 3H92A 2A68F 3OR2C 1OCRC 2EIJC 3GFIA 3K70D 2OC6A 1JJ6C 2EIMC 5B1BH 4RDUA 1A7VA 3T4RA 2M8EA 1MMGA 1IDZA 4KNWA 3HM5A 1F1ZA 2ID6A 4JYKA 2JMWA 4V2FA 5DDGA 2HV6A 2V9VA 4PUSA 4XIDA 2KK1A 1ZN2A 2C03A 1RIOH 2OU2A 5KCMA 3Q9SA 3Q6NA 4II3A 2ZMEA 3TJ5A 4LERA 2NUTA 1RMVA 2QWWA 1NG6A 4MGRA 4FETA 3IRRA 4A2NB 3ABMH 1SMTA 4JBAA 2JTVA 1BOAA 2W7NA 1Y8RB 1S3JA 3R7CA 2BE5F 1T38A 4IL6C 3LESA 4LDKA 4UV9A 1QLEC 3M1CA 2FOKA 1XGOA 3COAC 4OIPF 3SZTA 4Y13A 4O6JA 1T6UA 3RIPA 5F6FA 5E3NA 2J8WA 4IQJA 1WATA 2CH0A 4FE7A 4UV8A 5K1YA 4M6YA 1QKRA 2DOFA 4DYRA 3DLLF 4CS7A 5J3LA 5CVVA 4JQFA 5CQGA 2IA2A 1TWFJ 2EFPA 4M3FA 2GA1A 3WE2A 1OKRA 3OSFA 3G50A 2DODA 1DP3A 2XAJA 3B0UX 4CYCB 3ZWIA 1Z91A 5DQZA 4BQNA 1AKHA 4C3JJ 4YELA 2JT1A 3V42A 1I6HJ 4XRMA 4FESA 3KP5A 3V8JA 2PNOA 1YS6A 4S0HB 4BJ5C 1T6SA 5M3FJ 4PR9A 2K4JA 2WAQN 1ORYA 2ZJRF 3S84A 3DP7A 4L5EA 4EBJA 3HOSA 2M7AA 3WGHA 3QTHA 4DXWA 4ENNA 2UXNA 1O87A 3B0VC 5B1BC 1M6TA 4RAYA 2FGYA 5HS8A 4ZH4F 3I55I 5EK0A 3GUDA 3N05A 1VB5A 1YX5A 2IXSA 1Y39A 1MKMA 5ED4A 3OYLA 1J9IA 3EG9A 1T95A 2HI3A 4N4WA 4GYGA 5L3CA 3VM6A 2EPOA 3TDUC 1F36A 4G6QA 2ME6A 1WH5A 2HFHA 4F91B 5D4RA 1P4AA 2XKPA 1UCRA 2EQRA 4EMSA 3MD2A 2CV2A 1Q0KA 3RH3A 3DV8A 4E7SA 4IRIA 1MDMB 1FC3A 1Y1VJ 4BYYA 4L5IA 2UZKA 2YLIA 3AJMA 2Q2EB 2HXOA 2QENA 1I1GA 1WI9A 2K27A 3U2RA 3ZP5A 1ETXA 4P96A 2EPNA 3IH4A 5D8LB 3OYHA 1SFXA 1LI5A 1X3ZB 2CRGA 1Y0UA 2MD0A 2WV0A 3MLGA 1HY5A 3BG5A 3G2BA 2R03A 1T5OA 1W5TA 3R6SA 2B9SA 4UVCA 1HLVA 5DM7F 3IWZA 2FX0A 3TW7A 4DGWB 1D3YA 3RJPA 2RGVA 2LY1A 1PJRA 1TP4A 1RUNA 3QVYA 3AFHA 1VMAA 1L0OC 2B0JA 4IZZA 1FBQA 2MH2A 4U5FE 3LS0A 1F43A 2QE9A 2WVNA 1Z6TA 4ZLDA 1R1VA 1R5GA 3HOYJ 4M72A 2ZCWA 1FEXA 1X1AA 1G3TA 4LLCA 3NYJA 5L3VA 2VT2A 4N06A 4N0BA 3AGUA 1UHWA 2R5ZB 4UY8I 2QUFA 3UMHA 3WAQA 2VKDA 4MTEA 4B1RA 2XL6A 3QOPA 2R5YA 4F4BA 4MFEA 4RB0A 5HNFA 3J81K 3MKZA 1A5JA 1NLXA 3HPHA 1LJ9A 2KP6A 2VBZA 5EG0B 1UG0A 1C02A 1OCZH 1RJ9A 2JPBA 5HDKA 2YL0A 4LDQA 4J19A 2HOAA 3M3YJ 3BLYA 2J46A 5TGTA 2DMQA 2COBA 2VBXA 3BCBA 3LSJA 3JRDA 2ZJPF 2J0XA 4LK1F 4AE4B 1G2HA 3RZOJ 4CCKA 4BJ1A 3E0JB 3HHHA 3ISPA 4GYIA 2WZLA 2HMQA 1EH8A 3JYHA 1SR2A 3HL2A 4ZC3A 1X3WB 2O9LA 4HZFA 3S1QJ 3K66A 2DQLA 3OIQA 3R0AA 1N77A 3MCZA 1I39A 3IHUA 4CCMA 3JSPA 1A36A 1HE1A 4MEXF 4KYWA 3FXRA 4U0YA 1WGWA 2EV6A 4AL1A 4PJNA 5JLWA 3WTWC 1D5YA 1BL0A 2XHKA 3ZQFA 1YYJA 2L7ZA 3BZKA 4AX2A 3GF2A 3GTJJ 3Q7LA 1TTYA 3C7JA 1EQ1A 5T3WA 1EH6A 3GTMJ 2I15A 2PX0A 1AHDP 4N6CA 3T8TA 4HQMA 3MVPA 1BZ4A 3DKAA 2ZXHA 3CLOA 3K4MA 1HSJA 5DUKA 3ZSUA 1ULYA 2XB5A 2YPRA 3S93A 4Q47A 4FASD 3GTGJ 1JPJA 1MBEA 5LEKA 5FB2A 1GV5A 1HW5A 1W7PA 5EEAA 1GT0C 1XX5A 4RAGA 1TW2A 1AVOB 1FX7A 4M73A 3S3OA 2DT6A 5L0HA 4XWJA 1IUYA 3KP6A 3TEDA 1Z6RA 3H9QA 1FIAA 3IQ6A 5KYXA 3BR6A 5J4YA 2EFWA 3C1DA 2R0QC 1Z23A 3L2VA 1JOGA 4A4AA 3EJNA 3GEHA 1V54H 3FMSA 4RS8A 5IYCJ 3HOZJ 2KJGA 4OU0A 4MVQA 4DJ9A 4FCYA 5KYYB 4KITB 2HPIA 1MH4A 4RGSA 3VSLA 4Y7NJ 4G9YA 1V4RA 1RPWA 2R25A 2WVQA 3IQCA 3SXMA 1RKEB 2WBMA 1PUFB 1NU7D 4AIKA 3FZVA 4CSWA 3QPHA 1SVMA 3LA7A 3A01B 2DA1A 1IN6A 2ISYA 3FHDA 1KONA 4RLFA 4G7ZF 4IHYA 4I3MA 2YU3A 2A6TA 2J7PD 3RQIA 1XCBA 3GODA 3KETA 4S05A 1XPXA 2X9DA 1J8MF 4PJJA 1Z3IX 5DUIA 3F8BA 3NYMA 1LDKB 1QGPA 3FKIJ 3DPLC 3A11A 2HS5A 4XN3A 2DFEA 2EA2A 2CV1A 4U0VA 3Q3SA 3GTPJ 3IC7A 2FE3A 4CYDA 4KNVA 4P5OA 2K7LA 3PQJA 3S9OA 4EKWA 4O5VA 5E3OA 2M4EA 3HDDA 4G78A 3VYUB 1FMWA 2Q0OA 2QY9A 3I59B 1ACIA 4CGZA 4L9VA 4JC7A 3RPUA 4O6YA 2YLGA 3RQ4A 4F55A 2EWNA 3BDDA 5IOYA 3ZTZA 2WY7Q 1FOXA 1QNTA 3V7CA 3EH2A 5J1YA 4DOZA 1SAUA 2QLZA 4V2GA 4EV0A 1K4SA 1SFUA 2IS1A 1SFKA 1WPKA 2PMZN 3G1MA 4HX8A 1NK3P 2ZFUA 5IY5H 1SFOJ 1VTMP 1NH3A 3ZQLA 3LQRA 1NU9C 2AQEA 2F22A 3MN2A 1ZR2A 3ZQIA 4KISA 4ZYHA 5E8GA 3OIOA 1DU6A 3RQEA 3F23A 4RMNA 5M5XJ 3FAJA 3VRCA 2H8RA 4P1WA 2L3DA 1DP7P 3U5SA 3BJAA 4G7HF 5T1DB 3R61A 1E3PA 3FDYA 2OTLI 2FMYA 3EUHA 3PO3J 2DOAA 1JXSA 2BOLA 1M57C 1KU3A 4R79A 3WTTC 4AU7A 4MNDA 3M8EA 3CJQB 1HQCA 2XPUA 2IYLD 1ZARA 1LS4A 2YKZA 2HXIA 3DF8A 5FROA 4JCZA 5H6QA 4CZZA 4BY1J 2CFXA 3F3XA 4IEJA 3WHCA 2IXMA 2NG1A 4NQWA 4DBRA 3FIWA 1WVRA 1CPRA 2CCYA 2EINC 4YN0B 4HLYA 1S6LA 4HDVA 1CF7A 2XPVA 2R7XA 4ULVA 1OYYA 3BCAA 4U9EA 3U8PA 5A2QK 3J80K 4C30A 2DA2A 3KFWX 2BVMA 3VAYA 3DU6A 1JGSA 1UG2A 2H1KA 2Y3HA 3AOUA 1T08B 2EBIA 3WU0A 3L0IA 3S27A 3I56I 2VCBA 2OPTA 3LLIA 5K7FA 1WRJA 4CJGA 3MFKA 1PUEE 3CDLA 5TISC 2YU9J 2LSOA 3U9JA 2KQRA 2DYSH 4MTFA 5IY5C 2V4JC 2L9SA 2FEZA 3O8HA 5LBQA 2I8DA 2MA3A 3HOVJ 1NBBA 4RD9A 2Y9ZA 2DLLA 1MBJA 2KDOA 2DXIA 3IRQA 3ASNC 3RW0A 1YX3A 2H6CA 2ZD9A 3V5ZA 3WHBA 1YDIA 4UUVA 1ZHTA 3SXZA 1OXBA 4ESFA 3QP6A 2IXNA 4XOTA 4I2OA 4FX0A 2OJQA 5LHGA 4ANJA 3SQNA 5HDNA 1YAUO 3RDIA 2ZMEC 1W0TA 3HTSB 2FQ4A 4A3BJ 1JI8A 4D1QA 3RF3A 2QSGX 5D6FA 2DJIA 3A0HC 4BE0A 3F9KA 2XAQA 3K4JA 2KISA 3AQCA 2WV1A 3GLXA 5T3TA 1P4XA 2VQHA 4WF2A 3E6DA 4CCNA 4LIVA 2NUPA 2K9SA 3I3LA 5CI8A 1LFUP 2MABA 1VZ0A 4JKVA 2D45A 1R9TJ 4MIMA 2AVKA 1JPNA 4WCGA 5DM6F 4KI2A 3L09A 1LFBA 4RAFA 4GEHA 3PUBA 2MW8A 3R4KA 4XPXA 5IPAA 2XXAA 1OISA 5KVRA 4KT6A 3L9FA 1YQAA 3V5XA 2M30A 1K05A 2MWQA 3NRVA 1KQ8A 2A6HF 3TJ6A 1MNMC 5B3SH 1T2KA 4ENKA 4B4CA 3RKWA 1TBXA 1FYMA 3G4XA 2E2JJ 4M9XA 4JW1A 1ZR4A 1BI1A 1TT5B 1K78B 3E6CC 4GQHA 3WTUC 2LC2A 1VYKA 1R4MB 4OOIA 4I09A 1G59A 1WTYA 4U0WA 1ON1A 5DD8A 1M2VA 2LYCA 1FSEA 3WTSC 2DO7A 2CGEA 2YZSA 2KJBA 1P6RA 4XTKA 2GIVA 5COFA 1K7AA 3I0TA 2E87A 2A69F 4LMYA 4U88A 2DYRH 5LRSA 1X2NA 3H1CA 4HDUA 4DBQA 1QHHD 4YT4A 4R1HA 3ASOH 3SZRA 5LEJA 3S29A 2W00A 2Q3TA 1RC9A 2VJ5A 2GDCA 2KLOA 4AWXB 2G3KA 2LSEA 4N9HA 2Z2SB 2EV0A 3L2RA 4JCHA 1SFEA 4IXAA 3KPHA 1WJBA 1YLMA 1T9KA 1PD1A 3T6BA 1XSXA 2IEKA 3KP7A 5J1RA 3HTUA 3CC4I 2P4WA 3JCUQ 3FXHA 2KNHA 1OR7C 2GLOA 2GA0A 2L4AA 1IF1A 4ZZLA 3KP3A 3E7LA 4CH7A 2JSPA 1TWCJ 3IH2A 4IJJA 4E70A 3O3KA 5L0CA 1MW7A 3CJNA 3K7AJ 3VEPA 3I5QA 1Y6DA 3FISA 5ICEA 2R7RA 3CCLI 4E0IA 2GWWA 5L0DA 2KRCA 2BW3B 1FZPB 2X6OA 2XRHA 5B3SC 1MJAA 5HLTA 5BNGA 2VCCA 3IUOA 4FWVA 1J75A 2MD5A 4N6HA 2HJ3A 5F0FA 5FLVA 1DPRA 3LAJA 4A3LJ 1DQUA 1UFBA 3ABKH 2M0MA 2J7PA 3W6VA 4FQGA 1YHQI 3CEXA 3U9MA 1F1MA 1YE9A 4A12A 2Y0MA 3CLQA 4CX9A 5CIVA 4XSXF 4J7TA 3ABTA 1ENHA 4LLNA 4M9ZA 3W8IA 2DK5A 4JTDB 1NSGB 1JGGA 2DYRC 3HNKA 1PP8F 5JUAA 4XLNF 2O8XA 5M3MJ 1WJ5A 4LG0B 5FKKA 3ASOC 1DOWA 1YS7A 4FTHA 2W4BA 3KZYA 3DBRB 1TNSA 2VC0A 5FFZA 3V7RA 4JE9A 2P6SA 2GXAA 3VYSB 1U9OA 1RR7A 2K02A 4BE2A 4NB5A 1HDDC 4B47A 2VUMJ 1Z3XA 3J7AO 3NWTA 2DCEA 3LFKA 3ZQHA 2Q9BA 2A5WA 3LSRA 3HIFA 4EJOA 3MYFA 4HRIA 4MTDA 3DTIA 2ZNYA 3V5YA 4U5EE 3C62A 2ZMEB 4MFDA 2NUTB 4XN0A 3LSTA 3C3WA 3H35A 1FSHA 2PBIA 1C03A 2V79A 3ABLH 3OS1A 2O6GE 3S1MJ 1O5HA 3I58A 4KNYA 3FAPB 2ETHA 2VCAA 2DU9A 3CP2A 2CW8A 5KAIC 1AWCA 3M1CB 2L7FP 4EJWA 3OR1C 4JURI 2OUMA 2XV4S 2XAGA 1KU7A 2LOOA 3ECOA 5LD2C 2J9WA 3DKYA 2L9JA 3IL2A 1VQOI 3DZAA 3BJ6A 4XQFA 3LQQA 4AYBA 3CC2I 1VYIA 1U3EM 1TWCA 2NOGA 3ABKC 4A3DJ 3CP8A 1WN0A 3SZGA 2CJJA 4XOPA 2X48A 1OFCX 1EA3A 2JRTA 3HC7A 4NBQA 3JRFA 1AKHB 2CNWA 2ETSA 3ROUA 2PG4A 1OCCH 3PJRA 2LP4A 1YYVA 4GFBA 2HKXA 1R49A 2UUHA 4XLHA 2KIQA 2WADA 1HA8A 3ZIBA 2V26A 3RVYA 4BGDA 1BI3A 4DYCA 4EGYA 3FHNA 5EZHA 1WHUA 2O8KA 3I4UA 5E79C 2VOOA 2E7WA 3ZTMA 4IQ4A 1ZLKA 1WJEA 2R05A 3K1PA 3S15J 1VOMA 1ZGAA 2XAUA 3GO5A 4BBRJ 1BA5A 1TKNA 1B4AA 3SYTA 2XLDA 2P6TA 2TRTA 5D5UB 4V19K 1LUJB 5JVTA 1JT0A 4UUSA 3EG9B 3ZC4A 3CCVI 3R60A 1X4PA 3V4GA 4XRSG 4AVZA 2XDVA 2JQ7A 4MLOA 4OIQF 3ABLC 2P7VA 1BI0A 2VL8A 4HSTA 1OKKA 4DW6A 5GPCA 2V6CA 3HRSA 3WU2C 2R7WA 4BE1A 2O5RA 2XIGA 2VODA 3FXOA 1ITYA 2E2IJ 4XONA 3K2ZA 1ZRDA 2VOPA 2EV5A 2R4GA 5F0HA 3EPZA 5FGMA 5IP6A 2ECCA 3K70C 3GEZA 2Y39A 1WWXA 3C8ZA 2HZDA 1YW8A 1QO0D 4RB1A 4HEA2 3I4PA 4JEBA 3ZMSA 4LLEA 3IP4B 5EGYA 2TDXA 3EPVA 1VF9A 4F92B 2DA6A 2ESNA 3A02A 4LB6B 3IEEA 2XSEA 3DBHB 4KIFA 1YIOA 1ZZPA 3NQOA 3Q9VA 5TJ5E 5F1JA 1ETYA 1QHGA 2BY2A 4BY7J 2CMPA 2D1VA 3A03A 2W24A 5FLXZ 2XL4A 2EZHA 5KYNA 2GOMA 1S05A 3MX3A 4K2EA 4KIGA 2K86A 1Z9CA 3F72A 4XEFA 2YL3A 5BQHA 5ILSA 4B43A 1VQ8I 3VDXA 1WGXA 2XROA 4ULWA 2O3FA 2LLKA 5D5VB 2JA6J 2R5YB 1Z5ZA 5AC5A 2FNAA 2O0YA 1VFCA 2R92J 2E5ZA 1W4MA 2JD3A 4C3DA 1RJ9B 2K85A 3GEIA 3PQKA 3TP3A 1BOBA 2K5CA 3NWSA 3V7OA 1IRFA 1OW7A 4J7YA 3QYEA 3FBIB 3S32A 3ZRGA 1FTTA 4BDYA 3EUHC 5HNHA 4D0PA 3QW0A 4D5CA 2DT7B 3Q0WA 2QBYA 4G6DA 4ZDOA 2QF7A 3DFGA 3EGXA 1XGMA 4O3MA 5C3EJ 4EM0B 1YO5C 4R8HA 2VJIA 2R02A 4YL1A 4NHJA 1ETQA 4RBOA 1YJWI 3F0CA 4RGXA 1I27A 4ENMA 4Z2YA 3BTCA 4HX4A 4H0EA 3AG3H 2P0NA 3WG7C 4CSAC 3NDBB 4D5FA 3WTVC 3OYJA 3WTZA 3HOTA 1Q1VA 3JR9A 4KFCA 1LE8A 2XL8A 1TWHJ 1WOLA 4QI2A 4LIUA 3S17J 4FE4A 2ID3A 2BC5A 4IAOA 2TCTA 4IOCF 4MNUA 4JTAB 2KGOA 3TQOA 3OMYA 2J9UA 2FBKA 2BY3A 2OEXA 4CCOA 4BUPA 3WU1B 3GTOJ 2JUCA 1ZRFA 3KMIA 3HPGA 1FNNA 4KT5C 4E7IA 2V9KA 1LS1A 1EA8A 1W7PB 1YA9A 3AAFA 2HUJA 4XPWA 5E33A 3D5RC 2XGCA 1IV6A 1ZKGA 3FXKA 2DT5A 1VI0A 3LFUA 2PMHA 4GCVA 4PZJA 1X1PA 3CMAI 5H2FC 4LD5A 2KSFA 4ONSA 5HS7A 2VI6A 4IO9F 3HZJA 3RTRA 3KX2A 5KYXB 5ICGA 2PX3A 4E7HA 2EJRA 2VB6A 3DEWA 1JT6A 3TL4X 4BJTA 3K4LA 1G4US 3HUGA 1VTNC 3DKXA 2NNNA 3UKGA 5IP7J 1SMYF 3JRTA 3QU3A 1QQ3A 3IQ5A 1ZW3A 2M64A 3W8HA 3REOA 1B72A 2IXPA 2G7UA 3S1RJ 4ZTFA 4NC7A 3OY9A 3SFZA 2ZXRA 1ZG3A 4BJ6A 1X3UA 1XGNA 1M2OA 2R7QA 2WB7A 1LPEA 3QPTA 2BL2A 5D91A 4I99C 4JX5A 3X2QH 4IJAA 3AKZA 1KU9A 4BH9A 3AG3C 4Q48A 3G4SI 4LACB 2MGQA 3E9VA 1QVUA 3OEOA 3CTAA 5EZGA 4GO1A 1S7AA 2HOTA 3CUOA 2LKXA 1PYVA 5K0IA 3J7YJ 1CGPA 1YOVB 4F7ZA 1YFHA 5FO5A 3W6KB 4WJ0A 4I6ZA 4I1MA 5FCLA 1I6XA 3HGYA 3A0BC 3SHFA 5DS5A 2R93J 5JP7A 3O2PE 2HTSA 2DAOA 3M9AA 2W48A 5C44J 1TT0A 3CO7C 4OD5A 2CUFA 2L54A 3DWLE 3ESWB 3TO6A 1YJ9I 4MW8A 3FKJA 5KAFC 1TWHA 4RM3A 2X6YA 1NFOA 3SDGA 1CPQA 3W4YA 1Z7Qc 3JTGA 3BWGA 3VWBA 4HV5A 2AU5A 4ZJZA 1E86A 1FP2A 3ATPA 4B8XA 1A7DA 1RI7A 2F4OB 2DPUA 1FOYA 1D8KA 4MTOA 2YQYA 3ABMC 3SDBA 4IF4A 1KNYA 3OYKA 3H5AA 1ORKA 3QWLA 2GM4A 4LITA 2C04A 3K33A 3KYCB 4U5HA 3LS1A 1OQCA 2P5KA 2Q4FA 1RCPA 1UG7A 1R5ID 5FKLA 1OR7A 2GIZA 2R3SA 1QZXA 1QZYA 4D7MA 1Z3YA 3PNTA 3OL4A 5B66C 1CGOA 1O3TA 2Q9AA 4LDRA 4LK0F 1GVDA 2LY2A 4M3EA 1FBUA 1KU2A 3X2QC 1TC3C 4RGRA 1JUSA 1VNDA 2VBWA 2RREA 5DYMA 2VT3A 4IWBA 4D4NA 2ZSIB 1H7IA 4HNTA 1MBFA 1VLSA 1UB9A 2Z5UA 2VKEA 1C0WA 1ZHFA 5GP9A 4A3EJ 1RR8C 2FQ3A 1U89A 4W8PA 2H7BA 3OYFA 1OR3A 2YEVA 5BS6A 4NQWB 3FOPA 3OL3A 2QSFX 3PIOF 1SYQA 4PJMA 2EZKA 2H27A 3BP8A 2KYHA 2LKSA 2DA4A 3LSGA 2KIUA 1CF7B 4IHSA 1YARO 3HNLA 4EBBA 2Y31A 1TW3A 5E1WA 3RCOA 3T1BA 3OYAA 2E60A 2P1AA 2KC3A 2ZFWA 1VQPI 4ZYAA 1IG7A 3I71A 5BPDA 1BC7C 1GDTA 4C2UA 1V5FA 3BG6A 2A61A 3DI5A 1I3QJ 2DFFA 1ZU5A 4NCQA 4Q5SF 4EIYA 1R22A 3K4NA 4PJ0C 4A3KJ 2V6EA 3SP1A 2LR8A 3C2BA
chains in the Genus database with same CATH topology
3BCAA 2VASA 5E3AA 3QYFA 1Y6IA 2KRHA 4XKVA 4C30A 3OYDA 1V5GA 2BVMA 3VAYA 2HVSA 4B6IA 2JA2A 3DU6A 3L2QA 2Y3HA 4ZLCA 2F5VA 2WAEA 4OAZA 4PSWA 3S27A 3L0IA 5KNLA 2WL8A 2K9LA 4C3EA 3LLIA 3IAM2 4ZDLA 2R7VA 1D0XA 3EZHA 2KQRA 2VQLA 5HOOA 5IY5C 2W4SA 2V4JC 2L9SA 2P0WA 4HFKB 2XF6A 3IAS2 4XLCA 4EATA 2M4GA 1UAAA 2R7OA 3L2WA 1WJFA 2I8DA 1Z6AA 5KYUA 4RD9A 2DXIA 2KDOA 3ASNC 2WAFA 3DJUB 5B1AC 1YX3A 4XR6A 2NUPB 5DLJA 3KL4A 1X4OA 2JUGA 4FX5A 4HE8D 3OS2A 1Z7LA 1ZHTA 1W36D 2IXNA 4XNFA 4XOTA 4J00A 4W8KA 4ANJA 4Q4ZF 1MMAA 3D5SC 3RSNA 2M4KA 2XXAB 1JI8A 3RPUD 3QMKA 3H9GA 4HPQA 4D1QA 2CDQA 2IGKA 2DJIA 2X1EA 4BE0A 3F9KA 2WB1A 3K4JA 3OWTA 3W2AA 1OCZC 3ONQA 4U87A 3AQCA 3UMKA 5T3TA 1W2WA 2VQHA 1IW7F 4CCNA 4LIVA 2PP4A 1X1BA 1FFHA 3AL0B 2NUPA 3I3LA 4I44A 5CI8A 2MABA 1VZ0A 2R7SA 2X6XA 4J30B 3UGPA 2KL4A 4B44A 2A6EF 4U7BA 1JPNA 5LFAA 3CSKA 3DAGA 4U5GA 4KI2A 3MKYB 3VYTB 3LSIA 2WA0A 1M2VB 4GEHA 2V7FA 3PUBA 4P6IC 2HDWA 3VYWA 1Z63A 2XXAA 3W3CA 2KW3C 3CQZA 2W1OA 2XF5A 4KT6A 4YEJA 2MWQA 2Y0SA 1MMNA 4Q7CA 2Q1ZB 4CS8A 1ERDA 2A6HF 3LAYA 3E1SA 4BU2A 2VH3A 3UNGC 3LJBA 1X19A 1J09A 2KMUA 3MMYB 2LG4A 4E7ZA 4JW1A 1D1BA 3T6JA 4YJWA 4BEJA 4CS9C 2J9VA 3EGDB 2LC2A 1VYKA 2KZVA 3H9JA 1G59A 1BR2A 1TZLA 3OYGA 4E7KA 2ZXPA 1M2VA 2L9NA 2LYCA 3OYBA 3ZG1A 2WZFA 2CGEA 1ZYRF 2KHMA 2XC7A 2YZSA 3LSHA 4XTKA 3S28A 1LFPA 2F6CA 3OOUA 2E87A 4NNJA 2A69F 3EHNA 2W82A 2PJRB 4HEAJ 3UR3C 4DBQA 1QHHD 4KJZA 2CV0A 4YT4A 3SZRA 3EUAA 4XM3A 4OIOF 3S29A 2W00A 4RM2A 2Q3TA 2VJ5A 2VJJA 2Y3BA 2KLOA 2M7BA 3I9V2 1TR2A 2LH9A 1VK5A 2G3KA 2LSEA 4DJAA 2OV7A 1V54C 2Z2SB 2Q9CA 3L2RA 1W36C 1Z21A 2UV1A 1ZHWA 2HU9A 4JCHA 2MYSA 1V55C 2RNGA 2P6VA 1WJBA 3PL8A 3QOEA 4LG3A 2Y3GA 4YT2A 2IGMA 4KC9A 3BC8A 2PJRA 1PD1A 2PF4E 3K6BA 3T6BA 3E70C 4J32B 2LRDA 2UUZA 3AG1C 4ZDPA 4Y3OA 3C2GA 3JCUQ 2KNHA 3K6GA 2ELJA 1OR7C 2G3VA 2LREA 4X0GA 2QKLB 3OYIA 1ST6A 3FBNB 3K4BA 4CH7A 2JSPA 3LL7A 1TWAA 3ZGKA 2G62A 2DGJA 2HV7A 1MW7A 2E5NA 1SZIA 2IOQA 2IS4A 3NYLA 1D1AA 1WJCA 1Y56A 4CZCA 4E7JA 1NG1A 3I5QA 5DS4A 3CZ6A 2ZXOA 4CSAC 2R7RA 3SEZA 4DIQA 1AA7A 2KRCA 2BW3B 4PK4A 2XRHA 5B3SC 3J7AY 2VKHA 5HLTA 4HSRA 3CF2A 4E4HA 1FTSA 3IUOA 3F46A 4NUBA 4FWVA 3PHF2 4G7OF 2HQAA 2X6WA 3DAFA 4RBNA 1DQUA 2UWMA 2M0MA 3HG9A 2J7PA 3LLKA 2Z16A 4XLEA 4QDLA 1YE9A 3HLZA 4CIHA 3EFOB 4HNUA 2W4MA 1S9HA 3AG4C 4K0DA 3DTEA 3K1HA 3W8IA 1PD0A 2BW3A 4IKFA 2DYRC 3H5NA 1T0FC 3C2HA 4XLNF 5CKTA 2WAQA 3GANA 4YT8A 1UELB 4XLPF 1WJ5A 3CESA 4PSXA 4C2TA 3ASOC 3LNRA 1ZELA 2W4BA 2AQFA 1MNEA 2I8BA 3K1IC 4IX7A 3I5PA 4HFFB 3VYSB 4BE2A 3EFOA 3H5RA 4B47A 1Z3XA 5BUOA 3NWTA 2DCEA 2OCCC 2Q9BA 2A5WA 1PCXA 4AK9A 1IZMA 3HXLA 4CBEA 4PJLA 3S3MA 4HRIA 2X1CA 2F4IA 3DTIA 3SYNA 4U5EE 4JJGA 3DEEA 4YWQA 2NUTB 4XN0A 3H35A 1O5HA 2V3CC 3OS1A 4QPQA 2FUG2 3OR2C 2A68F 1OCRC 2EIJC 4O6NA 3PMRA 3K70D 3S0XA 2OC6A 2EIMC 1P9QC 2CW8A 3CP2A 2FFHA 3QZCA 3T4RA 1MMGA 3M1CB 4KNWA 2HV6A 4PUSA 3OR1C 2CS3A 2V1NA 2OUMA 5CPRB 2C03A 4JURI 4G0HA 2LOOA 5LD2C 5KCMA 2J9WA 3Q6NA 5DVWA 3DKYA 4II3A 3PNYA 4GYTA 2CW7A 2L9JA 4LERA 2NUTA 2WVOA 1NG6A 3DZAA 4FETA 4A2NB 4XQFA 4AYBA 1VYIA 1TWCA 3ABKC 2W7NA 2BE5F 3LESA 3CP8A 3SZGA 4K7BA 4XOPA 1QLEC 4I1OB 3M1CA 3FDQA 3HC7A 1EA3A 2IGNA 2K3PA 4OIPF 2CNWA 4RLQA 3ZCOA 3RIPA 3PJRA 3DD7A 4IQJA 4BJ6C 1DGRM 2CH0A 4XLHA 2WADA 3PNVA 1HA8A 3ZIBA 2V26A 4NY3A 2JVHA 4CS7A 4BGDA 2VLAA 3FHNA 3GBGA 4JQFA 3I4UA 4OINF 5CQGA 4O6MA 2XF7A 4IQ4A 1N1CA 1WJEA 2ZSHB 4OAYA 2Y3DA 3KKBA 2HVQA 1DP3A 1X1CA 1VOMA 3OA1A 3B0UX 3TD7A 3K10A 2CUJA 1FFTC 2XAUA 1TKNA 2K9MA 5DQZA 5DQTA 4BQNA 3SYTA 2DYSC 4YELA 2H7OA 4CS9A 3V42A 4B48A 4FESA 2Y69C 4F3QA 2EILC 3EG9B 3ZC4A 2R7TA 1X4PA 4BDZA 1D0YA 4AVZA 4BJ5C 2XDVA 2X51A 3AG2C 4MLOA 1FMVA 4OIQF 3ABLC 4QPOA 2P7VA 2VL8A 4HSTA 3HOSA 2M7AA 2LBFB 1OKKA 2R7WA 4BE1A 2O5RA 4G6TB 3A1YA 1O87A 2PFDA 5B1BC 3B0VC 2GOXB 2FGYA 4XONA 3W2VA 4CUGA 3EGDA 3CJRB 1TWGA 2R4GA 3N05A 3EPZA 1YX5A 4J01A 2IXSA 3K70C 3OYLA 2Y39A 3EG9A 3DM5A 1T95A 1WJDA 2HZDA 1X1DA 5E2QA 4HEA2 4LLEA 2VIXA 3IP4B 5EGYA 4F91B 1D1CA 3HKZA 3EPVA 4F92B 2CV2A 3MD2A 3RH3A 4U5CE 3IEEA 4U5DE 4E7SA 2LBFA 2R7UA 1OLTA 2XSEA 4MQ9F 2J0WA 3OIPA 5DS6A 2QTVA 3RKOF 2J45A 1QHGA 2Q2EB 2CMPA 2XL4A 5KYNA 4C9YA 2GOMA 4DVZA 3MX3A 3OYHA 5FRNA 4B43A 2MD0A 3MLGA 3DPTA 3G2BA 3VDXA 3U21A 1OCOC 4CSAA 4Y4RA 4ULWA 4DVYP 2GFHA 3HTKC 4BG0A 2MFZA 3A4CA 1Z5ZA 3EGXB 4DGWB 4GRIA 1R6RA 4XKCA 3EZIA 2LY1A 1PJRA 2E5ZA 3AFHA 1VMAA 2EIKC 2B0JA 4IZZA 1RJ9B 2JD3A 4U5FE 4C3DA 3LS0A 1BOBA 3QYBA 2K5CA 2WVNA 3NWSA 3V7OA 2JVGA 4EWCA 1G8XA 4ZLDA 5L3VA 1X1AA 4LLCA 3NYJA 4N06A 3LSMA 2IGOA 3FBIB 3QYEA 3S32A 3ZRGA 4JOMA 3MKWB 4BDYA 2CUZA 3EUHC 5HNHA 2CFOA 3UMHA 2DT7B 2VKDA 4ZDOA 3UGOA 5CQEA 3EGXA 4F4BA 2L7KA 4U5BE 4IWBA 5HNFA 3SEOA 4CCJA 3MKZA 2VJIA 3HPHA 2KP6A 1ZHYA 3K4KA 3PSIA 4XKBA 3B0PA 3NRHA 1UG0A 1QU3A 4QI0A 1RJ9A 4OWRB 4XLAA 1N75A 3WG7C 3NDBB 2CNWD 3BLYA 3OYJA 3LSKA 4BACA 5TGTA 3OYCA 3BCBA 2D5RB 2J0XA 3HOTA 3OS0A 2J46A 3LEVA 3RFYA 4AE4B 4BJ1A 4CCKA 1NG7A 3E0JB 4QI2A 4LIUA 2WZLA 1D0ZA 3JYHA 3HL2A 4ZC3A 4IAOA 3LMMA 2IXOA 2Z1DA 1J8YF 3N24A 4YT5A 4CCLA 2E1MC 4BL0B 2KGOA 4HG2A 3X1OA 3OMYA 2J9UA 3QODA 3K66A 3WODF 1V5EA 4CCOA 4BUPA 1WFXA 3OIQA 3HUGB 1N77A 2MC4A 3KMIA 5L3QA 3Q7GA 4CCMA 3HPGA 3AQBA 4E7IA 1LS1A 2V9KA 4JJFA 4JVSA 4O7GA 4YN0B 4C3BA 4AE4A 1WGWA 2VJ4A 5E33A 3D5RC 2CW0F 4BEHB 4PJNA 3W2WA 3OYMA 3LFUA 4II2A 3SEQA 1N78A 1WJAA 2IS2A 1S7ZA 3HJCA 3NKDA 4AX2A 2WY8Q 4IJJA 4M63A 2PMZA 4N4NB 3Q7LA 2BVLA 4XMYA 3RTRA 3F47A 3KX2A 5KYXB 1ZHZA 1IRXA 4ITVA 2XSJC 2PX0A 1OKKD 2PX3A 5T3WA 1MMDA 4E7HA 2NOJB 3DU5A 2VQGA 4YRVA 2VB6A 3KH2A 5F5FA 3O6XA 2M3AA 2ZXHA 3K4MA 3K4LA 3TL4X 4NC8A 4BJTA 2L81A 2X85A 2Z15A 3ZSUA 3DKXA 3S93A 4FASD 1JPJA 4PFOA 1SMYF 2H7VC 3JRTA 4X0RA 3DLAA 2YHSA 3FVYA 2L5QA 3DM9B 4BEHA 5JHFA 4IRUA 3S3OA 2DT6A 3DQVC 1K6YA 3W8HA 2IXPA 3KYLA 4XWJA 4BXFA 4ZTFA 4NC7A 3OY9A 2VXZA 3H9QA 5FRMA 2ZXRA 5KYXA 4BJ6A 3O39A 1Z23A 2OG2A 1M2OA 3L2VA 2R7QA 2WB7A 3EJNA 5D91A 4PFPA 2HNHA 4E7LA 2KJGA 3AKZA 3ZVRA 3S3NA 2VPLA 3AG3C 4LACB 5E3CA 3L2UA 3E9VA 5KYYB 4KITB 2HPIA 4XLFA 3VSLA 3OEOA 2W45A 3POVA 3L34A 3PSFA 1PYVA 2WVQA 3ITFA 2KQ9A 3NG1A 2WBMA 3H65A 4WJ0A 3EH1A 5FCLA 4I1MA 1SF8A 4XL9A 2QKMB 1NU7D 3K7DA 4CSWA 3OYEA 5DS5A 2X1DA 4F52A 3FHDA 3DJNB 1KONA 1TT0A 4RLFA 3Q6MA 4I3MA 4OD5A 4BJ5A 4G7ZF 3N2ZB 3DWLE 3ZXSA 4CS8C 5KYYA 4F93B 2A6TA 3FKJA 4D9JA 2J7PD 3AL0C 1TWHA 3GODA 1MNDA 4RM3A 5CI9A 2X6YA 1Z3IX 1J8MF 4RDAA 4PJJA 1ZHXA 3JSZA 5D92A 3M8JA 2A1DD 3NYMA 1LDKB 1LKXA 3DPLC 3VWBA 3DPUA 4OD4A 4ZJZA 4XN3A 4B3XA 2CV1A 5HVQC 4O79A 1GLNA 2VXDA 4KNVA 4P5OA 4XKWA 4ZTJA 2M4EA 3VYUB 3ABMC 4OIRF 1FMWA 2QY9A 3SDBA 3K33A 4KBLA 3OYKA 3H5AA 3EHMA 2C04A 4LITA 3VYRB 3B9QA 4O6YA 3RQ4A 3ZQQA 4F55A 3LS1A 4U5HA 1DGWY 2WY7Q 4BQOA 2IS6A 4E6KG 2O9XA 3EH2A 5HSWA 1OCCC 2W9YA 3JT1A 4DOZA 1SAUA 2IS1A 1QZXA 2HVRA 1Z3YA 1SFKA 3OL4A 3PNTA 2Q9AA 2ZPAA 5F5HA 3BG7A 2LY2A 3KEYA 1KU2A 3X2QC 3K4CA 2ZFUA 4CA0A 4C7OB 2RREA 3TBIA 4BS9A 4XORA 1ZU4A 2ZSIB 1NU9C 3EUKL 5KYWB 1BR4A 2AQEA 2VQCA 4HNTA 4KISA 4JZAA 3UMIA 2HPMA 2ZXWC 3D5LA 4RMNA 2H7BA 3OYFA 3DXJF 1BR1A 3FAJA 4P1WA 1E0EA 3PFYA 2YEVA 4G7HF 4N4OB 4NQWB 5T1DB 3OL3A 3FDYA 4H4KC 4PJMA 2ZXIA 3VSKA 2DOAA 3OYNA 3H0DA 3LSGA 1U0JA 1NZEA 4EBBA 4C7OA 2BOLA 1LVKA 1M57C 3DMDA 3EQLF 5KYWA 3RCOA 4R79A 4AU7A 2E1MB 3OYAA 4MNDA 3RYLA 3S8PA 2E60A 3ZR8X 3CJQB 4ZYAA 3NKEA 2IYLD 3CMMA 5FROA 5KHDA 2RQQA 1M56C 3TMOA 4C2UA 1V5FA 2L2OA 2WZGA 3DTKA 2IXMA 3BG6A 4DBRA 2NG1A 4BQQA 3SNHA 2EINC 1ZU5A 3ECSA 5EHHA 5KYUB 4Q5SF 3K4NA 2KPMA 4Y33A 3N0TA 2V6EA 3A2KA 3SP1A 2R7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWT A;  4BJT A;  3CZ6 A;  4BJ6 C;  4BJ5 C;  3K6G A; 
#chains in the Genus database with same CATH topology
 4FHT A;  4CDG A;  3QYF A;  2KRH A;  1XG1 A;  1V5G A;  3TOM A;  3U2M A;  1XS9 A;  2FXA A;  2F5V A;  1MJB A;  2KT0 A;  2WAE A;  1KYZ A;  2CGP A;  5DEQ A;  2KIM A;  5KNL A;  5JVE A;  3M1E A;  1QQI A;  4ZDL A;  3EZH A;  4UVA A;  4BBS J;  1A35 A;  1O3S A;  2EPL X;  2W4S A;  3OV8 A;  2MHR A;  2UXX A;  4PGG A;  2CO5 A;  2EIL H;  4XLC A;  4CIC A;  2LQG A;  2HYF A;  1TQI A;  1WJF A;  2FBI A;  1XZP A;  4WGZ A;  2CYY A;  2Y9Y A;  2Y48 A;  4HW0 A;  3AG2 H;  4QWQ A;  4XR6 A;  2NUP B;  1V3F A;  5GPG B;  3CME I;  4EEF G;  2M0C A;  4IRG A;  2DMN A;  4FX5 A;  4HE8 D;  2IA1 A;  3OS2 A;  3GX4 X;  1FR0 A;  1W36 D;  3ZMV A;  3HHG A;  5EGO A;  1MMA A;  3D5S C;  1FPQ A;  1FWZ A;  2M4K A;  3RSN A;  1X58 A;  2GWR A;  4EJU A;  5HV9 A;  2XXA B;  3QAH A;  2CDQ A;  4MO7 A;  4M74 A;  1OCZ C;  2WB1 A;  1IN7 A;  1TWA J;  3F6V A;  4X1E A;  1USS A;  1JR8 A;  3HSR A;  5JT4 A;  4C3H J;  1BDJ B;  1XB4 A;  5DCM A;  1O4X A;  2PP4 A;  1FFH A;  4I44 A;  4NTF A;  1BI2 A;  2JPC A;  1DDN A;  4C3B A;  1ZGW A;  4J30 B;  3UGP A;  3AG1 H;  3TO9 A;  4KN7 X;  3BT9 A;  3VOD A;  5LFA A;  2K9Q A;  3RPQ A;  2QCO A;  1JKR C;  1G6N A;  2AO9 A;  2WA0 A;  1LQ1 A;  2EFO A;  1M2V B;  4P6I C;  4XQ1 A;  3VYW A;  2R7F A;  2RDP A;  1LDD A;  4NTA A;  5C4X J;  1YI2 I;  2V1U A;  2KW3 C;  2FSW A;  2XF5 A;  2DOE A;  3ZQG A;  1T56 A;  3NEU A;  2A0B A;  1Y4C A;  2PI0 A;  3JSO A;  1MMN A;  1OCO H;  2Q7R A;  2R9R B;  4ABZ A;  2B7E A;  5FFX A;  3CCR I;  4IAQ A;  4BU2 A;  4X6A J;  1KTM A;  3HBL A;  1J09 A;  2HTJ A;  3MMY B;  2NXN B;  1GS9 A;  4JK1 X;  5C4J J;  4HAM A;  2HWV A;  4BEJ A;  3GWZ A;  1S7E A;  1SVL A;  5L0G A;  3TP0 A;  4E7K A;  3OYG A;  1Y8Q B;  3BZ6 A;  4BHP A;  1SVO A;  4LB5 A;  3A9C A;  3OYB A;  1W5C C;  1K83 J;  2L9V A;  3GME A;  1EKY A;  2QQA A;  4QSH A;  1LVA A;  3LSH A;  2JK3 A;  3S28 A;  3JRB A;  1PVE A;  2F6C A;  2W85 A;  3OOU A;  1K61 A;  3S90 A;  3GFJ A;  4HEA J;  3UR3 C;  1ZG1 A;  4KJZ A;  4M3D A;  2CV0 A;  2RV8 A;  3E5Q A;  1DPU A;  1GQA A;  1AU7 A;  1EKE A;  3EUA A;  4XM3 A;  2HMZ A;  2XPW A;  2XVC A;  1RET A;  1K04 A;  2M7B A;  2BYV E;  2IA0 A;  1TR2 A;  3HOX J;  1V54 C;  2NPU A;  3V8K A;  1O3Q A;  2Z9O A;  2MYS A;  4LLL A;  3QOE A;  2RKH A;  4D4X A;  2BXZ A;  2FF4 A;  2IGM A;  3BEH A;  4KC9 A;  2PJR A;  4YT2 A;  3K6B A;  5F28 E;  3M4O J;  2LRD A;  3ZMU A;  3AG1 C;  4Y3O A;  3EET A;  2NVY J;  1YA7 O;  3O8G A;  1E3H A;  1U8R A;  2ELJ A;  2NNY A;  2LRE A;  2XLE A;  2QKL B;  5IT9 Z;  1ST6 A;  2XLH A;  1TWA A;  5CLS A;  1T01 A;  2HV7 A;  2AWC A;  3GEE A;  2DBB A;  2IVM A;  1SZI A;  4CJO A;  1D1A A;  1WJC A;  2PN6 A;  1E83 A;  2JA5 J;  3P9I A;  3GTL J;  5FKN A;  1AA7 A;  4B3A A;  1ZGJ A;  1U5T A;  4PK4 A;  2CYD A;  3DBL B;  2HSB A;  2AXT C;  2VKH A;  1A6Q A;  3O6B B;  1XDS A;  4HSR A;  1R5H A;  1TQP A;  2B0L A;  4E4H A;  5J47 A;  1F4K A;  4G7O F;  3PHF 2;  2X6W A;  2RD9 A;  4L9J A;  4ESB A;  2ZKZ A;  3F8C A;  1IN4 A;  4HX7 A;  3LLK A;  3V7S A;  4XLE A;  4QDL A;  4H54 A;  3HLZ A;  5GAG J;  3RKQ A;  3B29 A;  4K1O A;  5L0F A;  2L0K A;  4YFX F;  2H94 A;  1LPQ A;  1ZRC A;  5BQI A;  3DTE A;  3K1H A;  5A6K A;  2Z33 A;  2CWE A;  3H5N A;  1TNT A;  4MVZ A;  2L7A A;  3GAN A;  4YT8 A;  3HJE A;  3MAJ A;  4XLP F;  3CDH A;  3CES A;  4C2T A;  3GTQ J;  2LIG A;  3LNR A;  1TQG A;  4A3J J;  4QLC U;  1WAS A;  1MNE A;  2I8B A;  2XLV A;  3T5X A;  2VE8 A;  4IX7 A;  2XAH A;  3I5P A;  4GGG A;  1X2M A;  2OZU A;  3H5R A;  5ILU A;  2EFN A;  3ERE D;  4IHV A;  2OQG A;  2DPD A;  1DUX C;  2Y69 H;  1HMO A;  1TWG J;  3ZQY A;  4JIO A;  3SYN A;  5J8F A;  3WG9 A;  1UZC A;  2DK8 A;  4YK5 A;  2V3C C;  1OXK A;  3R0J A;  2RC4 A;  4Y17 A;  1APC A;  2BV6 A;  2AS5 F;  3C63 A;  2B63 J;  4XPY A;  4CO8 A;  2I5U A;  3E3V A;  3PMR A;  3S0X A;  4UUT A;  2FFH A;  2E1C A;  4MVR A;  5FLM J;  1ZQ3 P;  4U9D A;  4ENJ A;  4DRH B;  3ZPL A;  3F6O A;  2XGX A;  3IH3 A;  3CD6 I;  2OCE A;  3PFI A;  4AUX A;  2CS3 A;  2V1N A;  5CPR B;  4NC3 A;  4C3I J;  3U3F A;  4EUK B;  1BJA A;  3RQG A;  5DVW A;  3PNY A;  4GYT A;  2CW7 A;  2EA4 A;  2RAE A;  3H0G J;  2Y75 A;  1OCT C;  3F8F A;  3ZMT A;  1ZTR A;  3ZN1 A;  2ICW G;  3CCJ I;  2ASR A;  3O10 A;  1YW7 A;  1VQL I;  1SD6 A;  3N4M A;  1H9T A;  2EPF A;  4K7B A;  2IM8 A;  4I1O B;  1QA6 A;  3FDQ A;  1ODD A;  5J6X A;  2IGN A;  5D5X B;  1VQ7 I;  4XEK A;  4RLQ A;  3ZCO A;  1IAW A;  1XC5 A;  6PAX A;  3DD7 A;  4BJ6 C;  4UUS B;  3HEF A;  3PNV A;  1RUO A;  5L0I A;  4LLG F;  4JP0 A;  2JVH A;  4NY3 A;  2VLA A;  2ELK A;  1BC8 C;  3GBG A;  3KLO A;  4OIN F;  4O6M A;  2P7V B;  2XF7 A;  4I02 A;  3BR0 A;  2ZSH B;  5K5R A;  3GTK J;  2D2W A;  3MWM A;  2HVQ A;  3OA1 A;  3K10 A;  2CUJ A;  2HKO A;  1FFT C;  2X4H A;  3MEX A;  5DQT A;  2DYS C;  4CS9 A;  2H7O A;  1SD4 A;  3FXM A;  3HYI A;  2HKV A;  3JRM O;  4B48 A;  3VF0 A;  1U6H A;  2Y69 C;  2BHY A;  4MVS A;  4DYQ A;  1J5Y A;  1IC8 A;  1QPI A;  2R7T A;  2X0C A;  1GXP A;  1D0Y A;  3JYY A;  2X51 A;  5CVR A;  2P8T A;  3BY6 A;  4QPO A;  3WTX C;  1J7K A;  1LIH A;  2LFD A;  5L3B A;  4G6T B;  1P2F A;  5FJ8 J;  3LEO A;  2K3F A;  3CJT B;  1P4W A;  4UDV A;  3W2V A;  4CUG A;  1TWG A;  1ZAO A;  5LGT A;  4J01 A;  3FOO A;  3LAP A;  3SJM A;  1WJD A;  4KUM A;  4HOB A;  3KP2 A;  5J8C A;  1D1C A;  2H1L A;  3HKZ A;  2XM4 A;  3WE3 A;  5CVJ A;  4M9S A;  4U5D E;  2MH9 A;  3P7N A;  2LBF A;  1ON2 A;  2L4M A;  3OIP A;  2NVX J;  2R7D A;  5DS6 A;  2FBH A;  4BHC A;  1ORS C;  2OQM A;  2J45 A;  3ML6 A;  1O7F A;  5DD4 A;  4C9Y A;  2WWY A;  4DVZ A;  5FRN A;  1MD0 A;  2HOE A;  1P7J A;  3Q0U A;  2HZT A;  4Y4R A;  3JZ0 A;  1VLT A;  2QBY B;  2GFH A;  4DVY P;  4KN4 X;  1LEA A;  2DFH A;  3A4C A;  4AYB N;  1B59 A;  4ZYG A;  3EGX B;  4GRI A;  4XKC A;  5HLH A;  3EZI A;  2UUI A;  2OF7 A;  3GM1 A;  1OYI A;  3PUF A;  4JRZ A;  1MJ9 A;  3JRE A;  1PDN C;  2JVG A;  1T39 A;  3NMJ A;  3US6 A;  2IP2 A;  3CCM I;  3KP4 A;  1LE8 B;  5GTH C;  4A69 C;  3MKW B;  4R32 A;  2M87 A;  4A0X A;  2NAZ A;  1U2W A;  4IHT A;  1J2X A;  1PP7 U;  2P5V A;  2W57 A;  3UGO A;  5CQE A;  4AC0 A;  2LF7 A;  2L7K A;  3JTL O;  4U5B E;  1WKM A;  3NRH A;  2LCH A;  2LMD A;  3LA3 A;  2XRN A;  1S29 A;  2DFI A;  4XKB A;  1F5T A;  2OTJ I;  1A41 A;  3B0P A;  4CDY A;  2M45 A;  2JSC A;  2AHQ A;  4OWR B;  1KQ9 A;  2ELH A;  2DA3 A;  1REP C;  2A5Y B;  3N24 A;  3QU6 A;  3OYC A;  1Q0F A;  1XDU A;  1XN7 A;  2D5R B;  2XB0 X;  2M2E A;  2RSE B;  1OQY A;  1MSF C;  2CQ7 A;  3G73 A;  1D0Z A;  3PO2 J;  2FAP B;  5EJC A;  3MQ0 A;  3MBG A;  3QRF F;  2A07 F;  2IXO A;  2Z1D A;  3K69 A;  4CHU A;  2YL1 A;  3I53 A;  5LGN A;  1N25 A;  2E1M C;  2P81 A;  4HG2 A;  4BL0 B;  1AOY A;  2D4U A;  3QOD A;  3BG3 A;  3WOD F;  1V5E A;  4L9N A;  1WFX A;  1MGT A;  4A5M A;  3HUG B;  1O3R A;  2MC4 A;  3LWF A;  2Y30 A;  2XAS A;  1ETO A;  2IRF G;  1QVX A;  4JJF A;  4JVS A;  4P9U A;  4O7G A;  3BRJ A;  1TQM A;  2VJ4 A;  2PX9 A;  3WTY C;  2IS2 A;  3OYM A;  1FIP A;  1N78 A;  1J0R A;  1JKO C;  1B72 B;  2WY8 Q;  1YW9 A;  1TL8 A;  1IXC A;  3F47 A;  1IRX A;  2QYO A;  2XSJ C;  1MMD A;  2NOJ B;  4A3G J;  3GOR A;  3ZDL A;  3M8F A;  4YRV A;  2LKP A;  3FXU A;  5AIQ A;  2M3A A;  3O6X A;  2Z15 A;  2X85 A;  4CIP A;  1U78 A;  5A69 A;  1I4Y A;  1Y0N A;  4PFO A;  2NVT J;  2LK2 A;  1IUF A;  3DLA A;  4E18 A;  3TOA A;  4HV6 A;  2L5Q A;  2VON A;  4BEH A;  3DM9 B;  4IRH A;  3DQV C;  4EJV A;  4HYE A;  4BXF A;  1B9N A;  2DDA A;  5EF6 A;  4U7D A;  2YLD A;  2VXZ A;  5JLX A;  5FRM A;  3B6C A;  3O39 A;  1H6G A;  3AGT A;  1R71 A;  2OG2 A;  2J5O A;  2M9H A;  1Z67 A;  1LM3 B;  4PFP A;  2HNH A;  2YS9 A;  3TKY A;  2LNB A;  2V1D A;  1CGM E;  2VPL A;  2GAQ A;  5E3C A;  3BQY A;  4TV7 A;  5DTD A;  3L2U A;  4XLF A;  3POV A;  3L34 A;  3G3Z A;  1XZQ A;  1V74 B;  5AIP A;  1ZK8 A;  3RKX A;  2OEV A;  3BR1 A;  4A0Z A;  4ASN A;  3EH1 A;  2XKO A;  4XL9 A;  2HQN A;  1SF8 A;  3K7D A;  5B3I A;  3OYE A;  4UXN A;  1FT9 A;  2X1D A;  3IWF A;  2HZ8 A;  3FK7 A;  3ZOB A;  5ERI A;  1H89 C;  2VPR A;  4F52 A;  1G3Y A;  1OYW A;  5FKM A;  1U6G A;  4FAP B;  3N2Z B;  1Z77 A;  2LD5 A;  4D9J A;  2NRA C;  5L3G A;  5CI9 A;  2MLK A;  2YX7 A;  3ZMZ A;  1ZHX A;  4A3F J;  3JSZ A;  4RDA A;  4A3C J;  2KKO A;  1TLH B;  3DPU A;  5A6J A;  1E84 A;  3C8G D;  4RGU A;  4OD4 A;  5JLI A;  5HVQ C;  2O03 A;  4A0Y A;  2YSR A;  3D0S A;  4XKW A;  1JUP A;  4WWC A;  4L18 B;  5B5E C;  2BHZ A;  5FD6 A;  4WAB A;  1LE2 A;  3I4M J;  1FOW A;  2DA5 A;  2GXB A;  2EFQ A;  5EEH A;  4BHB A;  5AON A;  3EHM A;  1B1B A;  3B9Q A;  4XEV A;  5ICF A;  4BQO A;  2O9X A;  2MLG A;  3ERM A;  4IGG A;  4B09 A;  1OCC C;  2W9Y A;  2NS0 A;  3TOL A;  2HVR A;  2P5L C;  2GA2 A;  5BMZ A;  1MIJ A;  3KEY A;  3EYI A;  1ZVZ A;  1SAN A;  3K4C A;  1JKP C;  4CA0 A;  1U9N A;  3BPX A;  4RAZ A;  4YIR X;  4Z9H A;  3TBI A;  2DTZ A;  4XOR A;  1ZU4 A;  2FML A;  3L8I A;  3EUK L;  4MVO A;  1BR4 A;  2E7X A;  2M5W A;  4N9I A;  1A31 A;  2KIF A;  3J81 Z;  2R7Z J;  2XS8 A;  4JZA A;  2OJE D;  5IOZ A;  2EPK X;  3D5L A;  1ZRE A;  5GAE J;  1BR1 A;  1OCR H;  2EIJ H;  2JN6 A;  1E0E A;  1WSU A;  2KDZ A;  4OMY A;  1NK2 P;  2DQR A;  3FK6 A;  2KZG A;  4C7O A;  1OW8 A;  5E1Z B;  1STZ A;  1JHF A;  1U0J A;  1NZE A;  3N97 A;  1U5T C;  1LVK A;  3EQL F;  2CQX A;  4KDP A;  1HW1 A;  1Q0G A;  3DMD A;  5KYW A;  3H2V A;  3VFZ A;  2E1M B;  1W7P D;  3RYL A;  3ZR8 X;  1Z7U A;  4A3M J;  3S2H J;  5H6R A;  4EQQ A;  3CQZ J;  3CMM A;  2QSH X;  2L02 A;  5KHD A;  1G3S A;  3EYY A;  4PDK A;  5E20 A;  1M56 C;  3TMO A;  2L2O A;  1CGN A;  3TK0 A;  1G3W A;  1R00 A;  4MVM A;  3SNH A;  3L00 A;  4BQQ A;  3ECS A;  5EHH A;  1W1W E;  3QP5 A;  1APL C;  3JTH A;  4Y33 A;  3A2K A;  5LGU A;  3OSG A;  1BIA A;  1HW2 A;  3S16 J;  1CQT A;  1IV8 A;  4GXO A;  2XSD C;  4BEM J;  1Y6I A;  2QZ8 A;  3TW6 A;  4XKV A;  3DCF A;  3OYD A;  5IYB J;  5F1R A;  3L8J A;  4B6I A;  2JA2 A;  5DS9 A;  4RB2 C;  4DQ2 A;  3L2Q A;  4CDV A;  4ZLC A;  3CCY A;  4PSW A;  2BEO A;  2WL8 A;  5DS4 A;  5EEG A;  3IAM 2;  5J40 A;  2VC1 A;  4DNC A;  1R4T A;  4MS2 A;  1AUE A;  3FF5 A;  2R7V A;  1BM9 A;  1D0X A;  3T8R A;  3CC7 I;  5IP9 J;  2VQL A;  2VKV A;  2EB7 A;  2YUS A;  1ZH5 A;  1FNT c;  1ZLJ A;  2P0W A;  5EGO B;  4HFK B;  2CQK A;  2XF6 A;  3IAS 2;  1BBH A;  1UAA A;  2R7O A;  3L2W A;  2STW A;  2FNP A;  4PCQ A;  5KYU A;  3HRT A;  4C2M J;  1H88 C;  1I3A A;  3S2W A;  3DJU B;  3B73 A;  1RES A;  3KCC A;  5DCM B;  2JWT A;  5DLJ A;  2EK5 A;  5JI6 A;  1H8A C;  4KIB A;  2DI3 A;  2XGD A;  1Z7L A;  2LTP A;  4G94 A;  4XNF A;  4J00 A;  1JMW A;  1G4D A;  5M5W J;  1YYX A;  3K9T A;  4KMU X;  3RPU D;  3QMK A;  3F8N A;  2MSY A;  2YHS A;  5K5Q A;  3ONQ A;  2FRH A;  1V55 H;  4U87 A;  1W2W A;  1IW7 F;  1QVT A;  1UST A;  2XRL A;  3B02 A;  1BW6 A;  2DMU A;  5F04 A;  1IGN A;  2V9P A;  1YIJ I;  2X6X A;  2NSF A;  2KL4 A;  3RYP A;  4B44 A;  1VQN I;  3BR2 A;  3CSK A;  3Q0V A;  3VYT B;  2H09 A;  2D1H A;  1A0B A;  2HDW A;  1Z63 A;  1OCP A;  3GZN B;  3W3C A;  4CXF A;  2L9R A;  2MG4 A;  3CQZ A;  2W1O A;  2VC9 A;  3KYI A;  1YJG A;  3E5U A;  2GQQ A;  2GBY A;  4Q7C A;  2Q1Z B;  1WI3 A;  4CS8 A;  1YVI A;  1ERD A;  1S8N A;  3KEO A;  1TFK B;  1O57 A;  2KMU A;  2LG4 A;  4E7Z A;  3PCV A;  1D1B A;  3T6J A;  3GM2 A;  2QLA A;  4CS9 C;  3K2A A;  2J9V A;  3EGD B;  4G8X A;  4FIS A;  2QVO A;  5CYV A;  1BR2 A;  1TZL A;  1ZG5 A;  2ZXP A;  4PAC A;  1P92 A;  1BIB A;  3SFI A;  5IT3 A;  1FYL A;  1ZYR F;  2KHM A;  2RQP A;  3M4B A;  2CG4 A;  4W97 A;  4Z9J A;  5CVU A;  3EHN A;  2W82 A;  2G7H A;  2PJR B;  4AM3 A;  2BGC A;  5HLI A;  2ZXJ A;  5K7Z A;  1EF4 A;  2MBF A;  3F8M A;  4ETS A;  1FOK A;  4OIO F;  3D1N I;  2VJJ A;  2Y3B A;  2DMT A;  3I9V 2;  2LH9 A;  1TFO B;  2OV7 A;  4BNC A;  3TQN A;  3CCQ I;  1W36 C;  2OAZ A;  1Z21 A;  4JEA A;  2HU9 A;  5K7H A;  1WCM J;  1V55 C;  5JVG F;  1T8I A;  2RNG A;  2P6V A;  2NS8 A;  5TRD A;  2Y3G A;  1T6Q A;  3JRC A;  1Y1W J;  1U5T B;  3BC8 A;  5F08 A;  1YRN A;  2PF4 E;  2J5P A;  1JAF A;  3C18 A;  4WXH A;  4J32 B;  5E3L A;  4ZDP A;  3C2G A;  2I10 A;  3I5U A;  3CCE I;  3GLL A;  4IAR A;  4L6R A;  3K6G A;  4X0G A;  3FBN B;  2OU6 A;  2G62 A;  4IB4 A;  2DGJ A;  2IOQ A;  1E3O C;  3T9O A;  1NG1 A;  1VQM I;  2E35 A;  2M34 A;  3CZ6 A;  4HF2 A;  2WB1 N;  3SEZ A;  4YL0 A;  4AVP A;  5ILV A;  4DRI B;  1S7O A;  5A2Q Z;  3J80 Z;  4NUB A;  2ESH A;  2E2H J;  5F0C A;  3BZC A;  4M6V A;  2WTE A;  5FLX K;  1I5N A;  2L7M P;  2GZW A;  2UWM A;  3HG9 A;  1L3L A;  2Z16 A;  1XSV A;  1I1S A;  3DKW A;  4CIH A;  4IOA F;  4HNU A;  2HDC A;  4M71 A;  1S9H A;  1VQ9 I;  4ZYE A;  2H7V C;  4K0D A;  3I4N J;  4KMF A;  3S1N J;  3C8G A;  3L2C A;  4UNO A;  1PD0 A;  3HKK A;  2DDB A;  5CKT A;  2WAQ A;  3ZQC A;  1OPC A;  1UEL B;  2XGE A;  3CUQ A;  1B8I A;  2K9N A;  3QQA A;  2LP0 A;  3HNI A;  3H3U A;  1I4Z A;  1ZEL A;  1QPM A;  2AQF A;  4L0Y B;  1IN5 A;  2XLW A;  2L6H A;  3EFO A;  4UHT A;  2OD5 A;  5BUO A;  1WZ2 A;  1IRZ A;  1YIT I;  2COM A;  5H20 A;  1GM5 A;  4AK9 A;  3BTJ A;  1PCX A;  3L1M A;  1GXQ A;  3HXL A;  4PJL A;  1ZW2 A;  2F4I A;  3DEE A;  1Q0D A;  2BXY A;  2G0E A;  3J7Z I;  2G9W A;  3BG9 A;  1JTY A;  4I7H A;  4QPQ A;  4L0Z B;  2QGU A;  4O6N A;  3QZC A;  1P9Q C;  2ZNZ A;  3O55 A;  4BG0 A;  2EZL A;  1OMI A;  1W0U A;  2EZI A;  1HKT A;  4WXC A;  4G0H A;  3FXJ A;  3GVA A;  3OOP A;  3G1L A;  1H0M A;  2QEX I;  1ORJ A;  2WVO A;  2KFD A;  2WC2 A;  1RZ4 A;  3QPL A;  2LFF A;  2HQ5 A;  2QQ8 A;  3CDI A;  3IPM O;  3K1M A;  3NAR A;  2M8G X;  3P9K A;  3ECH A;  1EV7 A;  3PM1 A;  3U3B A;  2CU7 A;  3K0L A;  2K3P A;  1QZZ A;  1NHA A;  1HKQ A;  4MQV A;  1D8J A;  5AC4 A;  2HGC A;  3QPS A;  3JSE O;  2M1B A;  1Z05 A;  5L0J A;  1DGR M;  4MHG A;  2XLM A;  4EM2 A;  2LY9 A;  2FD5 A;  1I5Z A;  1L7C A;  1HF0 A;  5D4S A;  1OR2 A;  5LHH A;  1N1C A;  1G4W R;  2Y3D A;  1RKT A;  4OAY A;  2LD6 A;  3NAU A;  4AD9 A;  3KKB A;  1U0B B;  1X1C A;  2PEX A;  3DE9 A;  3TD7 A;  1FY7 A;  1VQ5 I;  3FWE A;  3KE2 A;  2K9M A;  2EIK H;  5L3E A;  1NTC A;  4KA4 A;  4A3I J;  3KYJ A;  3M15 A;  2VE9 A;  4E0H A;  4F3Q A;  2EIL C;  1Q0M A;  2H8W A;  2BY1 A;  4YFK F;  1RRJ A;  4BDZ A;  5DV5 A;  3FMQ A;  2D5V A;  3AG2 C;  5AGF A;  1FMV A;  1YTY A;  2B0H A;  4E17 A;  4ESJ A;  3FXL A;  3M79 A;  2LBF B;  3VB2 A;  1UJ8 A;  2PFD A;  4CYC A;  3A1Y A;  3LA2 A;  2GOX B;  2N8G A;  3E6M A;  3EGD A;  3CJR B;  4HLX A;  3H3V K;  3WHN A;  3DM5 A;  2AXL A;  2QNL A;  2O61 A;  1X1D A;  1R58 A;  5E2Q A;  2E19 A;  2VIX A;  2BBY A;  2EIN H;  3FMR A;  5E1X A;  1H9G A;  4U5C E;  2OOC A;  1RKC A;  1IN8 A;  1OLT A;  4MQ9 F;  2R7U A;  2F5E A;  1S5L C;  4EM1 A;  1IDY A;  4YIF A;  1JKQ C;  2J0W A;  2XM0 A;  2TMV P;  3MZH A;  2HYJ A;  3VOE A;  2J9B A;  2QTV A;  3RKO F;  4JTC B;  2Q00 A;  1KGS A;  2DMP A;  4LJZ F;  5FZT A;  1QRY A;  4ON0 A;  1UHM A;  3U1D A;  3DPT A;  1Z1D A;  2HYG D;  3U21 A;  4Z9I A;  1OCO C;  4CSA A;  3Q5F A;  3M7G A;  4JX4 A;  3HSF A;  5HS9 A;  3W6J B;  3MZ8 A;  2OBP A;  3U1K A;  2ACJ A;  2MFZ A;  4Y15 A;  3B71 A;  1J59 A;  3HTK C;  4A5N A;  1MDM A;  1R6R A;  5CJ9 A;  4WX9 A;  3RI4 A;  1MSE C;  4A6E A;  2EIK C;  1HKS A;  2Q2E A;  2ZJQ F;  3QYB A;  4EWC A;  3ASN H;  3ZMD A;  1G8X A;  1ETV A;  3LSM A;  2IGO A;  2GXG A;  4JOM A;  4HQE A;  2CUZ A;  1K79 A;  2CFO A;  4D7N A;  1R4N B;  1BN5 A;  3HSE A;  4LFU A;  1IRG A;  3E5X A;  4EBK A;  3EDP A;  1LDJ A;  3SEO A;  1XGS A;  1T0F A;  4CCJ A;  1BW5 A;  1ZHY A;  3K4K A;  3PSI A;  4BAY A;  1SD5 A;  2PBE A;  1QU3 A;  4QI0 A;  1UHS A;  2FOW A;  4XLA A;  3CAX A;  1N75 A;  3K1N A;  1KZH A;  2KJC A;  2CNW D;  3GYH X;  3LSK A;  4BAC A;  1IXS B;  2IJL A;  3K1I A;  3OS0 A;  3LEV A;  3RFY A;  5F64 A;  1NG7 A;  5F27 A;  2CSO A;  3FHZ A;  2R5Z A;  1UFM A;  2F4M B;  1JJ8 C;  2QM3 A;  3LMM A;  1C17 M;  1J8Y F;  2AP3 A;  4YT5 A;  3FM3 A;  4CCL A;  3X1O A;  5EG0 A;  4NTB A;  2HQR A;  2X0L A;  5E3M A;  3KIO A;  4MEY F;  2DB4 A;  1A6I A;  5L3Q A;  3Q7G A;  5GTI C;  1GUU A;  3AQB A;  4DZJ A;  1R7J A;  2ZB9 A;  3NMK A;  3BR3 A;  5D5W B;  2QQB A;  4AE4 A;  2CW0 F;  4NC6 A;  4BEH B;  1FLI A;  3W2W A;  1A7E A;  4M63 A;  4II2 A;  3SEQ A;  4AIH A;  1WJA A;  1S7Z A;  2JPU A;  3HJC A;  3NKD A;  5A6B D;  2CQQ A;  1U8B A;  2PMZ A;  4N4N B;  5GAD J;  5BOX A;  3HKZ N;  2BVL A;  4XMY A;  2ZO4 A;  5HLG A;  3JRG A;  1ZHZ A;  4ITV A;  1R23 A;  1OKK D;  1JRA A;  4YG2 F;  3DU5 A;  2VQG A;  5F5F A;  3KH2 A;  2L81 A;  5LRR A;  4NC8 A;  3HOW J;  4I76 A;  1FAP B;  3PIP F;  1JTX A;  3FVY A;  3BR5 A;  3P5J A;  5JHF A;  4IRU A;  2LF8 A;  4HF0 A;  1K6Y A;  3KYL A;  1IZ1 A;  2XUB A;  2OZ6 A;  4MVU A;  4FX4 A;  3GM3 A;  4KIC A;  2IW5 A;  2HEO A;  1LB2 A;  3ELK A;  5FKO A;  3VPR A;  4E7L A;  3ZVR A;  3S3N A;  1HOM A;  5LHI A;  3BQZ A;  3ZQV A;  3KEQ A;  2W45 A;  3H2U A;  3PSF A;  2STT A;  1KA8 A;  4EJT A;  3ITF A;  1JE8 A;  4WGY A;  4DRJ B;  2KQ9 A;  3NG1 A;  2ADU A;  1GV2 A;  2ZXW H;  3H65 A;  3U8V A;  2NSG A;  2QUP A;  4XRS A;  4RB3 C;  2OQR A;  2QKM B;  2GAU A;  4A2U A;  1AEP A;  3BRO A;  2ME0 A;  1YLF A;  4X0R A;  3LSP A;  3I64 A;  1E85 A;  1FTZ A;  5BPI A;  3DJN B;  3Q6M A;  5LLQ A;  4BJ5 A;  1M1E B;  3DWW A;  2IBD A;  3ZXS A;  4HNV A;  4CS8 C;  2RN7 A;  1XMK A;  3KZI C;  4F93 B;  4MTG A;  3RVZ A;  5KYY A;  3AL0 C;  4EVI A;  2RNJ A;  1MND A;  1QBJ A;  2HSQ A;  1RKE A;  1GVJ A;  5D92 A;  3M8J A;  1ETW A;  2A1D D;  1JUM A;  4LOC A;  1LKX A;  1FBS A;  1T98 A;  3TDZ C;  4AID A;  1PUF A;  1FJL A;  1VQ6 I;  3GWN A;  3TGN A;  5KK1 A;  4B3X A;  1S72 I;  3A01 A;  4O79 A;  1GLN A;  2BY0 A;  2VXD A;  2JA7 J;  1B68 A;  4ZTJ A;  1NFN A;  1KYW A;  2PQ8 A;  2O7O A;  4OIR F;  3SZP A;  2IAI A;  2F5D A;  3GXO A;  3JAM Z;  4KBL A;  3TUL A;  1GGQ A;  1IJW C;  3VYR B;  5D8K B;  2MC3 A;  3ZQQ A;  3BTL A;  2JA8 J;  1R1U A;  1DGW Y;  2IS6 A;  4XSZ F;  4E6K G;  2ECB A;  5HSW A;  4HF1 A;  1O7L A;  1XCV A;  2DJN A;  3HRM A;  5E8I A;  4WK8 F;  2CQN A;  2YVK A;  3JT1 A;  1XD7 A;  3LOC A;  1HBX G;  2ZPA A;  5F5H A;  3BG7 A;  4G12 A;  3H3Z A;  1QSP A;  5COG A;  2F5F A;  3HGG A;  5GPA A;  2P61 A;  1HE9 A;  3I59 A;  3GCM A;  4C7O B;  2DN0 A;  4BS9 A;  2E36 A;  3CO6 C;  5KYW B;  2V1X A;  2VQC A;  5JHU A;  4NQF A;  1OW6 A;  2HPM A;  3UMI A;  3GFL A;  2ZXW C;  3WGI A;  4P55 A;  3ZQ7 A;  5B1A H;  5A6A A;  3T6G B;  3FXQ A;  1A04 A;  1LEB A;  3DXJ F;  3U0C A;  5JFR A;  4FT8 A;  2YR2 A;  3PFY A;  4N4O B;  4XRF A;  1T6I A;  1XWJ A;  2NS7 A;  1RXQ A;  2F48 A;  4H4K C;  2E1O A;  2YL7 A;  2ZXI A;  2LFB A;  3H36 A;  3VSK A;  3OYN A;  3H0D A;  3BPV A;  4OMZ A;  2NVQ J;  3ULQ B;  1HDP A;  4AIJ A;  4EHP A;  1MZB A;  3IKV A;  3IV5 A;  4A6D A;  4A93 J;  3S8P A;  3U2L A;  3JCU C;  3LUT B;  3NKE A;  2CUE A;  4IPA A;  2IBF A;  4UVB A;  5IT9 K;  2RQQ A;  2PMU A;  3F22 A;  5JSL A;  2VBY A;  1K6O A;  3U9G A;  3GZ5 A;  1HMD A;  2WZG A;  3DTK A;  5E18 F;  2LVS A;  3IQT A;  3HRU A;  1EH7 A;  2E1N A;  5EDN A;  4CDA A;  3SXY A;  3B6A A;  2EPM X;  1XTA A;  2KPM A;  3GFM A;  3N0T A;  2K40 A;  4LGW A;  2LK4 A;  4P9F A;  1D5V A;  4L5J A;  2VAS A;  1MMS A;  5E3A A;  2Y0S N;  5COM A;  2HOS A;  4JX6 A;  3CUQ C;  2ZJ2 A;  3TO7 A;  4HBL A;  4QIW N;  2F2E A;  1SAX A;  3CMY A;  5KYU B;  2HVS A;  3CCU I;  3J06 A;  2XAF A;  2HJM A;  4OAZ A;  3GWL A;  3JRA A;  3HNJ A;  2YX4 A;  3L1P A;  4I01 A;  2K9L A;  1IO2 A;  4GDF A;  4C3E A;  1XMA A;  3V8L A;  3S2D J;  3CF5 F;  3RZD J;  2FA5 A;  1MQV A;  5HOO A;  4WXD A;  2FU4 A;  3SXK A;  4W1U A;  5IYD J;  1YG2 A;  5HDG A;  2NYX A;  4EAT A;  3BTI A;  2M4G A;  2HFI A;  3PDM P;  1YZA A;  1Z6A A;  3MYI A;  1MBH A;  2WAF A;  5B1A C;  1QPU A;  3MFN A;  1GHC A;  1HXD A;  1BJZ A;  3KL4 A;  3LNM B;  2KRF A;  1X4O A;  2JUG A;  2HDD A;  4UB8 C;  5JS5 A;  2XS1 A;  1V4A A;  3ZN0 A;  4W8K A;  3JRI A;  4Q4Z F;  3M07 A;  2YWA A;  3H9G A;  3FX3 A;  3G1O A;  4HPQ A;  2IGK A;  2F5C A;  1WH7 A;  2X1E A;  4XIC A;  4HA8 A;  3OWT A;  3RKY A;  3W2A A;  3UMK A;  5J1U A;  1K40 A;  3HB9 A;  2E34 A;  2H6B A;  4BPM A;  1X1B A;  1RKW A;  3AL0 B;  3E6B A;  2K4B A;  2H8A A;  4BXX J;  2JJ7 A;  2R7S A;  4RA2 A;  4PGH A;  2Q8K A;  1E2X A;  5M5Y J;  2A6E F;  4QTR A;  4U7B A;  4IHW A;  1KQ0 A;  3DAG A;  5D6E A;  4U5G A;  1K4T A;  3MKY B;  2NVU B;  2W84 A;  3LSI A;  2V7F A;  4BQA A;  5GAH J;  5FD5 A;  4XK4 A;  4YEJ A;  2LDU A;  3F21 A;  3WGG A;  1T33 A;  4ER9 A;  1WWP A;  1FP1 D;  2Y0S A;  2BZT A;  3CCS I;  1G5Z A;  2OKU A;  1F9N A;  3L7W A;  5K5O A;  3E1S A;  3LAY A;  2VH3 A;  3UNG C;  3LJB A;  1X19 A;  5J4V A;  4YJW A;  2JX0 A;  2PFB A;  3MKL A;  1W5S A;  1LI7 A;  2DA7 A;  2KZV A;  3H9J A;  1YZC A;  1LNW A;  3BOQ A;  2L9N A;  2FJ1 A;  4YII A;  4Y52 J;  1HST A;  3ZG1 A;  3KYD B;  2WZF A;  3AG4 H;  5L3F A;  1XSD A;  2XC7 A;  1LE4 A;  1IXR C;  3IKT A;  3G71 I;  2PLY A;  1O3U A;  5A6B A;  1I50 J;  1LFP A;  2DW4 A;  2Y2Z A;  5L3D A;  1SEU A;  2ZC2 A;  4NNJ A;  4DZP A;  2PJP A;  4EGZ A;  1YRN B;  3G6E I;  4M6X A;  4M3G A;  4XBF A;  3DEU A;  1R1T A;  2RVC A;  1JHH A;  1R36 A;  1K78 A;  1EI7 A;  4I0B A;  4RM2 A;  3WG7 H;  5HOD A;  5EYR A;  3KLN A;  3RIR A;  4S04 A;  2A3S A;  5CVI A;  1VK5 A;  4DJA A;  2Q9C A;  4UB6 C;  4AL0 A;  2UV1 A;  1ZHW A;  1PV3 A;  2OCC H;  3R2P A;  3ABU A;  2YRF A;  3PL8 A;  4LG3 A;  3JW4 A;  3JRH A;  1SD7 A;  1MH3 A;  5JRA A;  4IHX A;  3E70 C;  2UUZ A;  4BXU A;  1POG A;  3S14 J;  4YL3 A;  3GW2 A;  1XMX A;  2G3V A;  1VQ4 I;  3OYI A;  1BBY A;  3GZ6 A;  1B6A A;  3FM5 A;  3K4B A;  1FYK A;  2EIM H;  3LL7 A;  3ZGK A;  1MBG A;  1HC8 A;  3NYL A;  2E5N A;  3TOB A;  2IS4 A;  4I0A A;  1Y56 A;  4CZC A;  2QA4 I;  4E7J A;  3RYR A;  1HCR A;  1P7I A;  4P9T A;  2ZXO A;  3HOU J;  3C8G B;  4DIQ A;  3JAM K;  3E97 A;  1MBK A;  5BQT A;  2VN2 A;  1SC7 A;  2ISZ A;  2E71 A;  2HR3 A;  3J7A Y;  3T0Y A;  4Z6Y A;  3F46 A;  3CF2 A;  1VQK I;  1FTS A;  2L6F A;  3CUQ B;  1B8I B;  2AWY A;  2A05 A;  2HQA A;  3DAF A;  4RBN A;  3BJO A;  3QVZ A;  3P9C A;  2IT0 A;  1B9M A;  1Q1H A;  2L01 A;  5BQG A;  1EJ9 A;  1OJL A;  3EFO B;  2EH3 A;  2P7C B;  2W4M A;  3AG4 C;  2Z3Y A;  5JR3 A;  3DE8 A;  3LNQ A;  3NMI A;  1Z0X A;  9ANT A;  4NDL A;  4IVN A;  2W25 A;  4M3B A;  2XLO A;  2BW3 A;  4MW3 A;  4IKF A;  1DOV A;  1T0F C;  2C6Y A;  3C2H A;  4ZZD A;  2IPQ X;  5ICC A;  2JRM A;  5E17 F;  2L6G A;  4PSX A;  4I98 B;  1UMQ A;  1QZE A;  4YFN F;  3M4C A;  1E17 A;  4L9T A;  3MZY A;  2JZY A;  256B A;  3K1I C;  4BKX A;  3RQF A;  4HFF B;  2DTR A;  2QQ9 A;  2Z99 A;  5TJJ A;  3KZZ A;  1DU0 A;  2OCC C;  1IZM A;  4CBE A;  3S3M A;  1YJN I;  2X1C A;  1RNL A;  5DCF A;  4JJG A;  2A0U A;  4YWQ A;  1L3P A;  1ONV A;  3I54 A;  4ZYD A;  3G4Z A;  4LG0 A;  2ZBK A;  3QW1 A;  1ETK A;  1WQ2 A;  2FUG 2;  2OA4 A;  3H92 A;  2A68 F;  3OR2 C;  1OCR C;  2EIJ C;  3GFI A;  3K70 D;  2OC6 A;  1JJ6 C;  2EIM C;  5B1B H;  4RDU A;  1A7V A;  3T4R A;  2M8E A;  1MMG A;  1IDZ A;  4KNW A;  3HM5 A;  1F1Z A;  2ID6 A;  4JYK A;  2JMW A;  4V2F A;  5DDG A;  2HV6 A;  2V9V A;  4PUS A;  4XID A;  2KK1 A;  1ZN2 A;  2C03 A;  1RIO H;  2OU2 A;  5KCM A;  3Q9S A;  3Q6N A;  4II3 A;  2ZME A;  3TJ5 A;  4LER A;  2NUT A;  1RMV A;  2QWW A;  1NG6 A;  4MGR A;  4FET A;  3IRR A;  4A2N B;  3ABM H;  1SMT A;  4JBA A;  2JTV A;  1BOA A;  2W7N A;  1Y8R B;  1S3J A;  3R7C A;  2BE5 F;  1T38 A;  4IL6 C;  3LES A;  4LDK A;  4UV9 A;  1QLE C;  3M1C A;  2FOK A;  1XGO A;  3COA C;  4OIP F;  3SZT A;  4Y13 A;  4O6J A;  1T6U A;  3RIP A;  5F6F A;  5E3N A;  2J8W A;  4IQJ A;  1WAT A;  2CH0 A;  4FE7 A;  4UV8 A;  5K1Y A;  4M6Y A;  1QKR A;  2DOF A;  4DYR A;  3DLL F;  4CS7 A;  5J3L A;  5CVV A;  4JQF A;  5CQG A;  2IA2 A;  1TWF J;  2EFP A;  4M3F A;  2GA1 A;  3WE2 A;  1OKR A;  3OSF A;  3G50 A;  2DOD A;  1DP3 A;  2XAJ A;  3B0U X;  4CYC B;  3ZWI A;  1Z91 A;  5DQZ A;  4BQN A;  1AKH A;  4C3J J;  4YEL A;  2JT1 A;  3V42 A;  1I6H J;  4XRM A;  4FES A;  3KP5 A;  3V8J A;  2PNO A;  1YS6 A;  4S0H B;  4BJ5 C;  1T6S A;  5M3F J;  4PR9 A;  2K4J A;  2WAQ N;  1ORY A;  2ZJR F;  3S84 A;  3DP7 A;  4L5E A;  4EBJ A;  3HOS A;  2M7A A;  3WGH A;  3QTH A;  4DXW A;  4ENN A;  2UXN A;  1O87 A;  3B0V C;  5B1B C;  1M6T A;  4RAY A;  2FGY A;  5HS8 A;  4ZH4 F;  3I55 I;  5EK0 A;  3GUD A;  3N05 A;  1VB5 A;  1YX5 A;  2IXS A;  1Y39 A;  1MKM A;  5ED4 A;  3OYL A;  1J9I A;  3EG9 A;  1T95 A;  2HI3 A;  4N4W A;  4GYG A;  5L3C A;  3VM6 A;  2EPO A;  3TDU C;  1F36 A;  4G6Q A;  2ME6 A;  1WH5 A;  2HFH A;  4F91 B;  5D4R A;  1P4A A;  2XKP A;  1UCR A;  2EQR A;  4EMS A;  3MD2 A;  2CV2 A;  1Q0K A;  3RH3 A;  3DV8 A;  4E7S A;  4IRI A;  1MDM B;  1FC3 A;  1Y1V J;  4BYY A;  4L5I A;  2UZK A;  2YLI A;  3AJM A;  2Q2E B;  2HXO A;  2QEN A;  1I1G A;  1WI9 A;  2K27 A;  3U2R A;  3ZP5 A;  1ETX A;  4P96 A;  2EPN A;  3IH4 A;  5D8L B;  3OYH A;  1SFX A;  1LI5 A;  1X3Z B;  2CRG A;  1Y0U A;  2MD0 A;  2WV0 A;  3MLG A;  1HY5 A;  3BG5 A;  3G2B A;  2R03 A;  1T5O A;  1W5T A;  3R6S A;  2B9S A;  4UVC A;  1HLV A;  5DM7 F;  3IWZ A;  2FX0 A;  3TW7 A;  4DGW B;  1D3Y A;  3RJP A;  2RGV A;  2LY1 A;  1PJR A;  1TP4 A;  1RUN A;  3QVY A;  3AFH A;  1VMA A;  1L0O C;  2B0J A;  4IZZ A;  1FBQ A;  2MH2 A;  4U5F E;  3LS0 A;  1F43 A;  2QE9 A;  2WVN A;  1Z6T A;  4ZLD A;  1R1V A;  1R5G A;  3HOY J;  4M72 A;  2ZCW A;  1FEX A;  1X1A A;  1G3T A;  4LLC A;  3NYJ A;  5L3V A;  2VT2 A;  4N06 A;  4N0B A;  3AGU A;  1UHW A;  2R5Z B;  4UY8 I;  2QUF A;  3UMH A;  3WAQ A;  2VKD A;  4MTE A;  4B1R A;  2XL6 A;  3QOP A;  2R5Y A;  4F4B A;  4MFE A;  4RB0 A;  5HNF A;  3J81 K;  3MKZ A;  1A5J A;  1NLX A;  3HPH A;  1LJ9 A;  2KP6 A;  2VBZ A;  5EG0 B;  1UG0 A;  1C02 A;  1OCZ H;  1RJ9 A;  2JPB A;  5HDK A;  2YL0 A;  4LDQ A;  4J19 A;  2HOA A;  3M3Y J;  3BLY A;  2J46 A;  5TGT A;  2DMQ A;  2COB A;  2VBX A;  3BCB A;  3LSJ A;  3JRD A;  2ZJP F;  2J0X A;  4LK1 F;  4AE4 B;  1G2H A;  3RZO J;  4CCK A;  4BJ1 A;  3E0J B;  3HHH A;  3ISP A;  4GYI A;  2WZL A;  2HMQ A;  1EH8 A;  3JYH A;  1SR2 A;  3HL2 A;  4ZC3 A;  1X3W B;  2O9L A;  4HZF A;  3S1Q J;  3K66 A;  2DQL A;  3OIQ A;  3R0A A;  1N77 A;  3MCZ A;  1I39 A;  3IHU A;  4CCM A;  3JSP A;  1A36 A;  1HE1 A;  4MEX F;  4KYW A;  3FXR A;  4U0Y A;  1WGW A;  2EV6 A;  4AL1 A;  4PJN A;  5JLW A;  3WTW C;  1D5Y A;  1BL0 A;  2XHK A;  3ZQF A;  1YYJ A;  2L7Z A;  3BZK A;  4AX2 A;  3GF2 A;  3GTJ J;  3Q7L A;  1TTY A;  3C7J A;  1EQ1 A;  5T3W A;  1EH6 A;  3GTM J;  2I15 A;  2PX0 A;  1AHD P;  4N6C A;  3T8T A;  4HQM A;  3MVP A;  1BZ4 A;  3DKA A;  2ZXH A;  3CLO A;  3K4M A;  1HSJ A;  5DUK A;  3ZSU A;  1ULY A;  2XB5 A;  2YPR A;  3S93 A;  4Q47 A;  4FAS D;  3GTG J;  1JPJ A;  1MBE A;  5LEK A;  5FB2 A;  1GV5 A;  1HW5 A;  1W7P A;  5EEA A;  1GT0 C;  1XX5 A;  4RAG A;  1TW2 A;  1AVO B;  1FX7 A;  4M73 A;  3S3O A;  2DT6 A;  5L0H A;  4XWJ A;  1IUY A;  3KP6 A;  3TED A;  1Z6R A;  3H9Q A;  1FIA A;  3IQ6 A;  5KYX A;  3BR6 A;  5J4Y A;  2EFW A;  3C1D A;  2R0Q C;  1Z23 A;  3L2V A;  1JOG A;  4A4A A;  3EJN A;  3GEH A;  1V54 H;  3FMS A;  4RS8 A;  5IYC J;  3HOZ J;  2KJG A;  4OU0 A;  4MVQ A;  4DJ9 A;  4FCY A;  5KYY B;  4KIT B;  2HPI A;  1MH4 A;  4RGS A;  3VSL A;  4Y7N J;  4G9Y A;  1V4R A;  1RPW A;  2R25 A;  2WVQ A;  3IQC A;  3SXM A;  1RKE B;  2WBM A;  1PUF B;  1NU7 D;  4AIK A;  3FZV A;  4CSW A;  3QPH A;  1SVM A;  3LA7 A;  3A01 B;  2DA1 A;  1IN6 A;  2ISY A;  3FHD A;  1KON A;  4RLF A;  4G7Z F;  4IHY A;  4I3M A;  2YU3 A;  2A6T A;  2J7P D;  3RQI A;  1XCB A;  3GOD A;  3KET A;  4S05 A;  1XPX A;  2X9D A;  1J8M F;  4PJJ A;  1Z3I X;  5DUI A;  3F8B A;  3NYM A;  1LDK B;  1QGP A;  3FKI J;  3DPL C;  3A11 A;  2HS5 A;  4XN3 A;  2DFE A;  2EA2 A;  2CV1 A;  4U0V A;  3Q3S A;  3GTP J;  3IC7 A;  2FE3 A;  4CYD A;  4KNV A;  4P5O A;  2K7L A;  3PQJ A;  3S9O A;  4EKW A;  4O5V A;  5E3O A;  2M4E A;  3HDD A;  4G78 A;  3VYU B;  1FMW A;  2Q0O A;  2QY9 A;  3I59 B;  1ACI A;  4CGZ A;  4L9V A;  4JC7 A;  3RPU A;  4O6Y A;  2YLG A;  3RQ4 A;  4F55 A;  2EWN A;  3BDD A;  5IOY A;  3ZTZ A;  2WY7 Q;  1FOX A;  1QNT A;  3V7C A;  3EH2 A;  5J1Y A;  4DOZ A;  1SAU A;  2QLZ A;  4V2G A;  4EV0 A;  1K4S A;  1SFU A;  2IS1 A;  1SFK A;  1WPK A;  2PMZ N;  3G1M A;  4HX8 A;  1NK3 P;  2ZFU A;  5IY5 H;  1SFO J;  1VTM P;  1NH3 A;  3ZQL A;  3LQR A;  1NU9 C;  2AQE A;  2F22 A;  3MN2 A;  1ZR2 A;  3ZQI A;  4KIS A;  4ZYH A;  5E8G A;  3OIO A;  1DU6 A;  3RQE A;  3F23 A;  4RMN A;  5M5X J;  3FAJ A;  3VRC A;  2H8R A;  4P1W A;  2L3D A;  1DP7 P;  3U5S A;  3BJA A;  4G7H F;  5T1D B;  3R61 A;  1E3P A;  3FDY A;  2OTL I;  2FMY A;  3EUH A;  3PO3 J;  2DOA A;  1JXS A;  2BOL A;  1M57 C;  1KU3 A;  4R79 A;  3WTT C;  4AU7 A;  4MND A;  3M8E A;  3CJQ B;  1HQC A;  2XPU A;  2IYL D;  1ZAR A;  1LS4 A;  2YKZ A;  2HXI A;  3DF8 A;  5FRO A;  4JCZ A;  5H6Q A;  4CZZ A;  4BY1 J;  2CFX A;  3F3X A;  4IEJ A;  3WHC A;  2IXM A;  2NG1 A;  4NQW A;  4DBR A;  3FIW A;  1WVR A;  1CPR A;  2CCY A;  2EIN C;  4YN0 B;  4HLY A;  1S6L A;  4HDV A;  1CF7 A;  2XPV A;  2R7X A;  4ULV A;  1OYY A;  3BCA A;  4U9E A;  3U8P A;  5A2Q K;  3J80 K;  4C30 A;  2DA2 A;  3KFW X;  2BVM A;  3VAY A;  3DU6 A;  1JGS A;  1UG2 A;  2H1K A;  2Y3H A;  3AOU A;  1T08 B;  2EBI A;  3WU0 A;  3L0I A;  3S27 A;  3I56 I;  2VCB A;  2OPT A;  3LLI A;  5K7F A;  1WRJ A;  4CJG A;  3MFK A;  1PUE E;  3CDL A;  5TIS C;  2YU9 J;  2LSO A;  3U9J A;  2KQR A;  2DYS H;  4MTF A;  5IY5 C;  2V4J C;  2L9S A;  2FEZ A;  3O8H A;  5LBQ A;  2I8D A;  2MA3 A;  3HOV J;  1NBB A;  4RD9 A;  2Y9Z A;  2DLL A;  1MBJ A;  2KDO A;  2DXI A;  3IRQ A;  3ASN C;  3RW0 A;  1YX3 A;  2H6C A;  2ZD9 A;  3V5Z A;  3WHB A;  1YDI A;  4UUV A;  1ZHT A;  3SXZ A;  1OXB A;  4ESF A;  3QP6 A;  2IXN A;  4XOT A;  4I2O A;  4FX0 A;  2OJQ A;  5LHG A;  4ANJ A;  3SQN A;  5HDN A;  1YAU O;  3RDI A;  2ZME C;  1W0T A;  3HTS B;  2FQ4 A;  4A3B J;  1JI8 A;  4D1Q A;  3RF3 A;  2QSG X;  5D6F A;  2DJI A;  3A0H C;  4BE0 A;  3F9K A;  2XAQ A;  3K4J A;  2KIS A;  3AQC A;  2WV1 A;  3GLX A;  5T3T A;  1P4X A;  2VQH A;  4WF2 A;  3E6D A;  4CCN A;  4LIV A;  2NUP A;  2K9S A;  3I3L A;  5CI8 A;  1LFU P;  2MAB A;  1VZ0 A;  4JKV A;  2D45 A;  1R9T J;  4MIM A;  2AVK A;  1JPN A;  4WCG A;  5DM6 F;  4KI2 A;  3L09 A;  1LFB A;  4RAF A;  4GEH A;  3PUB A;  2MW8 A;  3R4K A;  4XPX A;  5IPA A;  2XXA A;  1OIS A;  5KVR A;  4KT6 A;  3L9F A;  1YQA A;  3V5X A;  2M30 A;  1K05 A;  2MWQ A;  3NRV A;  1KQ8 A;  2A6H F;  3TJ6 A;  1MNM C;  5B3S H;  1T2K A;  4ENK A;  4B4C A;  3RKW A;  1TBX A;  1FYM A;  3G4X A;  2E2J J;  4M9X A;  4JW1 A;  1ZR4 A;  1BI1 A;  1TT5 B;  1K78 B;  3E6C C;  4GQH A;  3WTU C;  2LC2 A;  1VYK A;  1R4M B;  4OOI A;  4I09 A;  1G59 A;  1WTY A;  4U0W A;  1ON1 A;  5DD8 A;  1M2V A;  2LYC A;  1FSE A;  3WTS C;  2DO7 A;  2CGE A;  2YZS A;  2KJB A;  1P6R A;  4XTK A;  2GIV A;  5COF A;  1K7A A;  3I0T A;  2E87 A;  2A69 F;  4LMY A;  4U88 A;  2DYR H;  5LRS A;  1X2N A;  3H1C A;  4HDU A;  4DBQ A;  1QHH D;  4YT4 A;  4R1H A;  3ASO H;  3SZR A;  5LEJ A;  3S29 A;  2W00 A;  2Q3T A;  1RC9 A;  2VJ5 A;  2GDC A;  2KLO A;  4AWX B;  2G3K A;  2LSE A;  4N9H A;  2Z2S B;  2EV0 A;  3L2R A;  4JCH A;  1SFE A;  4IXA A;  3KPH A;  1WJB A;  1YLM A;  1T9K A;  1PD1 A;  3T6B A;  1XSX A;  2IEK A;  3KP7 A;  5J1R A;  3HTU A;  3CC4 I;  2P4W A;  3JCU Q;  3FXH A;  2KNH A;  1OR7 C;  2GLO A;  2GA0 A;  2L4A A;  1IF1 A;  4ZZL A;  3KP3 A;  3E7L A;  4CH7 A;  2JSP A;  1TWC J;  3IH2 A;  4IJJ A;  4E70 A;  3O3K A;  5L0C A;  1MW7 A;  3CJN A;  3K7A J;  3VEP A;  3I5Q A;  1Y6D A;  3FIS A;  5ICE A;  2R7R A;  3CCL I;  4E0I A;  2GWW A;  5L0D A;  2KRC A;  2BW3 B;  1FZP B;  2X6O A;  2XRH A;  5B3S C;  1MJA A;  5HLT A;  5BNG A;  2VCC A;  3IUO A;  4FWV A;  1J75 A;  2MD5 A;  4N6H A;  2HJ3 A;  5F0F A;  5FLV A;  1DPR A;  3LAJ A;  4A3L J;  1DQU A;  1UFB A;  3ABK H;  2M0M A;  2J7P A;  3W6V A;  4FQG A;  1YHQ I;  3CEX A;  3U9M A;  1F1M A;  1YE9 A;  4A12 A;  2Y0M A;  3CLQ A;  4CX9 A;  5CIV A;  4XSX F;  4J7T A;  3ABT A;  1ENH A;  4LLN A;  4M9Z A;  3W8I A;  2DK5 A;  4JTD B;  1NSG B;  1JGG A;  2DYR C;  3HNK A;  1PP8 F;  5JUA A;  4XLN F;  2O8X A;  5M3M J;  1WJ5 A;  4LG0 B;  5FKK A;  3ASO C;  1DOW A;  1YS7 A;  4FTH A;  2W4B A;  3KZY A;  3DBR B;  1TNS A;  2VC0 A;  5FFZ A;  3V7R A;  4JE9 A;  2P6S A;  2GXA A;  3VYS B;  1U9O A;  1RR7 A;  2K02 A;  4BE2 A;  4NB5 A;  1HDD C;  4B47 A;  2VUM J;  1Z3X A;  3J7A O;  3NWT A;  2DCE A;  3LFK A;  3ZQH A;  2Q9B A;  2A5W A;  3LSR A;  3HIF A;  4EJO A;  3MYF A;  4HRI A;  4MTD A;  3DTI A;  2ZNY A;  3V5Y A;  4U5E E;  3C62 A;  2ZME B;  4MFD A;  2NUT B;  4XN0 A;  3LST A;  3C3W A;  3H35 A;  1FSH A;  2PBI A;  1C03 A;  2V79 A;  3ABL H;  3OS1 A;  2O6G E;  3S1M J;  1O5H A;  3I58 A;  4KNY A;  3FAP B;  2ETH A;  2VCA A;  2DU9 A;  3CP2 A;  2CW8 A;  5KAI C;  1AWC A;  3M1C B;  2L7F P;  4EJW A;  3OR1 C;  4JUR I;  2OUM A;  2XV4 S;  2XAG A;  1KU7 A;  2LOO A;  3ECO A;  5LD2 C;  2J9W A;  3DKY A;  2L9J A;  3IL2 A;  1VQO I;  3DZA A;  3BJ6 A;  4XQF A;  3LQQ A;  4AYB A;  3CC2 I;  1VYI A;  1U3E M;  1TWC A;  2NOG A;  3ABK C;  4A3D J;  3CP8 A;  1WN0 A;  3SZG A;  2CJJ A;  4XOP A;  2X48 A;  1OFC X;  1EA3 A;  2JRT A;  3HC7 A;  4NBQ A;  3JRF A;  1AKH B;  2CNW A;  2ETS A;  3ROU A;  2PG4 A;  1OCC H;  3PJR A;  2LP4 A;  1YYV A;  4GFB A;  2HKX A;  1R49 A;  2UUH A;  4XLH A;  2KIQ A;  2WAD A;  1HA8 A;  3ZIB A;  2V26 A;  3RVY A;  4BGD A;  1BI3 A;  4DYC A;  4EGY A;  3FHN A;  5EZH A;  1WHU A;  2O8K A;  3I4U A;  5E79 C;  2VOO A;  2E7W A;  3ZTM A;  4IQ4 A;  1ZLK A;  1WJE A;  2R05 A;  3K1P A;  3S15 J;  1VOM A;  1ZGA A;  2XAU A;  3GO5 A;  4BBR J;  1BA5 A;  1TKN A;  1B4A A;  3SYT A;  2XLD A;  2P6T A;  2TRT A;  5D5U B;  4V19 K;  1LUJ B;  5JVT A;  1JT0 A;  4UUS A;  3EG9 B;  3ZC4 A;  3CCV I;  3R60 A;  1X4P A;  3V4G A;  4XRS G;  4AVZ A;  2XDV A;  2JQ7 A;  4MLO A;  4OIQ F;  3ABL C;  2P7V A;  1BI0 A;  2VL8 A;  4HST A;  1OKK A;  4DW6 A;  5GPC A;  2V6C A;  3HRS A;  3WU2 C;  2R7W A;  4BE1 A;  2O5R A;  2XIG A;  2VOD A;  3FXO A;  1ITY A;  2E2I J;  4XON A;  3K2Z A;  1ZRD A;  2VOP A;  2EV5 A;  2R4G A;  5F0H A;  3EPZ A;  5FGM A;  5IP6 A;  2ECC A;  3K70 C;  3GEZ A;  2Y39 A;  1WWX A;  3C8Z A;  2HZD A;  1YW8 A;  1QO0 D;  4RB1 A;  4HEA 2;  3I4P A;  4JEB A;  3ZMS A;  4LLE A;  3IP4 B;  5EGY A;  2TDX A;  3EPV A;  1VF9 A;  4F92 B;  2DA6 A;  2ESN A;  3A02 A;  4LB6 B;  3IEE A;  2XSE A;  3DBH B;  4KIF A;  1YIO A;  1ZZP A;  3NQO A;  3Q9V A;  5TJ5 E;  5F1J A;  1ETY A;  1QHG A;  2BY2 A;  4BY7 J;  2CMP A;  2D1V A;  3A03 A;  2W24 A;  5FLX Z;  2XL4 A;  2EZH A;  5KYN A;  2GOM A;  1S05 A;  3MX3 A;  4K2E A;  4KIG A;  2K86 A;  1Z9C A;  3F72 A;  4XEF A;  2YL3 A;  5BQH A;  5ILS A;  4B43 A;  1VQ8 I;  3VDX A;  1WGX A;  2XRO A;  4ULW A;  2O3F A;  2LLK A;  5D5V B;  2JA6 J;  2R5Y B;  1Z5Z A;  5AC5 A;  2FNA A;  2O0Y A;  1VFC A;  2R92 J;  2E5Z A;  1W4M A;  2JD3 A;  4C3D A;  1RJ9 B;  2K85 A;  3GEI A;  3PQK A;  3TP3 A;  1BOB A;  2K5C A;  3NWS A;  3V7O A;  1IRF A;  1OW7 A;  4J7Y A;  3QYE A;  3FBI B;  3S32 A;  3ZRG A;  1FTT A;  4BDY A;  3EUH C;  5HNH A;  4D0P A;  3QW0 A;  4D5C A;  2DT7 B;  3Q0W A;  2QBY A;  4G6D A;  4ZDO A;  2QF7 A;  3DFG A;  3EGX A;  1XGM A;  4O3M A;  5C3E J;  4EM0 B;  1YO5 C;  4R8H A;  2VJI A;  2R02 A;  4YL1 A;  4NHJ A;  1ETQ A;  4RBO A;  1YJW I;  3F0C A;  4RGX A;  1I27 A;  4ENM A;  4Z2Y A;  3BTC A;  4HX4 A;  4H0E A;  3AG3 H;  2P0N A;  3WG7 C;  4CSA C;  3NDB B;  4D5F A;  3WTV C;  3OYJ A;  3WTZ A;  3HOT A;  1Q1V A;  3JR9 A;  4KFC A;  1LE8 A;  2XL8 A;  1TWH J;  1WOL A;  4QI2 A;  4LIU A;  3S17 J;  4FE4 A;  2ID3 A;  2BC5 A;  4IAO A;  2TCT A;  4IOC F;  4MNU A;  4JTA B;  2KGO A;  3TQO A;  3OMY A;  2J9U A;  2FBK A;  2BY3 A;  2OEX A;  4CCO A;  4BUP A;  3WU1 B;  3GTO J;  2JUC A;  1ZRF A;  3KMI A;  3HPG A;  1FNN A;  4KT5 C;  4E7I A;  2V9K A;  1LS1 A;  1EA8 A;  1W7P B;  1YA9 A;  3AAF A;  2HUJ A;  4XPW A;  5E33 A;  3D5R C;  2XGC A;  1IV6 A;  1ZKG A;  3FXK A;  2DT5 A;  1VI0 A;  3LFU A;  2PMH A;  4GCV A;  4PZJ A;  1X1P A;  3CMA I;  5H2F C;  4LD5 A;  2KSF A;  4ONS A;  5HS7 A;  2VI6 A;  4IO9 F;  3HZJ A;  3RTR A;  3KX2 A;  5KYX B;  5ICG A;  2PX3 A;  4E7H A;  2EJR A;  2VB6 A;  3DEW A;  1JT6 A;  3TL4 X;  4BJT A;  3K4L A;  1G4U S;  3HUG A;  1VTN C;  3DKX A;  2NNN A;  3UKG A;  5IP7 J;  1SMY F;  3JRT A;  3QU3 A;  1QQ3 A;  3IQ5 A;  1ZW3 A;  2M64 A;  3W8H A;  3REO A;  1B72 A;  2IXP A;  2G7U A;  3S1R J;  4ZTF A;  4NC7 A;  3OY9 A;  3SFZ A;  2ZXR A;  1ZG3 A;  4BJ6 A;  1X3U A;  1XGN A;  1M2O A;  2R7Q A;  2WB7 A;  1LPE A;  3QPT A;  2BL2 A;  5D91 A;  4I99 C;  4JX5 A;  3X2Q H;  4IJA A;  3AKZ A;  1KU9 A;  4BH9 A;  3AG3 C;  4Q48 A;  3G4S I;  4LAC B;  2MGQ A;  3E9V A;  1QVU A;  3OEO A;  3CTA A;  5EZG A;  4GO1 A;  1S7A A;  2HOT A;  3CUO A;  2LKX A;  1PYV A;  5K0I A;  3J7Y J;  1CGP A;  1YOV B;  4F7Z A;  1YFH A;  5FO5 A;  3W6K B;  4WJ0 A;  4I6Z A;  4I1M A;  5FCL A;  1I6X A;  3HGY A;  3A0B C;  3SHF A;  5DS5 A;  2R93 J;  5JP7 A;  3O2P E;  2HTS A;  2DAO A;  3M9A A;  2W48 A;  5C44 J;  1TT0 A;  3CO7 C;  4OD5 A;  2CUF A;  2L54 A;  3DWL E;  3ESW B;  3TO6 A;  1YJ9 I;  4MW8 A;  3FKJ A;  5KAF C;  1TWH A;  4RM3 A;  2X6Y A;  1NFO A;  3SDG A;  1CPQ A;  3W4Y A;  1Z7Q c;  3JTG A;  3BWG A;  3VWB A;  4HV5 A;  2AU5 A;  4ZJZ A;  1E86 A;  1FP2 A;  3ATP A;  4B8X A;  1A7D A;  1RI7 A;  2F4O B;  2DPU A;  1FOY A;  1D8K A;  4MTO A;  2YQY A;  3ABM C;  3SDB A;  4IF4 A;  1KNY A;  3OYK A;  3H5A A;  1ORK A;  3QWL A;  2GM4 A;  4LIT A;  2C04 A;  3K33 A;  3KYC B;  4U5H A;  3LS1 A;  1OQC A;  2P5K A;  2Q4F A;  1RCP A;  1UG7 A;  1R5I D;  5FKL A;  1OR7 A;  2GIZ A;  2R3S A;  1QZX A;  1QZY A;  4D7M A;  1Z3Y A;  3PNT A;  3OL4 A;  5B66 C;  1CGO A;  1O3T A;  2Q9A A;  4LDR A;  4LK0 F;  1GVD A;  2LY2 A;  4M3E A;  1FBU A;  1KU2 A;  3X2Q C;  1TC3 C;  4RGR A;  1JUS A;  1VND A;  2VBW A;  2RRE A;  5DYM A;  2VT3 A;  4IWB A;  4D4N A;  2ZSI B;  1H7I A;  4HNT A;  1MBF A;  1VLS A;  1UB9 A;  2Z5U A;  2VKE A;  1C0W A;  1ZHF A;  5GP9 A;  4A3E J;  1RR8 C;  2FQ3 A;  1U89 A;  4W8P A;  2H7B A;  3OYF A;  1OR3 A;  2YEV A;  5BS6 A;  4NQW B;  3FOP A;  3OL3 A;  2QSF X;  3PIO F;  1SYQ A;  4PJM A;  2EZK A;  2H27 A;  3BP8 A;  2KYH A;  2LKS A;  2DA4 A;  3LSG A;  2KIU A;  1CF7 B;  4IHS A;  1YAR O;  3HNL A;  4EBB A;  2Y31 A;  1TW3 A;  5E1W A;  3RCO A;  3T1B A;  3OYA A;  2E60 A;  2P1A A;  2KC3 A;  2ZFW A;  1VQP I;  4ZYA A;  1IG7 A;  3I71 A;  5BPD A;  1BC7 C;  1GDT A;  4C2U A;  1V5F A;  3BG6 A;  2A61 A;  3DI5 A;  1I3Q J;  2DFF A;  1ZU5 A;  4NCQ A;  4Q5S F;  4EIY A;  1R22 A;  3K4N A;  4PJ0 C;  4A3K J;  2V6E A;  3SP1 A;  2LR8 A;  3C2B A; 
#chains in the Genus database with same CATH homology
 3BCA A;  2VAS A;  5E3A A;  3QYF A;  1Y6I A;  2KRH A;  4XKV A;  4C30 A;  3OYD A;  1V5G A;  2BVM A;  3VAY A;  2HVS A;  4B6I A;  2JA2 A;  3DU6 A;  3L2Q A;  2Y3H A;  4ZLC A;  2F5V A;  2WAE A;  4OAZ A;  4PSW A;  3S27 A;  3L0I A;  5KNL A;  2WL8 A;  2K9L A;  4C3E A;  3LLI A;  3IAM 2;  4ZDL A;  2R7V A;  1D0X A;  3EZH A;  2KQR A;  2VQL A;  5HOO A;  5IY5 C;  2W4S A;  2V4J C;  2L9S A;  2P0W A;  4HFK B;  2XF6 A;  3IAS 2;  4XLC A;  4EAT A;  2M4G A;  1UAA A;  2R7O A;  3L2W A;  1WJF A;  2I8D A;  1Z6A A;  5KYU A;  4RD9 A;  2DXI A;  2KDO A;  3ASN C;  2WAF A;  3DJU B;  5B1A C;  1YX3 A;  4XR6 A;  2NUP B;  5DLJ A;  3KL4 A;  1X4O A;  2JUG A;  4FX5 A;  4HE8 D;  3OS2 A;  1Z7L A;  1ZHT A;  1W36 D;  2IXN A;  4XNF A;  4XOT A;  4J00 A;  4W8K A;  4ANJ A;  4Q4Z F;  1MMA A;  3D5S C;  3RSN A;  2M4K A;  2XXA B;  1JI8 A;  3RPU D;  3QMK A;  3H9G A;  4HPQ A;  4D1Q A;  2CDQ A;  2IGK A;  2DJI A;  2X1E A;  4BE0 A;  3F9K A;  2WB1 A;  3K4J A;  3OWT A;  3W2A A;  1OCZ C;  3ONQ A;  4U87 A;  3AQC A;  3UMK A;  5T3T A;  1W2W A;  2VQH A;  1IW7 F;  4CCN A;  4LIV A;  2PP4 A;  1X1B A;  1FFH A;  3AL0 B;  2NUP A;  3I3L A;  4I44 A;  5CI8 A;  2MAB A;  1VZ0 A;  2R7S A;  2X6X A;  4J30 B;  3UGP A;  2KL4 A;  4B44 A;  2A6E F;  4U7B A;  1JPN A;  5LFA A;  3CSK A;  3DAG A;  4U5G A;  4KI2 A;  3MKY B;  3VYT B;  3LSI A;  2WA0 A;  1M2V B;  4GEH A;  2V7F A;  3PUB A;  4P6I C;  2HDW A;  3VYW A;  1Z63 A;  2XXA A;  3W3C A;  2KW3 C;  3CQZ A;  2W1O A;  2XF5 A;  4KT6 A;  4YEJ A;  2MWQ A;  2Y0S A;  1MMN A;  4Q7C A;  2Q1Z B;  4CS8 A;  1ERD A;  2A6H F;  3LAY A;  3E1S A;  4BU2 A;  2VH3 A;  3UNG C;  3LJB A;  1X19 A;  1J09 A;  2KMU A;  3MMY B;  2LG4 A;  4E7Z A;  4JW1 A;  1D1B A;  3T6J A;  4YJW A;  4BEJ A;  4CS9 C;  2J9V A;  3EGD B;  2LC2 A;  1VYK A;  2KZV A;  3H9J A;  1G59 A;  1BR2 A;  1TZL A;  3OYG A;  4E7K A;  2ZXP A;  1M2V A;  2L9N A;  2LYC A;  3OYB A;  3ZG1 A;  2WZF A;  2CGE A;  1ZYR F;  2KHM A;  2XC7 A;  2YZS A;  3LSH A;  4XTK A;  3S28 A;  1LFP A;  2F6C A;  3OOU A;  2E87 A;  4NNJ A;  2A69 F;  3EHN A;  2W82 A;  2PJR B;  4HEA J;  3UR3 C;  4DBQ A;  1QHH D;  4KJZ A;  2CV0 A;  4YT4 A;  3SZR A;  3EUA A;  4XM3 A;  4OIO F;  3S29 A;  2W00 A;  4RM2 A;  2Q3T A;  2VJ5 A;  2VJJ A;  2Y3B A;  2KLO A;  2M7B A;  3I9V 2;  1TR2 A;  2LH9 A;  1VK5 A;  2G3K A;  2LSE A;  4DJA A;  2OV7 A;  1V54 C;  2Z2S B;  2Q9C A;  3L2R A;  1W36 C;  1Z21 A;  2UV1 A;  1ZHW A;  2HU9 A;  4JCH A;  2MYS A;  1V55 C;  2RNG A;  2P6V A;  1WJB A;  3PL8 A;  3QOE A;  4LG3 A;  2Y3G A;  4YT2 A;  2IGM A;  4KC9 A;  3BC8 A;  2PJR A;  1PD1 A;  2PF4 E;  3K6B A;  3T6B A;  3E70 C;  4J32 B;  2LRD A;  2UUZ A;  3AG1 C;  4ZDP A;  4Y3O A;  3C2G A;  3JCU Q;  2KNH A;  3K6G A;  2ELJ A;  1OR7 C;  2G3V A;  2LRE A;  4X0G A;  2QKL B;  3OYI A;  1ST6 A;  3FBN B;  3K4B A;  4CH7 A;  2JSP A;  3LL7 A;  1TWA A;  3ZGK A;  2G62 A;  2DGJ A;  2HV7 A;  1MW7 A;  2E5N A;  1SZI A;  2IOQ A;  2IS4 A;  3NYL A;  1D1A A;  1WJC A;  1Y56 A;  4CZC A;  4E7J A;  1NG1 A;  3I5Q A;  5DS4 A;  3CZ6 A;  2ZXO A;  4CSA C;  2R7R A;  3SEZ A;  4DIQ A;  1AA7 A;  2KRC A;  2BW3 B;  4PK4 A;  2XRH A;  5B3S C;  3J7A Y;  2VKH A;  5HLT A;  4HSR A;  3CF2 A;  4E4H A;  1FTS A;  3IUO A;  3F46 A;  4NUB A;  4FWV A;  3PHF 2;  4G7O F;  2HQA A;  2X6W A;  3DAF A;  4RBN A;  1DQU A;  2UWM A;  2M0M A;  3HG9 A;  2J7P A;  3LLK A;  2Z16 A;  4XLE A;  4QDL A;  1YE9 A;  3HLZ A;  4CIH A;  3EFO B;  4HNU A;  2W4M A;  1S9H A;  3AG4 C;  4K0D A;  3DTE A;  3K1H A;  3W8I A;  1PD0 A;  2BW3 A;  4IKF A;  2DYR C;  3H5N A;  1T0F C;  3C2H A;  4XLN F;  5CKT A;  2WAQ A;  3GAN A;  4YT8 A;  1UEL B;  4XLP F;  1WJ5 A;  3CES A;  4PSX A;  4C2T A;  3ASO C;  3LNR A;  1ZEL A;  2W4B A;  2AQF A;  1MNE A;  2I8B A;  3K1I C;  4IX7 A;  3I5P A;  4HFF B;  3VYS B;  4BE2 A;  3EFO A;  3H5R A;  4B47 A;  1Z3X A;  5BUO A;  3NWT A;  2DCE A;  2OCC C;  2Q9B A;  2A5W A;  1PCX A;  4AK9 A;  1IZM A;  3HXL A;  4CBE A;  4PJL A;  3S3M A;  4HRI A;  2X1C A;  2F4I A;  3DTI A;  3SYN A;  4U5E E;  4JJG A;  3DEE A;  4YWQ A;  2NUT B;  4XN0 A;  3H35 A;  1O5H A;  2V3C C;  3OS1 A;  4QPQ A;  2FUG 2;  3OR2 C;  2A68 F;  1OCR C;  2EIJ C;  4O6N A;  3PMR A;  3K70 D;  3S0X A;  2OC6 A;  2EIM C;  1P9Q C;  2CW8 A;  3CP2 A;  2FFH A;  3QZC A;  3T4R A;  1MMG A;  3M1C B;  4KNW A;  2HV6 A;  4PUS A;  3OR1 C;  2CS3 A;  2V1N A;  2OUM A;  5CPR B;  2C03 A;  4JUR I;  4G0H A;  2LOO A;  5LD2 C;  5KCM A;  2J9W A;  3Q6N A;  5DVW A;  3DKY A;  4II3 A;  3PNY A;  4GYT A;  2CW7 A;  2L9J A;  4LER A;  2NUT A;  2WVO A;  1NG6 A;  3DZA A;  4FET A;  4A2N B;  4XQF A;  4AYB A;  1VYI A;  1TWC A;  3ABK C;  2W7N A;  2BE5 F;  3LES A;  3CP8 A;  3SZG A;  4K7B A;  4XOP A;  1QLE C;  4I1O B;  3M1C A;  3FDQ A;  3HC7 A;  1EA3 A;  2IGN A;  2K3P A;  4OIP F;  2CNW A;  4RLQ A;  3ZCO A;  3RIP A;  3PJR A;  3DD7 A;  4IQJ A;  4BJ6 C;  1DGR M;  2CH0 A;  4XLH A;  2WAD A;  3PNV A;  1HA8 A;  3ZIB A;  2V26 A;  4NY3 A;  2JVH A;  4CS7 A;  4BGD A;  2VLA A;  3FHN A;  3GBG A;  4JQF A;  3I4U A;  4OIN F;  5CQG A;  4O6M A;  2XF7 A;  4IQ4 A;  1N1C A;  1WJE A;  2ZSH B;  4OAY A;  2Y3D A;  3KKB A;  2HVQ A;  1DP3 A;  1X1C A;  1VOM A;  3OA1 A;  3B0U X;  3TD7 A;  3K10 A;  2CUJ A;  1FFT C;  2XAU A;  1TKN A;  2K9M A;  5DQZ A;  5DQT A;  4BQN A;  3SYT A;  2DYS C;  4YEL A;  2H7O A;  4CS9 A;  3V42 A;  4B48 A;  4FES A;  2Y69 C;  4F3Q A;  2EIL C;  3EG9 B;  3ZC4 A;  2R7T A;  1X4P A;  4BDZ A;  1D0Y A;  4AVZ A;  4BJ5 C;  2XDV A;  2X51 A;  3AG2 C;  4MLO A;  1FMV A;  4OIQ F;  3ABL C;  4QPO A;  2P7V A;  2VL8 A;  4HST A;  3HOS A;  2M7A A;  2LBF B;  1OKK A;  2R7W A;  4BE1 A;  2O5R A;  4G6T B;  3A1Y A;  1O87 A;  2PFD A;  5B1B C;  3B0V C;  2GOX B;  2FGY A;  4XON A;  3W2V A;  4CUG A;  3EGD A;  3CJR B;  1TWG A;  2R4G A;  3N05 A;  3EPZ A;  1YX5 A;  4J01 A;  2IXS A;  3K70 C;  3OYL A;  2Y39 A;  3EG9 A;  3DM5 A;  1T95 A;  1WJD A;  2HZD A;  1X1D A;  5E2Q A;  4HEA 2;  4LLE A;  2VIX A;  3IP4 B;  5EGY A;  4F91 B;  1D1C A;  3HKZ A;  3EPV A;  4F92 B;  2CV2 A;  3MD2 A;  3RH3 A;  4U5C E;  3IEE A;  4U5D E;  4E7S A;  2LBF A;  2R7U A;  1OLT A;  2XSE A;  4MQ9 F;  2J0W A;  3OIP A;  5DS6 A;  2QTV A;  3RKO F;  2J45 A;  1QHG A;  2Q2E B;  2CMP A;  2XL4 A;  5KYN A;  4C9Y A;  2GOM A;  4DVZ A;  3MX3 A;  3OYH A;  5FRN A;  4B43 A;  2MD0 A;  3MLG A;  3DPT A;  3G2B A;  3VDX A;  3U21 A;  1OCO C;  4CSA A;  4Y4R A;  4ULW A;  4DVY P;  2GFH A;  3HTK C;  4BG0 A;  2MFZ A;  3A4C A;  1Z5Z A;  3EGX B;  4DGW B;  4GRI A;  1R6R A;  4XKC A;  3EZI A;  2LY1 A;  1PJR A;  2E5Z A;  3AFH A;  1VMA A;  2EIK C;  2B0J A;  4IZZ A;  1RJ9 B;  2JD3 A;  4U5F E;  4C3D A;  3LS0 A;  1BOB A;  3QYB A;  2K5C A;  2WVN A;  3NWS A;  3V7O A;  2JVG A;  4EWC A;  1G8X A;  4ZLD A;  5L3V A;  1X1A A;  4LLC A;  3NYJ A;  4N06 A;  3LSM A;  2IGO A;  3FBI B;  3QYE A;  3S32 A;  3ZRG A;  4JOM A;  3MKW B;  4BDY A;  2CUZ A;  3EUH C;  5HNH A;  2CFO A;  3UMH A;  2DT7 B;  2VKD A;  4ZDO A;  3UGO A;  5CQE A;  3EGX A;  4F4B A;  2L7K A;  4U5B E;  4IWB A;  5HNF A;  3SEO A;  4CCJ A;  3MKZ A;  2VJI A;  3HPH A;  2KP6 A;  1ZHY A;  3K4K A;  3PSI A;  4XKB A;  3B0P A;  3NRH A;  1UG0 A;  1QU3 A;  4QI0 A;  1RJ9 A;  4OWR B;  4XLA A;  1N75 A;  3WG7 C;  3NDB B;  2CNW D;  3BLY A;  3OYJ A;  3LSK A;  4BAC A;  5TGT A;  3OYC A;  3BCB A;  2D5R B;  2J0X A;  3HOT A;  3OS0 A;  2J46 A;  3LEV A;  3RFY A;  4AE4 B;  4BJ1 A;  4CCK A;  1NG7 A;  3E0J B;  4QI2 A;  4LIU A;  2WZL A;  1D0Z A;  3JYH A;  3HL2 A;  4ZC3 A;  4IAO A;  3LMM A;  2IXO A;  2Z1D A;  1J8Y F;  3N24 A;  4YT5 A;  4CCL A;  2E1M C;  4BL0 B;  2KGO A;  4HG2 A;  3X1O A;  3OMY A;  2J9U A;  3QOD A;  3K66 A;  3WOD F;  1V5E A;  4CCO A;  4BUP A;  1WFX A;  3OIQ A;  3HUG B;  1N77 A;  2MC4 A;  3KMI A;  5L3Q A;  3Q7G A;  4CCM A;  3HPG A;  3AQB A;  4E7I A;  1LS1 A;  2V9K A;  4JJF A;  4JVS A;  4O7G A;  4YN0 B;  4C3B A;  4AE4 A;  1WGW A;  2VJ4 A;  5E33 A;  3D5R C;  2CW0 F;  4BEH B;  4PJN A;  3W2W A;  3OYM A;  3LFU A;  4II2 A;  3SEQ A;  1N78 A;  1WJA A;  2IS2 A;  1S7Z A;  3HJC A;  3NKD A;  4AX2 A;  2WY8 Q;  4IJJ A;  4M63 A;  2PMZ A;  4N4N B;  3Q7L A;  2BVL A;  4XMY A;  3RTR A;  3F47 A;  3KX2 A;  5KYX B;  1ZHZ A;  1IRX A;  4ITV A;  2XSJ C;  2PX0 A;  1OKK D;  2PX3 A;  5T3W A;  1MMD A;  4E7H A;  2NOJ B;  3DU5 A;  2VQG A;  4YRV A;  2VB6 A;  3KH2 A;  5F5F A;  3O6X A;  2M3A A;  2ZXH A;  3K4M A;  3K4L A;  3TL4 X;  4NC8 A;  4BJT A;  2L81 A;  2X85 A;  2Z15 A;  3ZSU A;  3DKX A;  3S93 A;  4FAS D;  1JPJ A;  4PFO A;  1SMY F;  2H7V C;  3JRT A;  4X0R A;  3DLA A;  2YHS A;  3FVY A;  2L5Q A;  3DM9 B;  4BEH A;  5JHF A;  4IRU A;  3S3O A;  2DT6 A;  3DQV C;  1K6Y A;  3W8H A;  2IXP A;  3KYL A;  4XWJ A;  4BXF A;  4ZTF A;  4NC7 A;  3OY9 A;  2VXZ A;  3H9Q A;  5FRM A;  2ZXR A;  5KYX A;  4BJ6 A;  3O39 A;  1Z23 A;  2OG2 A;  1M2O A;  3L2V A;  2R7Q A;  2WB7 A;  3EJN A;  5D91 A;  4PFP A;  2HNH A;  4E7L A;  2KJG A;  3AKZ A;  3ZVR A;  3S3N A;  2VPL A;  3AG3 C;  4LAC B;  5E3C A;  3L2U A;  3E9V A;  5KYY B;  4KIT B;  2HPI A;  4XLF A;  3VSL A;  3OEO A;  2W45 A;  3POV A;  3L34 A;  3PSF A;  1PYV A;  2WVQ A;  3ITF A;  2KQ9 A;  3NG1 A;  2WBM A;  3H65 A;  4WJ0 A;  3EH1 A;  5FCL A;  4I1M A;  1SF8 A;  4XL9 A;  2QKM B;  1NU7 D;  3K7D A;  4CSW A;  3OYE A;  5DS5 A;  2X1D A;  4F52 A;  3FHD A;  3DJN B;  1KON A;  1TT0 A;  4RLF A;  3Q6M A;  4I3M A;  4OD5 A;  4BJ5 A;  4G7Z F;  3N2Z B;  3DWL E;  3ZXS A;  4CS8 C;  5KYY A;  4F93 B;  2A6T A;  3FKJ A;  4D9J A;  2J7P D;  3AL0 C;  1TWH A;  3GOD A;  1MND A;  4RM3 A;  5CI9 A;  2X6Y A;  1Z3I X;  1J8M F;  4RDA A;  4PJJ A;  1ZHX A;  3JSZ A;  5D92 A;  3M8J A;  2A1D D;  3NYM A;  1LDK B;  1LKX A;  3DPL C;  3VWB A;  3DPU A;  4OD4 A;  4ZJZ A;  4XN3 A;  4B3X A;  2CV1 A;  5HVQ C;  4O79 A;  1GLN A;  2VXD A;  4KNV A;  4P5O A;  4XKW A;  4ZTJ A;  2M4E A;  3VYU B;  3ABM C;  4OIR F;  1FMW A;  2QY9 A;  3SDB A;  3K33 A;  4KBL A;  3OYK A;  3H5A A;  3EHM A;  2C04 A;  4LIT A;  3VYR B;  3B9Q A;  4O6Y A;  3RQ4 A;  3ZQQ A;  4F55 A;  3LS1 A;  4U5H A;  1DGW Y;  2WY7 Q;  4BQO A;  2IS6 A;  4E6K G;  2O9X A;  3EH2 A;  5HSW A;  1OCC C;  2W9Y A;  3JT1 A;  4DOZ A;  1SAU A;  2IS1 A;  1QZX A;  2HVR A;  1Z3Y A;  1SFK A;  3OL4 A;  3PNT A;  2Q9A A;  2ZPA A;  5F5H A;  3BG7 A;  2LY2 A;  3KEY A;  1KU2 A;  3X2Q C;  3K4C A;  2ZFU A;  4CA0 A;  4C7O B;  2RRE A;  3TBI A;  4BS9 A;  4XOR A;  1ZU4 A;  2ZSI B;  1NU9 C;  3EUK L;  5KYW B;  1BR4 A;  2AQE A;  2VQC A;  4HNT A;  4KIS A;  4JZA A;  3UMI A;  2HPM A;  2ZXW C;  3D5L A;  4RMN A;  2H7B A;  3OYF A;  3DXJ F;  1BR1 A;  3FAJ A;  4P1W A;  1E0E A;  3PFY A;  2YEV A;  4G7H F;  4N4O B;  4NQW B;  5T1D B;  3OL3 A;  3FDY A;  4H4K C;  4PJM A;  2ZXI A;  3VSK A;  2DOA A;  3OYN A;  3H0D A;  3LSG A;  1U0J A;  1NZE A;  4EBB A;  4C7O A;  2BOL A;  1LVK A;  1M57 C;  3DMD A;  3EQL F;  5KYW A;  3RCO A;  4R79 A;  4AU7 A;  2E1M B;  3OYA A;  4MND A;  3RYL A;  3S8P A;  2E60 A;  3ZR8 X;  3CJQ B;  4ZYA A;  3NKE A;  2IYL D;  3CMM A;  5FRO A;  5KHD A;  2RQQ A;  1M56 C;  3TMO A;  4C2U A;  1V5F A;  2L2O A;  2WZG A;  3DTK A;  2IXM A;  3BG6 A;  4DBR A;  2NG1 A;  4BQQ A;  3SNH A;  2EIN C;  1ZU5 A;  3ECS A;  5EHH A;  5KYU B;  4Q5S F;  3K4N A;  2KPM A;  4Y33 A;  3N0T A;  2V6E A;  3A2K A;  3SP1 A;  2R7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...