4BKGA

Crystal structure of human disumo-2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL UBIQUITIN-RELATED MODIFIER 2
publication title Multivalent Interactions of the Sumo-Interaction Motifs in the Ring-Finger Protein 4 (Rnf4) Determine the Specificity for Chains of the Small Ubiquitin-Related Modifier (Sumo).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bkgA00
3ZUNA 2N7EA 1F9JA 2L3ZA 1WJNA 3VUYA 3RULA 4GSWA 3PT2B 3PREA 1TBEA 1EF5A 3AI5A 2N7DA 3IBEA 4W9IA 1WXSA 1T0YA 2KDBA 2JF5A 2ZPNA 4FADA 5GMVA 3M63B 1L7YA 1UH6A 4FBJB 3V62A 2N9PC 1TGZB 4M0WB 3DBHI 2JRIB 2RGFA 2GOWA 2RD0A 3L16A 2FCQA 3PHXB 4DHJB 2L0TA 3RD2A 2KWUB 2KFKA 3APCA 3SHQA 1R4NI 3PLUA 2DAFA 3R7QA 1V86A 2DYMA 2J0KA 4MSQB 3HM3A 3R3MA 1V9JA 4MELA 2MP2B 1E8WA 1UZXB 2KHWB 3ZVVA 2DZJA 2OJRA 5JZEB 5IAAC 2MWSB 2ASQA 4G3XB 1YIWA 2K8HA 2KZRA 4G11A 1YJ1A 1V80A 2KLGA 2MBOA 5DPTA 4W9JA 2LVOA 3MJWA 3VTVA 5CHVC 3VXWA 4TQ0A 3NOBA 2NR2A 2IY1B 3MTNB 1EO6A 4AJWA 1IP9A 3KUZA 3GZNI 5DPSA 5KHOA 3R7RA 2GBMA 2L00B 4FJYA 4JL9A 3L0WB 1KM7A 2JUOA 4FJZA 1J0GA 2NS5A 2KKCA 2MA9B 3CMMB 3WAMA 1A5RA 2LASA 5D7GA 2V1YA 1YD8U 2CR5A 2L0FA 2R2QA 2NPTB 2KTRA 3A4RA 4RM8A 3PPAA 1VD2A 3Q3FA 3VFKA 4OVVA 2PPHA 2M4NA 5G2NA 4MH0E 1JRUA 2ZCCA 3IFWB 5FR6A 3ZNID 4X57B 4LDTB 2M0XA 2ZPYA 1Y8RC 2MBHA 3X0WA 2DZIA 2CHWA 5CX3A 3VUXA 1E8ZA 4JQWC 4MGZE 3DCGA 4WAAA 5D6JB 2KDFB 3L54A 3VH4B 2MW5A 3PTFC 4HPLB 4M8NA 3LDZE 2M1MA 2IO3B 3IVFA 4DHZE 1ISNA 3PHWB 4M8MA 4E74A 4GDLA 1WE7A 2EMSA 3APDA 2N9EB 1UGMA 3TJPA 4F1SA 4WJQA 4EEWA 4KV2A 5JHAA 1WR6E 4OVUA 3A4SC 1S3SG 4GB9A 2KLCA 3N32A 3QA8A 2O6VB 2IY0B 3N30A 3RT3B 2C7NB 2AWTA 1WGDA 2KJ6A 5C1ZA 2KN5A 1KJTA 4IM2A 2KX3A 1BT0A 3A9JA 2KXJA 5HKHA 2LVQA 1GC7A 3KUCB 3QX1A 1NBFC 4BVUC 4B95A 4I6NB 3WAOA 2OOBB 5IA7A 1LM8B 1ZW7A 4E71A 1WMHA 4FN2A 2JRHA 1XD3B 4MGIE 3UGBB 1V6EA 2ZVOA 3ZTCA 1YQBA 2FAZA 3H9DA 3V6EB 2FIFA 4MJSA 3QIJA 4WWOA 2R2OA 3U7DA 2KO3A 4AOFA 2REXA 2ZNVB 3PRPB 4NAWB 4A20A 2DAJA 1VCBA 4GXBA 2K8BA 2DX5B 3VDZA 2CS4A 3A9KA 3X23A 1P98A 1LQBA 3VTUA 1D3ZA 1EUVB 4RMAA 3OJ3A 3ZDMC 4RM9A 2WYQA 4ICVA 2K8CA 4MGKE 2JZ3B 4IM3A 4KZCA 3HK0A 2BYEA 2WDTB 2D07B 4ZRKA 3QK0A 2BF8B 4ANUA 4DWFA 4EZLA 4NJ7A 4HK2A 2Y5BB 4MSMB 2G3QB 2N9XA 1OTRB 1I35A 4A3OA 3ZKJC 3TBLD 3ENEA 3PVLA 2G45B 2IO2B 3GOEA 4HWIB 3EC8A 3DPDA 2BKRB 1Q0WB 2C5LC 4HCNB 4W9EA 1RAXA 5G55A 2KK8A 2DZKA 3KW5B 2AL6A 2L05A 1P3QU 3I3TB 4GOCA 4PS7A 3DVNU 2JWZA 3JSVB 3C0RB 2IBIB 3DOWA 2N4FA 1HE8A 2KC1A 4ANVA 1RRBA 5CHFA 3OLMD 1CMXB 2ZJDA 3QWZB 2KX0A 5AZHA 2J0MA 4IG7B 3VUWA 4NPNA 3H7SA 4AP4C 2G4SA 4DBGA 4BOSC 2GBRA 1H8CA 3JSVA 4W9CA 4HLEA 4W9DA 3WA0A 1WX9A 2LWPA 3K9PB 2Z0EB 3BY4B 1MG8A 4FJVB 3SU8X 2MP2A 3HM6X 4DHJD 1PQSA 1WM3A 3CSFA 1RFAA 2NBWB 3Q3JA 4IC7B 5D2MB 4ASWC 4BKTA 3H7PB 2UYZB 4TV3A 2NVUI 4K7WA 2NCNA 2I1KA 4HDQA 2KOXA 4FULA 4MDKE 2KWVB 4PYZA 2KC2A 2KVRA 1KOTA 3TCAA 3V60A 4XC2A 2NBVB 3ALBA 1WGHA 1R4MI 2BPSA 3AU5A 1X1MA 2HJ8A 2GBKA 3H1UA 1WIAA 3PV1A 4B9KA 4W9FA 2ZZPB 1C1YB 2BWES 2LGXA 3U30A 4AJYB 5DCNA 2NPTA 4ZRIA 2G4DB 2CHXA 4FHJA 1WY8A 3M95A 4PS8A 4ANXA 4TKNA 5C23A 2B3AA 2HD5B 3ZDTA 2BYFA 2A5UA 3NY5A 5AEKB 2KFJA 2D10A 2FUHB 2FIDA 2K1FA 1M94A 4P7IA 2D3GA 5TR5A 4BKGA 4LDTD 1SIFA 3AU4A 2ZCBA 2LGDA 3ZW3A 3DBRI 1V49A 5AZFA 4HVBA 3HHMA 3NZSA 3B08A 1GC6A 3L08A 1WH3A 4KIKB 1ZGUB 3JW0X 4AWJA 2LVPA 4W9LA 4NY0A 1AARA 3PRMB 3V61A 4GGQA 4NQLB 4ZRJA 4HXDA 2BWFA 2YVCA 2DENB 2L76A 3EFUA 1FXTB 4MM3A 1IYFA 2LRWA 2KJRA 2RPQA 4KVGB 2O6VA 3BINA 2M17A 3L10B 2MBBB 3UQAA 4DK5A 3VVWB 2WX1A 3L17A 3M62B 1WX8A 3W1SA 3ZIMA 3VH3B 3DQVA 4K7SA 2O6VD 2KWCA 4I6PA 1XQQA 1E90A 2HTHA 3KVFB 4G0NB 1NDDA 4IM0A 1P0RA 3QHTA 3QJZA 4FHKA 2PJHA 1OQYA 1WZ3A 1UBIA 2JT4B 4EZJA 1LFDA 4GDKB 1WXAA 2HE7A 3QAQA 2KTFA 3AULA 3S2AA 2D11A 2MLBA 3O65B 4W9GA 3WIMA 2C9WB 4GMVA 4EFOA 4IW0A 2XBBC 1SGHA 2LRUA 2KANA 3RZWC 3ZTDA 4NAWA 4WJPA 4LJPB 3A1QB 1IPGA 3QARA 2GMIC 2O2VB 2C7MB 2RSUA 2JY6A 2XEWA 1P1AA 4NJ6A 1TTNA 2VRRB 1E5WA 4FLHA 4K1RB 1SE9A 2LJ5A 3APFA 2LXAA 3T8MA 3ECIA 4A3PA 4BBNF 1TZ1A 4GIVA 2IO1B 2V4LA 3UIPB 2LUEA 3W1YA 2GBNA 4WJNA 4FA6A 2JXXA 1EF1A 2XK5B 5AZGA 3ZNHB 3TL5A 3KYCD 3ZO5B 1QZEA 2JPHA 2JVCA 4LCDE 2L8JA 5LXHA 1LXDA 1V5OA 1WXVA 1J19A 2FCNA 4HCPB 2BYVE 3VTWA 1WI0A 3JYUA 2MRPA 2RR9A 4JIOU 3WALA 2W9NA 3WANA 1Z5SB 4CO7A 4G50A 3PGEA 4E3CA 2FNJB 2MBQA 3PZDA 2XK5A 5LLIA 2A4ZA 5J18A 4XZ4A 1RLFA 3B0AA 5KHQA 3KYDD 2L7RA 4WQOB 2IZVB 5J17A 2MX2A 3OJ4B 5BO4B 3P2BA 2KFKB 4ICUA 2C7HA 3DVGX 5DPRA 1WJ4A 4W9KA 4EUTA 1I42A 1E7UA 1UBQA 2QHOA 3M3JA 4IWOA 4BOZB 3VHTC 4TUUA 3TIXA 5EDSA 3ONSA 3QC8B 3QQ8B 1WXMA 5JH5C 3ZNZB 2I1JA 4BBNC 3UINB 4KDIC 3TMPB 2PEAA 4PS3A 1UD7A 3PS6A 5DPWA 4AUQC 4ZYNA 4KZ0A 3ZRCA 1J8CA 3UQBA 2KMCA 3R66C 5L95C 3T9LA 1GUAB 2K25A 3N3KB 2LGYA 3AXCA 1S1QB 3MHSD 4NQKE 3H7PA 2AYOB 2MQJA 2CHZA 2DHZA 3KUDB 2LZ6A 3PSEB 4HDOA 2EMTA 4TQ1A 2KTRB 2KQSA 2MSED 2KD0A 2ZEQA 3IG3A 3NHEB 4WJOA 4XX5A 3DBSA 4DXAB 4URKA 3DDCB 4GN1A 2PE6B 1E8YA 2UWQA 3PLVA 2WX0A 1WJ6A 4JLCA 5J2RA 4GU2A 2IYDB 2DZMA 1GG3A 2GBJA 4CHKA 2K6DB 4F7ZA 4F8CB 5E6OA 1WE6A 4KSKC 1GNUA 1OEYA 5L83A 2IO0B 2LXCA 3SDLC 1YX5B 3IHPC 4W9HA 4CYEA 2KNBA 2V3SA 1GJZA 1WGRA 3LJ3A 4ZDVA 4NNJB 2AEHA 2M8SA 4K81A 3RUIB 4GDLB 1E7VA 3UF8A 3W1SC 4IWQA 2CKHB 4ANWA 2MBEA 5LXIB 1V81A 3EECA 3VAWA 1L2NA 4N9F4 1WZ0A 1OGWA 2BGFA 1WF9A 2LD9A 4EZKA 1G6JA 4YL8A 3DVGY 1WR1A 3RZFA 5JHBA 3NS8A 3D32A 4KIKA 2D2QA 5E6PA 2FCSA 3B1LX 3DVNV 2Z0DB 1WGYA 3U8ZA 3CF6E 3ML8A 2KDIA 3PRZA 1XT9B 3A9JB 3RYTA 4DDID 1YX6B 1P9DU 3EHVA 4WWNA 4II2B 2ZNVC 3CSTA 3ZRFA 3V6CB 1E8XA 2DYOA 3ML9A 2DYBA 4II3B 3SD5A 2KQ7A 1UELA 2PE9A 5D94A 1WMHB 2J0JA 1Q1OA 4B6WA 4MEMA 4DDGD 3KH0A 2CU1A 4IWPA 2WWZA 2N1VA 3OAWA 1H4RA 2YLMA 4HJKA 5CHWA 4MGYE 1C3TA 4MJSB 5E6NA 3H6NA 2MCNB 1Q5WB 4WWPA 4EKUA 3K9OB 3VQIA 1Z2MA 2LI5A 1KLVA 3HIZA 3QCAA 4IUMB 1NI2A 2KDEB 1WYWB 3A9KB 2J7QB 2KMAA 4GDKA 4BKSA 4EOYA 4I6LB 2N1WA 1WRDB 4LJOB 2C60A 1V2YA 2K6QA 4KSLC 3L13A 3WAPA 1U4AA 2KJHB 4PYUA 1WFYA 3DBLI 1WGGA 3RCZA 2BKFA 3A1QA 5CTRC 4HPMB 4BKSD 3JVZX 2JZZA 2ZVNA 3ZLZA 2FCMA 2O2VA 1V5TA 2EKEC 1WX7A 4J6IA 4K7UA 3ZNGC 1WM2A 2AL3A 4DHZB 2Z59B 1OEYJ 3A33B 1WJUA 1ZKHA 2K39A 3UIOB 2NBUA 4BFRA 4JGHB 4KDLB 1K8RB 3NZUA
chains in the Genus database with same CATH superfamily
2JWUA 2WXKA 3RULA 1YN4A 3PT2B 1TBEA 1EF5A 2YEPB 1WXSA 2ZPNA 3VRBB 2L52A 3Q8FA 3RNEC 4MACA 2N9PC 3DBHI 5MPOA 2RGFA 2GOWA 3MP9A 4RGMA 4DHJB 3RD2A 2KFKA 2Y5PA 1FM0D 1I4XA 2DAFA 1F77A 1V86A 2DYMA 3AM9A 1JCKB 1V9JA 4MELA 2CJNA 1UZXB 3ZVVA 4G11A 1V80A 5DPTA 3VTVA 4TQ0A 5CHVC 1TY0A 2E6XA 4JL9A 1KM7A 2NS5A 4LNKA 3BIID 4P1CC 4LNFA 1IGCA 3CMMB 2LASA 2LJIA 1XCTL 1I7HA 1YD8U 2R2QA 2KTRA 3PPAA 3Q3FA 4MH0E 1JRUA 2ZCCA 3MC0B 1L0YB 1Y8RC 3RN9C 2JYEA 1EWCA 2MBHA 5CX3A 5E6JA 3VUXA 1E8ZA 4JQWC 3DCGA 5D6JB 3ZXVA 3L54A 3VH4B 2MW5A 3MJ5A 1E7PB 2X38A 3NVWA 1B1ZA 2N9EB 1UGMA 4F1SA 3ABVB 1JMLA 1HA5A 2IY0B 3RT3B 4OVZA 3EA6A 1XLPA 2KX3A 1FPYA 2KXJA 2R61A 1SJHD 2LVQA 3C8YA 3KUCB 4I6NB 3WAOA 5IA7A 3ZXRA 1ZW7A 1ENFA 4FN2A 2JRHA 3UGBB 1V6EA 2ZW1A 2WDQB 4MJSA 4WWOA 2R2OA 2ZNVB 2BS2B 4A20A 1VCBA 2CS4A 4WWMA 1P98A 1DOXA 1D3ZA 1EUVB 3ZDMC 1PUTA 2WYQA 3HK0A 1E6EB 2BYEA 3OWEB 3QK0A 4EZLA 2WHIA 1AW7A 2KMMA 3ZKJC 3DHHC 2G45B 1ET9A 3PZ8A 2BKRB 3RMKC 2L05A 1P3QU 3I3TB 2N9LA 2JYTA 3GS2A 5BMHA 2KYWA 2WXOA 3OLMD 1CMXB 2KX0A 2J0MA 2LHEA 4IG7B 4ARIA 2GBRA 1H8CA 5EE0A 3P63A 1WX9A 2Z0EB 2WLBA 2IGDA 4AS1A 5D2MB 2UYZB 4S0RA 2I1KA 4HDQA 4OZAA 2ON8A 2H89B 2KWVB 2MEKA 1KOTA 3V60A 2PTLA 4A90A 1LGRA 2BPSA 3AU5A 5EE1A 2HJ8A 3H1UA 3PV1A 1T6BX 3RNGC 1FRRA 3AEAB 3P4PB 4ZRIA 1WY8A 1MFWA 4LTUA 1SIJA 4DXFA 3FILB 4JX1C 1EU3A 3NY5A 2MJ3A 2FUHB 5BYRA 4OZBA 1SIFA 3AU4A 3DBRI 1V49A 5AZFA 1N6ZA 3NZSA 4KIKB 3B08A 1WH3A 3AEDB 4W9LA 5AUIA 3PRMB 3V61A 4GGQA 4NQLB 1RFKA 2DENB 2AQ1B 2L76A 1KTKA 3AEFB 1IYFA 4KVGB 2M17A 1QOBA 4DK5A 3VVWB 2WX1A 2PIAA 2LEKA 1N5XA 3VH3B 5IP4D 2W82A 4OZCA 1XQQA 3KVFB 1NDDA 1F1HA 1OQYA 3NRZA 2I38A 1LFDA 2IDYA 3FKYA 2KTFA 3AULA 3S2AA 2MLBA 4GMVA 2W55A 2XBBC 4N6EB 2KANA 4NAWA 3R2TA 3A1QB 3H8HA 3QARA 1P7FA 2O2VB 3HRDD 1HQRD 2C7MB 2JY6A 1FO4A 4P16A 1E5WA 1E9MA 1IBXB 3KWLA 3T8MA 4BBNF 1SE3A 3SFEB 2IJ0A 2WDRB 3UIPB 4WJNA 4FA6A 2JXXA 2XK5B 4TMAB 1KLGD 1V1PA 3ZO5B 1QZEA 2JVCA 1MHHE 2FCNA 1J19A 2MRPA 2RR9A 4CO7A 1Z5SB 3AE9B 4G50A 2FNJB 2MBQA 2A4ZA 1YN3A 5J18A 1RLFA 3B0AA 5KHQA 3KYDD 3C19A 4WQOB 2IZVB 4US9A 1UF0A 1WJ4A 2N9KA 4W9KA 1I42A 1E7UA 4IWOA 5EDSA 3U2SC 2PKOA 1J7AA 2I1JA 4O1NA 3UINB 3TMPB 5DPWA 1UD7A 3PS6A 3TSSA 4AUQC 4RGNA 1GB4A 3GE3C 3T9LA 1GUAB 2BYTA 3Q14C 1SF0A 3MHSD 3H7PA 2CHZA 4JWSC 2AX5A 2BVCA 1OQQA 2WU2B 5G5GA 1N63A 4XX5A 4DXAB 1JRPA 4GN1A 2PE6B 4HJGE 1UGJA 1V1OA 2L32A 1GG3A 4DQOC 2FBWB 1IGDA 2K6DB 3GP7A 4KSKC 1OEYA 1SXTA 2IO0B 2LXCA 3SDLC 5BYQA 3IHPC 2WXRA 1GJZA 1WGRA 4ZDVA 3IXSA 4NNJB 4IOIE 3UF8A 2CKHB 1V81A 2DBYA 3VAWA 1RYJA 1GAQB 2LD9A 1G6JA 5JHBA 1TS2A 3D32A 2D2QA 1TKYA 3PRZA 2KDIA 1XT9B 3ZYYX 4C7YA 4WWNA 3ZRFA 1QILA 3CSTA 4II2B 3V6CB 2DYOA 2DYBA 1STEA 1MPEA 2QDFA 1D6EC 1Q1OA 4B6WA 1R7SA 3OAWA 2GB1A 1H4RA 2YLMA 5E6NA 1Q5WB 4N59A 3VQIA 1Z2MA 2LI5A 1TS3A 3QCAA 1QKZA 2KDEB 3B2FA 2J7QB 3AE8B 3Q8EA 2KJHB 1WFYA 2BKFA 1CK1A 5HI1A 3JVZX 1V5TA 3MC8A 4H2AA 3EUB2 3A33B 1I4QA 1WJUA 3UIOB 1T3QA 1SE2A 4W9DA 3ETRA 3ZW3A 2N7EA 4XGAB 2J52A 3VUYA 2N7DA 4W9IA 1ZE3D 1K51A 1T0YA 2QILA 4KKIA 3BVMA 1L5PA 2LGSA 1UH6A 4M0WB 1I4HA 1QOAA 1K53A 3RFZB 4B0EA 2FCQA 3N20C 1T0SC 2BQQA 1JW9D 2L0TA 3APCA 3SHQA 2XNAC 3PLUA 1FNVA 3Q2AC 3HM3A 5EE9A 4M02A 4RGTA 5JZEB 3HVDA 2ASQA 2K8HA 4C56C 2KZRA 2KLGA 3W9CB 3RI7C 3Q3NC 3MJWA 3NOBA 2NR2A 1EO6A 4AJWA 1FXIA 3GZNI 3R7RA 3L0WB 4FJZA 2JUOA 1J0GA 2KKCA 2MA9B 3WAMA 1XLNA 4L2YA 1L0XB 4OVVA 5C2TB 2M4NA 3DBRB 3IFWB 2WP9B 1EM7A 5EE3A 2ZPYA 4J3OD 1ESFA 2DZIA 2CHWA 2QSDA 2QJLA 4MGZE 2J4XA 3P4RB 2IO3B 5D3IB 1AN8A 4PT5A 3NVZA 1WE7A 1D5XC 3TJPA 4EEWA 5JHAA 2KLCA 1J7BA 4US8A 1JALA 4TSSA 2KN5A 4YTNB 4ITKA 2D3BA 1BT0A 4B0MA 5HKHA 4BVUC 4YXDB 4E71A 3AV8A 4MGIE 1L6UA 1XF5L 3ZTCA 1YQBA 2FIFA 2JX5A 2PLPA 3U7DA 1C4CA 2REXA 2QMTA 3EGRA 4GXBA 1JQ4A 2LFIA 2K8BA 1ZPSA 2DX5B 1V8CA 3OJ3A 1BMLC 2K8CA 2VH2A 1XLQA 3J9CA 2WDTB 2WXQA 4DWFA 2GI9A 2WGSA 4MSMB 1I35A 3TBLD 2BB5A 2IO2B 3GOEA 3DPDA 2MJEA 3Q8AA 1RAXA 3PO0A 1C4AA 3KW5B 1Q10A 3JSVB 3DOWA 1F2RI 5CHFA 4RF1A 3QWZB 1UWXA 2KACA 5H8YE 1JROA 2OJWA 3T3OA 3B9JA 4HLEA 3ZQ4A 2LWPA 3RNAC 2INDC 4FJVB 1DOIA 2MP2A 2CU3A 1TKEA 2LUMA 1NYRA 1RFAA 2BTEA 3Q3JA 3AEGB 4K7WA 2KOXA 4FULA 5I4DA 2KC2A 3TCAA 4XC2A 2NBVB 3ALBA 1R4MI 1WIAA 4B9KA 4HEA1 2DNFA 1FFVA 2BWES 4AJYB 2EKIA 2NPTA 1FRDA 3AE7B 2CHXA 3M95A 4PS8A 4RH6A 3N1YC 5C23A 3ZDTA 2HD5B 1D5ZC 4KKJA 3AEBB 2D3GA 1JWUD 5TR5A 4BKGA 4LDTD 2ZCBA 1C4PA 1ZGUB 4NY0A 4ZRJA 2BWFA 2YVCA 1FXTB 3Q8CA 2K5PA 1ZP0B 2RPQA 2YEPF 2O6VA 3BYTB 3U4EG 1VZ6A 3M62B 4L1BA 3ZIMA 1TYGB 4K7SA 2O6VD 2KWCA 1E90A 2HTHA 4IM0A 2PJHA 4GLSC 1UBIA 3AECB 4GDKB 1F2RC 2HE7A 2B76B 3O65B 3WIMA 2L83A 2C9WB 4EFOA 1SGHA 2LRUA 4JPSA 4WIPA 1JWMD 4WJPA 4LJPB 1IPGA 1C77A 4L23A 2RSUA 4ZYSA 2LXAA 1NEKB 2JSVX 4A3PA 4GIVA 2IO1B 2V4LA 2WXNA 2LUEA 3W1YA 2GBNA 1EF1A 5IOIA 2JPHA 4LCDE 2L8JA 1A70A 2K0PA 1YN5A 1WI0A 4JIOU 1AWDA 1PGBA 4E3CA 3PZDA 2XK5A 3AMZA 4K3CA 3GE8C 4AQ7A 1NENB 1C78A 3TEZA 5BO4B 2KFKB 1E10A 4EUTA 1XXGA 3GZNB 4NAMA 5JXVA 3VHTC 3QQ8B 1WXMA 5JH5C 3T3NA 3SFDB 3DWMA 1Y56A 1HTOA 3NZ3A 3R66C 2GLSA 3W2DA 1FFUA 2X8XX 3AXCA 1TZOA 2AYOB 1WSPA 3OG5A 1QOFA 2LZ6A 2MHJA 2EMTA 2KTRB 2MSED 2ZEQA 3NHEB 3HVZA 4ZOHC 3DDCB 1E8YA 5J2RA 4GU2A 2DZMA 1MHXA 5AUKA 2JXTA 4F8CB 4F7ZA 1WE6A 2QCZA 5G5HA 2NTTA 2HJ1A 4CYEA 3LJ3A 1QQRA 2I2YA 2M8SA 4K81A 3RUIB 4A6QA 1E7VA 5HHDG 1FNUA 3TEXA 4XYCA 3EECA 1L2NA 4N9F4 4A55A 1OGWA 2BGFA 2KN4A 2INNE 3NS8A 4A9AA 1C79A 1HZ6A 4LK0M 3U8ZA 2KAJA 4IKGA 2PE9A 2Y5CA 5FK9C 4DDGD 2BW2A 5FR3A 4HJKA 4MGYE 4C4VA 4MJSB 2MCNB 4HKQA 2G9HD 3R8BA 2D3AA 2N7JA 1KLVA 3HIZA 4IUMB 1NI2A 3NVYA 1FIQA 4EOYA 4I6LB 1WRDB 1ZUD2 4LJOB 3L13A 4MH8A 3DBHB 3FAHA 3DBLI 1WGGA 4MT5A 3AH7A 3Q6BA 2JZZA 3R2IA 1XEEA 3GB1A 3ZLZA 3MFGA 2EKEC 1YQ4B 2AL3A 1OEYJ 2NBUA 1SE4A 3ZUNA 1F9JA 2L3ZA 1WJNA 4GSWA 3PREA 5IO9A 1SB3C 2KDBA 2JF5A 5GMVA 3M63B 4HRSA 1L7YA 2J42A 2JRIB 3V3XA 4WH4A 2RMMA 2ACZB 1MVKA 3PHXB 4HPPA 2KWUB 4MSQB 3R3MA 1I4PA 1E8WA 4RGOS 2OHFA 2H88B 1TJEA 2KHWB 2AQ2B 2IPKD 2KWDA 5IAAC 2RPVA 2MWSB 4G3XB 4W9JA 3MTNB 4XDDA 5FKAC 3KUZA 3KQ4A 1VR9A 2HTME 2W3SA 2PVOD 1CJEA 1A5RA 2V1YA 4IDIA 1VD2A 2PPHA 2M0XA 3NG0A 3X0WA 3NJTA 4WAAA 1YJIA 1WRIA 2KDFB 3P1MA 4M8NA 3LDZE 1ZDVA 3IVFA 3PHWB 2SAKA 4M8MA 4E74A 4GDLA 3IT4B 2EMSA 3ZGZA 4WJQA 4KV2A 4OVUA 2V9HA 3A4SC 4GB9A 3QA8A 2C7NB 2KJ6A 5C1ZA 3FC4A 4IM2A 3A9JA 1GC7A 2VZKD 3QX1A 1NBFC 3I57A 3ZJTA 2OOBB 1LM8B 1VLBA 1YQ3B 4S17A 1QLBB 1WMHA 2ZVOA 2QC8A 1LO5D 4D2KA 3V6EB 1CZPA 4AOFA 4NAWB 3W5VB 1QOGA 2RDHA 4ZRPA 3VDZA 3X23A 3A9KA 3Q8BA 2FE8A 3VTUA 1PFDA 4RM9A 3BVGA 4ICVA 4IM3A 3ZJUA 2D07B 3CIRB 4NJ7A 1EWYC 3U7ZA 1C9FA 1V1PB 1OTRB 4A3OA 1YJJA 2WQYB 4P6VF 2N0SB 2K22A 4HWIB 3W5UB 4HCNB 3IAS1 2KK8A 3ZJVA 1OFFA 4GOCA 5TSSA 3C0RB 2D3CA 2IBIB 4KGTA 2N4FA 3BVZA 4ANVA 5LNK1 3URYA 4NPNA 2INCC 3V05A 2G4SA 1SJED 4BOSC 4BAXA 3JSVA 4W9CA 2QEJC 2W3RA 3DWGC 2KT7A 3K9PB 3BY4B 1JWSD 3NUHB 1MG8A 4LNOA 3SU8X 3HM6X 2Z8LA 4DHJD 2WXPA 3Q69A 3CSFA 4N58A 4BKTA 4RNAA 3H7PB 4TV3A 3SR6A 2LHDA 1CQVA 3AE6B 4PK1A 1WGHA 2WU5B 2GBKA 4YSZB 2ZZPB 2LGXA 1L4ZB 1JWAD 3U30A 2G4DB 2BBCA 4FHJA 3LYYA 4TKNA 3HUIA 1E0ZA 2B3AA 2BYFA 2A5UA 2KFJA 2D10A 4Q2JA 3P42A 4P7IA 4MM3B 1GC6A 3JW0X 2LVPA 3E9SA 1AARA 4M01A 3AE3B 4HXDA 4EE2A 5BYSA 2G1EA 2KJRA 3N9YC 2JU6X 2MBBB 1WGKA 3UQAA 3W1SA 1AYFA 3DQVA 1JWBD 2WXJA 1VZ7A 4I6PA 3DBLB 3IAM1 1FD6A 4G0NB 1P0RA 4XDCA 5GXGB 4FHKA 1FNWA 1I4RA 2K3UA 1L6VA 1J7CA 2D11A 4R3DA 4W9GA 1TY2A 3BWUD 4DXGA 3ZTDA 2XEWA 1P1AA 4NJ6A 1TTNA 1HXYD 4FLHA 3BK2A 1SE9A 3BK1A 3ECIA 1TZ1A 2JQRB 1T0RC 3ZNHB 5AZGA 3DHGC 3KYCD 2JZPA 1LXDA 1V5OA 1WXVA 1K52A 4HCPB 4KGRA 2BYVE 3VTWA 3WALA 3WANA 2W9NA 4K3BA 3VR8B 1OQRA 3RNFC 5LLIA 1IUEA 4XZ4A 2L7RA 5J17A 3OJ4B 4LLGM 4ICUA 5DPRA 1UBQA 2QHOA 2M19A 3M3JA 4KX6B 1VJKA 3BYYB 4TUUA 3PZ7A 1K50A 3ONSA 3QC8B 4BBNC 1HZ5A 1GPXA 4KDIC 1M4VA 4PS3A 1RM6C 1PGAA 2WXLA 3I63C 1N60A 4KZ0A 3ZRCA 1J8CA 3UQBA 2KMCA 5L95C 3AE2B 3N3KB 2LGYA 4HROA 2QIEB 3AE5B 4CQNA 2DHZA 3KUDB 4QAYA 3PSEB 4HDOA 1XCQL 4TQ1A 2KQSA 2KD0A 4ARCA 1PDXA 4NJCA 4RCOA 1NYQA 3PLVA 1GB1A 2IYDB 1YOVB 4CHKA 5E6OA 5L83A 1YX5B 2V3SA 1I4GA 1YNTE 3FILA 4USAA 4IWQA 1ET6A 4ANWA 5LXIB 1WZ0A 1QT9A 2FUG1 1VZ8A 2Q5WD 3DVGY 4YL8A 3AE4B 1TKGA 3Q3OC 1YMHE 4KIKA 5E6PA 3B1LX 3DVNV 2Z0DB 1WGYA 3LXFA 3CF6E 3ML8A 1YX6B 1P9DU 3EHVA 2LMCA 4II3B 2GRIA 1UELA 5D94A 2J0JA 3MHZA 4MEMA 1P7EA 3KH0A 4IWPA 2N1VA 1UNSA 2UU7A 5HFYA 3LB8C 4BZAA 1WYWB 4BKSA 2VH1A 2K6QA 4FXCA 3RCZA 4BKSD 3A1QA 4HPMB 1KF6B 2FCMA 2O2VA 3CWIA 4J6IA 4K7UA 1WM2A 1IBXA 2K39A 4JGHB 1K8RB 1BXTA 1HEZE 4YTPB 4RFBA 2BS3B 3O13A 3AI5A 3IBEA 4P1BC 3UI3A 4FADA 1FMAD 3V62A 4FBJB 1TGZB 1WYGA 3AEEB 2CJOA 2RD0A 3L16A 1UWMA 1TS4A 1R4NI 3R7QA 2J0KA 1RWSA 2KQ4X 2MP2B 4YSYB 2DZJA 2OJRA 1YIWA 2AQ3B 4HKZE 2LGIA 1VDVA 4LNIA 1YJ1A 1ZXHA 2MBOA 2LVOA 1F52A 3VXWA 2IY1B 1IP9A 4XWTA 2E3TA 5DPSA 5KHOA 2GBMA 4YSXB 2L00B 4FJYA 1T0QC 1FEHA 3TUOA 1FCLA 3I9V1 5D7GA 2CR5A 2L0FA 2NPTB 3A4RA 4RM8A 3VFKA 5G2NA 5H92C 3AN1A 5FR6A 3ZNID 4X57B 4LDTB 5BMIA 2ICIA 1KH0A 1D4BA 4KGSA 5T8IA 3PTFC 4HPLB 2M1MA 4DHZE 1ISNA 2WXIA 4A8XC 5BMGA 3APDA 2WNMA 1WR6E 1S3SG 3N32A 2O6VB 2BB6A 3N30A 2AWTA 4ZHPA 1WGDA 1ZXIA 1KJTA 2ONQA 1SBBB 4B95A 3WCQA 1N62A 2MH7A 1DYQA 3P4SB 1XO3A 1XD3B 3N1XC 1NI3A 1XLOA 3NS1A 1EU4A 2FAZA 3H9DA 1ACCA 1KFYB 3QIJA 2KO3A 3PRPB 3E56A 2DAJA 1ROEA 4C80A 2V3PA 1LQBA 4RMAA 4MGKE 2JZ3B 4KZCA 4ZRKA 2BF8B 4ANUA 4HK2A 3RNCC 2Y5BB 2PVGC 2G3QB 2N9XA 1N61A 3ENEA 3PVLA 3NVVA 3EC8A 1ZOYB 1V97A 1Q0WB 2C5LC 4W9EA 5G55A 2DZKA 2AL6A 4PS7A 1ZDXA 3DVNU 2JWZA 2INPE 1HE8A 2KC1A 2Y3AA 1RRBA 2WXGA 3BZDB 2ZJDA 4M0WA 4M00A 5AZHA 3VUWA 4WURA 3H7SA 4AP4C 1C76A 4DBGA 1R4MB 5IKCM 3WA0A 1WXQA 1DGJA 1UUPA 1PQSA 3RNBC 1WM3A 2NBWB 4IC7B 4ASWC 2KVZA 4ACFA 2NVUI 1L4DB 2NCNA 4MDKE 4PYZA 2KVRA 2W54A 4RF0A 4YTMB 1F0ZA 3MC9A 1X1MA 4XE0A 4W9FA 1C1YB 5DCNA 2EELA 4WAFA 4YT0B 4ANXA 2D5GA 3TEWA 5AEKB 2FIDA 2K1FA 1M94A 4ZHOA 2XN9C 3N1ZC 2LGDA 4REZA 4HVBA 3HHMA 2KDMA 3L08A 1SSNA 2J53A 4AWJA 3P4QB 2NTSA 1TIFA 4XWWA 3EFUA 4MM3A 2LRWA 4NZLB 4ZRQA 3BINA 5D3DA 3L10B 3L17A 1WX8A 4YWGG 4C7ZA 4C4VB 1NVID 4JWUC 3VR9B 1PYWD 3AE1B 3Q3MC 3QJZA 3QHTA 5C3JB 1WZ3A 2JT4B 4EZJA 3KLSX 1WXAA 2SEBD 3QAQA 4IW0A 4OHJA 3RZWC 3VRAB 2V0GA 2RDGA 2BS4B 2GMIC 2VRRB 4K1RB 2LJ5A 3APFA 2PMVA 2M0AA 2NMQA 2K9XA 3TEYA 3TL5A 5LXHA 1R4NB 4LNNA 3JYUA 4JE3B 3U52E 3KWVA 3PGEA 1KRHA 2V4IB 2MX2A 3P2BA 1SEBD 2C7HA 2WDVB 3DVGX 4BOZB 3TIXA 2WS3B 3ZNZB 1L0VB 2M56B 1GOZA 4WQMA 2PEAA 1MJDA 5HG2A 1PGXA 4ZYNA 3DHIC 2TSSA 2K25A 2RDBC 1S1QB 3EFCA 4NQKE 3AB5A 1FXAA 1FCCC 2MQJA 4OW0A 4WJOA 3IG3A 1QF6A 3DBSA 4URKA 2UWQA 2WX0A 1WJ6A 4JLCA 2WXMA 2GBJA 1N5WA 2MJDA 1GNUA 3RPFC 5IN7A 1TT5B 4W9HA 1DOYA 2KNBA 2IGHA 2IGGA 2AEHA 4GDLB 3B2GA 3W1SC 2MBEA 4EZKA 1WF9A 2ZW0A 1WR1A 3RZFA 2VZKB 3L4PA 2DWQA 2FCSA 3A9JB 3RYTA 4DDID 2ZNVC 1TS5A 1E8XA 3ML9A 3SD5A 2KQ7A 2PW9A 1WMHB 4C00A 1KLUD 2L1AA 1T5XD 1WWTA 2CU1A 2WWZA 1C3TA 5CHWA 3IT6B 3H6NA 4WWPA 1VRAB 2BT6A 4EKUA 2OEDA 3K9OB 2WXHA 2DLBA 3A9KB 2KMAA 3I5JC 4GDKA 1D5MC 2N1WA 1B9RA 2WXFA 2C60A 1BUIC 1V2YA 1MI0A 4UDUC 4KSLC 1MG4A 3WAPA 1U4AA 4PYUA 5CTRC 2V3NA 3SEBA 2ZVNA 1HTQA 1WX7A 3ZNGC 4DHZB 2Z59B 1ZKHA 4BFRA 4KDLB 3NZUA 2HDEA
chains in the Genus database with same CATH topology
3ZUNA 2N7EA 1F9JA 2L3ZA 1WJNA 3VUYA 3RULA 4GSWA 3PT2B 3PREA 1TBEA 1EF5A 3AI5A 2N7DA 3IBEA 4W9IA 1WXSA 1T0YA 2KDBA 2JF5A 2ZPNA 4FADA 5GMVA 3M63B 1L7YA 1UH6A 4FBJB 3V62A 2N9PC 1TGZB 4M0WB 3DBHI 2JRIB 2RGFA 2GOWA 2RD0A 3L16A 2FCQA 3PHXB 4DHJB 2L0TA 3RD2A 2KWUB 2KFKA 3APCA 3SHQA 1R4NI 3PLUA 2DAFA 3R7QA 1V86A 2DYMA 2J0KA 4MSQB 3HM3A 3R3MA 1V9JA 4MELA 2MP2B 1E8WA 1UZXB 2KHWB 3ZVVA 2DZJA 2OJRA 5JZEB 5IAAC 2MWSB 2ASQA 4G3XB 1YIWA 2K8HA 2KZRA 4G11A 1YJ1A 1V80A 2KLGA 2MBOA 5DPTA 4W9JA 2LVOA 3MJWA 3VTVA 5CHVC 3VXWA 4TQ0A 3NOBA 2NR2A 2IY1B 3MTNB 1EO6A 4AJWA 1IP9A 3KUZA 3GZNI 5DPSA 5KHOA 3R7RA 2GBMA 2L00B 4FJYA 4JL9A 3L0WB 1KM7A 2JUOA 4FJZA 1J0GA 2NS5A 2KKCA 2MA9B 3CMMB 3WAMA 1A5RA 2LASA 5D7GA 2V1YA 1YD8U 2CR5A 2L0FA 2R2QA 2NPTB 2KTRA 3A4RA 4RM8A 3PPAA 1VD2A 3Q3FA 3VFKA 4OVVA 2PPHA 2M4NA 5G2NA 4MH0E 1JRUA 2ZCCA 3IFWB 5FR6A 3ZNID 4X57B 4LDTB 2M0XA 2ZPYA 1Y8RC 2MBHA 3X0WA 2DZIA 2CHWA 5CX3A 3VUXA 1E8ZA 4JQWC 4MGZE 3DCGA 4WAAA 5D6JB 2KDFB 3L54A 3VH4B 2MW5A 3PTFC 4HPLB 4M8NA 3LDZE 2M1MA 2IO3B 3IVFA 4DHZE 1ISNA 3PHWB 4M8MA 4E74A 4GDLA 1WE7A 2EMSA 3APDA 2N9EB 1UGMA 3TJPA 4F1SA 4WJQA 4EEWA 4KV2A 5JHAA 1WR6E 4OVUA 3A4SC 1S3SG 4GB9A 2KLCA 3N32A 3QA8A 2O6VB 2IY0B 3N30A 3RT3B 2C7NB 2AWTA 1WGDA 2KJ6A 5C1ZA 2KN5A 1KJTA 4IM2A 2KX3A 1BT0A 3A9JA 2KXJA 5HKHA 2LVQA 1GC7A 3KUCB 3QX1A 1NBFC 4BVUC 4B95A 4I6NB 3WAOA 2OOBB 5IA7A 1LM8B 1ZW7A 4E71A 1WMHA 4FN2A 2JRHA 1XD3B 4MGIE 3UGBB 1V6EA 2ZVOA 3ZTCA 1YQBA 2FAZA 3H9DA 3V6EB 2FIFA 4MJSA 3QIJA 4WWOA 2R2OA 3U7DA 2KO3A 4AOFA 2REXA 2ZNVB 3PRPB 4NAWB 4A20A 2DAJA 1VCBA 4GXBA 2K8BA 2DX5B 3VDZA 2CS4A 3A9KA 3X23A 1P98A 1LQBA 3VTUA 1D3ZA 1EUVB 4RMAA 3OJ3A 3ZDMC 4RM9A 2WYQA 4ICVA 2K8CA 4MGKE 2JZ3B 4IM3A 4KZCA 3HK0A 2BYEA 2WDTB 2D07B 4ZRKA 3QK0A 2BF8B 4ANUA 4DWFA 4EZLA 4NJ7A 4HK2A 2Y5BB 4MSMB 2G3QB 2N9XA 1OTRB 1I35A 4A3OA 3ZKJC 3TBLD 3ENEA 3PVLA 2G45B 2IO2B 3GOEA 4HWIB 3EC8A 3DPDA 2BKRB 1Q0WB 2C5LC 4HCNB 4W9EA 1RAXA 5G55A 2KK8A 2DZKA 3KW5B 2AL6A 2L05A 1P3QU 3I3TB 4GOCA 4PS7A 3DVNU 2JWZA 3JSVB 3C0RB 2IBIB 3DOWA 2N4FA 1HE8A 2KC1A 4ANVA 1RRBA 5CHFA 3OLMD 1CMXB 2ZJDA 3QWZB 2KX0A 5AZHA 2J0MA 4IG7B 3VUWA 4NPNA 3H7SA 4AP4C 2G4SA 4DBGA 4BOSC 2GBRA 1H8CA 3JSVA 4W9CA 4HLEA 4W9DA 3WA0A 1WX9A 2LWPA 3K9PB 2Z0EB 3BY4B 1MG8A 4FJVB 3SU8X 2MP2A 3HM6X 4DHJD 1PQSA 1WM3A 3CSFA 1RFAA 2NBWB 3Q3JA 4IC7B 5D2MB 4ASWC 4BKTA 3H7PB 2UYZB 4TV3A 2NVUI 4K7WA 2NCNA 2I1KA 4HDQA 2KOXA 4FULA 4MDKE 2KWVB 4PYZA 2KC2A 2KVRA 1KOTA 3TCAA 3V60A 4XC2A 2NBVB 3ALBA 1WGHA 1R4MI 2BPSA 3AU5A 1X1MA 2HJ8A 2GBKA 3H1UA 1WIAA 3PV1A 4B9KA 4W9FA 2ZZPB 1C1YB 2BWES 2LGXA 3U30A 4AJYB 5DCNA 2NPTA 4ZRIA 2G4DB 2CHXA 4FHJA 1WY8A 3M95A 4PS8A 4ANXA 4TKNA 5C23A 2B3AA 2HD5B 3ZDTA 2BYFA 2A5UA 3NY5A 5AEKB 2KFJA 2D10A 2FUHB 2FIDA 2K1FA 1M94A 4P7IA 2D3GA 5TR5A 4BKGA 4LDTD 1SIFA 3AU4A 2ZCBA 2LGDA 3ZW3A 3DBRI 1V49A 5AZFA 4HVBA 3HHMA 3NZSA 3B08A 1GC6A 3L08A 1WH3A 4KIKB 1ZGUB 3JW0X 4AWJA 2LVPA 4W9LA 4NY0A 1AARA 3PRMB 3V61A 4GGQA 4NQLB 4ZRJA 4HXDA 2BWFA 2YVCA 2DENB 2L76A 3EFUA 1FXTB 4MM3A 1IYFA 2LRWA 2KJRA 2RPQA 4KVGB 2O6VA 3BINA 2M17A 3L10B 2MBBB 3UQAA 4DK5A 3VVWB 2WX1A 3L17A 3M62B 1WX8A 3W1SA 3ZIMA 3VH3B 3DQVA 4K7SA 2O6VD 2KWCA 4I6PA 1XQQA 1E90A 2HTHA 3KVFB 4G0NB 1NDDA 4IM0A 1P0RA 3QHTA 3QJZA 4FHKA 2PJHA 1OQYA 1WZ3A 1UBIA 2JT4B 4EZJA 1LFDA 4GDKB 1WXAA 2HE7A 3QAQA 2KTFA 3AULA 3S2AA 2D11A 2MLBA 3O65B 4W9GA 3WIMA 2C9WB 4GMVA 4EFOA 4IW0A 2XBBC 1SGHA 2LRUA 2KANA 3RZWC 3ZTDA 4NAWA 4WJPA 4LJPB 3A1QB 1IPGA 3QARA 2GMIC 2O2VB 2C7MB 2RSUA 2JY6A 2XEWA 1P1AA 4NJ6A 1TTNA 2VRRB 1E5WA 4FLHA 4K1RB 1SE9A 2LJ5A 3APFA 2LXAA 3T8MA 3ECIA 4A3PA 4BBNF 1TZ1A 4GIVA 2IO1B 2V4LA 3UIPB 2LUEA 3W1YA 2GBNA 4WJNA 4FA6A 2JXXA 1EF1A 2XK5B 5AZGA 3ZNHB 3TL5A 3KYCD 3ZO5B 1QZEA 2JPHA 2JVCA 4LCDE 2L8JA 5LXHA 1LXDA 1V5OA 1WXVA 1J19A 2FCNA 4HCPB 2BYVE 3VTWA 1WI0A 3JYUA 2MRPA 2RR9A 4JIOU 3WALA 2W9NA 3WANA 1Z5SB 4CO7A 4G50A 3PGEA 4E3CA 2FNJB 2MBQA 3PZDA 2XK5A 5LLIA 2A4ZA 5J18A 4XZ4A 1RLFA 3B0AA 5KHQA 3KYDD 2L7RA 4WQOB 2IZVB 5J17A 2MX2A 3OJ4B 5BO4B 3P2BA 2KFKB 4ICUA 2C7HA 3DVGX 5DPRA 1WJ4A 4W9KA 4EUTA 1I42A 1E7UA 1UBQA 2QHOA 3M3JA 4IWOA 4BOZB 3VHTC 4TUUA 3TIXA 5EDSA 3ONSA 3QC8B 3QQ8B 1WXMA 5JH5C 3ZNZB 2I1JA 4BBNC 3UINB 4KDIC 3TMPB 2PEAA 4PS3A 1UD7A 3PS6A 5DPWA 4AUQC 4ZYNA 4KZ0A 3ZRCA 1J8CA 3UQBA 2KMCA 3R66C 5L95C 3T9LA 1GUAB 2K25A 3N3KB 2LGYA 3AXCA 1S1QB 3MHSD 4NQKE 3H7PA 2AYOB 2MQJA 2CHZA 2DHZA 3KUDB 2LZ6A 3PSEB 4HDOA 2EMTA 4TQ1A 2KTRB 2KQSA 2MSED 2KD0A 2ZEQA 3IG3A 3NHEB 4WJOA 4XX5A 3DBSA 4DXAB 4URKA 3DDCB 4GN1A 2PE6B 1E8YA 2UWQA 3PLVA 2WX0A 1WJ6A 4JLCA 5J2RA 4GU2A 2IYDB 2DZMA 1GG3A 2GBJA 4CHKA 2K6DB 4F7ZA 4F8CB 5E6OA 1WE6A 4KSKC 1GNUA 1OEYA 5L83A 2IO0B 2LXCA 3SDLC 1YX5B 3IHPC 4W9HA 4CYEA 2KNBA 2V3SA 1GJZA 1WGRA 3LJ3A 4ZDVA 4NNJB 2AEHA 2M8SA 4K81A 3RUIB 4GDLB 1E7VA 3UF8A 3W1SC 4IWQA 2CKHB 4ANWA 2MBEA 5LXIB 1V81A 3EECA 3VAWA 1L2NA 4N9F4 1WZ0A 1OGWA 2BGFA 1WF9A 2LD9A 4EZKA 1G6JA 4YL8A 3DVGY 1WR1A 3RZFA 5JHBA 3NS8A 3D32A 4KIKA 2D2QA 5E6PA 2FCSA 3B1LX 3DVNV 2Z0DB 1WGYA 3U8ZA 3CF6E 3ML8A 2KDIA 3PRZA 1XT9B 3A9JB 3RYTA 4DDID 1YX6B 1P9DU 3EHVA 4WWNA 4II2B 2ZNVC 3CSTA 3ZRFA 3V6CB 1E8XA 2DYOA 3ML9A 2DYBA 4II3B 3SD5A 2KQ7A 1UELA 2PE9A 5D94A 1WMHB 2J0JA 1Q1OA 4B6WA 4MEMA 4DDGD 3KH0A 2CU1A 4IWPA 2WWZA 2N1VA 3OAWA 1H4RA 2YLMA 4HJKA 5CHWA 4MGYE 1C3TA 4MJSB 5E6NA 3H6NA 2MCNB 1Q5WB 4WWPA 4EKUA 3K9OB 3VQIA 1Z2MA 2LI5A 1KLVA 3HIZA 3QCAA 4IUMB 1NI2A 2KDEB 1WYWB 3A9KB 2J7QB 2KMAA 4GDKA 4BKSA 4EOYA 4I6LB 2N1WA 1WRDB 4LJOB 2C60A 1V2YA 2K6QA 4KSLC 3L13A 3WAPA 1U4AA 2KJHB 4PYUA 1WFYA 3DBLI 1WGGA 3RCZA 2BKFA 3A1QA 5CTRC 4HPMB 4BKSD 3JVZX 2JZZA 2ZVNA 3ZLZA 2FCMA 2O2VA 1V5TA 2EKEC 1WX7A 4J6IA 4K7UA 3ZNGC 1WM2A 2AL3A 4DHZB 2Z59B 1OEYJ 3A33B 1WJUA 1ZKHA 2K39A 3UIOB 2NBUA 4BFRA 4JGHB 4KDLB 1K8RB 3NZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUN A;  2N7E A;  1F9J A;  2L3Z A;  1WJN A;  3VUY A;  3RUL A;  4GSW A;  3PT2 B;  3PRE A;  1TBE A;  1EF5 A;  3AI5 A;  2N7D A;  3IBE A;  4W9I A;  1WXS A;  1T0Y A;  2KDB A;  2JF5 A;  2ZPN A;  4FAD A;  5GMV A;  3M63 B;  1L7Y A;  1UH6 A;  4FBJ B;  3V62 A;  2N9P C;  1TGZ B;  4M0W B;  3DBH I;  2JRI B;  2RGF A;  2GOW A;  2RD0 A;  3L16 A;  2FCQ A;  3PHX B;  4DHJ B;  2L0T A;  3RD2 A;  2KWU B;  2KFK A;  3APC A;  3SHQ A;  1R4N I;  3PLU A;  2DAF A;  3R7Q A;  1V86 A;  2DYM A;  2J0K A;  4MSQ B;  3HM3 A;  3R3M A;  1V9J A;  4MEL A;  2MP2 B;  1E8W A;  1UZX B;  2KHW B;  3ZVV A;  2DZJ A;  2OJR A;  5JZE B;  5IAA C;  2MWS B;  2ASQ A;  4G3X B;  1YIW A;  2K8H A;  2KZR A;  4G11 A;  1YJ1 A;  1V80 A;  2KLG A;  2MBO A;  5DPT A;  4W9J A;  2LVO A;  3MJW A;  3VTV A;  5CHV C;  3VXW A;  4TQ0 A;  3NOB A;  2NR2 A;  2IY1 B;  3MTN B;  1EO6 A;  4AJW A;  1IP9 A;  3KUZ A;  3GZN I;  5DPS A;  5KHO A;  3R7R A;  2GBM A;  2L00 B;  4FJY A;  4JL9 A;  3L0W B;  1KM7 A;  2JUO A;  4FJZ A;  1J0G A;  2NS5 A;  2KKC A;  2MA9 B;  3CMM B;  3WAM A;  1A5R A;  2LAS A;  5D7G A;  2V1Y A;  1YD8 U;  2CR5 A;  2L0F A;  2R2Q A;  2NPT B;  2KTR A;  3A4R A;  4RM8 A;  3PPA A;  1VD2 A;  3Q3F A;  3VFK A;  4OVV A;  2PPH A;  2M4N A;  5G2N A;  4MH0 E;  1JRU A;  2ZCC A;  3IFW B;  5FR6 A;  3ZNI D;  4X57 B;  4LDT B;  2M0X A;  2ZPY A;  1Y8R C;  2MBH A;  3X0W A;  2DZI A;  2CHW A;  5CX3 A;  3VUX A;  1E8Z A;  4JQW C;  4MGZ E;  3DCG A;  4WAA A;  5D6J B;  2KDF B;  3L54 A;  3VH4 B;  2MW5 A;  3PTF C;  4HPL B;  4M8N A;  3LDZ E;  2M1M A;  2IO3 B;  3IVF A;  4DHZ E;  1ISN A;  3PHW B;  4M8M A;  4E74 A;  4GDL A;  1WE7 A;  2EMS A;  3APD A;  2N9E B;  1UGM A;  3TJP A;  4F1S A;  4WJQ A;  4EEW A;  4KV2 A;  5JHA A;  1WR6 E;  4OVU A;  3A4S C;  1S3S G;  4GB9 A;  2KLC A;  3N32 A;  3QA8 A;  2O6V B;  2IY0 B;  3N30 A;  3RT3 B;  2C7N B;  2AWT A;  1WGD A;  2KJ6 A;  5C1Z A;  2KN5 A;  1KJT A;  4IM2 A;  2KX3 A;  1BT0 A;  3A9J A;  2KXJ A;  5HKH A;  2LVQ A;  1GC7 A;  3KUC B;  3QX1 A;  1NBF C;  4BVU C;  4B95 A;  4I6N B;  3WAO A;  2OOB B;  5IA7 A;  1LM8 B;  1ZW7 A;  4E71 A;  1WMH A;  4FN2 A;  2JRH A;  1XD3 B;  4MGI E;  3UGB B;  1V6E A;  2ZVO A;  3ZTC A;  1YQB A;  2FAZ A;  3H9D A;  3V6E B;  2FIF A;  4MJS A;  3QIJ A;  4WWO A;  2R2O A;  3U7D A;  2KO3 A;  4AOF A;  2REX A;  2ZNV B;  3PRP B;  4NAW B;  4A20 A;  2DAJ A;  1VCB A;  4GXB A;  2K8B A;  2DX5 B;  3VDZ A;  2CS4 A;  3A9K A;  3X23 A;  1P98 A;  1LQB A;  3VTU A;  1D3Z A;  1EUV B;  4RMA A;  3OJ3 A;  3ZDM C;  4RM9 A;  2WYQ A;  4ICV A;  2K8C A;  4MGK E;  2JZ3 B;  4IM3 A;  4KZC A;  3HK0 A;  2BYE A;  2WDT B;  2D07 B;  4ZRK A;  3QK0 A;  2BF8 B;  4ANU A;  4DWF A;  4EZL A;  4NJ7 A;  4HK2 A;  2Y5B B;  4MSM B;  2G3Q B;  2N9X A;  1OTR B;  1I35 A;  4A3O A;  3ZKJ C;  3TBL D;  3ENE A;  3PVL A;  2G45 B;  2IO2 B;  3GOE A;  4HWI B;  3EC8 A;  3DPD A;  2BKR B;  1Q0W B;  2C5L C;  4HCN B;  4W9E A;  1RAX A;  5G55 A;  2KK8 A;  2DZK A;  3KW5 B;  2AL6 A;  2L05 A;  1P3Q U;  3I3T B;  4GOC A;  4PS7 A;  3DVN U;  2JWZ A;  3JSV B;  3C0R B;  2IBI B;  3DOW A;  2N4F A;  1HE8 A;  2KC1 A;  4ANV A;  1RRB A;  5CHF A;  3OLM D;  1CMX B;  2ZJD A;  3QWZ B;  2KX0 A;  5AZH A;  2J0M A;  4IG7 B;  3VUW A;  4NPN A;  3H7S A;  4AP4 C;  2G4S A;  4DBG A;  4BOS C;  2GBR A;  1H8C A;  3JSV A;  4W9C A;  4HLE A;  4W9D A;  3WA0 A;  1WX9 A;  2LWP A;  3K9P B;  2Z0E B;  3BY4 B;  1MG8 A;  4FJV B;  3SU8 X;  2MP2 A;  3HM6 X;  4DHJ D;  1PQS A;  1WM3 A;  3CSF A;  1RFA A;  2NBW B;  3Q3J A;  4IC7 B;  5D2M B;  4ASW C;  4BKT A;  3H7P B;  2UYZ B;  4TV3 A;  2NVU I;  4K7W A;  2NCN A;  2I1K A;  4HDQ A;  2KOX A;  4FUL A;  4MDK E;  2KWV B;  4PYZ A;  2KC2 A;  2KVR A;  1KOT A;  3TCA A;  3V60 A;  4XC2 A;  2NBV B;  3ALB A;  1WGH A;  1R4M I;  2BPS A;  3AU5 A;  1X1M A;  2HJ8 A;  2GBK A;  3H1U A;  1WIA A;  3PV1 A;  4B9K A;  4W9F A;  2ZZP B;  1C1Y B;  2BWE S;  2LGX A;  3U30 A;  4AJY B;  5DCN A;  2NPT A;  4ZRI A;  2G4D B;  2CHX A;  4FHJ A;  1WY8 A;  3M95 A;  4PS8 A;  4ANX A;  4TKN A;  5C23 A;  2B3A A;  2HD5 B;  3ZDT A;  2BYF A;  2A5U A;  3NY5 A;  5AEK B;  2KFJ A;  2D10 A;  2FUH B;  2FID A;  2K1F A;  1M94 A;  4P7I A;  2D3G A;  5TR5 A;  4BKG A;  4LDT D;  1SIF A;  3AU4 A;  2ZCB A;  2LGD A;  3ZW3 A;  3DBR I;  1V49 A;  5AZF A;  4HVB A;  3HHM A;  3NZS A;  3B08 A;  1GC6 A;  3L08 A;  1WH3 A;  4KIK B;  1ZGU B;  3JW0 X;  4AWJ A;  2LVP A;  4W9L A;  4NY0 A;  1AAR A;  3PRM B;  3V61 A;  4GGQ A;  4NQL B;  4ZRJ A;  4HXD A;  2BWF A;  2YVC A;  2DEN B;  2L76 A;  3EFU A;  1FXT B;  4MM3 A;  1IYF A;  2LRW A;  2KJR A;  2RPQ A;  4KVG B;  2O6V A;  3BIN A;  2M17 A;  3L10 B;  2MBB B;  3UQA A;  4DK5 A;  3VVW B;  2WX1 A;  3L17 A;  3M62 B;  1WX8 A;  3W1S A;  3ZIM A;  3VH3 B;  3DQV A;  4K7S A;  2O6V D;  2KWC A;  4I6P A;  1XQQ A;  1E90 A;  2HTH A;  3KVF B;  4G0N B;  1NDD A;  4IM0 A;  1P0R A;  3QHT A;  3QJZ A;  4FHK A;  2PJH A;  1OQY A;  1WZ3 A;  1UBI A;  2JT4 B;  4EZJ A;  1LFD A;  4GDK B;  1WXA A;  2HE7 A;  3QAQ A;  2KTF A;  3AUL A;  3S2A A;  2D11 A;  2MLB A;  3O65 B;  4W9G A;  3WIM A;  2C9W B;  4GMV A;  4EFO A;  4IW0 A;  2XBB C;  1SGH A;  2LRU A;  2KAN A;  3RZW C;  3ZTD A;  4NAW A;  4WJP A;  4LJP B;  3A1Q B;  1IPG A;  3QAR A;  2GMI C;  2O2V B;  2C7M B;  2RSU A;  2JY6 A;  2XEW A;  1P1A A;  4NJ6 A;  1TTN A;  2VRR B;  1E5W A;  4FLH A;  4K1R B;  1SE9 A;  2LJ5 A;  3APF A;  2LXA A;  3T8M A;  3ECI A;  4A3P A;  4BBN F;  1TZ1 A;  4GIV A;  2IO1 B;  2V4L A;  3UIP B;  2LUE A;  3W1Y A;  2GBN A;  4WJN A;  4FA6 A;  2JXX A;  1EF1 A;  2XK5 B;  5AZG A;  3ZNH B;  3TL5 A;  3KYC D;  3ZO5 B;  1QZE A;  2JPH A;  2JVC A;  4LCD E;  2L8J A;  5LXH A;  1LXD A;  1V5O A;  1WXV A;  1J19 A;  2FCN A;  4HCP B;  2BYV E;  3VTW A;  1WI0 A;  3JYU A;  2MRP A;  2RR9 A;  4JIO U;  3WAL A;  2W9N A;  3WAN A;  1Z5S B;  4CO7 A;  4G50 A;  3PGE A;  4E3C A;  2FNJ B;  2MBQ A;  3PZD A;  2XK5 A;  5LLI A;  2A4Z A;  5J18 A;  4XZ4 A;  1RLF A;  3B0A A;  5KHQ A;  3KYD D;  2L7R A;  4WQO B;  2IZV B;  5J17 A;  2MX2 A;  3OJ4 B;  5BO4 B;  3P2B A;  2KFK B;  4ICU A;  2C7H A;  3DVG X;  5DPR A;  1WJ4 A;  4W9K A;  4EUT A;  1I42 A;  1E7U A;  1UBQ A;  2QHO A;  3M3J A;  4IWO A;  4BOZ B;  3VHT C;  4TUU A;  3TIX A;  5EDS A;  3ONS A;  3QC8 B;  3QQ8 B;  1WXM A;  5JH5 C;  3ZNZ B;  2I1J A;  4BBN C;  3UIN B;  4KDI C;  3TMP B;  2PEA A;  4PS3 A;  1UD7 A;  3PS6 A;  5DPW A;  4AUQ C;  4ZYN A;  4KZ0 A;  3ZRC A;  1J8C A;  3UQB A;  2KMC A;  3R66 C;  5L95 C;  3T9L A;  1GUA B;  2K25 A;  3N3K B;  2LGY A;  3AXC A;  1S1Q B;  3MHS D;  4NQK E;  3H7P A;  2AYO B;  2MQJ A;  2CHZ A;  2DHZ A;  3KUD B;  2LZ6 A;  3PSE B;  4HDO A;  2EMT A;  4TQ1 A;  2KTR B;  2KQS A;  2MSE D;  2KD0 A;  2ZEQ A;  3IG3 A;  3NHE B;  4WJO A;  4XX5 A;  3DBS A;  4DXA B;  4URK A;  3DDC B;  4GN1 A;  2PE6 B;  1E8Y A;  2UWQ A;  3PLV A;  2WX0 A;  1WJ6 A;  4JLC A;  5J2R A;  4GU2 A;  2IYD B;  2DZM A;  1GG3 A;  2GBJ A;  4CHK A;  2K6D B;  4F7Z A;  4F8C B;  5E6O A;  1WE6 A;  4KSK C;  1GNU A;  1OEY A;  5L83 A;  2IO0 B;  2LXC A;  3SDL C;  1YX5 B;  3IHP C;  4W9H A;  4CYE A;  2KNB A;  2V3S A;  1GJZ A;  1WGR A;  3LJ3 A;  4ZDV A;  4NNJ B;  2AEH A;  2M8S A;  4K81 A;  3RUI B;  4GDL B;  1E7V A;  3UF8 A;  3W1S C;  4IWQ A;  2CKH B;  4ANW A;  2MBE A;  5LXI B;  1V81 A;  3EEC A;  3VAW A;  1L2N A;  4N9F 4;  1WZ0 A;  1OGW A;  2BGF A;  1WF9 A;  2LD9 A;  4EZK A;  1G6J A;  4YL8 A;  3DVG Y;  1WR1 A;  3RZF A;  5JHB A;  3NS8 A;  3D32 A;  4KIK A;  2D2Q A;  5E6P A;  2FCS A;  3B1L X;  3DVN V;  2Z0D B;  1WGY A;  3U8Z A;  3CF6 E;  3ML8 A;  2KDI A;  3PRZ A;  1XT9 B;  3A9J B;  3RYT A;  4DDI D;  1YX6 B;  1P9D U;  3EHV A;  4WWN A;  4II2 B;  2ZNV C;  3CST A;  3ZRF A;  3V6C B;  1E8X A;  2DYO A;  3ML9 A;  2DYB A;  4II3 B;  3SD5 A;  2KQ7 A;  1UEL A;  2PE9 A;  5D94 A;  1WMH B;  2J0J A;  1Q1O A;  4B6W A;  4MEM A;  4DDG D;  3KH0 A;  2CU1 A;  4IWP A;  2WWZ A;  2N1V A;  3OAW A;  1H4R A;  2YLM A;  4HJK A;  5CHW A;  4MGY E;  1C3T A;  4MJS B;  5E6N A;  3H6N A;  2MCN B;  1Q5W B;  4WWP A;  4EKU A;  3K9O B;  3VQI A;  1Z2M A;  2LI5 A;  1KLV A;  3HIZ A;  3QCA A;  4IUM B;  1NI2 A;  2KDE B;  1WYW B;  3A9K B;  2J7Q B;  2KMA A;  4GDK A;  4BKS A;  4EOY A;  4I6L B;  2N1W A;  1WRD B;  4LJO B;  2C60 A;  1V2Y A;  2K6Q A;  4KSL C;  3L13 A;  3WAP A;  1U4A A;  2KJH B;  4PYU A;  1WFY A;  3DBL I;  1WGG A;  3RCZ A;  2BKF A;  3A1Q A;  5CTR C;  4HPM B;  4BKS D;  3JVZ X;  2JZZ A;  2ZVN A;  3ZLZ A;  2FCM A;  2O2V A;  1V5T A;  2EKE C;  1WX7 A;  4J6I A;  4K7U A;  3ZNG C;  1WM2 A;  2AL3 A;  4DHZ B;  2Z59 B;  1OEY J;  3A33 B;  1WJU A;  1ZKH A;  2K39 A;  3UIO B;  2NBU A;  4BFR A;  4JGH B;  4KDL B;  1K8R B;  3NZU A; 
#chains in the Genus database with same CATH topology
 2JWU A;  2WXK A;  3RUL A;  1YN4 A;  3PT2 B;  1TBE A;  1EF5 A;  2YEP B;  1WXS A;  2ZPN A;  3VRB B;  2L52 A;  3Q8F A;  3RNE C;  4MAC A;  2N9P C;  3DBH I;  5MPO A;  2RGF A;  2GOW A;  3MP9 A;  4RGM A;  4DHJ B;  3RD2 A;  2KFK A;  2Y5P A;  1FM0 D;  1I4X A;  2DAF A;  1F77 A;  1V86 A;  2DYM A;  3AM9 A;  1JCK B;  1V9J A;  4MEL A;  2CJN A;  1UZX B;  3ZVV A;  4G11 A;  1V80 A;  5DPT A;  3VTV A;  4TQ0 A;  5CHV C;  1TY0 A;  2E6X A;  4JL9 A;  1KM7 A;  2NS5 A;  4LNK A;  3BII D;  4P1C C;  4LNF A;  1IGC A;  3CMM B;  2LAS A;  2LJI A;  1XCT L;  1I7H A;  1YD8 U;  2R2Q A;  2KTR A;  3PPA A;  3Q3F A;  4MH0 E;  1JRU A;  2ZCC A;  3MC0 B;  1L0Y B;  1Y8R C;  3RN9 C;  2JYE A;  1EWC A;  2MBH A;  5CX3 A;  5E6J A;  3VUX A;  1E8Z A;  4JQW C;  3DCG A;  5D6J B;  3ZXV A;  3L54 A;  3VH4 B;  2MW5 A;  3MJ5 A;  1E7P B;  2X38 A;  3NVW A;  1B1Z A;  2N9E B;  1UGM A;  4F1S A;  3ABV B;  1JML A;  1HA5 A;  2IY0 B;  3RT3 B;  4OVZ A;  3EA6 A;  1XLP A;  2KX3 A;  1FPY A;  2KXJ A;  2R61 A;  1SJH D;  2LVQ A;  3C8Y A;  3KUC B;  4I6N B;  3WAO A;  5IA7 A;  3ZXR A;  1ZW7 A;  1ENF A;  4FN2 A;  2JRH A;  3UGB B;  1V6E A;  2ZW1 A;  2WDQ B;  4MJS A;  4WWO A;  2R2O A;  2ZNV B;  2BS2 B;  4A20 A;  1VCB A;  2CS4 A;  4WWM A;  1P98 A;  1DOX A;  1D3Z A;  1EUV B;  3ZDM C;  1PUT A;  2WYQ A;  3HK0 A;  1E6E B;  2BYE A;  3OWE B;  3QK0 A;  4EZL A;  2WHI A;  1AW7 A;  2KMM A;  3ZKJ C;  3DHH C;  2G45 B;  1ET9 A;  3PZ8 A;  2BKR B;  3RMK C;  2L05 A;  1P3Q U;  3I3T B;  2N9L A;  2JYT A;  3GS2 A;  5BMH A;  2KYW A;  2WXO A;  3OLM D;  1CMX B;  2KX0 A;  2J0M A;  2LHE A;  4IG7 B;  4ARI A;  2GBR A;  1H8C A;  5EE0 A;  3P63 A;  1WX9 A;  2Z0E B;  2WLB A;  2IGD A;  4AS1 A;  5D2M B;  2UYZ B;  4S0R A;  2I1K A;  4HDQ A;  4OZA A;  2ON8 A;  2H89 B;  2KWV B;  2MEK A;  1KOT A;  3V60 A;  2PTL A;  4A90 A;  1LGR A;  2BPS A;  3AU5 A;  5EE1 A;  2HJ8 A;  3H1U A;  3PV1 A;  1T6B X;  3RNG C;  1FRR A;  3AEA B;  3P4P B;  4ZRI A;  1WY8 A;  1MFW A;  4LTU A;  1SIJ A;  4DXF A;  3FIL B;  4JX1 C;  1EU3 A;  3NY5 A;  2MJ3 A;  2FUH B;  5BYR A;  4OZB A;  1SIF A;  3AU4 A;  3DBR I;  1V49 A;  5AZF A;  1N6Z A;  3NZS A;  4KIK B;  3B08 A;  1WH3 A;  3AED B;  4W9L A;  5AUI A;  3PRM B;  3V61 A;  4GGQ A;  4NQL B;  1RFK A;  2DEN B;  2AQ1 B;  2L76 A;  1KTK A;  3AEF B;  1IYF A;  4KVG B;  2M17 A;  1QOB A;  4DK5 A;  3VVW B;  2WX1 A;  2PIA A;  2LEK A;  1N5X A;  3VH3 B;  5IP4 D;  2W82 A;  4OZC A;  1XQQ A;  3KVF B;  1NDD A;  1F1H A;  1OQY A;  3NRZ A;  2I38 A;  1LFD A;  2IDY A;  3FKY A;  2KTF A;  3AUL A;  3S2A A;  2MLB A;  4GMV A;  2W55 A;  2XBB C;  4N6E B;  2KAN A;  4NAW A;  3R2T A;  3A1Q B;  3H8H A;  3QAR A;  1P7F A;  2O2V B;  3HRD D;  1HQR D;  2C7M B;  2JY6 A;  1FO4 A;  4P16 A;  1E5W A;  1E9M A;  1IBX B;  3KWL A;  3T8M A;  4BBN F;  1SE3 A;  3SFE B;  2IJ0 A;  2WDR B;  3UIP B;  4WJN A;  4FA6 A;  2JXX A;  2XK5 B;  4TMA B;  1KLG D;  1V1P A;  3ZO5 B;  1QZE A;  2JVC A;  1MHH E;  2FCN A;  1J19 A;  2MRP A;  2RR9 A;  4CO7 A;  1Z5S B;  3AE9 B;  4G50 A;  2FNJ B;  2MBQ A;  2A4Z A;  1YN3 A;  5J18 A;  1RLF A;  3B0A A;  5KHQ A;  3KYD D;  3C19 A;  4WQO B;  2IZV B;  4US9 A;  1UF0 A;  1WJ4 A;  2N9K A;  4W9K A;  1I42 A;  1E7U A;  4IWO A;  5EDS A;  3U2S C;  2PKO A;  1J7A A;  2I1J A;  4O1N A;  3UIN B;  3TMP B;  5DPW A;  1UD7 A;  3PS6 A;  3TSS A;  4AUQ C;  4RGN A;  1GB4 A;  3GE3 C;  3T9L A;  1GUA B;  2BYT A;  3Q14 C;  1SF0 A;  3MHS D;  3H7P A;  2CHZ A;  4JWS C;  2AX5 A;  2BVC A;  1OQQ A;  2WU2 B;  5G5G A;  1N63 A;  4XX5 A;  4DXA B;  1JRP A;  4GN1 A;  2PE6 B;  4HJG E;  1UGJ A;  1V1O A;  2L32 A;  1GG3 A;  4DQO C;  2FBW B;  1IGD A;  2K6D B;  3GP7 A;  4KSK C;  1OEY A;  1SXT A;  2IO0 B;  2LXC A;  3SDL C;  5BYQ A;  3IHP C;  2WXR A;  1GJZ A;  1WGR A;  4ZDV A;  3IXS A;  4NNJ B;  4IOI E;  3UF8 A;  2CKH B;  1V81 A;  2DBY A;  3VAW A;  1RYJ A;  1GAQ B;  2LD9 A;  1G6J A;  5JHB A;  1TS2 A;  3D32 A;  2D2Q A;  1TKY A;  3PRZ A;  2KDI A;  1XT9 B;  3ZYY X;  4C7Y A;  4WWN A;  3ZRF A;  1QIL A;  3CST A;  4II2 B;  3V6C B;  2DYO A;  2DYB A;  1STE A;  1MPE A;  2QDF A;  1D6E C;  1Q1O A;  4B6W A;  1R7S A;  3OAW A;  2GB1 A;  1H4R A;  2YLM A;  5E6N A;  1Q5W B;  4N59 A;  3VQI A;  1Z2M A;  2LI5 A;  1TS3 A;  3QCA A;  1QKZ A;  2KDE B;  3B2F A;  2J7Q B;  3AE8 B;  3Q8E A;  2KJH B;  1WFY A;  2BKF A;  1CK1 A;  5HI1 A;  3JVZ X;  1V5T A;  3MC8 A;  4H2A A;  3EUB 2;  3A33 B;  1I4Q A;  1WJU A;  3UIO B;  1T3Q A;  1SE2 A;  4W9D A;  3ETR A;  3ZW3 A;  2N7E A;  4XGA B;  2J52 A;  3VUY A;  2N7D A;  4W9I A;  1ZE3 D;  1K51 A;  1T0Y A;  2QIL A;  4KKI A;  3BVM A;  1L5P A;  2LGS A;  1UH6 A;  4M0W B;  1I4H A;  1QOA A;  1K53 A;  3RFZ B;  4B0E A;  2FCQ A;  3N20 C;  1T0S C;  2BQQ A;  1JW9 D;  2L0T A;  3APC A;  3SHQ A;  2XNA C;  3PLU A;  1FNV A;  3Q2A C;  3HM3 A;  5EE9 A;  4M02 A;  4RGT A;  5JZE B;  3HVD A;  2ASQ A;  2K8H A;  4C56 C;  2KZR A;  2KLG A;  3W9C B;  3RI7 C;  3Q3N C;  3MJW A;  3NOB A;  2NR2 A;  1EO6 A;  4AJW A;  1FXI A;  3GZN I;  3R7R A;  3L0W B;  4FJZ A;  2JUO A;  1J0G A;  2KKC A;  2MA9 B;  3WAM A;  1XLN A;  4L2Y A;  1L0X B;  4OVV A;  5C2T B;  2M4N A;  3DBR B;  3IFW B;  2WP9 B;  1EM7 A;  5EE3 A;  2ZPY A;  4J3O D;  1ESF A;  2DZI A;  2CHW A;  2QSD A;  2QJL A;  4MGZ E;  2J4X A;  3P4R B;  2IO3 B;  5D3I B;  1AN8 A;  4PT5 A;  3NVZ A;  1WE7 A;  1D5X C;  3TJP A;  4EEW A;  5JHA A;  2KLC A;  1J7B A;  4US8 A;  1JAL A;  4TSS A;  2KN5 A;  4YTN B;  4ITK A;  2D3B A;  1BT0 A;  4B0M A;  5HKH A;  4BVU C;  4YXD B;  4E71 A;  3AV8 A;  4MGI E;  1L6U A;  1XF5 L;  3ZTC A;  1YQB A;  2FIF A;  2JX5 A;  2PLP A;  3U7D A;  1C4C A;  2REX A;  2QMT A;  3EGR A;  4GXB A;  1JQ4 A;  2LFI A;  2K8B A;  1ZPS A;  2DX5 B;  1V8C A;  3OJ3 A;  1BML C;  2K8C A;  2VH2 A;  1XLQ A;  3J9C A;  2WDT B;  2WXQ A;  4DWF A;  2GI9 A;  2WGS A;  4MSM B;  1I35 A;  3TBL D;  2BB5 A;  2IO2 B;  3GOE A;  3DPD A;  2MJE A;  3Q8A A;  1RAX A;  3PO0 A;  1C4A A;  3KW5 B;  1Q10 A;  3JSV B;  3DOW A;  1F2R I;  5CHF A;  4RF1 A;  3QWZ B;  1UWX A;  2KAC A;  5H8Y E;  1JRO A;  2OJW A;  3T3O A;  3B9J A;  4HLE A;  3ZQ4 A;  2LWP A;  3RNA C;  2IND C;  4FJV B;  1DOI A;  2MP2 A;  2CU3 A;  1TKE A;  2LUM A;  1NYR A;  1RFA A;  2BTE A;  3Q3J A;  3AEG B;  4K7W A;  2KOX A;  4FUL A;  5I4D A;  2KC2 A;  3TCA A;  4XC2 A;  2NBV B;  3ALB A;  1R4M I;  1WIA A;  4B9K A;  4HEA 1;  2DNF A;  1FFV A;  2BWE S;  4AJY B;  2EKI A;  2NPT A;  1FRD A;  3AE7 B;  2CHX A;  3M95 A;  4PS8 A;  4RH6 A;  3N1Y C;  5C23 A;  3ZDT A;  2HD5 B;  1D5Z C;  4KKJ A;  3AEB B;  2D3G A;  1JWU D;  5TR5 A;  4BKG A;  4LDT D;  2ZCB A;  1C4P A;  1ZGU B;  4NY0 A;  4ZRJ A;  2BWF A;  2YVC A;  1FXT B;  3Q8C A;  2K5P A;  1ZP0 B;  2RPQ A;  2YEP F;  2O6V A;  3BYT B;  3U4E G;  1VZ6 A;  3M62 B;  4L1B A;  3ZIM A;  1TYG B;  4K7S A;  2O6V D;  2KWC A;  1E90 A;  2HTH A;  4IM0 A;  2PJH A;  4GLS C;  1UBI A;  3AEC B;  4GDK B;  1F2R C;  2HE7 A;  2B76 B;  3O65 B;  3WIM A;  2L83 A;  2C9W B;  4EFO A;  1SGH A;  2LRU A;  4JPS A;  4WIP A;  1JWM D;  4WJP A;  4LJP B;  1IPG A;  1C77 A;  4L23 A;  2RSU A;  4ZYS A;  2LXA A;  1NEK B;  2JSV X;  4A3P A;  4GIV A;  2IO1 B;  2V4L A;  2WXN A;  2LUE A;  3W1Y A;  2GBN A;  1EF1 A;  5IOI A;  2JPH A;  4LCD E;  2L8J A;  1A70 A;  2K0P A;  1YN5 A;  1WI0 A;  4JIO U;  1AWD A;  1PGB A;  4E3C A;  3PZD A;  2XK5 A;  3AMZ A;  4K3C A;  3GE8 C;  4AQ7 A;  1NEN B;  1C78 A;  3TEZ A;  5BO4 B;  2KFK B;  1E10 A;  4EUT A;  1XXG A;  3GZN B;  4NAM A;  5JXV A;  3VHT C;  3QQ8 B;  1WXM A;  5JH5 C;  3T3N A;  3SFD B;  3DWM A;  1Y56 A;  1HTO A;  3NZ3 A;  3R66 C;  2GLS A;  3W2D A;  1FFU A;  2X8X X;  3AXC A;  1TZO A;  2AYO B;  1WSP A;  3OG5 A;  1QOF A;  2LZ6 A;  2MHJ A;  2EMT A;  2KTR B;  2MSE D;  2ZEQ A;  3NHE B;  3HVZ A;  4ZOH C;  3DDC B;  1E8Y A;  5J2R A;  4GU2 A;  2DZM A;  1MHX A;  5AUK A;  2JXT A;  4F8C B;  4F7Z A;  1WE6 A;  2QCZ A;  5G5H A;  2NTT A;  2HJ1 A;  4CYE A;  3LJ3 A;  1QQR A;  2I2Y A;  2M8S A;  4K81 A;  3RUI B;  4A6Q A;  1E7V A;  5HHD G;  1FNU A;  3TEX A;  4XYC A;  3EEC A;  1L2N A;  4N9F 4;  4A55 A;  1OGW A;  2BGF A;  2KN4 A;  2INN E;  3NS8 A;  4A9A A;  1C79 A;  1HZ6 A;  4LK0 M;  3U8Z A;  2KAJ A;  4IKG A;  2PE9 A;  2Y5C A;  5FK9 C;  4DDG D;  2BW2 A;  5FR3 A;  4HJK A;  4MGY E;  4C4V A;  4MJS B;  2MCN B;  4HKQ A;  2G9H D;  3R8B A;  2D3A A;  2N7J A;  1KLV A;  3HIZ A;  4IUM B;  1NI2 A;  3NVY A;  1FIQ A;  4EOY A;  4I6L B;  1WRD B;  1ZUD 2;  4LJO B;  3L13 A;  4MH8 A;  3DBH B;  3FAH A;  3DBL I;  1WGG A;  4MT5 A;  3AH7 A;  3Q6B A;  2JZZ A;  3R2I A;  1XEE A;  3GB1 A;  3ZLZ A;  3MFG A;  2EKE C;  1YQ4 B;  2AL3 A;  1OEY J;  2NBU A;  1SE4 A;  3ZUN A;  1F9J A;  2L3Z A;  1WJN A;  4GSW A;  3PRE A;  5IO9 A;  1SB3 C;  2KDB A;  2JF5 A;  5GMV A;  3M63 B;  4HRS A;  1L7Y A;  2J42 A;  2JRI B;  3V3X A;  4WH4 A;  2RMM A;  2ACZ B;  1MVK A;  3PHX B;  4HPP A;  2KWU B;  4MSQ B;  3R3M A;  1I4P A;  1E8W A;  4RGO S;  2OHF A;  2H88 B;  1TJE A;  2KHW B;  2AQ2 B;  2IPK D;  2KWD A;  5IAA C;  2RPV A;  2MWS B;  4G3X B;  4W9J A;  3MTN B;  4XDD A;  5FKA C;  3KUZ A;  3KQ4 A;  1VR9 A;  2HTM E;  2W3S A;  2PVO D;  1CJE A;  1A5R A;  2V1Y A;  4IDI A;  1VD2 A;  2PPH A;  2M0X A;  3NG0 A;  3X0W A;  3NJT A;  4WAA A;  1YJI A;  1WRI A;  2KDF B;  3P1M A;  4M8N A;  3LDZ E;  1ZDV A;  3IVF A;  3PHW B;  2SAK A;  4M8M A;  4E74 A;  4GDL A;  3IT4 B;  2EMS A;  3ZGZ A;  4WJQ A;  4KV2 A;  4OVU A;  2V9H A;  3A4S C;  4GB9 A;  3QA8 A;  2C7N B;  2KJ6 A;  5C1Z A;  3FC4 A;  4IM2 A;  3A9J A;  1GC7 A;  2VZK D;  3QX1 A;  1NBF C;  3I57 A;  3ZJT A;  2OOB B;  1LM8 B;  1VLB A;  1YQ3 B;  4S17 A;  1QLB B;  1WMH A;  2ZVO A;  2QC8 A;  1LO5 D;  4D2K A;  3V6E B;  1CZP A;  4AOF A;  4NAW B;  3W5V B;  1QOG A;  2RDH A;  4ZRP A;  3VDZ A;  3X23 A;  3A9K A;  3Q8B A;  2FE8 A;  3VTU A;  1PFD A;  4RM9 A;  3BVG A;  4ICV A;  4IM3 A;  3ZJU A;  2D07 B;  3CIR B;  4NJ7 A;  1EWY C;  3U7Z A;  1C9F A;  1V1P B;  1OTR B;  4A3O A;  1YJJ A;  2WQY B;  4P6V F;  2N0S B;  2K22 A;  4HWI B;  3W5U B;  4HCN B;  3IAS 1;  2KK8 A;  3ZJV A;  1OFF A;  4GOC A;  5TSS A;  3C0R B;  2D3C A;  2IBI B;  4KGT A;  2N4F A;  3BVZ A;  4ANV A;  5LNK 1;  3URY A;  4NPN A;  2INC C;  3V05 A;  2G4S A;  1SJE D;  4BOS C;  4BAX A;  3JSV A;  4W9C A;  2QEJ C;  2W3R A;  3DWG C;  2KT7 A;  3K9P B;  3BY4 B;  1JWS D;  3NUH B;  1MG8 A;  4LNO A;  3SU8 X;  3HM6 X;  2Z8L A;  4DHJ D;  2WXP A;  3Q69 A;  3CSF A;  4N58 A;  4BKT A;  4RNA A;  3H7P B;  4TV3 A;  3SR6 A;  2LHD A;  1CQV A;  3AE6 B;  4PK1 A;  1WGH A;  2WU5 B;  2GBK A;  4YSZ B;  2ZZP B;  2LGX A;  1L4Z B;  1JWA D;  3U30 A;  2G4D B;  2BBC A;  4FHJ A;  3LYY A;  4TKN A;  3HUI A;  1E0Z A;  2B3A A;  2BYF A;  2A5U A;  2KFJ A;  2D10 A;  4Q2J A;  3P42 A;  4P7I A;  4MM3 B;  1GC6 A;  3JW0 X;  2LVP A;  3E9S A;  1AAR A;  4M01 A;  3AE3 B;  4HXD A;  4EE2 A;  5BYS A;  2G1E A;  2KJR A;  3N9Y C;  2JU6 X;  2MBB B;  1WGK A;  3UQA A;  3W1S A;  1AYF A;  3DQV A;  1JWB D;  2WXJ A;  1VZ7 A;  4I6P A;  3DBL B;  3IAM 1;  1FD6 A;  4G0N B;  1P0R A;  4XDC A;  5GXG B;  4FHK A;  1FNW A;  1I4R A;  2K3U A;  1L6V A;  1J7C A;  2D11 A;  4R3D A;  4W9G A;  1TY2 A;  3BWU D;  4DXG A;  3ZTD A;  2XEW A;  1P1A A;  4NJ6 A;  1TTN A;  1HXY D;  4FLH A;  3BK2 A;  1SE9 A;  3BK1 A;  3ECI A;  1TZ1 A;  2JQR B;  1T0R C;  3ZNH B;  5AZG A;  3DHG C;  3KYC D;  2JZP A;  1LXD A;  1V5O A;  1WXV A;  1K52 A;  4HCP B;  4KGR A;  2BYV E;  3VTW A;  3WAL A;  3WAN A;  2W9N A;  4K3B A;  3VR8 B;  1OQR A;  3RNF C;  5LLI A;  1IUE A;  4XZ4 A;  2L7R A;  5J17 A;  3OJ4 B;  4LLG M;  4ICU A;  5DPR A;  1UBQ A;  2QHO A;  2M19 A;  3M3J A;  4KX6 B;  1VJK A;  3BYY B;  4TUU A;  3PZ7 A;  1K50 A;  3ONS A;  3QC8 B;  4BBN C;  1HZ5 A;  1GPX A;  4KDI C;  1M4V A;  4PS3 A;  1RM6 C;  1PGA A;  2WXL A;  3I63 C;  1N60 A;  4KZ0 A;  3ZRC A;  1J8C A;  3UQB A;  2KMC A;  5L95 C;  3AE2 B;  3N3K B;  2LGY A;  4HRO A;  2QIE B;  3AE5 B;  4CQN A;  2DHZ A;  3KUD B;  4QAY A;  3PSE B;  4HDO A;  1XCQ L;  4TQ1 A;  2KQS A;  2KD0 A;  4ARC A;  1PDX A;  4NJC A;  4RCO A;  1NYQ A;  3PLV A;  1GB1 A;  2IYD B;  1YOV B;  4CHK A;  5E6O A;  5L83 A;  1YX5 B;  2V3S A;  1I4G A;  1YNT E;  3FIL A;  4USA A;  4IWQ A;  1ET6 A;  4ANW A;  5LXI B;  1WZ0 A;  1QT9 A;  2FUG 1;  1VZ8 A;  2Q5W D;  3DVG Y;  4YL8 A;  3AE4 B;  1TKG A;  3Q3O C;  1YMH E;  4KIK A;  5E6P A;  3B1L X;  3DVN V;  2Z0D B;  1WGY A;  3LXF A;  3CF6 E;  3ML8 A;  1YX6 B;  1P9D U;  3EHV A;  2LMC A;  4II3 B;  2GRI A;  1UEL A;  5D94 A;  2J0J A;  3MHZ A;  4MEM A;  1P7E A;  3KH0 A;  4IWP A;  2N1V A;  1UNS A;  2UU7 A;  5HFY A;  3LB8 C;  4BZA A;  1WYW B;  4BKS A;  2VH1 A;  2K6Q A;  4FXC A;  3RCZ A;  4BKS D;  3A1Q A;  4HPM B;  1KF6 B;  2FCM A;  2O2V A;  3CWI A;  4J6I A;  4K7U A;  1WM2 A;  1IBX A;  2K39 A;  4JGH B;  1K8R B;  1BXT A;  1HEZ E;  4YTP B;  4RFB A;  2BS3 B;  3O13 A;  3AI5 A;  3IBE A;  4P1B C;  3UI3 A;  4FAD A;  1FMA D;  3V62 A;  4FBJ B;  1TGZ B;  1WYG A;  3AEE B;  2CJO A;  2RD0 A;  3L16 A;  1UWM A;  1TS4 A;  1R4N I;  3R7Q A;  2J0K A;  1RWS A;  2KQ4 X;  2MP2 B;  4YSY B;  2DZJ A;  2OJR A;  1YIW A;  2AQ3 B;  4HKZ E;  2LGI A;  1VDV A;  4LNI A;  1YJ1 A;  1ZXH A;  2MBO A;  2LVO A;  1F52 A;  3VXW A;  2IY1 B;  1IP9 A;  4XWT A;  2E3T A;  5DPS A;  5KHO A;  2GBM A;  4YSX B;  2L00 B;  4FJY A;  1T0Q C;  1FEH A;  3TUO A;  1FCL A;  3I9V 1;  5D7G A;  2CR5 A;  2L0F A;  2NPT B;  3A4R A;  4RM8 A;  3VFK A;  5G2N A;  5H92 C;  3AN1 A;  5FR6 A;  3ZNI D;  4X57 B;  4LDT B;  5BMI A;  2ICI A;  1KH0 A;  1D4B A;  4KGS A;  5T8I A;  3PTF C;  4HPL B;  2M1M A;  4DHZ E;  1ISN A;  2WXI A;  4A8X C;  5BMG A;  3APD A;  2WNM A;  1WR6 E;  1S3S G;  3N32 A;  2O6V B;  2BB6 A;  3N30 A;  2AWT A;  4ZHP A;  1WGD A;  1ZXI A;  1KJT A;  2ONQ A;  1SBB B;  4B95 A;  3WCQ A;  1N62 A;  2MH7 A;  1DYQ A;  3P4S B;  1XO3 A;  1XD3 B;  3N1X C;  1NI3 A;  1XLO A;  3NS1 A;  1EU4 A;  2FAZ A;  3H9D A;  1ACC A;  1KFY B;  3QIJ A;  2KO3 A;  3PRP B;  3E56 A;  2DAJ A;  1ROE A;  4C80 A;  2V3P A;  1LQB A;  4RMA A;  4MGK E;  2JZ3 B;  4KZC A;  4ZRK A;  2BF8 B;  4ANU A;  4HK2 A;  3RNC C;  2Y5B B;  2PVG C;  2G3Q B;  2N9X A;  1N61 A;  3ENE A;  3PVL A;  3NVV A;  3EC8 A;  1ZOY B;  1V97 A;  1Q0W B;  2C5L C;  4W9E A;  5G55 A;  2DZK A;  2AL6 A;  4PS7 A;  1ZDX A;  3DVN U;  2JWZ A;  2INP E;  1HE8 A;  2KC1 A;  2Y3A A;  1RRB A;  2WXG A;  3BZD B;  2ZJD A;  4M0W A;  4M00 A;  5AZH A;  3VUW A;  4WUR A;  3H7S A;  4AP4 C;  1C76 A;  4DBG A;  1R4M B;  5IKC M;  3WA0 A;  1WXQ A;  1DGJ A;  1UUP A;  1PQS A;  3RNB C;  1WM3 A;  2NBW B;  4IC7 B;  4ASW C;  2KVZ A;  4ACF A;  2NVU I;  1L4D B;  2NCN A;  4MDK E;  4PYZ A;  2KVR A;  2W54 A;  4RF0 A;  4YTM B;  1F0Z A;  3MC9 A;  1X1M A;  4XE0 A;  4W9F A;  1C1Y B;  5DCN A;  2EEL A;  4WAF A;  4YT0 B;  4ANX A;  2D5G A;  3TEW A;  5AEK B;  2FID A;  2K1F A;  1M94 A;  4ZHO A;  2XN9 C;  3N1Z C;  2LGD A;  4REZ A;  4HVB A;  3HHM A;  2KDM A;  3L08 A;  1SSN A;  2J53 A;  4AWJ A;  3P4Q B;  2NTS A;  1TIF A;  4XWW A;  3EFU A;  4MM3 A;  2LRW A;  4NZL B;  4ZRQ A;  3BIN A;  5D3D A;  3L10 B;  3L17 A;  1WX8 A;  4YWG G;  4C7Z A;  4C4V B;  1NVI D;  4JWU C;  3VR9 B;  1PYW D;  3AE1 B;  3Q3M C;  3QJZ A;  3QHT A;  5C3J B;  1WZ3 A;  2JT4 B;  4EZJ A;  3KLS X;  1WXA A;  2SEB D;  3QAQ A;  4IW0 A;  4OHJ A;  3RZW C;  3VRA B;  2V0G A;  2RDG A;  2BS4 B;  2GMI C;  2VRR B;  4K1R B;  2LJ5 A;  3APF A;  2PMV A;  2M0A A;  2NMQ A;  2K9X A;  3TEY A;  3TL5 A;  5LXH A;  1R4N B;  4LNN A;  3JYU A;  4JE3 B;  3U52 E;  3KWV A;  3PGE A;  1KRH A;  2V4I B;  2MX2 A;  3P2B A;  1SEB D;  2C7H A;  2WDV B;  3DVG X;  4BOZ B;  3TIX A;  2WS3 B;  3ZNZ B;  1L0V B;  2M56 B;  1GOZ A;  4WQM A;  2PEA A;  1MJD A;  5HG2 A;  1PGX A;  4ZYN A;  3DHI C;  2TSS A;  2K25 A;  2RDB C;  1S1Q B;  3EFC A;  4NQK E;  3AB5 A;  1FXA A;  1FCC C;  2MQJ A;  4OW0 A;  4WJO A;  3IG3 A;  1QF6 A;  3DBS A;  4URK A;  2UWQ A;  2WX0 A;  1WJ6 A;  4JLC A;  2WXM A;  2GBJ A;  1N5W A;  2MJD A;  1GNU A;  3RPF C;  5IN7 A;  1TT5 B;  4W9H A;  1DOY A;  2KNB A;  2IGH A;  2IGG A;  2AEH A;  4GDL B;  3B2G A;  3W1S C;  2MBE A;  4EZK A;  1WF9 A;  2ZW0 A;  1WR1 A;  3RZF A;  2VZK B;  3L4P A;  2DWQ A;  2FCS A;  3A9J B;  3RYT A;  4DDI D;  2ZNV C;  1TS5 A;  1E8X A;  3ML9 A;  3SD5 A;  2KQ7 A;  2PW9 A;  1WMH B;  4C00 A;  1KLU D;  2L1A A;  1T5X D;  1WWT A;  2CU1 A;  2WWZ A;  1C3T A;  5CHW A;  3IT6 B;  3H6N A;  4WWP A;  1VRA B;  2BT6 A;  4EKU A;  2OED A;  3K9O B;  2WXH A;  2DLB A;  3A9K B;  2KMA A;  3I5J C;  4GDK A;  1D5M C;  2N1W A;  1B9R A;  2WXF A;  2C60 A;  1BUI C;  1V2Y A;  1MI0 A;  4UDU C;  4KSL C;  1MG4 A;  3WAP A;  1U4A A;  4PYU A;  5CTR C;  2V3N A;  3SEB A;  2ZVN A;  1HTQ A;  1WX7 A;  3ZNG C;  4DHZ B;  2Z59 B;  1ZKH A;  4BFR A;  4KDL B;  3NZU A;  2HDE A; 
#chains in the Genus database with same CATH homology
 3ZUN A;  2N7E A;  1F9J A;  2L3Z A;  1WJN A;  3VUY A;  3RUL A;  4GSW A;  3PT2 B;  3PRE A;  1TBE A;  1EF5 A;  3AI5 A;  2N7D A;  3IBE A;  4W9I A;  1WXS A;  1T0Y A;  2KDB A;  2JF5 A;  2ZPN A;  4FAD A;  5GMV A;  3M63 B;  1L7Y A;  1UH6 A;  4FBJ B;  3V62 A;  2N9P C;  1TGZ B;  4M0W B;  3DBH I;  2JRI B;  2RGF A;  2GOW A;  2RD0 A;  3L16 A;  2FCQ A;  3PHX B;  4DHJ B;  2L0T A;  3RD2 A;  2KWU B;  2KFK A;  3APC A;  3SHQ A;  1R4N I;  3PLU A;  2DAF A;  3R7Q A;  1V86 A;  2DYM A;  2J0K A;  4MSQ B;  3HM3 A;  3R3M A;  1V9J A;  4MEL A;  2MP2 B;  1E8W A;  1UZX B;  2KHW B;  3ZVV A;  2DZJ A;  2OJR A;  5JZE B;  5IAA C;  2MWS B;  2ASQ A;  4G3X B;  1YIW A;  2K8H A;  2KZR A;  4G11 A;  1YJ1 A;  1V80 A;  2KLG A;  2MBO A;  5DPT A;  4W9J A;  2LVO A;  3MJW A;  3VTV A;  5CHV C;  3VXW A;  4TQ0 A;  3NOB A;  2NR2 A;  2IY1 B;  3MTN B;  1EO6 A;  4AJW A;  1IP9 A;  3KUZ A;  3GZN I;  5DPS A;  5KHO A;  3R7R A;  2GBM A;  2L00 B;  4FJY A;  4JL9 A;  3L0W B;  1KM7 A;  2JUO A;  4FJZ A;  1J0G A;  2NS5 A;  2KKC A;  2MA9 B;  3CMM B;  3WAM A;  1A5R A;  2LAS A;  5D7G A;  2V1Y A;  1YD8 U;  2CR5 A;  2L0F A;  2R2Q A;  2NPT B;  2KTR A;  3A4R A;  4RM8 A;  3PPA A;  1VD2 A;  3Q3F A;  3VFK A;  4OVV A;  2PPH A;  2M4N A;  5G2N A;  4MH0 E;  1JRU A;  2ZCC A;  3IFW B;  5FR6 A;  3ZNI D;  4X57 B;  4LDT B;  2M0X A;  2ZPY A;  1Y8R C;  2MBH A;  3X0W A;  2DZI A;  2CHW A;  5CX3 A;  3VUX A;  1E8Z A;  4JQW C;  4MGZ E;  3DCG A;  4WAA A;  5D6J B;  2KDF B;  3L54 A;  3VH4 B;  2MW5 A;  3PTF C;  4HPL B;  4M8N A;  3LDZ E;  2M1M A;  2IO3 B;  3IVF A;  4DHZ E;  1ISN A;  3PHW B;  4M8M A;  4E74 A;  4GDL A;  1WE7 A;  2EMS A;  3APD A;  2N9E B;  1UGM A;  3TJP A;  4F1S A;  4WJQ A;  4EEW A;  4KV2 A;  5JHA A;  1WR6 E;  4OVU A;  3A4S C;  1S3S G;  4GB9 A;  2KLC A;  3N32 A;  3QA8 A;  2O6V B;  2IY0 B;  3N30 A;  3RT3 B;  2C7N B;  2AWT A;  1WGD A;  2KJ6 A;  5C1Z A;  2KN5 A;  1KJT A;  4IM2 A;  2KX3 A;  1BT0 A;  3A9J A;  2KXJ A;  5HKH A;  2LVQ A;  1GC7 A;  3KUC B;  3QX1 A;  1NBF C;  4BVU C;  4B95 A;  4I6N B;  3WAO A;  2OOB B;  5IA7 A;  1LM8 B;  1ZW7 A;  4E71 A;  1WMH A;  4FN2 A;  2JRH A;  1XD3 B;  4MGI E;  3UGB B;  1V6E A;  2ZVO A;  3ZTC A;  1YQB A;  2FAZ A;  3H9D A;  3V6E B;  2FIF A;  4MJS A;  3QIJ A;  4WWO A;  2R2O A;  3U7D A;  2KO3 A;  4AOF A;  2REX A;  2ZNV B;  3PRP B;  4NAW B;  4A20 A;  2DAJ A;  1VCB A;  4GXB A;  2K8B A;  2DX5 B;  3VDZ A;  2CS4 A;  3A9K A;  3X23 A;  1P98 A;  1LQB A;  3VTU A;  1D3Z A;  1EUV B;  4RMA A;  3OJ3 A;  3ZDM C;  4RM9 A;  2WYQ A;  4ICV A;  2K8C A;  4MGK E;  2JZ3 B;  4IM3 A;  4KZC A;  3HK0 A;  2BYE A;  2WDT B;  2D07 B;  4ZRK A;  3QK0 A;  2BF8 B;  4ANU A;  4DWF A;  4EZL A;  4NJ7 A;  4HK2 A;  2Y5B B;  4MSM B;  2G3Q B;  2N9X A;  1OTR B;  1I35 A;  4A3O A;  3ZKJ C;  3TBL D;  3ENE A;  3PVL A;  2G45 B;  2IO2 B;  3GOE A;  4HWI B;  3EC8 A;  3DPD A;  2BKR B;  1Q0W B;  2C5L C;  4HCN B;  4W9E A;  1RAX A;  5G55 A;  2KK8 A;  2DZK A;  3KW5 B;  2AL6 A;  2L05 A;  1P3Q U;  3I3T B;  4GOC A;  4PS7 A;  3DVN U;  2JWZ A;  3JSV B;  3C0R B;  2IBI B;  3DOW A;  2N4F A;  1HE8 A;  2KC1 A;  4ANV A;  1RRB A;  5CHF A;  3OLM D;  1CMX B;  2ZJD A;  3QWZ B;  2KX0 A;  5AZH A;  2J0M A;  4IG7 B;  3VUW A;  4NPN A;  3H7S A;  4AP4 C;  2G4S A;  4DBG A;  4BOS C;  2GBR A;  1H8C A;  3JSV A;  4W9C A;  4HLE A;  4W9D A;  3WA0 A;  1WX9 A;  2LWP A;  3K9P B;  2Z0E B;  3BY4 B;  1MG8 A;  4FJV B;  3SU8 X;  2MP2 A;  3HM6 X;  4DHJ D;  1PQS A;  1WM3 A;  3CSF A;  1RFA A;  2NBW B;  3Q3J A;  4IC7 B;  5D2M B;  4ASW C;  4BKT A;  3H7P B;  2UYZ B;  4TV3 A;  2NVU I;  4K7W A;  2NCN A;  2I1K A;  4HDQ A;  2KOX A;  4FUL A;  4MDK E;  2KWV B;  4PYZ A;  2KC2 A;  2KVR A;  1KOT A;  3TCA A;  3V60 A;  4XC2 A;  2NBV B;  3ALB A;  1WGH A;  1R4M I;  2BPS A;  3AU5 A;  1X1M A;  2HJ8 A;  2GBK A;  3H1U A;  1WIA A;  3PV1 A;  4B9K A;  4W9F A;  2ZZP B;  1C1Y B;  2BWE S;  2LGX A;  3U30 A;  4AJY B;  5DCN A;  2NPT A;  4ZRI A;  2G4D B;  2CHX A;  4FHJ A;  1WY8 A;  3M95 A;  4PS8 A;  4ANX A;  4TKN A;  5C23 A;  2B3A A;  2HD5 B;  3ZDT A;  2BYF A;  2A5U A;  3NY5 A;  5AEK B;  2KFJ A;  2D10 A;  2FUH B;  2FID A;  2K1F A;  1M94 A;  4P7I A;  2D3G A;  5TR5 A;  4BKG A;  4LDT D;  1SIF A;  3AU4 A;  2ZCB A;  2LGD A;  3ZW3 A;  3DBR I;  1V49 A;  5AZF A;  4HVB A;  3HHM A;  3NZS A;  3B08 A;  1GC6 A;  3L08 A;  1WH3 A;  4KIK B;  1ZGU B;  3JW0 X;  4AWJ A;  2LVP A;  4W9L A;  4NY0 A;  1AAR A;  3PRM B;  3V61 A;  4GGQ A;  4NQL B;  4ZRJ A;  4HXD A;  2BWF A;  2YVC A;  2DEN B;  2L76 A;  3EFU A;  1FXT B;  4MM3 A;  1IYF A;  2LRW A;  2KJR A;  2RPQ A;  4KVG B;  2O6V A;  3BIN A;  2M17 A;  3L10 B;  2MBB B;  3UQA A;  4DK5 A;  3VVW B;  2WX1 A;  3L17 A;  3M62 B;  1WX8 A;  3W1S A;  3ZIM A;  3VH3 B;  3DQV A;  4K7S A;  2O6V D;  2KWC A;  4I6P A;  1XQQ A;  1E90 A;  2HTH A;  3KVF B;  4G0N B;  1NDD A;  4IM0 A;  1P0R A;  3QHT A;  3QJZ A;  4FHK A;  2PJH A;  1OQY A;  1WZ3 A;  1UBI A;  2JT4 B;  4EZJ A;  1LFD A;  4GDK B;  1WXA A;  2HE7 A;  3QAQ A;  2KTF A;  3AUL A;  3S2A A;  2D11 A;  2MLB A;  3O65 B;  4W9G A;  3WIM A;  2C9W B;  4GMV A;  4EFO A;  4IW0 A;  2XBB C;  1SGH A;  2LRU A;  2KAN A;  3RZW C;  3ZTD A;  4NAW A;  4WJP A;  4LJP B;  3A1Q B;  1IPG A;  3QAR A;  2GMI C;  2O2V B;  2C7M B;  2RSU A;  2JY6 A;  2XEW A;  1P1A A;  4NJ6 A;  1TTN A;  2VRR B;  1E5W A;  4FLH A;  4K1R B;  1SE9 A;  2LJ5 A;  3APF A;  2LXA A;  3T8M A;  3ECI A;  4A3P A;  4BBN F;  1TZ1 A;  4GIV A;  2IO1 B;  2V4L A;  3UIP B;  2LUE A;  3W1Y A;  2GBN A;  4WJN A;  4FA6 A;  2JXX A;  1EF1 A;  2XK5 B;  5AZG A;  3ZNH B;  3TL5 A;  3KYC D;  3ZO5 B;  1QZE A;  2JPH A;  2JVC A;  4LCD E;  2L8J A;  5LXH A;  1LXD A;  1V5O A;  1WXV A;  1J19 A;  2FCN A;  4HCP B;  2BYV E;  3VTW A;  1WI0 A;  3JYU A;  2MRP A;  2RR9 A;  4JIO U;  3WAL A;  2W9N A;  3WAN A;  1Z5S B;  4CO7 A;  4G50 A;  3PGE A;  4E3C A;  2FNJ B;  2MBQ A;  3PZD A;  2XK5 A;  5LLI A;  2A4Z A;  5J18 A;  4XZ4 A;  1RLF A;  3B0A A;  5KHQ A;  3KYD D;  2L7R A;  4WQO B;  2IZV B;  5J17 A;  2MX2 A;  3OJ4 B;  5BO4 B;  3P2B A;  2KFK B;  4ICU A;  2C7H A;  3DVG X;  5DPR A;  1WJ4 A;  4W9K A;  4EUT A;  1I42 A;  1E7U A;  1UBQ A;  2QHO A;  3M3J A;  4IWO A;  4BOZ B;  3VHT C;  4TUU A;  3TIX A;  5EDS A;  3ONS A;  3QC8 B;  3QQ8 B;  1WXM A;  5JH5 C;  3ZNZ B;  2I1J A;  4BBN C;  3UIN B;  4KDI C;  3TMP B;  2PEA A;  4PS3 A;  1UD7 A;  3PS6 A;  5DPW A;  4AUQ C;  4ZYN A;  4KZ0 A;  3ZRC A;  1J8C A;  3UQB A;  2KMC A;  3R66 C;  5L95 C;  3T9L A;  1GUA B;  2K25 A;  3N3K B;  2LGY A;  3AXC A;  1S1Q B;  3MHS D;  4NQK E;  3H7P A;  2AYO B;  2MQJ A;  2CHZ A;  2DHZ A;  3KUD B;  2LZ6 A;  3PSE B;  4HDO A;  2EMT A;  4TQ1 A;  2KTR B;  2KQS A;  2MSE D;  2KD0 A;  2ZEQ A;  3IG3 A;  3NHE B;  4WJO A;  4XX5 A;  3DBS A;  4DXA B;  4URK A;  3DDC B;  4GN1 A;  2PE6 B;  1E8Y A;  2UWQ A;  3PLV A;  2WX0 A;  1WJ6 A;  4JLC A;  5J2R A;  4GU2 A;  2IYD B;  2DZM A;  1GG3 A;  2GBJ A;  4CHK A;  2K6D B;  4F7Z A;  4F8C B;  5E6O A;  1WE6 A;  4KSK C;  1GNU A;  1OEY A;  5L83 A;  2IO0 B;  2LXC A;  3SDL C;  1YX5 B;  3IHP C;  4W9H A;  4CYE A;  2KNB A;  2V3S A;  1GJZ A;  1WGR A;  3LJ3 A;  4ZDV A;  4NNJ B;  2AEH A;  2M8S A;  4K81 A;  3RUI B;  4GDL B;  1E7V A;  3UF8 A;  3W1S C;  4IWQ A;  2CKH B;  4ANW A;  2MBE A;  5LXI B;  1V81 A;  3EEC A;  3VAW A;  1L2N A;  4N9F 4;  1WZ0 A;  1OGW A;  2BGF A;  1WF9 A;  2LD9 A;  4EZK A;  1G6J A;  4YL8 A;  3DVG Y;  1WR1 A;  3RZF A;  5JHB A;  3NS8 A;  3D32 A;  4KIK A;  2D2Q A;  5E6P A;  2FCS A;  3B1L X;  3DVN V;  2Z0D B;  1WGY A;  3U8Z A;  3CF6 E;  3ML8 A;  2KDI A;  3PRZ A;  1XT9 B;  3A9J B;  3RYT A;  4DDI D;  1YX6 B;  1P9D U;  3EHV A;  4WWN A;  4II2 B;  2ZNV C;  3CST A;  3ZRF A;  3V6C B;  1E8X A;  2DYO A;  3ML9 A;  2DYB A;  4II3 B;  3SD5 A;  2KQ7 A;  1UEL A;  2PE9 A;  5D94 A;  1WMH B;  2J0J A;  1Q1O A;  4B6W A;  4MEM A;  4DDG D;  3KH0 A;  2CU1 A;  4IWP A;  2WWZ A;  2N1V A;  3OAW A;  1H4R A;  2YLM A;  4HJK A;  5CHW A;  4MGY E;  1C3T A;  4MJS B;  5E6N A;  3H6N A;  2MCN B;  1Q5W B;  4WWP A;  4EKU A;  3K9O B;  3VQI A;  1Z2M A;  2LI5 A;  1KLV A;  3HIZ A;  3QCA A;  4IUM B;  1NI2 A;  2KDE B;  1WYW B;  3A9K B;  2J7Q B;  2KMA A;  4GDK A;  4BKS A;  4EOY A;  4I6L B;  2N1W A;  1WRD B;  4LJO B;  2C60 A;  1V2Y A;  2K6Q A;  4KSL C;  3L13 A;  3WAP A;  1U4A A;  2KJH B;  4PYU A;  1WFY A;  3DBL I;  1WGG A;  3RCZ A;  2BKF A;  3A1Q A;  5CTR C;  4HPM B;  4BKS D;  3JVZ X;  2JZZ A;  2ZVN A;  3ZLZ A;  2FCM A;  2O2V A;  1V5T A;  2EKE C;  1WX7 A;  4J6I A;  4K7U A;  3ZNG C;  1WM2 A;  2AL3 A;  4DHZ B;  2Z59 B;  1OEY J;  3A33 B;  1WJU A;  1ZKH A;  2K39 A;  3UIO B;  2NBU A;  4BFR A;  4JGH B;  4KDL B;  1K8R B;  3NZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...