4BJ8A

Zebavidin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'SSCNVTGVWRNELGSTLRVKAEGSEVRGVYQTAVESTRGAAGHHRSARIIGMVSDGTQPTVSFSVLWEKGSCSAWVGQCFILDDGAQVLKTFWMLRSVADNLASAWGSTRMGEDIFFKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZEBAVIDIN
publication title Zebavidin
pubmed doi rcsb
source organism Danio rerio
molecule tags Biotin-binding protein
total genus 25
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4bj8A00
1RXKA 1LCVA 2IZIA 2RTGB 4GDAA 3RY1A 1SWNA 1SWDA 1VWQB 1Y55X 2IZEB 3RE5A 1VWLB 1VWJB 3PK2A 2OFAA 1VWOB 1LCWA 3MM0A 4Z28A 4CPFA 1VWKB 5CHKA 4Z6JA 3WZPA 4CPIA 3X00A 1I9HA 2ZSCA 1SWRA 4I60A 3WZOA 4GD9A 2RTJA 1N43A 1HXZA 2Y3EA 4U46A 2OF8A 4JO6A 2JGSA 4EKVA 1NBXA 1KL3A 1RXHA 2IZHB 2RTPB 1SLGB 3WZQA 1SRJA 1STPA 2RTRB 2MF6A 1SWQA 1SWTA 1SWGA 1NDJA 2FHLA 2IZCB 4YVBA 2IZAA 2OF9A 1RSTB 1LDOA 1VWPB 3SZIA 4CPEA 4JHQA 3RDUA 1HXLA 1SWSA 1SWAA 1SWBA 3RDOA 1SWUA 5IRAA 1STSB 5IRUA 1HY2A 2F01A 1VWFB 2RTDB 1RSUB 5B5FA 1N9YA 1SWPA 1RAVA 2IZDB 1PTSA 1SLDB 1SWFA 1SRGA 1N7YA 1VWEB 4JNJA 3FDCA 2RTMA 4Y5DA 2QCBA 2RTHB 3RDQA 1SWLA 1SLEB 1VWAB 1WBIA 2C1SA 3RE6A 1N4JA 2IZKA 1N9MA 1RXJA 1SRHA 1SWJA 4IRWA 3EW1A 1VWNB 1SREA 4CPHA 1LDQA 1VWDB 3T6FA 1SRIA 1SRFA 4DNEA 4CPHB 1IJ8A 2Y3FA 1NQNA 2RTCB 2A5BA 2IZFB 3RDXA 1KFFA 1KL5A 1LELA 2RTNB 1LUQA 3WYPA 5L3YA 1LCZA 2RTEB 2A8GA 3VHIA 3WZNA 1STRB 1VWCB 4Z27A 4BX6A 2RTIB 5CSEA 3T6LA 1NQMA 1VYOA 2OFBA 2RTKA 4BX6B 4Z2PA 3T2WA 4GGZA 1SLFB 1SWCA 5IRWA 4GGRA 4BX7B 4GGTA 2UYWA 1KL4A 2RTLA 4GJSA 4Y59A 1SWHA 1SWKA 2IZGB 4OKAA 2RTAA 3VHHA 2G5LA 1SWOA 5F2BA 1AVEA 2RTBB 2Y32A 3VHMA 4Z2OA 1MOYA 2IZJA 1VWHB 2CAMA 3T2XA 2AVIA 5B5GA 1MK5A 1VWRB 2WPUA 1Y52X 1HQQA 3RDSA 3SZJA 2RTOB 4BCSA 5K67A 1VWBB 1Y53X 2RTQB 3MG5A 1VWIB 1DF8A 4BJ8A 2FHNX 1SWEA 4GJVA 1AVDA 3WYQA 2UZ2A 3RY2A 3RDMA 2RTFB 3SZHA 1NC9A 4BX5A 4BX7A 3EW2A 4BX5B 4Z2VA 4BBOA 1VWGB 1VWMB 2GH7A 5JD2A 5K68A 3VGWA 2BC3A 2C1QA 2IZBA 2A5CA 1MEPA 2IZLB 2C4IA 1MM9A
chains in the Genus database with same CATH superfamily
1RXKA 5HZQA 1DV9A 1GX8A 4KT5A 1EIIA 2RTGB 1NGLA 3RY1A 4YFQA 2OVEA 3KZAA 3PQUA 2IZEB 1PEEA 2OYBO 1GT5A 1G5WA 1EUOA 3B2KA 1KT4A 1LCWA 1OSPO 1VWOB 3MM0A 1VWKB 3CR6A 4I3DA 4I6SA 1N0SA 4OS0A 4Z6JA 1PMPA 4CDFA 1NP1A 4ZHHA 2MO5A 1HBPA 1IIUA 1ZRYA 2IFBA 5FAZA 4NW4A 5HAEA 2X8SA 1E02A 1RXHA 1I04A 2IZHB 2RTPB 1CBIA 1SLGB 3TGCA 4K19A 3WJCA 1QY1A 2OZQA 3B2LA 4ORYA 3VE1A 1PM1X 1UYNX 2RTRB 1SWTA 3HK1A 4U9CA 5L8IA 3ELZA 4U8UN 5HA0A 3UAQA 1NDJA 1XCAA 1EI5A 3PDFA 3VG6A 4ZHCA 4MVIA 1U17A 1RLBE 3AKMA 1JYJA 3SZIA 1G74A 2JN3A 3D97A 4EQAC 1NP4A 3P02A 1UYOX 5B27A 3S60A 5EDCA 2O62A 3BY0A 1AQBA 1DZPA 2R74A 1SWAA 1SWBA 1LNMA 2VFBA 1STSB 2CBSA 1HY2A 2F01A 3FR5A 1VWFB 4TKHA 3RKGA 3FA8A 4O3XB 4ALOA 5B5FA 4D6BA 1RAVA 2FWVA 1A57A 4M6SA 4YGGA 4IABA 1QABE 4YGZA 1SWFA 2Q2MA 1VWEB 1EXSA 4JNJA 2RTMA 4N7CA 4KCAA 4XMCA 2QCBA 2RTHB 3FA9A 1SWLA 3BSZE 4QYPA 4QGXA 1I05A 3NPOA 1BSOA 1N4JA 1ML7A 1SRHA 4AZNA 1SREA 4CPHA 2AT8X 4ZR2A 1SRIA 4COTA 3O22A 1ALBA 2AKQA 2AT5X 1LF7A 5D48A 3T1DA 1W6FA 2JOZA 2A5BA 4QYNA 1YIVA 4YKOA 1H91A 1HMSA 1S7DA 3FIQA 3PECA 4MIRA 4A1YA 1ZNKA 3BX8A 1DFVA 3SLJA 2RTEB 4KC7A 2A8GA 5L3YA 4BVMA 3H3IA 1STRB 3LV4A 1DC9A 4UU2A 5AJBA 5HBSA 1OPAA 2RTIB 5CSEA 4Z27A 2OFBA 2RTKA 2HLVA 1TW4A 2AL0X 4BX6B 3CWKA 3S5VA 3ZUIA 1SWCA 2CZTA 1OEKA 3FW4A 1QFTA 4NNSA 1DZKA 2UYWA 4FQBB 4GJSA 2HNXA 4BGFA 4PJ2A 5CYBA 2A13A 2A0AA 2WR6A 5FQ8E 1BEBA 2HZQA 2Z4HA 4UU3A 3FW5A 1LKEA 1X8UA 1SWOA 2XSTA 1AVEA 4LKTA 1U18A 1W4TA 4O4OA 1FE3A 3STKA 4Z2OA 2X45A 1MOYA 4WHIA 3FMZA 4Y0SA 5AEOA 1FJ1E 1VWHB 2G79A 3FLLA 4HPBA 1MK5A 1VWRB 2QMIA 2WPUA 2AT6X 3BX7A 2FKGA 2VFCA 3Q34A 3SZJA 1SXUA 1KT6A 1VWBB 4KH8A 5H9AA 3WJGA 2RTQB 2GTLN 4DQ3A 5LKEA 1IFCA 1CBSA 1Y9LA 1VYGA 4BJ8A 1YWBA 1SWEA 4GJVA 5JR8A 1AVDA 4O49A 3WYQA 4ODDA 3UEVA 5BVTA 1HQPA 2HYSA 2HZRA 4IB7A 3FIDA 3UEWA 3WVMA 4O4UA 4BX5B 4QNIA 4NYRA 4DQ4A 3U03A 1VWGB 1VWMB 3VGWA 1GX3A 2C1QA 2IZBA 3MVFA 2LBAA 3JS1A 1GT4A 2I5ZO 3APXA 1MM9A 3P6DA 4ID2A 3EMMA 5H9LA 1LCVA 1SY2A 1TXLA 2IZIA 3EYCA 4AZQA 2QOSC 1JIWI 5HZ9A 4MVLA 3RWXA 1SWNA 4ZHFA 3NQKA 1KQXA 4DCBA 2BHVA 2QO5A 1VWLB 3KFFA 4AZPA 3SAOA 5BVSA 4GDZA 5CHKA 3I17A 2RA6A 3FR2A 1I9HA 3L4RA 2ZSCA 4OMXA 1L6MA 2X55A 2RTJA 1HXZA 2Y3EA 1X89A 5IO7A 1O1VA 2Q4NA 4YKMA 1NBXA 1KL3A 1ERBA 3NX2A 4LKPA 1T0VA 4ZH9A 1SXWA 2Z4IA 5IO5A 1STPA 3DSZA 1S44A 2FT9A 1CBRA 1SXYA 3HWFA 4O3WA 5HCEC 1PBOA 4AYHA 4EFGA 4YMYA 1B4MA 4NP1A 1KZXA 4YVBA 3FELA 2IZAA 4IAXA 4YDBA 1LDOA 1LIDA 3ZWEA 1VYFA 1MDCA 1B56A 1WUBA 3P6GA 4EXZA 1ACDA 2ANSA 4JHQA 4QQ1A 2OFMX 1D2UA 3RDUA 1SWSA 1DF3A 1E06A 2OL7A 5IRAA 4MEEA 2RTDB 1BRPA 1TOUA 4I9RA 3E3CA 5LJKA 3V8UA 2KTDA 3IA8A 3P24A 2DJFA 1BSQA 1PTSA 3WOVA 4AZRA 2JU3A 1LIFA 3G7XA 1T68X 5HCDC 4YCHA 4YFPA 4TKBA 2G8CO 4AZMA 3EM0A 1ZNEA 1TVQA 1VWAB 1JBHA 1WBIA 4ZJ0A 2C1SA 2YMSA 3LTWA 1BBPA 5FQ7E 5H9KA 1AVGI 1GXAA 2GTLO 1KGLA 1LDQA 1JJJA 3T6FA 4A60A 3OD9A 1SRFA 2YG2A 3B2IA 5HTEA 4CPHB 1E2TA 2OY8A 2R56A 1OEJA 2Y3FA 3AEHA 4U8UM 2RTCB 4CDDA 2ACOA 2IZFB 2WQ9A 2X8TA 3PPTA 4ORUA 2RTNB 1LUQA 3EBWA 5DG4A 1LCZA 3WZNA 1SY0A 4WFUA 2A2GA 1EPAA 1QY2A 4NYQA 3T6LA 2OL8O 4ORWA 1NQMA 1VYOA 5EDBA 3U0DA 3SLTA 1SMPI 3T2WA 5IRWA 2FR2A 4QRLA 5HCCC 4BX7B 2CM4A 4GGTA 1ZNLA 2MM3A 2M4LA 2WSJA 4CK4A 4ZFXA 2FKJA 4Y0PA 1UREA 1X8QA 2RN4A 1SWKA 2IZGB 4INNA 5AQ6A 3CBSA 1YUPA 2G5LA 5F2BA 4FBVA 1G85A 4GU8A 5B29A 2A2UA 2RTBB 2Y32A 2W2BA 4CDCA 5LJCA 5F58A 4YH0A 3T2XA 1CJ5A 5KHPA 1BJ7A 4ZH6A 3ZW1A 2OFRX 4RUNA 1HQQA 5EZ2A 3RDSA 3NADA 3K3LA 3WBGA 2RTOB 1EALA 1G7NA 3FR4A 4ARHA 5K67A 1GX9A 3MG5A 3VG2A 3VU1A 2AT0X 1BLRA 3BRNA 1KT7A 2FTBA 4O4XA 3SZHA 4FGIB 3RDMA 4NV8A 3F9DA 3PQSA 3BS2A 1IKEA 2F73A 4BX7A 1HMTA 4M7MA 1XKIA 1CBQA 3D95A 1QG5A 5L8OA 1EIOA 5K68A 4ON1A 1JZUA 1TOWA 2FGSA 1Y9TA 2AH7X 2PY1A 4XMFA 3P6HA 1MEPA 2IZLB 2JU7A 4OEMA 3ZW2A 1LIBA 2JU8A 3LHNA 1OBPA 4A1HA 5KICA 5FQ6E 3TGBA 1SWDA 4IB8A 3D9WA 5H8TA 3HWDA 1A18A 1Y55X 2WEXA 3CMPA 1VWJB 3PK2A 2OFAA 3AKNA 3P6CA 4MVKA 4Z28A 1QFVA 2F09A 1SY1A 2X56A 2XKLA 4CPFA 3BLGA 4KIIA 4CPIA 3X00A 1KXOA 4U8UO 1SWRA 4I60A 1MX7A 3Q6LA 5DPQA 3WZOA 1GKAA 5LJBA 1N43A 3PEDA 3ZZVA 2OF8A 4JO6A 1BRQA 4EKVA 1BSYA 2GTLM 3CKFA 5D47A 3APWA 3C76X 5B3MO 4NLJA 2X4MA 3WJEA 3PP6A 4TNNA 3ELXA 4XMGA 3ZW0B 4WFVA 1JV4A 2BS5A 3HOEA 2MF6A 1SXXA 1OEEA 2KW1A 2X32A 1GGLA 3F6ZB 1FDQA 1OBUA 2FHLA 3KQ0A 4OMWA 2OF9A 2G7BA 2OY5O 1VWPB 2I5VO 1S2PA 3ZQ3A 3EC5A 2DJGA 5F6BA 2WWPA 1DZJA 4O9SA 4B55A 2OY7A 1YWDA 2A3FX 3VPJE 4YDAA 4ZGUA 5FFHA 3RDOA 1SWUA 3O2YA 5IRUA 4QGVA 4Y0RA 3VG4A 1SWPA 1LFOA 2IZDB 1SLDB 1Y0GA 3PH5A 1N7YA 1P6PA 1QWDA 3FDCA 3FEPA 4BQUA 3TGAA 4QAEA 3DTQA 4GNWA 3RDQA 4FBRA 5HWZA 1K24A 1SLEB 3QKGA 3ZW0A 3WJBA 4ORXA 4XMHA 5HZ5A 1B8EA 3RE6A 1GT3A 1RXJA 4HWMA 4KC8A 1SWJA 4GUZA 4BOEA 4YBPA 3KFIA 2BLGA 2P8GA 1Z24A 2OVDA 4DNEA 1GM6A 1ICMA 5LJEA 1A2DA 2L68A 1KZWA 1NQNA 2OVAA 4HPCA 1I78A 1KOIA 4WBKA 5BVQA 3OE3A 3O19A 5KIDA 2QM9A 3FA7A 3S26A 5EEEA 1U0XA 2WEWA 3VHIA 2KT4B 1R0UA 3VG7A 1I06A 2NNDA 3HTYA 4CDEA 4ALBA 1AELA 5BYPA 5HZ6A 4CSBA 5HZ8A 2GC9A 4Z2PA 3F8AA 3ZUOA 4ZCBA 1SLFB 3B2HA 4IMNA 4MISA 4XMEA 4GGRA 2L67A 2FS7A 2ZAGA 1ZNGA 1IKJA 3IFBA 4TLJA 1KL4A 3KVNA 4O3ZA 4Y59A 2RD7C 1SWHA 3D4RA 4ORRA 2AT3X 2K23A 1W5RA 3P6EA 4OKAA 3TF6A 2RTAA 3SOTA 5L8NA 4ZHDA 2FRSA 3D96A 4HFOA 5D8JA 2QO4A 3I0AA 4N7DA 3APVA 2IZJA 2VDFA 3CBCA 2CAMA 3PH6A 3C77X 4QZTA 1I4UA 4I3BA 3VE2A 1ZNDA 2LFOA 1Y52X 5D45A 2JMBA 3ZW1B 3NQ9A 4GETA 5LJGA 4BCSA 1A3YA 4ML7B 1EPBA 3HWGA 1SA8A 2X34A 3GE2A 3KFGA 5IO6A 4YFRA 1VWIB 3S5XA 5B10O 2FHNX 5EEDA 2LKKA 3CQRA 4HPDA 4RUUA 2UZ2A 3RY2A 3STNA 1X71A 5EPQA 2FLJA 4YBUA 4ORSA 1NC9A 2W2AA 1T8VA 5D4AA 2RQ0A 3EW2A 3FYFA 2K62A 1ERXA 3ZI8A 4GH7A 4Z2VA 4U3QA 1HN2A 2GH7A 5IXGA 3OBLA 2L9CA 2BC3A 1B0OA 1JYDA 4NLIA 4EEJA 2NNEA 1JQPA 3RBYA 2C4IA 4L1NA 4LZVA 5K06A 1YP7A 4IB6A 2R73A 4GDAA 4R0BA 2FS6A 3P6FA 3VG3A 1IFBA 1VWQB 2QO6A 1K3BA 2CM9A 3RE5A 3BU9A 4O4SA 1IW2A 1YP6A 3WZPA 2HMBA 3KFHA 4L3RA 2L5PA 4GD9A 4OELA 4Y0QA 4U46A 1GKAB 2JGSA 1YWCA 1E5PA 2OY1O 3JQOA 2BT9A 3MBTA 1E00A 3WZQA 4A8ZA 1HBQA 1SRJA 3CQNA 3FEKA 3B2JA 1ICNA 2E4JA 1SWQA 3FA6A 5H9NA 1SWGA 4YGHA 5HA1A 2IZCB 3RZYA 3AUMO 4GNYA 5LJHA 1MVGA 2G78A 2NP1A 2OL6O 1RSTB 4I95A 1JJUA 2NNQA 2KD2A 4IB9A 2FR3A 4CPEA 1EQDA 1O8VA 1X8OA 4I9SA 4NNTA 4HPAA 2X46A 3NX1A 2HKDA 2ZAIA 1HXLA 1KT5A 5LKFA 5F1EA 1X8PA 4QZUA 2DM5A 3VG5A 1RBPA 2MHDA 2KTSA 3C78X 3HWEA 3JSQA 4I3CA 1SY3A 4OS8A 2Q9SA 2LBVA 1EW3A 1RSUB 5B2AO 5LJDA 1N9YA 1BM5A 1ZNHA 2MJIA 1ADLA 2QOMA 2X8FA 1SRGA 1YWAA 4Y5DA 3U9PC 5F6ZA 2RCTA 3GAQA 2BSZA 5AJCA 4AZOA 3HPEA 2IZKA 1FELA 1N9MA 4IRWA 3EBKA 3EW1A 1VWNB 4O3YA 1VWDB 5B11O 2PI3O 4XMDA 1IJ8A 2ASNX 4EDEA 1AB0A 1LICA 1LIEA 1OPBA 1X8NA 3NQ3A 4IAWA 4IMOA 4QGWA 1KFFA 1KL5A 1OBQA 3RDXA 1LELA 4LQZA 4ZGFA 3HOLA 4FBOA 3APUA 3MX7A 3WYPA 1FEMA 1MX8A 1QQSA 2CZUA 1VWCB 1VPRA 4BX6A 2CBRA 4ES7A 4GKCA 1LPJA 2BS6A 2JW1A 2POAA 4TJZA 4PSQA 1KQWA 3WJDA 4C5PA 4GK9A 4GGZA 3N91A 3BDRA 2GTFX 3QQ2A 2RCQA 3NR3A 4GE1A 2RTLA 3NBXX 3FENA 2LB6A 1D3SA 2N93A 3VHHA 1CRBA 5HTDA 1DZMA 3UEXA 4IBAA 3SLOA 1O1UA 3VHMA 4MVEA 4ZHGA 3TZSA 3UEUA 3WXQA 1MUPA 2AVIA 4OS3A 2WQAE 5B5GA 4AW8A 5C0NA 4CV7A 2W2FA 1QY0A 3CKGA 3NP1A 2LA7A 4JGLA 4YCEA 4TKJA 1BWYA 3BU1A 1Y53X 1GT1A 5F7GA 2Q39A 4NV7A 1DF8A 3RSWA 4TQ2A 5CE4A 1JJXA 1HMRA 2ACPX 2ALLX 2EU7X 1JMZA 2RTFB 3STMX 4GRJA 3WJFA 2WUTA 4BX5A 1JMXA 1FTPA 2AMMX 1FENA 4LZUA 2OVSA 4BBOA 3OJYC 5JD2A 1PBYA 4GZVA 2AF5A 2MWHA 2Q2PA 4D6AA 2A5CA 2GJ5A 5FENA 1KT3A 1UZ2X
chains in the Genus database with same CATH topology
1RXKA 1LCVA 2IZIA 2RTGB 4GDAA 3RY1A 1SWNA 1SWDA 1VWQB 1Y55X 2IZEB 3RE5A 1VWLB 1VWJB 3PK2A 2OFAA 1VWOB 1LCWA 3MM0A 4Z28A 4CPFA 1VWKB 5CHKA 4Z6JA 3WZPA 4CPIA 3X00A 1I9HA 2ZSCA 1SWRA 4I60A 3WZOA 4GD9A 2RTJA 1N43A 1HXZA 2Y3EA 4U46A 2OF8A 4JO6A 2JGSA 4EKVA 1NBXA 1KL3A 1RXHA 2IZHB 2RTPB 1SLGB 3WZQA 1SRJA 1STPA 2RTRB 2MF6A 1SWQA 1SWTA 1SWGA 1NDJA 2FHLA 2IZCB 4YVBA 2IZAA 2OF9A 1RSTB 1LDOA 1VWPB 3SZIA 4CPEA 4JHQA 3RDUA 1HXLA 1SWSA 1SWAA 1SWBA 3RDOA 1SWUA 5IRAA 1STSB 5IRUA 1HY2A 2F01A 1VWFB 2RTDB 1RSUB 5B5FA 1N9YA 1SWPA 1RAVA 2IZDB 1PTSA 1SLDB 1SWFA 1SRGA 1N7YA 1VWEB 4JNJA 3FDCA 2RTMA 4Y5DA 2QCBA 2RTHB 3RDQA 1SWLA 1SLEB 1VWAB 1WBIA 2C1SA 3RE6A 1N4JA 2IZKA 1N9MA 1RXJA 1SRHA 1SWJA 4IRWA 3EW1A 1VWNB 1SREA 4CPHA 1LDQA 1VWDB 3T6FA 1SRIA 1SRFA 4DNEA 4CPHB 1IJ8A 2Y3FA 1NQNA 2RTCB 2A5BA 2IZFB 3RDXA 1KFFA 1KL5A 1LELA 2RTNB 1LUQA 3WYPA 5L3YA 1LCZA 2RTEB 2A8GA 3VHIA 3WZNA 1STRB 1VWCB 4Z27A 4BX6A 2RTIB 5CSEA 3T6LA 1NQMA 1VYOA 2OFBA 2RTKA 4BX6B 4Z2PA 3T2WA 4GGZA 1SLFB 1SWCA 5IRWA 4GGRA 4BX7B 4GGTA 2UYWA 1KL4A 2RTLA 4GJSA 4Y59A 1SWHA 1SWKA 2IZGB 4OKAA 2RTAA 3VHHA 2G5LA 1SWOA 5F2BA 1AVEA 2RTBB 2Y32A 3VHMA 4Z2OA 1MOYA 2IZJA 1VWHB 2CAMA 3T2XA 2AVIA 5B5GA 1MK5A 1VWRB 2WPUA 1Y52X 1HQQA 3RDSA 3SZJA 2RTOB 4BCSA 5K67A 1VWBB 1Y53X 2RTQB 3MG5A 1VWIB 1DF8A 4BJ8A 2FHNX 1SWEA 4GJVA 1AVDA 3WYQA 2UZ2A 3RY2A 3RDMA 2RTFB 3SZHA 1NC9A 4BX5A 4BX7A 3EW2A 4BX5B 4Z2VA 4BBOA 1VWGB 1VWMB 2GH7A 5JD2A 5K68A 3VGWA 2BC3A 2C1QA 2IZBA 2A5CA 1MEPA 2IZLB 2C4IA 1MM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXK A;  1LCV A;  2IZI A;  2RTG B;  4GDA A;  3RY1 A;  1SWN A;  1SWD A;  1VWQ B;  1Y55 X;  2IZE B;  3RE5 A;  1VWL B;  1VWJ B;  3PK2 A;  2OFA A;  1VWO B;  1LCW A;  3MM0 A;  4Z28 A;  4CPF A;  1VWK B;  5CHK A;  4Z6J A;  3WZP A;  4CPI A;  3X00 A;  1I9H A;  2ZSC A;  1SWR A;  4I60 A;  3WZO A;  4GD9 A;  2RTJ A;  1N43 A;  1HXZ A;  2Y3E A;  4U46 A;  2OF8 A;  4JO6 A;  2JGS A;  4EKV A;  1NBX A;  1KL3 A;  1RXH A;  2IZH B;  2RTP B;  1SLG B;  3WZQ A;  1SRJ A;  1STP A;  2RTR B;  2MF6 A;  1SWQ A;  1SWT A;  1SWG A;  1NDJ A;  2FHL A;  2IZC B;  4YVB A;  2IZA A;  2OF9 A;  1RST B;  1LDO A;  1VWP B;  3SZI A;  4CPE A;  4JHQ A;  3RDU A;  1HXL A;  1SWS A;  1SWA A;  1SWB A;  3RDO A;  1SWU A;  5IRA A;  1STS B;  5IRU A;  1HY2 A;  2F01 A;  1VWF B;  2RTD B;  1RSU B;  5B5F A;  1N9Y A;  1SWP A;  1RAV A;  2IZD B;  1PTS A;  1SLD B;  1SWF A;  1SRG A;  1N7Y A;  1VWE B;  4JNJ A;  3FDC A;  2RTM A;  4Y5D A;  2QCB A;  2RTH B;  3RDQ A;  1SWL A;  1SLE B;  1VWA B;  1WBI A;  2C1S A;  3RE6 A;  1N4J A;  2IZK A;  1N9M A;  1RXJ A;  1SRH A;  1SWJ A;  4IRW A;  3EW1 A;  1VWN B;  1SRE A;  4CPH A;  1LDQ A;  1VWD B;  3T6F A;  1SRI A;  1SRF A;  4DNE A;  4CPH B;  1IJ8 A;  2Y3F A;  1NQN A;  2RTC B;  2A5B A;  2IZF B;  3RDX A;  1KFF A;  1KL5 A;  1LEL A;  2RTN B;  1LUQ A;  3WYP A;  5L3Y A;  1LCZ A;  2RTE B;  2A8G A;  3VHI A;  3WZN A;  1STR B;  1VWC B;  4Z27 A;  4BX6 A;  2RTI B;  5CSE A;  3T6L A;  1NQM A;  1VYO A;  2OFB A;  2RTK A;  4BX6 B;  4Z2P A;  3T2W A;  4GGZ A;  1SLF B;  1SWC A;  5IRW A;  4GGR A;  4BX7 B;  4GGT A;  2UYW A;  1KL4 A;  2RTL A;  4GJS A;  4Y59 A;  1SWH A;  1SWK A;  2IZG B;  4OKA A;  2RTA A;  3VHH A;  2G5L A;  1SWO A;  5F2B A;  1AVE A;  2RTB B;  2Y32 A;  3VHM A;  4Z2O A;  1MOY A;  2IZJ A;  1VWH B;  2CAM A;  3T2X A;  2AVI A;  5B5G A;  1MK5 A;  1VWR B;  2WPU A;  1Y52 X;  1HQQ A;  3RDS A;  3SZJ A;  2RTO B;  4BCS A;  5K67 A;  1VWB B;  1Y53 X;  2RTQ B;  3MG5 A;  1VWI B;  1DF8 A;  4BJ8 A;  2FHN X;  1SWE A;  4GJV A;  1AVD A;  3WYQ A;  2UZ2 A;  3RY2 A;  3RDM A;  2RTF B;  3SZH A;  1NC9 A;  4BX5 A;  4BX7 A;  3EW2 A;  4BX5 B;  4Z2V A;  4BBO A;  1VWG B;  1VWM B;  2GH7 A;  5JD2 A;  5K68 A;  3VGW A;  2BC3 A;  2C1Q A;  2IZB A;  2A5C A;  1MEP A;  2IZL B;  2C4I A;  1MM9 A; 
#chains in the Genus database with same CATH topology
 1RXK A;  5HZQ A;  1DV9 A;  1GX8 A;  4KT5 A;  1EII A;  2RTG B;  1NGL A;  3RY1 A;  4YFQ A;  2OVE A;  3KZA A;  3PQU A;  2IZE B;  1PEE A;  2OYB O;  1GT5 A;  1G5W A;  1EUO A;  3B2K A;  1KT4 A;  1LCW A;  1OSP O;  1VWO B;  3MM0 A;  1VWK B;  3CR6 A;  4I3D A;  4I6S A;  1N0S A;  4OS0 A;  4Z6J A;  1PMP A;  4CDF A;  1NP1 A;  4ZHH A;  2MO5 A;  1HBP A;  1IIU A;  1ZRY A;  2IFB A;  5FAZ A;  4NW4 A;  5HAE A;  2X8S A;  1E02 A;  1RXH A;  1I04 A;  2IZH B;  2RTP B;  1CBI A;  1SLG B;  3TGC A;  4K19 A;  3WJC A;  1QY1 A;  2OZQ A;  3B2L A;  4ORY A;  3VE1 A;  1PM1 X;  1UYN X;  2RTR B;  1SWT A;  3HK1 A;  4U9C A;  5L8I A;  3ELZ A;  4U8U N;  5HA0 A;  3UAQ A;  1NDJ A;  1XCA A;  1EI5 A;  3PDF A;  3VG6 A;  4ZHC A;  4MVI A;  1U17 A;  1RLB E;  3AKM A;  1JYJ A;  3SZI A;  1G74 A;  2JN3 A;  3D97 A;  4EQA C;  1NP4 A;  3P02 A;  1UYO X;  5B27 A;  3S60 A;  5EDC A;  2O62 A;  3BY0 A;  1AQB A;  1DZP A;  2R74 A;  1SWA A;  1SWB A;  1LNM A;  2VFB A;  1STS B;  2CBS A;  1HY2 A;  2F01 A;  3FR5 A;  1VWF B;  4TKH A;  3RKG A;  3FA8 A;  4O3X B;  4ALO A;  5B5F A;  4D6B A;  1RAV A;  2FWV A;  1A57 A;  4M6S A;  4YGG A;  4IAB A;  1QAB E;  4YGZ A;  1SWF A;  2Q2M A;  1VWE B;  1EXS A;  4JNJ A;  2RTM A;  4N7C A;  4KCA A;  4XMC A;  2QCB A;  2RTH B;  3FA9 A;  1SWL A;  3BSZ E;  4QYP A;  4QGX A;  1I05 A;  3NPO A;  1BSO A;  1N4J A;  1ML7 A;  1SRH A;  4AZN A;  1SRE A;  4CPH A;  2AT8 X;  4ZR2 A;  1SRI A;  4COT A;  3O22 A;  1ALB A;  2AKQ A;  2AT5 X;  1LF7 A;  5D48 A;  3T1D A;  1W6F A;  2JOZ A;  2A5B A;  4QYN A;  1YIV A;  4YKO A;  1H91 A;  1HMS A;  1S7D A;  3FIQ A;  3PEC A;  4MIR A;  4A1Y A;  1ZNK A;  3BX8 A;  1DFV A;  3SLJ A;  2RTE B;  4KC7 A;  2A8G A;  5L3Y A;  4BVM A;  3H3I A;  1STR B;  3LV4 A;  1DC9 A;  4UU2 A;  5AJB A;  5HBS A;  1OPA A;  2RTI B;  5CSE A;  4Z27 A;  2OFB A;  2RTK A;  2HLV A;  1TW4 A;  2AL0 X;  4BX6 B;  3CWK A;  3S5V A;  3ZUI A;  1SWC A;  2CZT A;  1OEK A;  3FW4 A;  1QFT A;  4NNS A;  1DZK A;  2UYW A;  4FQB B;  4GJS A;  2HNX A;  4BGF A;  4PJ2 A;  5CYB A;  2A13 A;  2A0A A;  2WR6 A;  5FQ8 E;  1BEB A;  2HZQ A;  2Z4H A;  4UU3 A;  3FW5 A;  1LKE A;  1X8U A;  1SWO A;  2XST A;  1AVE A;  4LKT A;  1U18 A;  1W4T A;  4O4O A;  1FE3 A;  3STK A;  4Z2O A;  2X45 A;  1MOY A;  4WHI A;  3FMZ A;  4Y0S A;  5AEO A;  1FJ1 E;  1VWH B;  2G79 A;  3FLL A;  4HPB A;  1MK5 A;  1VWR B;  2QMI A;  2WPU A;  2AT6 X;  3BX7 A;  2FKG A;  2VFC A;  3Q34 A;  3SZJ A;  1SXU A;  1KT6 A;  1VWB B;  4KH8 A;  5H9A A;  3WJG A;  2RTQ B;  2GTL N;  4DQ3 A;  5LKE A;  1IFC A;  1CBS A;  1Y9L A;  1VYG A;  4BJ8 A;  1YWB A;  1SWE A;  4GJV A;  5JR8 A;  1AVD A;  4O49 A;  3WYQ A;  4ODD A;  3UEV A;  5BVT A;  1HQP A;  2HYS A;  2HZR A;  4IB7 A;  3FID A;  3UEW A;  3WVM A;  4O4U A;  4BX5 B;  4QNI A;  4NYR A;  4DQ4 A;  3U03 A;  1VWG B;  1VWM B;  3VGW A;  1GX3 A;  2C1Q A;  2IZB A;  3MVF A;  2LBA A;  3JS1 A;  1GT4 A;  2I5Z O;  3APX A;  1MM9 A;  3P6D A;  4ID2 A;  3EMM A;  5H9L A;  1LCV A;  1SY2 A;  1TXL A;  2IZI A;  3EYC A;  4AZQ A;  2QOS C;  1JIW I;  5HZ9 A;  4MVL A;  3RWX A;  1SWN A;  4ZHF A;  3NQK A;  1KQX A;  4DCB A;  2BHV A;  2QO5 A;  1VWL B;  3KFF A;  4AZP A;  3SAO A;  5BVS A;  4GDZ A;  5CHK A;  3I17 A;  2RA6 A;  3FR2 A;  1I9H A;  3L4R A;  2ZSC A;  4OMX A;  1L6M A;  2X55 A;  2RTJ A;  1HXZ A;  2Y3E A;  1X89 A;  5IO7 A;  1O1V A;  2Q4N A;  4YKM A;  1NBX A;  1KL3 A;  1ERB A;  3NX2 A;  4LKP A;  1T0V A;  4ZH9 A;  1SXW A;  2Z4I A;  5IO5 A;  1STP A;  3DSZ A;  1S44 A;  2FT9 A;  1CBR A;  1SXY A;  3HWF A;  4O3W A;  5HCE C;  1PBO A;  4AYH A;  4EFG A;  4YMY A;  1B4M A;  4NP1 A;  1KZX A;  4YVB A;  3FEL A;  2IZA A;  4IAX A;  4YDB A;  1LDO A;  1LID A;  3ZWE A;  1VYF A;  1MDC A;  1B56 A;  1WUB A;  3P6G A;  4EXZ A;  1ACD A;  2ANS A;  4JHQ A;  4QQ1 A;  2OFM X;  1D2U A;  3RDU A;  1SWS A;  1DF3 A;  1E06 A;  2OL7 A;  5IRA A;  4MEE A;  2RTD B;  1BRP A;  1TOU A;  4I9R A;  3E3C A;  5LJK A;  3V8U A;  2KTD A;  3IA8 A;  3P24 A;  2DJF A;  1BSQ A;  1PTS A;  3WOV A;  4AZR A;  2JU3 A;  1LIF A;  3G7X A;  1T68 X;  5HCD C;  4YCH A;  4YFP A;  4TKB A;  2G8C O;  4AZM A;  3EM0 A;  1ZNE A;  1TVQ A;  1VWA B;  1JBH A;  1WBI A;  4ZJ0 A;  2C1S A;  2YMS A;  3LTW A;  1BBP A;  5FQ7 E;  5H9K A;  1AVG I;  1GXA A;  2GTL O;  1KGL A;  1LDQ A;  1JJJ A;  3T6F A;  4A60 A;  3OD9 A;  1SRF A;  2YG2 A;  3B2I A;  5HTE A;  4CPH B;  1E2T A;  2OY8 A;  2R56 A;  1OEJ A;  2Y3F A;  3AEH A;  4U8U M;  2RTC B;  4CDD A;  2ACO A;  2IZF B;  2WQ9 A;  2X8T A;  3PPT A;  4ORU A;  2RTN B;  1LUQ A;  3EBW A;  5DG4 A;  1LCZ A;  3WZN A;  1SY0 A;  4WFU A;  2A2G A;  1EPA A;  1QY2 A;  4NYQ A;  3T6L A;  2OL8 O;  4ORW A;  1NQM A;  1VYO A;  5EDB A;  3U0D A;  3SLT A;  1SMP I;  3T2W A;  5IRW A;  2FR2 A;  4QRL A;  5HCC C;  4BX7 B;  2CM4 A;  4GGT A;  1ZNL A;  2MM3 A;  2M4L A;  2WSJ A;  4CK4 A;  4ZFX A;  2FKJ A;  4Y0P A;  1URE A;  1X8Q A;  2RN4 A;  1SWK A;  2IZG B;  4INN A;  5AQ6 A;  3CBS A;  1YUP A;  2G5L A;  5F2B A;  4FBV A;  1G85 A;  4GU8 A;  5B29 A;  2A2U A;  2RTB B;  2Y32 A;  2W2B A;  4CDC A;  5LJC A;  5F58 A;  4YH0 A;  3T2X A;  1CJ5 A;  5KHP A;  1BJ7 A;  4ZH6 A;  3ZW1 A;  2OFR X;  4RUN A;  1HQQ A;  5EZ2 A;  3RDS A;  3NAD A;  3K3L A;  3WBG A;  2RTO B;  1EAL A;  1G7N A;  3FR4 A;  4ARH A;  5K67 A;  1GX9 A;  3MG5 A;  3VG2 A;  3VU1 A;  2AT0 X;  1BLR A;  3BRN A;  1KT7 A;  2FTB A;  4O4X A;  3SZH A;  4FGI B;  3RDM A;  4NV8 A;  3F9D A;  3PQS A;  3BS2 A;  1IKE A;  2F73 A;  4BX7 A;  1HMT A;  4M7M A;  1XKI A;  1CBQ A;  3D95 A;  1QG5 A;  5L8O A;  1EIO A;  5K68 A;  4ON1 A;  1JZU A;  1TOW A;  2FGS A;  1Y9T A;  2AH7 X;  2PY1 A;  4XMF A;  3P6H A;  1MEP A;  2IZL B;  2JU7 A;  4OEM A;  3ZW2 A;  1LIB A;  2JU8 A;  3LHN A;  1OBP A;  4A1H A;  5KIC A;  5FQ6 E;  3TGB A;  1SWD A;  4IB8 A;  3D9W A;  5H8T A;  3HWD A;  1A18 A;  1Y55 X;  2WEX A;  3CMP A;  1VWJ B;  3PK2 A;  2OFA A;  3AKN A;  3P6C A;  4MVK A;  4Z28 A;  1QFV A;  2F09 A;  1SY1 A;  2X56 A;  2XKL A;  4CPF A;  3BLG A;  4KII A;  4CPI A;  3X00 A;  1KXO A;  4U8U O;  1SWR A;  4I60 A;  1MX7 A;  3Q6L A;  5DPQ A;  3WZO A;  1GKA A;  5LJB A;  1N43 A;  3PED A;  3ZZV A;  2OF8 A;  4JO6 A;  1BRQ A;  4EKV A;  1BSY A;  2GTL M;  3CKF A;  5D47 A;  3APW A;  3C76 X;  5B3M O;  4NLJ A;  2X4M A;  3WJE A;  3PP6 A;  4TNN A;  3ELX A;  4XMG A;  3ZW0 B;  4WFV A;  1JV4 A;  2BS5 A;  3HOE A;  2MF6 A;  1SXX A;  1OEE A;  2KW1 A;  2X32 A;  1GGL A;  3F6Z B;  1FDQ A;  1OBU A;  2FHL A;  3KQ0 A;  4OMW A;  2OF9 A;  2G7B A;  2OY5 O;  1VWP B;  2I5V O;  1S2P A;  3ZQ3 A;  3EC5 A;  2DJG A;  5F6B A;  2WWP A;  1DZJ A;  4O9S A;  4B55 A;  2OY7 A;  1YWD A;  2A3F X;  3VPJ E;  4YDA A;  4ZGU A;  5FFH A;  3RDO A;  1SWU A;  3O2Y A;  5IRU A;  4QGV A;  4Y0R A;  3VG4 A;  1SWP A;  1LFO A;  2IZD B;  1SLD B;  1Y0G A;  3PH5 A;  1N7Y A;  1P6P A;  1QWD A;  3FDC A;  3FEP A;  4BQU A;  3TGA A;  4QAE A;  3DTQ A;  4GNW A;  3RDQ A;  4FBR A;  5HWZ A;  1K24 A;  1SLE B;  3QKG A;  3ZW0 A;  3WJB A;  4ORX A;  4XMH A;  5HZ5 A;  1B8E A;  3RE6 A;  1GT3 A;  1RXJ A;  4HWM A;  4KC8 A;  1SWJ A;  4GUZ A;  4BOE A;  4YBP A;  3KFI A;  2BLG A;  2P8G A;  1Z24 A;  2OVD A;  4DNE A;  1GM6 A;  1ICM A;  5LJE A;  1A2D A;  2L68 A;  1KZW A;  1NQN A;  2OVA A;  4HPC A;  1I78 A;  1KOI A;  4WBK A;  5BVQ A;  3OE3 A;  3O19 A;  5KID A;  2QM9 A;  3FA7 A;  3S26 A;  5EEE A;  1U0X A;  2WEW A;  3VHI A;  2KT4 B;  1R0U A;  3VG7 A;  1I06 A;  2NND A;  3HTY A;  4CDE A;  4ALB A;  1AEL A;  5BYP A;  5HZ6 A;  4CSB A;  5HZ8 A;  2GC9 A;  4Z2P A;  3F8A A;  3ZUO A;  4ZCB A;  1SLF B;  3B2H A;  4IMN A;  4MIS A;  4XME A;  4GGR A;  2L67 A;  2FS7 A;  2ZAG A;  1ZNG A;  1IKJ A;  3IFB A;  4TLJ A;  1KL4 A;  3KVN A;  4O3Z A;  4Y59 A;  2RD7 C;  1SWH A;  3D4R A;  4ORR A;  2AT3 X;  2K23 A;  1W5R A;  3P6E A;  4OKA A;  3TF6 A;  2RTA A;  3SOT A;  5L8N A;  4ZHD A;  2FRS A;  3D96 A;  4HFO A;  5D8J A;  2QO4 A;  3I0A A;  4N7D A;  3APV A;  2IZJ A;  2VDF A;  3CBC A;  2CAM A;  3PH6 A;  3C77 X;  4QZT A;  1I4U A;  4I3B A;  3VE2 A;  1ZND A;  2LFO A;  1Y52 X;  5D45 A;  2JMB A;  3ZW1 B;  3NQ9 A;  4GET A;  5LJG A;  4BCS A;  1A3Y A;  4ML7 B;  1EPB A;  3HWG A;  1SA8 A;  2X34 A;  3GE2 A;  3KFG A;  5IO6 A;  4YFR A;  1VWI B;  3S5X A;  5B10 O;  2FHN X;  5EED A;  2LKK A;  3CQR A;  4HPD A;  4RUU A;  2UZ2 A;  3RY2 A;  3STN A;  1X71 A;  5EPQ A;  2FLJ A;  4YBU A;  4ORS A;  1NC9 A;  2W2A A;  1T8V A;  5D4A A;  2RQ0 A;  3EW2 A;  3FYF A;  2K62 A;  1ERX A;  3ZI8 A;  4GH7 A;  4Z2V A;  4U3Q A;  1HN2 A;  2GH7 A;  5IXG A;  3OBL A;  2L9C A;  2BC3 A;  1B0O A;  1JYD A;  4NLI A;  4EEJ A;  2NNE A;  1JQP A;  3RBY A;  2C4I A;  4L1N A;  4LZV A;  5K06 A;  1YP7 A;  4IB6 A;  2R73 A;  4GDA A;  4R0B A;  2FS6 A;  3P6F A;  3VG3 A;  1IFB A;  1VWQ B;  2QO6 A;  1K3B A;  2CM9 A;  3RE5 A;  3BU9 A;  4O4S A;  1IW2 A;  1YP6 A;  3WZP A;  2HMB A;  3KFH A;  4L3R A;  2L5P A;  4GD9 A;  4OEL A;  4Y0Q A;  4U46 A;  1GKA B;  2JGS A;  1YWC A;  1E5P A;  2OY1 O;  3JQO A;  2BT9 A;  3MBT A;  1E00 A;  3WZQ A;  4A8Z A;  1HBQ A;  1SRJ A;  3CQN A;  3FEK A;  3B2J A;  1ICN A;  2E4J A;  1SWQ A;  3FA6 A;  5H9N A;  1SWG A;  4YGH A;  5HA1 A;  2IZC B;  3RZY A;  3AUM O;  4GNY A;  5LJH A;  1MVG A;  2G78 A;  2NP1 A;  2OL6 O;  1RST B;  4I95 A;  1JJU A;  2NNQ A;  2KD2 A;  4IB9 A;  2FR3 A;  4CPE A;  1EQD A;  1O8V A;  1X8O A;  4I9S A;  4NNT A;  4HPA A;  2X46 A;  3NX1 A;  2HKD A;  2ZAI A;  1HXL A;  1KT5 A;  5LKF A;  5F1E A;  1X8P A;  4QZU A;  2DM5 A;  3VG5 A;  1RBP A;  2MHD A;  2KTS A;  3C78 X;  3HWE A;  3JSQ A;  4I3C A;  1SY3 A;  4OS8 A;  2Q9S A;  2LBV A;  1EW3 A;  1RSU B;  5B2A O;  5LJD A;  1N9Y A;  1BM5 A;  1ZNH A;  2MJI A;  1ADL A;  2QOM A;  2X8F A;  1SRG A;  1YWA A;  4Y5D A;  3U9P C;  5F6Z A;  2RCT A;  3GAQ A;  2BSZ A;  5AJC A;  4AZO A;  3HPE A;  2IZK A;  1FEL A;  1N9M A;  4IRW A;  3EBK A;  3EW1 A;  1VWN B;  4O3Y A;  1VWD B;  5B11 O;  2PI3 O;  4XMD A;  1IJ8 A;  2ASN X;  4EDE A;  1AB0 A;  1LIC A;  1LIE A;  1OPB A;  1X8N A;  3NQ3 A;  4IAW A;  4IMO A;  4QGW A;  1KFF A;  1KL5 A;  1OBQ A;  3RDX A;  1LEL A;  4LQZ A;  4ZGF A;  3HOL A;  4FBO A;  3APU A;  3MX7 A;  3WYP A;  1FEM A;  1MX8 A;  1QQS A;  2CZU A;  1VWC B;  1VPR A;  4BX6 A;  2CBR A;  4ES7 A;  4GKC A;  1LPJ A;  2BS6 A;  2JW1 A;  2POA A;  4TJZ A;  4PSQ A;  1KQW A;  3WJD A;  4C5P A;  4GK9 A;  4GGZ A;  3N91 A;  3BDR A;  2GTF X;  3QQ2 A;  2RCQ A;  3NR3 A;  4GE1 A;  2RTL A;  3NBX X;  3FEN A;  2LB6 A;  1D3S A;  2N93 A;  3VHH A;  1CRB A;  5HTD A;  1DZM A;  3UEX A;  4IBA A;  3SLO A;  1O1U A;  3VHM A;  4MVE A;  4ZHG A;  3TZS A;  3UEU A;  3WXQ A;  1MUP A;  2AVI A;  4OS3 A;  2WQA E;  5B5G A;  4AW8 A;  5C0N A;  4CV7 A;  2W2F A;  1QY0 A;  3CKG A;  3NP1 A;  2LA7 A;  4JGL A;  4YCE A;  4TKJ A;  1BWY A;  3BU1 A;  1Y53 X;  1GT1 A;  5F7G A;  2Q39 A;  4NV7 A;  1DF8 A;  3RSW A;  4TQ2 A;  5CE4 A;  1JJX A;  1HMR A;  2ACP X;  2ALL X;  2EU7 X;  1JMZ A;  2RTF B;  3STM X;  4GRJ A;  3WJF A;  2WUT A;  4BX5 A;  1JMX A;  1FTP A;  2AMM X;  1FEN A;  4LZU A;  2OVS A;  4BBO A;  3OJY C;  5JD2 A;  1PBY A;  4GZV A;  2AF5 A;  2MWH A;  2Q2P A;  4D6A A;  2A5C A;  2GJ5 A;  5FEN A;  1KT3 A;  1UZ2 X; 
#chains in the Genus database with same CATH homology
 1RXK A;  1LCV A;  2IZI A;  2RTG B;  4GDA A;  3RY1 A;  1SWN A;  1SWD A;  1VWQ B;  1Y55 X;  2IZE B;  3RE5 A;  1VWL B;  1VWJ B;  3PK2 A;  2OFA A;  1VWO B;  1LCW A;  3MM0 A;  4Z28 A;  4CPF A;  1VWK B;  5CHK A;  4Z6J A;  3WZP A;  4CPI A;  3X00 A;  1I9H A;  2ZSC A;  1SWR A;  4I60 A;  3WZO A;  4GD9 A;  2RTJ A;  1N43 A;  1HXZ A;  2Y3E A;  4U46 A;  2OF8 A;  4JO6 A;  2JGS A;  4EKV A;  1NBX A;  1KL3 A;  1RXH A;  2IZH B;  2RTP B;  1SLG B;  3WZQ A;  1SRJ A;  1STP A;  2RTR B;  2MF6 A;  1SWQ A;  1SWT A;  1SWG A;  1NDJ A;  2FHL A;  2IZC B;  4YVB A;  2IZA A;  2OF9 A;  1RST B;  1LDO A;  1VWP B;  3SZI A;  4CPE A;  4JHQ A;  3RDU A;  1HXL A;  1SWS A;  1SWA A;  1SWB A;  3RDO A;  1SWU A;  5IRA A;  1STS B;  5IRU A;  1HY2 A;  2F01 A;  1VWF B;  2RTD B;  1RSU B;  5B5F A;  1N9Y A;  1SWP A;  1RAV A;  2IZD B;  1PTS A;  1SLD B;  1SWF A;  1SRG A;  1N7Y A;  1VWE B;  4JNJ A;  3FDC A;  2RTM A;  4Y5D A;  2QCB A;  2RTH B;  3RDQ A;  1SWL A;  1SLE B;  1VWA B;  1WBI A;  2C1S A;  3RE6 A;  1N4J A;  2IZK A;  1N9M A;  1RXJ A;  1SRH A;  1SWJ A;  4IRW A;  3EW1 A;  1VWN B;  1SRE A;  4CPH A;  1LDQ A;  1VWD B;  3T6F A;  1SRI A;  1SRF A;  4DNE A;  4CPH B;  1IJ8 A;  2Y3F A;  1NQN A;  2RTC B;  2A5B A;  2IZF B;  3RDX A;  1KFF A;  1KL5 A;  1LEL A;  2RTN B;  1LUQ A;  3WYP A;  5L3Y A;  1LCZ A;  2RTE B;  2A8G A;  3VHI A;  3WZN A;  1STR B;  1VWC B;  4Z27 A;  4BX6 A;  2RTI B;  5CSE A;  3T6L A;  1NQM A;  1VYO A;  2OFB A;  2RTK A;  4BX6 B;  4Z2P A;  3T2W A;  4GGZ A;  1SLF B;  1SWC A;  5IRW A;  4GGR A;  4BX7 B;  4GGT A;  2UYW A;  1KL4 A;  2RTL A;  4GJS A;  4Y59 A;  1SWH A;  1SWK A;  2IZG B;  4OKA A;  2RTA A;  3VHH A;  2G5L A;  1SWO A;  5F2B A;  1AVE A;  2RTB B;  2Y32 A;  3VHM A;  4Z2O A;  1MOY A;  2IZJ A;  1VWH B;  2CAM A;  3T2X A;  2AVI A;  5B5G A;  1MK5 A;  1VWR B;  2WPU A;  1Y52 X;  1HQQ A;  3RDS A;  3SZJ A;  2RTO B;  4BCS A;  5K67 A;  1VWB B;  1Y53 X;  2RTQ B;  3MG5 A;  1VWI B;  1DF8 A;  4BJ8 A;  2FHN X;  1SWE A;  4GJV A;  1AVD A;  3WYQ A;  2UZ2 A;  3RY2 A;  3RDM A;  2RTF B;  3SZH A;  1NC9 A;  4BX5 A;  4BX7 A;  3EW2 A;  4BX5 B;  4Z2V A;  4BBO A;  1VWG B;  1VWM B;  2GH7 A;  5JD2 A;  5K68 A;  3VGW A;  2BC3 A;  2C1Q A;  2IZB A;  2A5C A;  1MEP A;  2IZL B;  2C4I A;  1MM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...