4BKGA

Crystal structure of human disumo-2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multivalent Interactions of the Sumo-Interaction Motifs in the Ring-Finger Protein 4 (Rnf4) Determine the Specificity for Chains of the Small Ubiquitin-Related Modifier (Sumo).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords SMALL UBIQUITIN-RELATED MODIFIER 2
total genus 20
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bkgA00
4MSQB 3ZNZB 1YJ1A 3SDLC 2CHXA 3W1SA 2KD0A 2FNJB 4DK5A 2FCNA 5G55A 5LXHA 2CHWA 3GOEA 3WAOA 3AU5A 4ASWC 4AWJA 1L7YA 1KJTA 2JRIB 2LRUA 2XEWA 4GDLA 2BKFA 2DZMA 4MGZE 1GG3A 3U8ZA 2NBUA 2NBWB 2ASQA 2J0JA 2JPHA 1UGMA 3ALBA 3X23A 2DZJA 4W9DA 3VAWA 4FHKA 1OTRB 4MJSB 4NAWB 4DDGD 5FR6A 1WRDB 3AU4A 3DBLI 5TR5A 2KC1A 4F8CB 3UQBA 2FIDA 4XZ4A 1UD7A 1EF1A 2HE7A 2MBBB 4FA6A 5IA7A 4WQOB 2LGDA 2JZ3B 4CYEA 2C60A 1FXTB 3R66C 2DHZA 2K1FA 3NZSA 3HIZA 4F1SA 3KH0A 2ZZPB 4GOCA 3IVFA 2M8SA 1WR1A 3WAMA 3JSVA 3ML9A 3L08A 3TJPA 3RD2A 1IYFA 2KDIA 3DVNV 4KZ0A 5DCNA 1WY8A 1YX5B 2RD0A 4MM3A 1V80A 4IWQA 1Z2MA 4IUMB 4E74A 1E8YA 2A4ZA 2DYBA 3A4RA 3M62B 3OLMD 3OAWA 4IC7B 4J6IA 2N9XA 1P9DU 2IO0B 2NS5A 4AJYB 2MBQA 5KHOA 1V5OA 2MLBA 2FIFA 2IZVB 2RSUA 1WGHA 4KZCA 3HK0A 3PHWB 3U7DA 4FADA 2JZZA 3IHPC 2JT4B 2FCQA 1WX8A 4JQWC 3VUYA 3D32A 3VXWA 1J19A 2JRHA 5DPWA 3QIJA 3QK0A 1CMXB 4BKSD 4EZKA 4F7ZA 4B6WA 2Z59B 2DAJA 4ANUA 2HTHA 3APCA 4W9LA 4M0WB 3DQVA 2MWSB 4LCDE 3O65B 3UGBB 2KHWB 1UH6A 2JUOA 3V6CB 2KTRB 4I6NB 1S1QB 2GBRA 4DWFA 3KUZA 1WR6E 4HDOA 4M8MA 5J18A 2UYZB 3DVNU 4LJPB 1WJUA 4EOYA 3QAQA 1E7UA 2LXAA 4G3XB 4XC2A 2VRRB 2KMCA 5JH5C 4W9JA 3VUXA 2YVCA 2AL6A 4ZDVA 3PZDA 4EFOA 3L13A 1IP9A 3ML8A 2N1VA 1Z5SB 5AEKB 1X1MA 4JGHB 3KVFB 4G0NB 3ZTDA 4PYZA 1IPGA 4WJPA 1XQQA 3QA8A 3HM6X 4JL9A 1WX7A 5CTRC 4AUQC 1WIAA 2D2QA 1E5WA 3QQ8B 1EUVB 3WA0A 1WJNA 1NI2A 3B08A 2UWQA 1AARA 4E3CA 3B1LX 3L54A 4GN1A 2J0MA 4B95A 1TGZB 4MDKE 2DYOA 1XD3B 3H7SA 2XBBC 4HWIB 4YL8A 4KDLB 2WYQA 4LJOB 4M8NA 4GU2A 2IY0B 1TZ1A 2MCNB 4EEWA 1NDDA 2GBMA 1EO6A 2KJ6A 2KOXA 3KUDB 4CHKA 2G4DB 1G6JA 4KV2A 2KLCA 5BO4B 3KW5B 3PVLA 3IBEA 2LUEA 2KQSA 4TQ1A 2K39A 2GOWA 4WWPA 2NVUI 1E7VA 3GZNI 4GIVA 1WM3A 2L7RA 2MSED 4WWNA 3VHTC 1LQBA 3M63B 3B0AA 2DENB 2J7QB 2LGXA 2ZPYA 2L0FA 3JYUA 4K7WA 4KSLC 4ZRJA 2BWES 3X0WA 3RUIB 3JVZX 4HVBA 4FHJA 4IWPA 3M3JA 4II3B 4IM2A 2CS4A 2KTRA 3MHSD 4GB9A 3ZLZA 3ZVVA 3V61A 2K6DB 2KDEB 2KO3A 2MBHA 3ECIA 3LJ3A 4BKTA 2L8JA 5E6NA 2N7EA 1WZ3A 3DBSA 5D7GA 4MGYE 4ZRIA 5JZEB 2ZCCA 1V2YA 3DVGY 1EF5A 2LD9A 3QX1A 4G11A 5G2NA 1ISNA 3KYCD 1F9JA 4ANXA 3C0RB 4BOSC 4ICVA 3A9JB 2O6VD 5KHQA 2K8BA 4FLHA 1UELA 1QZEA 3PSEB 3VTUA 2B3AA 2L05A 3IG3A 3HM3A 4GDKA 3OJ3A 1GUAB 1Q1OA 2WX0A 1WJ4A 1BT0A 1T0YA 3ZIMA 2NR2A 3QHTA 1J8CA 2LZ6A 1D3ZA 1K8RB 1SE9A 3EHVA 1PQSA 1WGGA 2RGFA 3ZNHB 2I1JA 1WGYA 1VCBA 4BOZB 5LXIB 4AP4C 1V6EA 3ZTCA 4NQKE 2N1WA 4BVUC 3DVGX 3VTWA 2GBJA 3L17A 4DXAB 3ZKJC 4HJKA 1I42A 2M17A 4NY0A 4FJYA 3I3TB 5E6PA 2ZPNA 3APFA 3Q3FA 4GMVA 3AI5A 5J17A 4IWOA 3A1QA 4KDIC 1KOTA 3T9LA 2N9PC 1UBQA 4AJWA 4XX5A 2CU1A 3N32A 4MJSA 2BYVE 2IO3B 3SHQA 1L2NA 2BWFA 2KKCA 4IM0A 3V62A 3UIOB 2O6VB 4MELA 5L83A 1ZW7A 1RLFA 4I6LB 4JIOU 5LLIA 3PLVA 2ZNVC 1RRBA 2DYMA 1WI0A 4BBNF 2DZIA 3PRZA 1J0GA 2EMTA 3DCGA 4HDQA 1RAXA 4KSKC 3RZWC 3CMMB 4RM8A 1UZXB 2N9EB 5E6OA 4ANWA 1H8CA 4K1RB 1SIFA 2KVRA 2YLMA 4WJOA 3DOWA 2NCNA 1WMHB 1WXSA 4URKA 2K25A 2HJ8A 3AULA 4NAWA 2MBOA 1OGWA 2EKEC 4EZJA 4PS8A 2DAFA 2KJRA 2R2OA 2WX1A 1LFDA 4FBJB 2M0XA 2L76A 3ZW3A 2GBKA 2QHOA 2BGFA 2KQ7A 2O6VA 3DDCB 4DBGA 1VD2A 4DHJD 3A9KB 3DPDA 1TBEA 2G4SA 1XT9B 2K6QA 2ZVNA 2KK8A 1R4NI 2KN5A 2PE9A 3A9JA 2I1KA 1M94A 1JRUA 5J2RA 3EECA 2KFKB 2IY1B 3BY4B 4W9FA 3VQIA 2LVQA 4DDID 5CHVC 2IBIB 4N9F4 2MX2A 2Z0EB 4KIKA 1YQBA 2D07B 1WH3A 1U4AA 4I6PA 3CSFA 4EKUA 2KXJA 3W1SC 2HD5B 2Z0DB 3A33B 5GMVA 2EMSA 2KANA 3QWZB 2BPSA 4WWOA 5HKHA 3DBHI 3PLUA 3H7PB 3KYDD 1C3TA 3VTVA 3MTNB 3ZNID 1GJZA 3PRPB 2N4FA 3T8MA 2K8CA 2FCSA 2JWZA 3PHXB 3A9KA 3NHEB 2KFJA 2D11A 5CHWA 3Q3JA 3UIPB 3EC8A 1OEYA 4NJ6A 2NBVB 3ZNGC 3H1UA 4W9HA 2XK5A 3OJ4B 1WFYA 2CHZA 4BKSA 3A1QB 2LJ5A 5DPRA 2PJHA 3CF6E 3WALA 1WE6A 3PPAA 2D3GA 3R3MA 2KDBA 4A20A 2KWCA 1Q0WB 4NPNA 1E90A 1TTNA 3NY5A 1WGDA 2GMIC 2KNBA 3TIXA 1KM7A 1V5TA 2RPQA 3N30A 4ICUA 3ZRFA 2K8HA 3PRMB 4FJZA 5DPTA 1R4MI 4IM3A 1WYWB 4NNJB 2L0TA 5AZFA 4EUTA 1E8XA 3VDZA 2BKRB 2OOBB 3H9DA 2G45B 3P2BA 3NOBA 4IG7B 5JHAA 5D94A 4HPMB 2M1MA 2KFKA 2AWTA 1RFAA 1WM2A 3H6NA 4FN2A 2KWVB 2MW5A 4GDKB 4PS3A 3NS8A 4TUUA 3RCZA 4A3OA 4LDTB 4WJQA 3M95A 2JY6A 3V6EB 3BINA 4JLCA 4NJ7A 3IFWB 2C7HA 3ZRCA 2A5UA 3H7PA 4RM9A 2ZEQA 3RZFA 2L3ZA 3ZDTA 3EFUA 3APDA 2KX0A 1GNUA 3MJWA 2NPTB 2M4NA 2MP2B 4HXDA 2ZNVB 4WJNA 2WWZA 2LRWA 4ZYNA 2N7DA 3NZUA 3R7RA 4A3PA 4GSWA 5EDSA 2KX3A 4ZRKA 3AXCA 2DX5B 5AZGA 3L0WB 4W9EA 1WZ0A 1MG8A 2PEAA 2KDFB 4ANVA 3TCAA 1A5RA 4HK2A 3PT2B 2AYOB 5C23A 3VFKA 2KTFA 5CHFA 2L00B 1P3QU 1WF9A 4MGKE 3ENEA 4OVVA 2C5LC 4IW0A 3U30A 2O2VA 2IO1B 5AZHA 1YD8U 3TMPB 3A4SC 4X57B 4W9CA 5DPSA 3UF8A 1LXDA 2NPTA 4BBNC 3DBRI 3VVWB 1HE8A 3JSVB 2MBEA 4K7SA 2KWUB 3ZDMC 3WANA 4FJVB 4MSMB 1OEYJ 3JW0X 3HHMA 4TKNA 2WDTB 1P0RA 3PGEA 2FAZA 1C1YB 3W1YA 4MGIE 4HPLB 1P98A 4KVGB 2IYDB 4W9IA 2JXXA 1Y8RC 3QJZA 4MEMA 5D6JB 4PS7A 4HCPB 1H4RA 1WGRA 3R7QA 2MA9B 2Y5BB 2ZVOA 2KC2A 2DZKA 1GC7A 2MQJA 1ZKHA 4II2B 5C1ZA 3L10B 5IAAC 4K81A 3ZO5B 2LASA 2AL3A 2MP2A 2MRPA 3N3KB 2BF8B 4HLEA 2AEHA 1WXMA 1ZGUB 2RR9A 3L16A 3VUWA 3SU8X 3K9OB 2V3SA 1S3SG 1E8WA 2CR5A 5JHBA 1WMHA 1E8ZA 2OJRA 4KIKB 1V81A 3PV1A 2LVOA 4FULA 3RULA 2GBNA 2FCMA 2R2QA 2KLGA 3WIMA 2PE6B 2D10A 4K7UA 2BYEA 2KJHB 4TV3A 2LVPA 2ZCBA 2O2VB 2W9NA 2C7MB 3PS6A 1I35A 3K9PB 1GC6A 1LM8B 4LDTD 4AOFA 1SGHA 1P1AA 1WXAA 4W9KA 3PTFC 3RYTA 5L95C 4GDLB 4P7IA 4EZLA 2V1YA 4G50A 2ZJDA 3UINB 3LDZE 3ONSA 2JVCA 4HCNB 3SD5A 1V9JA 2KZRA 4E71A 2CKHB 4OVUA 2C9WB 3CSTA 1WE7A 1UBIA 5CX3A 5D2MB 3V60A 4DHZE 1WJ6A 1NBFC 2C7NB 3TBLD 2G3QB 3RT3B 1KLVA 4NQLB 4BFRA 2BYFA 3PREA 3ZUNA 2J0KA 2LI5A 4CO7A 4BKGA 3QC8B 2JF5A 4PYUA 4GGQA 4RMAA 4DHZB 1V86A 3QARA 4DHJB 1WX9A 2LWPA 3UQAA 2PPHA 1OQYA 3WAPA 2KMAA 1YIWA 2FUHB 3VH3B 3QCAA 1V49A 2XK5B 3S2AA 3VH4B 2LGYA 1Q5WB 2LXCA 2IO2B 4GXBA 4MH0E 1YX6B 2REXA 1WXVA 4WAAA 2V4LA 4TQ0A 4B9KA 4W9GA 3KUCB 3TL5A
chains in the Genus database with same CATH superfamily
3Q8CA 1QOFA 3GP7A 3N20C 2QILA 1MPEA 2DLBA 4ITKA 2MJ3A 2FCNA 5G55A 5LXHA 2ACZB 4MACA 4PK1A 4AWJA 4GDLA 1K53A 2BKFA 2DZMA 4M0WA 3U8ZA 2QCZA 3I63C 1QT9A 1GAQB 4W9DA 1MJDA 2KAJA 3AEBB 3OWEB 1Y56A 4DDGD 1C79A 3FILA 1WRDB 3DBLI 3AN1A 4F8CB 1UD7A 2LGDA 1FXTB 2QJLA 2ZZPB 4GOCA 3EFCA 3Q8BA 3L08A 1YQ3B 2KDIA 1N5WA 3DVNV 5DCNA 1WY8A 1Q10A 1NYQA 2JYTA 3OLMD 1YNTE 3C19A 2FBWB 2RMMA 1FO4A 3R8BA 1UWMA 2IZVB 2MLBA 2RSUA 1V97A 3IHPC 3D32A 3SFEB 4BKSD 4F7ZA 1F77A 4UDUC 4M0WB 4LCDE 2PW9A 2JUOA 2J4XA 2WXGA 1F0ZA 4DWFA 4NJCA 4M8MA 1TKGA 5J18A 3DWMA 3EGRA 2LXAA 2VRRB 4ACFA 3VUXA 2LGSA 1PDXA 1PYWD 3Q3OC 3ML8A 2N1VA 1X1MA 4PYZA 1YN4A 1XLPA 2MEKA 1ZDVA 2BS4B 4KGSA 1ZDXA 2UWQA 1LGRA 3L54A 3MFGA 4KDLB 1T5XD 4M8NA 1KLGD 1K51A 2G4DB 2WXHA 3URYA 2Y3AA 1E6EB 2LUEA 2GOWA 1E7VA 3GZNI 4GIVA 3B0AA 3X0WA 3JYUA 4ZRJA 4HVBA 1SJED 1JWUD 3N1YC 1UWXA 2CS4A 2PKOA 3RNEC 3ZVVA 3V61A 2K6DB 1SEBD 3N9YC 5E6NA 2N7EA 3EA6A 3RNGC 2FUG1 2WLBA 3QX1A 1ISNA 4ANXA 1MI0A 2K8BA 1UELA 3PZ8A 2B3AA 4O1NA 1CQVA 3RNBC 2ZW0A 3HVZA 1VDVA 4GDKA 3OJ3A 1GUAB 2JZPA 2LUMA 2JWUA 2AQ2B 4MH8A 1BT0A 3ZIMA 4REZA 1J8CA 1VZ8A 2BBCA 4BAXA 4RGMA 1OQQA 1WGGA 3W9CB 3NRZA 2I1JA 1WGYA 1ZXIA 2INNE 2D5GA 4AP4C 1ESFA 5GXGB 3RN9C 2MJEA 2N1WA 3VTWA 3L17A 1D5MC 3BWUD 4AS1A 3APFA 3AI5A 3DHGC 2WXOA 1KOTA 1YMHE 4XX5A 4MJSA 3MC0B 1L2NA 4B0MA 3V62A 3HUIA 1ZW7A 1RLFA 4I6LB 4JIOU 1T0RC 3TEYA 1WI0A 1QQRA 3DCGA 4HDQA 5BMHA 2WXIA 1ZXHA 4RCOA 2KT7A 4KSKC 2ONQA 3KQ4A 1UZXB 4K1RB 3RNAC 4C7ZA 4JE3B 2QDFA 4N6EB 4DBGA 1QKZA 4DHJD 3DPDA 4HRSA 3RZWC 2ZVNA 1R4NI 3A9JA 2PE9A 4US8A 5J2RA 4A6QA 1XLOA 4A55A 2IY1B 3BY4B 4DDID 5CHVC 1TYGB 2IBIB 2Z0EB 4KIKA 3BVZA 1FRRA 4EKUA 4HPPA 3GE8C 5C3JB 2HD5B 5GMVA 2EMSA 3PLUA 3H7PB 2VZKB 3ZNID 3U7ZA 2K8CA 1HQRD 3Q3MC 5CHWA 3UIPB 5JXVA 2EKIA 4W9HA 1IBXA 3Q2AC 3AEDB 1D4BA 1SJHD 3U2SC 3PPAA 1FD6A 4HJGE 2KDBA 4A20A 1TTNA 5TSSA 1T0SC 1KM7A 2PTLA 2RPQA 4WH4A 5BYQA 4FJZA 4XE0A 2BKRB 2MJDA 3NOBA 4IG7B 3H6NA 3W5VB 1XCTL 3Q69A 1C9FA 4A3OA 2JY6A 2BB5A 4NJ7A 3IFWB 2C7HA 1HEZE 2L32A 1EM7A 2D3AA 3RZFA 3APDA 1GNUA 1WWTA 1ROEA 2LRWA 3DBLB 2FE8A 3WCQA 1MG8A 1FNVA 2D3BA 1A5RA 4ZRQA 2AYOB 5CHFA 4MGKE 3ENEA 3U30A 1JWBD 3A4SC 2J42A 3O13A 1EWCA 4YTMB 1LXDA 3AE4B 3DBRI 3VVWB 1AWDA 3ZDMC 1DOIA 3NG0A 1NYRA 2L83A 3I57A 4TKNA 2WDTB 2WS3B 3MC9A 1P0RA 3PGEA 1C1YB 1DOXA 3W1YA 1NEKB 4HPLB 3DWGC 5FK9C 2JXXA 1Y8RC 4DXFA 4PS7A 2MHJA 2WXQA 1SE4A 2KC2A 1C77A 2MQJA 1R4MB 4CQNA 5IAAC 3ZO5B 3N3KB 3ZJUA 4RGNA 1WXMA 1LO5D 2V3SA 1E8WA 2OJRA 1AYFA 2LVOA 1V1OA 3AEFB 1E7PB 2KLGA 2CU3A 3WIMA 2D10A 4K7UA 2BYEA 2KJHB 3BZDB 2ZCBA 2O2VB 5HFYA 2JQRB 4LDTD 1SGHA 1P1AA 1WXAA 4W9KA 2IJ0A 3VR9B 3RYTA 2JSVX 2V1YA 2ZJDA 3UINB 3P4SB 3ONSA 4E71A 3PO0A 4OVUA 1WE7A 2W3RA 1R7SA 3TBLD 3EUB2 1L0YB 4Q2JA 2G3QB 4BFRA 3GZNB 2J0KA 4PYUA 3I9V1 1WX9A 4C56C 2FUHB 2XK5B 3S2AA 3VH4B 2LXCA 2IO2B 4GXBA 4MH0E 1YX6B 1WXVA 1JW9D 4WAAA 2V4LA 4W9GA 3KUCB 3ZNZB 1YJ1A 2J53A 2SEBD 1DYQA 4KKJA 3MJ5A 1VR9A 3WAOA 4OHJA 1B1ZA 3AU5A 4RGOS 2XEWA 1HA5A 4NZLB 1I4QA 1KRHA 2J0JA 4US9A 3U52E 1UGMA 3IT6B 4L23A 1L4ZB 2WQYB 2LGIA 2K3UA 4MJSB 4NAWB 5FR6A 3P4PB 1FNUA 3RNFC 1IUEA 3UQBA 4XZ4A 2HE7A 2MBBB 2JZ3B 3R66C 1TS3A 4QAYA 3KH0A 3IVFA 1WR1A 2VZKD 3JSVA 3LYYA 3ML9A 3RD2A 1IYFA 1C78A 1ZOYB 4A90A 4MM3A 4IWQA 1DGJA 4IUMB 2BS2B 2DYBA 4IC7B 3OAWA 1FFUA 1P9DU 2IO0B 4AJYB 4KZCA 2PIAA 3PHWB 2IGGA 2JZZA 2QEJC 1J7CA 4RF1A 1WX8A 3ZXRA 1I4RA 5BMIA 4LNNA 4B6WA 3AE7B 4ANUA 3Q8FA 4YTNB 1JQ4A 1UH6A 1FXAA 2GBRA 2LEKA 2WP9B 1WR6E 3KUZA 2KDMA 3V3XA 1WJUA 4EOYA 4MT5A 1SIJA 2KMCA 2AL6A 3PZDA 3L13A 1IP9A 1ET9A 1Z5SB 4JGHB 2QMTA 3MHZA 4IOIE 1WX7A 1E5WA 3QQ8B 1AARA 1E10A 3B1LX 4GN1A 2J0MA 1FNWA 2WHIA 3H7SA 4YL8A 2WYQA 3C8YA 3Q14C 4C4VB 1RYJA 2GBMA 3KUDB 1XO3A 1SE2A 2KLCA 5BO4B 2I38A 3GE3C 4WURA 2NVUI 1WM3A 2L7RA 1QOAA 4WWNA 1LQBA 2J7QB 4FHJA 4IWPA 3M3JA 4IM2A 2K5PA 2L52A 3L4PA 1J7AA 2KDEB 2KO3A 2VH2A 3VRBB 2AX5A 4BKTA 3DBSA 5D7GA 5JZEB 4MGYE 2ZCCA 4FXCA 4BOSC 4ICVA 3A9JB 5KHQA 4FLHA 1F2RC 2KMMA 2ICIA 1Q1OA 2WX0A 3MC8A 2KYWA 1V1PA 1D3ZA 1SE9A 3W5UB 1PQSA 4KGTA 2RGFA 1F2RI 1V6EA 4NQKE 3BK1A 3ZKJC 4NY0A 2V4IB 3I3TB 5E6PA 2ZPNA 3Q3FA 4AJWA 1RFKA 3DBRB 2BWFA 4MELA 3PLVA 4BBNF 3PRZA 1J0GA 1TKEA 4XWTA 2DWQA 1ZE3D 2WU5B 1JWMD 1SIFA 2KWDA 2NCNA 1WMHB 1WXSA 5C2TB 3RNCC 2MH7A 2BT6A 4EZJA 2EKEC 4PS8A 2PVGC 1LFDA 1V1PB 2M0XA 2QHOA 2KQ7A 3DDCB 1SE3A 1VJKA 1TBEA 4C7YA 2K6QA 1NVID 2I1KA 1M94A 2Q5WD 1WSPA 1YN3A 3TEXA 3U4EG 3VQIA 5EE0A 1XF5L 4KKIA 1WH3A 4I6PA 1KH0A 2KXJA 1TKYA 2BPSA 4WWOA 3DBHI 1C3TA 3VTVA 5IKCM 3A9KA 3AH7A 3EC8A 4NJ6A 3ZNGC 1K52A 2XK5A 3AE9B 1QLBB 2SAKA 4N58A 2HJ1A 3A1QB 3CF6E 4ARIA 2WNMA 3Q8EA 1V5TA 4ICUA 3PRMB 5DPTA 2L0TA 2R61A 5AZFA 4EUTA 1E8XA 2G45B 1IGDA 5FKAC 3ABVB 3P2BA 5JHAA 5D94A 1F52A 2M1MA 2AWTA 2CJOA 4RF0A 1PGAA 1WM2A 4FN2A 4RFBA 1WGKA 2MW5A 4YXDB 2IDYA 3RCZA 3Q3NC 3DBHB 4JLCA 1L4DB 3ZRCA 3ZGZA 2ZEQA 4ZHPA 3EFUA 2K0PA 2TSSA 2MP2B 3P4QB 4HXDA 2HDEA 3BIID 2ZNVB 3BVMA 5EDSA 4A3PA 2DBYA 4ZRKA 3AXCA 1WYGA 4W9EA 4YSZB 5IOIA 3VFKA 2L00B 4OVVA 3BK2A 2O2VA 3TEWA 5AZHA 3ZYYX 4X57B 4W9CA 5DPSA 3FC4A 1HE8A 2MBEA 2V3PA 2KWUB 1BMLC 1ZUD2 2V0GA 1EWYC 2KACA 3IAM1 1FMAD 2FAZA 1P98A 4KVGB 2OHFA 4MEMA 3HRDD 4OZBA 3AE1B 2MA9B 2ZVOA 1KTKA 2VH1A 1TZOA 1YOVB 2WXRA 5LNK1 2LASA 2AL3A 2MP2A 3R2IA 5HG2A 4HLEA 2RR9A 3VRAB 2N0SB 1V81A 4AQ7A 2PE6B 3KLSX 5EE1A 2LVPA 4BZAA 1GC6A 4OVZA 3PZ7A 1I4GA 4HEA1 3V05A 4IKGA 2PLPA 2RDGA 4C00A 2KZRA 4LNOA 1C4CA 5I4DA 1UBIA 5CX3A 1WJ6A 3RT3B 1KLVA 3ZUNA 3QC8B 2JF5A 2PMVA 3N1XC 4GGQA 4DHZB 1I7HA 1E0ZA 2DNFA 3QARA 2LWPA 3N1ZC 2OEDA 3UQAA 1OQYA 3WAPA 1V49A 1VZ6A 2LGYA 5BYRA 3H8HA 1FIQA 5EE3A 4B9KA 5E6JA 4XDDA 1N63A 1EU3A 1IGCA 1L6VA 4MSQB 3SDLC 3W1SA 2KVZA 1MVKA 2KD0A 2FNJB 4DK5A 4GLSC 5FR3A 1L7YA 2JRIB 2LRUA 3P63A 2NTTA 2NBUA 2ASQA 1GB1A 3X23A 2DZJA 1ZPSA 4FHKA 1OTRB 1FRDA 3AU4A 5TR5A 2FIDA 4RGTA 2WU2B 4FA6A 1T0QC 2C60A 2K1FA 3NZSA 5MPOA 1XEEA 3AE6B 3TJPA 1I4HA 2RD0A 3FAHA 2I2YA 1E8YA 2A4ZA 3M62B 4J6IA 1UGJA 2N9XA 1CZPA 4HKQA 1V5OA 2FIFA 4S0RA 1WGHA 1FFVA 1TY0A 3HK0A 3U7DA 4FADA 2JT4B 1JRPA 3VUYA 5DPWA 3QIJA 3QK0A 4EZKA 2Z59B 2WXJA 2HTHA 3DQVA 2MWSB 5H92C 3AM9A 3O65B 3RFZB 3UGBB 2IGHA 2KHWB 3V6CB 3UI3A 3Q6BA 4A9AA 1S1QB 1ENFA 3DVNU 4ARCA 4G3XB 2YVCA 4EFOA 2NMQA 1TT5B 1QOBA 4G0NB 1IPGA 4WJPA 1XQQA 3QA8A 3HM6X 4JL9A 4AUQC 1RWSA 2D2QA 1EUVB 1WJNA 3B08A 4E3CA 1XD3B 4ZYSA 3TSSA 5T8IA 4GU2A 4R3DA 1TZ1A 4L1BA 4EEWA 2KOXA 2KJ6A 3TEZA 1G6JA 4KV2A 3CIRB 1OFFA 3CWIA 5HHDG 4WWPA 1IBXB 1SSNA 4OZCA 3VHTC 3M63B 2ZPYA 4M01A 2BWES 1NENB 2OJWA 3JVZX 1HZ6A 3MHSD 3NVWA 3LJ3A 1C4AA 1K50A 2L8JA 1WZ3A 4ZRIA 3DVGY 4DXGA 1GPXA 2LD9A 4G11A 4LNFA 5G2NA 1FPYA 2O6VD 1C76A 1QZEA 5H8YE 1TJEA 2WXFA 4LNKA 3IG3A 3SR6A 3I5JC 2Y5CA 3AB5A 3HM3A 4P1CC 4YTPB 2IPKD 4P16A 2NR2A 2LZ6A 1K8RB 2WXKA 1VCBA 2X38A 4XWWA 3Q8AA 4BOZB 5LXIB 3ZTCA 4OW0A 4BVUC 3DVGX 2Y5PA 2D3CA 1R4NB 3GS2A 1I42A 2M17A 3GB1A 4M00A 3TUOA 4GMVA 5J17A 2E3TA 4IWOA 3A1QA 3T9LA 2BVCA 4RNAA 2KN4A 4A8XC 2J52A 4IM0A 5L83A 1YJIA 3B2FA 2ZNVC 1RRBA 3AE8B 1E9MA 2EMTA 2XNAC 2HTME 2WDQB 1B9RA 1PGBA 1RAXA 2QSDA 3NZ3A 3CMMB 4RM8A 2N9EB 5E6OA 1H8CA 2YLMA 4WJOA 3DOWA 2BS3B 4URKA 2K25A 2HJ8A 3AULA 1OGWA 3FILB 2KJRA 2R2OA 2LFIA 4FBJB 2L76A 3ZW3A 2K22A 2BGFA 2O6VA 3A9KB 1SF0A 1JRUA 1AW7A 2KFKB 2B76B 2CJNA 1UNSA 4N9F4 2MX2A 2RPVA 1U4AA 1SBBB 3CSFA 3W1SC 2Z0DB 3J9CA 2KANA 3QWZB 3OG5A 1GJZA 2FCSA 3NHEB 2KFJA 3NVVA 3H1UA 1WFYA 2CHZA 4BKSA 3ETRA 1WE6A 1FM0D 3T3NA 4J3OD 1Q0WB 4NPNA 1E90A 1WGDA 1YN5A 2GMIC 2KNBA 1CK1A 2K8HA 1R4MI 4IM3A 1WYWB 4NNJB 1JWAD 2OOBB 3H9DA 3E56A 4D2KA 3DHHC 3IXSA 2KFKA 4JWUC 4YSXB 1RFAA 4MM3B 2KWVB 1HTQA 4GDKB 1YQ4B 4TUUA 4LDTB 4RH6A 3M95A 4WJQA 2NTSA 1FEHA 3KWLA 3P42A 2L3ZA 3MJWA 2M4NA 4WJNA 2JXTA 4ZYNA 2LMCA 2N7DA 3B9JA 3NZUA 1PFDA 4GSWA 3R7RA 4EE2A 2KX3A 3B2GA 3L0WB 2KDFB 4WIPA 4ANVA 1YJJA 4HK2A 1NI3A 2YEPB 2GI9A 1WF9A 2WGSA 4P6VF 1MG4A 2C5LC 1VLBA 3NJTA 4XYCA 4IW0A 1ACCA 2IO1B 1YD8U 1D6EC 3TMPB 3UF8A 4BBNC 2NPTA 3JSVB 2V9HA 4FJVB 4MSMB 1F1HA 2Z8LA 2GRIA 3HHMA 2INPE 1J7BA 3VR8B 2IYDB 4W9IA 5D6JB 2RDHA 1BUIC 1H4RA 2WXMA 1FCLA 2KQ4X 1GC7A 4II2B 3L10B 2MRPA 1HZ5A 2BF8B 2QC8A 5AUIA 3SU8X 3K9OB 1S3SG 4N59A 1WMHA 4KIKB 4FULA 1N61A 3RULA 2GBNA 2R2QA 1UUPA 1VRAB 2W9NA 1LM8B 1TS5A 5IP4D 4AOFA 3PTFC 2L1AA 4P7IA 3AECB 4S17A 4G50A 3FKYA 2BW2A 4K3BA 4HCNB 1V9JA 1QOGA 2BYTA 3NS1A 2CKHB 4HKZE 2C9WB 5D2MB 4DHZE 2C7NB 4LTUA 3R2TA 4C4VA 2BYFA 4B0EA 4CO7A 4BKGA 1P7FA 4M02A 2N9LA 2M56B 1V86A 4DHJB 2H89B 2PPHA 1YIWA 3E9SA 1KF6B 1Q5WB 1L0XB 1GOZA 3ZJTA 1HTOA 3TL5A 3RMKC 2CHXA 1A70A 5D3DA 2CHWA 1TIFA 3GOEA 4ASWC 3AEEB 1KJTA 4TMAB 4MGZE 3T3OA 1GG3A 4XGAB 3P4RB 1EU4A 2NBWB 1TS4A 2JPHA 1MHHE 3ALBA 1WXQA 3VAWA 3ZQ4A 4KGRA 2KC1A 1EF1A 5IA7A 4WQOB 4CYEA 2DHZA 3HIZA 4F1SA 3WAMA 2M8SA 2JU6X 4P1BC 4KZ0A 1L6UA 1YX5B 1V80A 4TSSA 1Z2MA 2JYEA 4E74A 3A4RA 4H2AA 2NS5A 2MBQA 5KHOA 2GLSA 1JCKB 1HXYD 1ZP0B 2BB6A 1STEA 3VXWA 1I4PA 2FCQA 1N6ZA 4JQWC 1J19A 2JRHA 1CMXB 1ET6A 2DAJA 2ZW1A 3APCA 4W9LA 4JX1C 1T6BX 1JALA 2KTRB 1L5PA 4I6NB 4HDOA 2UYZB 4LJPB 3QAQA 1E7UA 4XC2A 5JH5C 4W9JA 4LK0M 3ZJVA 4ZDVA 1FCCC 1MFWA 5AEKB 3KVFB 3AE5B 4IDIA 3ZTDA 5G5HA 2LJIA 1DOYA 5CTRC 1WIAA 3WA0A 1T3QA 1OQRA 1I4XA 1NI2A 4B95A 1TGZB 4MDKE 1TS2A 2DYOA 2XBBC 4HWIB 4NAMA 2QIEB 4LJOB 1PGXA 2IY0B 4ZHOA 1V8CA 2MCNB 1NDDA 1EO6A 3BVGA 4CHKA 3KW5B 3PVLA 2N9KA 3IBEA 2KQSA 4TQ1A 2K39A 5HI1A 1XXGA 2INDC 2MSED 1QF6A 2H88B 3LXFA 2DENB 2LGXA 4K7WA 4KSLC 2L0FA 3SEBA 3KWVA 3RUIB 4II3B 2KTRA 4GB9A 3ZLZA 1C4PA 2MBHA 3ECIA 1V2YA 1EF5A 1RM6C 3KYCD 1JMLA 1F9JA 3C0RB 4HROA 3NUHB 3PSEB 3VTUA 2EELA 2L05A 2WXNA 4WWMA 1WJ4A 1T0YA 3QHTA 2E6XA 2LHEA 3EHVA 5IN7A 3ZNHB 1AN8A 4WAFA 5G5GA 3DHIC 4KX6B 2GBJA 3HVDA 4DXAB 4HJKA 4FJYA 1XCQL 4KDIC 2N9PC 1UBQA 3RPFC 2CU1A 3N32A 2WDRB 2BYVE 2IO3B 3SHQA 4OZAA 1XLQA 2KKCA 2W54A 3UIOB 2O6VB 5LLIA 2BTEA 2W3SA 2DYMA 4ZRPA 2DZIA 3AE2B 3AV8A 1FXIA 4ANWA 2KVRA 2AQ3B 1JROA 1VZ7A 1CJEA 2JX5A 4ZOHC 4NAWA 2MBOA 2DAFA 2WX1A 1UF0A 2GBKA 1VD2A 4JPSA 2G4SA 1XT9B 2KK8A 2KN5A 3EECA 4W9FA 2LVQA 3AEGB 1YQBA 3IAS1 2D07B 3SFDB 2W82A 1MHXA 3A33B 2ON8A 3RI7C 2YEPF 5HKHA 2WDVB 4YWGG 3KYDD 3MTNB 3PRPB 2N4FA 3T8MA 4DQOC 3AMZA 3PHXB 2JWZA 2D11A 3Q3JA 1OEYA 2NBVB 2K9XA 3OJ4B 2LJ5A 5DPRA 2PJHA 2UU7A 2G9HD 3WALA 4K3CA 2D3GA 3R3MA 1PUTA 2KWCA 1SXTA 3NY5A 2N7JA 3TIXA 2AQ1B 3N30A 2WXLA 3ZRFA 3VDZA 4HPMB 2M0AA 4PS3A 3NS8A 2X8XX 4USAA 3V6EB 3BINA 1TY2A 5BYSA 2A5UA 3H7PA 4RM9A 4L2YA 3ZDTA 2KX0A 2PVOD 2NPTB 5EE9A 2W55A 3LB8C 4WQMA 1XLNA 1N62A 1WRIA 2WWZA 3BYYB 4JWSC 2G1EA 1N60A 2DX5B 5AZGA 1WZ0A 5D3IB 2PEAA 4C80A 3TCAA 4YSYB 3PT2B 5C23A 2KTFA 1M4VA 4LNIA 1P3QU 4PT5A 2LHDA 1KFYB 1N5XA 2RDBC 1P7EA 3MP9A 1SB3C 1KLUD 4K7SA 3WANA 2BQQA 1OEYJ 3JW0X 2V3NA 1D5ZC 5BMGA 4MGIE 1QILA 3ZXVA 3P1MA 3QJZA 4HCPB 1WGRA 3R7QA 2Y5BB 2DZKA 1ZKHA 3NVYA 5C1ZA 3AE3B 4K81A 2AEHA 4XDCA 1ZGUB 3L16A 3VUWA 2CR5A 5JHBA 1E8ZA 3PV1A 2FCMA 1JWSD 4TV3A 2M19A 2C7MB 3PS6A 1BXTA 1I35A 3K9PB 3AEAB 4YT0B 4LLGM 5L95C 3IT4B 3BYTB 4GDLB 4EZLA 3W2DA 3LDZE 2WXPA 5AUKA 2JVCA 3SD5A 1GB4A 3CSTA 3V60A 1NBFC 2GB1A 4NQLB 3PREA 2LI5A 2IGDA 4RMAA 2XN9C 2KMAA 3VH3B 3QCAA 5IO9A 1L0VB 2INCC 3NVZA 2REXA 1D5XC 4TQ0A
chains in the Genus database with same CATH topology
4MSQB 3ZNZB 1YJ1A 3SDLC 2CHXA 3W1SA 2KD0A 2FNJB 4DK5A 2FCNA 5G55A 5LXHA 2CHWA 3GOEA 3WAOA 3AU5A 4ASWC 4AWJA 1L7YA 1KJTA 2JRIB 2LRUA 2XEWA 4GDLA 2BKFA 2DZMA 4MGZE 1GG3A 3U8ZA 2NBUA 2NBWB 2ASQA 2J0JA 2JPHA 1UGMA 3ALBA 3X23A 2DZJA 4W9DA 3VAWA 4FHKA 1OTRB 4MJSB 4NAWB 4DDGD 5FR6A 1WRDB 3AU4A 3DBLI 5TR5A 2KC1A 4F8CB 3UQBA 2FIDA 4XZ4A 1UD7A 1EF1A 2HE7A 2MBBB 4FA6A 5IA7A 4WQOB 2LGDA 2JZ3B 4CYEA 2C60A 1FXTB 3R66C 2DHZA 2K1FA 3NZSA 3HIZA 4F1SA 3KH0A 2ZZPB 4GOCA 3IVFA 2M8SA 1WR1A 3WAMA 3JSVA 3ML9A 3L08A 3TJPA 3RD2A 1IYFA 2KDIA 3DVNV 4KZ0A 5DCNA 1WY8A 1YX5B 2RD0A 4MM3A 1V80A 4IWQA 1Z2MA 4IUMB 4E74A 1E8YA 2A4ZA 2DYBA 3A4RA 3M62B 3OLMD 3OAWA 4IC7B 4J6IA 2N9XA 1P9DU 2IO0B 2NS5A 4AJYB 2MBQA 5KHOA 1V5OA 2MLBA 2FIFA 2IZVB 2RSUA 1WGHA 4KZCA 3HK0A 3PHWB 3U7DA 4FADA 2JZZA 3IHPC 2JT4B 2FCQA 1WX8A 4JQWC 3VUYA 3D32A 3VXWA 1J19A 2JRHA 5DPWA 3QIJA 3QK0A 1CMXB 4BKSD 4EZKA 4F7ZA 4B6WA 2Z59B 2DAJA 4ANUA 2HTHA 3APCA 4W9LA 4M0WB 3DQVA 2MWSB 4LCDE 3O65B 3UGBB 2KHWB 1UH6A 2JUOA 3V6CB 2KTRB 4I6NB 1S1QB 2GBRA 4DWFA 3KUZA 1WR6E 4HDOA 4M8MA 5J18A 2UYZB 3DVNU 4LJPB 1WJUA 4EOYA 3QAQA 1E7UA 2LXAA 4G3XB 4XC2A 2VRRB 2KMCA 5JH5C 4W9JA 3VUXA 2YVCA 2AL6A 4ZDVA 3PZDA 4EFOA 3L13A 1IP9A 3ML8A 2N1VA 1Z5SB 5AEKB 1X1MA 4JGHB 3KVFB 4G0NB 3ZTDA 4PYZA 1IPGA 4WJPA 1XQQA 3QA8A 3HM6X 4JL9A 1WX7A 5CTRC 4AUQC 1WIAA 2D2QA 1E5WA 3QQ8B 1EUVB 3WA0A 1WJNA 1NI2A 3B08A 2UWQA 1AARA 4E3CA 3B1LX 3L54A 4GN1A 2J0MA 4B95A 1TGZB 4MDKE 2DYOA 1XD3B 3H7SA 2XBBC 4HWIB 4YL8A 4KDLB 2WYQA 4LJOB 4M8NA 4GU2A 2IY0B 1TZ1A 2MCNB 4EEWA 1NDDA 2GBMA 1EO6A 2KJ6A 2KOXA 3KUDB 4CHKA 2G4DB 1G6JA 4KV2A 2KLCA 5BO4B 3KW5B 3PVLA 3IBEA 2LUEA 2KQSA 4TQ1A 2K39A 2GOWA 4WWPA 2NVUI 1E7VA 3GZNI 4GIVA 1WM3A 2L7RA 2MSED 4WWNA 3VHTC 1LQBA 3M63B 3B0AA 2DENB 2J7QB 2LGXA 2ZPYA 2L0FA 3JYUA 4K7WA 4KSLC 4ZRJA 2BWES 3X0WA 3RUIB 3JVZX 4HVBA 4FHJA 4IWPA 3M3JA 4II3B 4IM2A 2CS4A 2KTRA 3MHSD 4GB9A 3ZLZA 3ZVVA 3V61A 2K6DB 2KDEB 2KO3A 2MBHA 3ECIA 3LJ3A 4BKTA 2L8JA 5E6NA 2N7EA 1WZ3A 3DBSA 5D7GA 4MGYE 4ZRIA 5JZEB 2ZCCA 1V2YA 3DVGY 1EF5A 2LD9A 3QX1A 4G11A 5G2NA 1ISNA 3KYCD 1F9JA 4ANXA 3C0RB 4BOSC 4ICVA 3A9JB 2O6VD 5KHQA 2K8BA 4FLHA 1UELA 1QZEA 3PSEB 3VTUA 2B3AA 2L05A 3IG3A 3HM3A 4GDKA 3OJ3A 1GUAB 1Q1OA 2WX0A 1WJ4A 1BT0A 1T0YA 3ZIMA 2NR2A 3QHTA 1J8CA 2LZ6A 1D3ZA 1K8RB 1SE9A 3EHVA 1PQSA 1WGGA 2RGFA 3ZNHB 2I1JA 1WGYA 1VCBA 4BOZB 5LXIB 4AP4C 1V6EA 3ZTCA 4NQKE 2N1WA 4BVUC 3DVGX 3VTWA 2GBJA 3L17A 4DXAB 3ZKJC 4HJKA 1I42A 2M17A 4NY0A 4FJYA 3I3TB 5E6PA 2ZPNA 3APFA 3Q3FA 4GMVA 3AI5A 5J17A 4IWOA 3A1QA 4KDIC 1KOTA 3T9LA 2N9PC 1UBQA 4AJWA 4XX5A 2CU1A 3N32A 4MJSA 2BYVE 2IO3B 3SHQA 1L2NA 2BWFA 2KKCA 4IM0A 3V62A 3UIOB 2O6VB 4MELA 5L83A 1ZW7A 1RLFA 4I6LB 4JIOU 5LLIA 3PLVA 2ZNVC 1RRBA 2DYMA 1WI0A 4BBNF 2DZIA 3PRZA 1J0GA 2EMTA 3DCGA 4HDQA 1RAXA 4KSKC 3RZWC 3CMMB 4RM8A 1UZXB 2N9EB 5E6OA 4ANWA 1H8CA 4K1RB 1SIFA 2KVRA 2YLMA 4WJOA 3DOWA 2NCNA 1WMHB 1WXSA 4URKA 2K25A 2HJ8A 3AULA 4NAWA 2MBOA 1OGWA 2EKEC 4EZJA 4PS8A 2DAFA 2KJRA 2R2OA 2WX1A 1LFDA 4FBJB 2M0XA 2L76A 3ZW3A 2GBKA 2QHOA 2BGFA 2KQ7A 2O6VA 3DDCB 4DBGA 1VD2A 4DHJD 3A9KB 3DPDA 1TBEA 2G4SA 1XT9B 2K6QA 2ZVNA 2KK8A 1R4NI 2KN5A 2PE9A 3A9JA 2I1KA 1M94A 1JRUA 5J2RA 3EECA 2KFKB 2IY1B 3BY4B 4W9FA 3VQIA 2LVQA 4DDID 5CHVC 2IBIB 4N9F4 2MX2A 2Z0EB 4KIKA 1YQBA 2D07B 1WH3A 1U4AA 4I6PA 3CSFA 4EKUA 2KXJA 3W1SC 2HD5B 2Z0DB 3A33B 5GMVA 2EMSA 2KANA 3QWZB 2BPSA 4WWOA 5HKHA 3DBHI 3PLUA 3H7PB 3KYDD 1C3TA 3VTVA 3MTNB 3ZNID 1GJZA 3PRPB 2N4FA 3T8MA 2K8CA 2FCSA 2JWZA 3PHXB 3A9KA 3NHEB 2KFJA 2D11A 5CHWA 3Q3JA 3UIPB 3EC8A 1OEYA 4NJ6A 2NBVB 3ZNGC 3H1UA 4W9HA 2XK5A 3OJ4B 1WFYA 2CHZA 4BKSA 3A1QB 2LJ5A 5DPRA 2PJHA 3CF6E 3WALA 1WE6A 3PPAA 2D3GA 3R3MA 2KDBA 4A20A 2KWCA 1Q0WB 4NPNA 1E90A 1TTNA 3NY5A 1WGDA 2GMIC 2KNBA 3TIXA 1KM7A 1V5TA 2RPQA 3N30A 4ICUA 3ZRFA 2K8HA 3PRMB 4FJZA 5DPTA 1R4MI 4IM3A 1WYWB 4NNJB 2L0TA 5AZFA 4EUTA 1E8XA 3VDZA 2BKRB 2OOBB 3H9DA 2G45B 3P2BA 3NOBA 4IG7B 5JHAA 5D94A 4HPMB 2M1MA 2KFKA 2AWTA 1RFAA 1WM2A 3H6NA 4FN2A 2KWVB 2MW5A 4GDKB 4PS3A 3NS8A 4TUUA 3RCZA 4A3OA 4LDTB 4WJQA 3M95A 2JY6A 3V6EB 3BINA 4JLCA 4NJ7A 3IFWB 2C7HA 3ZRCA 2A5UA 3H7PA 4RM9A 2ZEQA 3RZFA 2L3ZA 3ZDTA 3EFUA 3APDA 2KX0A 1GNUA 3MJWA 2NPTB 2M4NA 2MP2B 4HXDA 2ZNVB 4WJNA 2WWZA 2LRWA 4ZYNA 2N7DA 3NZUA 3R7RA 4A3PA 4GSWA 5EDSA 2KX3A 4ZRKA 3AXCA 2DX5B 5AZGA 3L0WB 4W9EA 1WZ0A 1MG8A 2PEAA 2KDFB 4ANVA 3TCAA 1A5RA 4HK2A 3PT2B 2AYOB 5C23A 3VFKA 2KTFA 5CHFA 2L00B 1P3QU 1WF9A 4MGKE 3ENEA 4OVVA 2C5LC 4IW0A 3U30A 2O2VA 2IO1B 5AZHA 1YD8U 3TMPB 3A4SC 4X57B 4W9CA 5DPSA 3UF8A 1LXDA 2NPTA 4BBNC 3DBRI 3VVWB 1HE8A 3JSVB 2MBEA 4K7SA 2KWUB 3ZDMC 3WANA 4FJVB 4MSMB 1OEYJ 3JW0X 3HHMA 4TKNA 2WDTB 1P0RA 3PGEA 2FAZA 1C1YB 3W1YA 4MGIE 4HPLB 1P98A 4KVGB 2IYDB 4W9IA 2JXXA 1Y8RC 3QJZA 4MEMA 5D6JB 4PS7A 4HCPB 1H4RA 1WGRA 3R7QA 2MA9B 2Y5BB 2ZVOA 2KC2A 2DZKA 1GC7A 2MQJA 1ZKHA 4II2B 5C1ZA 3L10B 5IAAC 4K81A 3ZO5B 2LASA 2AL3A 2MP2A 2MRPA 3N3KB 2BF8B 4HLEA 2AEHA 1WXMA 1ZGUB 2RR9A 3L16A 3VUWA 3SU8X 3K9OB 2V3SA 1S3SG 1E8WA 2CR5A 5JHBA 1WMHA 1E8ZA 2OJRA 4KIKB 1V81A 3PV1A 2LVOA 4FULA 3RULA 2GBNA 2FCMA 2R2QA 2KLGA 3WIMA 2PE6B 2D10A 4K7UA 2BYEA 2KJHB 4TV3A 2LVPA 2ZCBA 2O2VB 2W9NA 2C7MB 3PS6A 1I35A 3K9PB 1GC6A 1LM8B 4LDTD 4AOFA 1SGHA 1P1AA 1WXAA 4W9KA 3PTFC 3RYTA 5L95C 4GDLB 4P7IA 4EZLA 2V1YA 4G50A 2ZJDA 3UINB 3LDZE 3ONSA 2JVCA 4HCNB 3SD5A 1V9JA 2KZRA 4E71A 2CKHB 4OVUA 2C9WB 3CSTA 1WE7A 1UBIA 5CX3A 5D2MB 3V60A 4DHZE 1WJ6A 1NBFC 2C7NB 3TBLD 2G3QB 3RT3B 1KLVA 4NQLB 4BFRA 2BYFA 3PREA 3ZUNA 2J0KA 2LI5A 4CO7A 4BKGA 3QC8B 2JF5A 4PYUA 4GGQA 4RMAA 4DHZB 1V86A 3QARA 4DHJB 1WX9A 2LWPA 3UQAA 2PPHA 1OQYA 3WAPA 2KMAA 1YIWA 2FUHB 3VH3B 3QCAA 1V49A 2XK5B 3S2AA 3VH4B 2LGYA 1Q5WB 2LXCA 2IO2B 4GXBA 4MH0E 1YX6B 2REXA 1WXVA 4WAAA 2V4LA 4TQ0A 4B9KA 4W9GA 3KUCB 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSQ B;  3ZNZ B;  1YJ1 A;  3SDL C;  2CHX A;  3W1S A;  2KD0 A;  2FNJ B;  4DK5 A;  2FCN A;  5G55 A;  5LXH A;  2CHW A;  3GOE A;  3WAO A;  3AU5 A;  4ASW C;  4AWJ A;  1L7Y A;  1KJT A;  2JRI B;  2LRU A;  2XEW A;  4GDL A;  2BKF A;  2DZM A;  4MGZ E;  1GG3 A;  3U8Z A;  2NBU A;  2NBW B;  2ASQ A;  2J0J A;  2JPH A;  1UGM A;  3ALB A;  3X23 A;  2DZJ A;  4W9D A;  3VAW A;  4FHK A;  1OTR B;  4MJS B;  4NAW B;  4DDG D;  5FR6 A;  1WRD B;  3AU4 A;  3DBL I;  5TR5 A;  2KC1 A;  4F8C B;  3UQB A;  2FID A;  4XZ4 A;  1UD7 A;  1EF1 A;  2HE7 A;  2MBB B;  4FA6 A;  5IA7 A;  4WQO B;  2LGD A;  2JZ3 B;  4CYE A;  2C60 A;  1FXT B;  3R66 C;  2DHZ A;  2K1F A;  3NZS A;  3HIZ A;  4F1S A;  3KH0 A;  2ZZP B;  4GOC A;  3IVF A;  2M8S A;  1WR1 A;  3WAM A;  3JSV A;  3ML9 A;  3L08 A;  3TJP A;  3RD2 A;  1IYF A;  2KDI A;  3DVN V;  4KZ0 A;  5DCN A;  1WY8 A;  1YX5 B;  2RD0 A;  4MM3 A;  1V80 A;  4IWQ A;  1Z2M A;  4IUM B;  4E74 A;  1E8Y A;  2A4Z A;  2DYB A;  3A4R A;  3M62 B;  3OLM D;  3OAW A;  4IC7 B;  4J6I A;  2N9X A;  1P9D U;  2IO0 B;  2NS5 A;  4AJY B;  2MBQ A;  5KHO A;  1V5O A;  2MLB A;  2FIF A;  2IZV B;  2RSU A;  1WGH A;  4KZC A;  3HK0 A;  3PHW B;  3U7D A;  4FAD A;  2JZZ A;  3IHP C;  2JT4 B;  2FCQ A;  1WX8 A;  4JQW C;  3VUY A;  3D32 A;  3VXW A;  1J19 A;  2JRH A;  5DPW A;  3QIJ A;  3QK0 A;  1CMX B;  4BKS D;  4EZK A;  4F7Z A;  4B6W A;  2Z59 B;  2DAJ A;  4ANU A;  2HTH A;  3APC A;  4W9L A;  4M0W B;  3DQV A;  2MWS B;  4LCD E;  3O65 B;  3UGB B;  2KHW B;  1UH6 A;  2JUO A;  3V6C B;  2KTR B;  4I6N B;  1S1Q B;  2GBR A;  4DWF A;  3KUZ A;  1WR6 E;  4HDO A;  4M8M A;  5J18 A;  2UYZ B;  3DVN U;  4LJP B;  1WJU A;  4EOY A;  3QAQ A;  1E7U A;  2LXA A;  4G3X B;  4XC2 A;  2VRR B;  2KMC A;  5JH5 C;  4W9J A;  3VUX A;  2YVC A;  2AL6 A;  4ZDV A;  3PZD A;  4EFO A;  3L13 A;  1IP9 A;  3ML8 A;  2N1V A;  1Z5S B;  5AEK B;  1X1M A;  4JGH B;  3KVF B;  4G0N B;  3ZTD A;  4PYZ A;  1IPG A;  4WJP A;  1XQQ A;  3QA8 A;  3HM6 X;  4JL9 A;  1WX7 A;  5CTR C;  4AUQ C;  1WIA A;  2D2Q A;  1E5W A;  3QQ8 B;  1EUV B;  3WA0 A;  1WJN A;  1NI2 A;  3B08 A;  2UWQ A;  1AAR A;  4E3C A;  3B1L X;  3L54 A;  4GN1 A;  2J0M A;  4B95 A;  1TGZ B;  4MDK E;  2DYO A;  1XD3 B;  3H7S A;  2XBB C;  4HWI B;  4YL8 A;  4KDL B;  2WYQ A;  4LJO B;  4M8N A;  4GU2 A;  2IY0 B;  1TZ1 A;  2MCN B;  4EEW A;  1NDD A;  2GBM A;  1EO6 A;  2KJ6 A;  2KOX A;  3KUD B;  4CHK A;  2G4D B;  1G6J A;  4KV2 A;  2KLC A;  5BO4 B;  3KW5 B;  3PVL A;  3IBE A;  2LUE A;  2KQS A;  4TQ1 A;  2K39 A;  2GOW A;  4WWP A;  2NVU I;  1E7V A;  3GZN I;  4GIV A;  1WM3 A;  2L7R A;  2MSE D;  4WWN A;  3VHT C;  1LQB A;  3M63 B;  3B0A A;  2DEN B;  2J7Q B;  2LGX A;  2ZPY A;  2L0F A;  3JYU A;  4K7W A;  4KSL C;  4ZRJ A;  2BWE S;  3X0W A;  3RUI B;  3JVZ X;  4HVB A;  4FHJ A;  4IWP A;  3M3J A;  4II3 B;  4IM2 A;  2CS4 A;  2KTR A;  3MHS D;  4GB9 A;  3ZLZ A;  3ZVV A;  3V61 A;  2K6D B;  2KDE B;  2KO3 A;  2MBH A;  3ECI A;  3LJ3 A;  4BKT A;  2L8J A;  5E6N A;  2N7E A;  1WZ3 A;  3DBS A;  5D7G A;  4MGY E;  4ZRI A;  5JZE B;  2ZCC A;  1V2Y A;  3DVG Y;  1EF5 A;  2LD9 A;  3QX1 A;  4G11 A;  5G2N A;  1ISN A;  3KYC D;  1F9J A;  4ANX A;  3C0R B;  4BOS C;  4ICV A;  3A9J B;  2O6V D;  5KHQ A;  2K8B A;  4FLH A;  1UEL A;  1QZE A;  3PSE B;  3VTU A;  2B3A A;  2L05 A;  3IG3 A;  3HM3 A;  4GDK A;  3OJ3 A;  1GUA B;  1Q1O A;  2WX0 A;  1WJ4 A;  1BT0 A;  1T0Y A;  3ZIM A;  2NR2 A;  3QHT A;  1J8C A;  2LZ6 A;  1D3Z A;  1K8R B;  1SE9 A;  3EHV A;  1PQS A;  1WGG A;  2RGF A;  3ZNH B;  2I1J A;  1WGY A;  1VCB A;  4BOZ B;  5LXI B;  4AP4 C;  1V6E A;  3ZTC A;  4NQK E;  2N1W A;  4BVU C;  3DVG X;  3VTW A;  2GBJ A;  3L17 A;  4DXA B;  3ZKJ C;  4HJK A;  1I42 A;  2M17 A;  4NY0 A;  4FJY A;  3I3T B;  5E6P A;  2ZPN A;  3APF A;  3Q3F A;  4GMV A;  3AI5 A;  5J17 A;  4IWO A;  3A1Q A;  4KDI C;  1KOT A;  3T9L A;  2N9P C;  1UBQ A;  4AJW A;  4XX5 A;  2CU1 A;  3N32 A;  4MJS A;  2BYV E;  2IO3 B;  3SHQ A;  1L2N A;  2BWF A;  2KKC A;  4IM0 A;  3V62 A;  3UIO B;  2O6V B;  4MEL A;  5L83 A;  1ZW7 A;  1RLF A;  4I6L B;  4JIO U;  5LLI A;  3PLV A;  2ZNV C;  1RRB A;  2DYM A;  1WI0 A;  4BBN F;  2DZI A;  3PRZ A;  1J0G A;  2EMT A;  3DCG A;  4HDQ A;  1RAX A;  4KSK C;  3RZW C;  3CMM B;  4RM8 A;  1UZX B;  2N9E B;  5E6O A;  4ANW A;  1H8C A;  4K1R B;  1SIF A;  2KVR A;  2YLM A;  4WJO A;  3DOW A;  2NCN A;  1WMH B;  1WXS A;  4URK A;  2K25 A;  2HJ8 A;  3AUL A;  4NAW A;  2MBO A;  1OGW A;  2EKE C;  4EZJ A;  4PS8 A;  2DAF A;  2KJR A;  2R2O A;  2WX1 A;  1LFD A;  4FBJ B;  2M0X A;  2L76 A;  3ZW3 A;  2GBK A;  2QHO A;  2BGF A;  2KQ7 A;  2O6V A;  3DDC B;  4DBG A;  1VD2 A;  4DHJ D;  3A9K B;  3DPD A;  1TBE A;  2G4S A;  1XT9 B;  2K6Q A;  2ZVN A;  2KK8 A;  1R4N I;  2KN5 A;  2PE9 A;  3A9J A;  2I1K A;  1M94 A;  1JRU A;  5J2R A;  3EEC A;  2KFK B;  2IY1 B;  3BY4 B;  4W9F A;  3VQI A;  2LVQ A;  4DDI D;  5CHV C;  2IBI B;  4N9F 4;  2MX2 A;  2Z0E B;  4KIK A;  1YQB A;  2D07 B;  1WH3 A;  1U4A A;  4I6P A;  3CSF A;  4EKU A;  2KXJ A;  3W1S C;  2HD5 B;  2Z0D B;  3A33 B;  5GMV A;  2EMS A;  2KAN A;  3QWZ B;  2BPS A;  4WWO A;  5HKH A;  3DBH I;  3PLU A;  3H7P B;  3KYD D;  1C3T A;  3VTV A;  3MTN B;  3ZNI D;  1GJZ A;  3PRP B;  2N4F A;  3T8M A;  2K8C A;  2FCS A;  2JWZ A;  3PHX B;  3A9K A;  3NHE B;  2KFJ A;  2D11 A;  5CHW A;  3Q3J A;  3UIP B;  3EC8 A;  1OEY A;  4NJ6 A;  2NBV B;  3ZNG C;  3H1U A;  4W9H A;  2XK5 A;  3OJ4 B;  1WFY A;  2CHZ A;  4BKS A;  3A1Q B;  2LJ5 A;  5DPR A;  2PJH A;  3CF6 E;  3WAL A;  1WE6 A;  3PPA A;  2D3G A;  3R3M A;  2KDB A;  4A20 A;  2KWC A;  1Q0W B;  4NPN A;  1E90 A;  1TTN A;  3NY5 A;  1WGD A;  2GMI C;  2KNB A;  3TIX A;  1KM7 A;  1V5T A;  2RPQ A;  3N30 A;  4ICU A;  3ZRF A;  2K8H A;  3PRM B;  4FJZ A;  5DPT A;  1R4M I;  4IM3 A;  1WYW B;  4NNJ B;  2L0T A;  5AZF A;  4EUT A;  1E8X A;  3VDZ A;  2BKR B;  2OOB B;  3H9D A;  2G45 B;  3P2B A;  3NOB A;  4IG7 B;  5JHA A;  5D94 A;  4HPM B;  2M1M A;  2KFK A;  2AWT A;  1RFA A;  1WM2 A;  3H6N A;  4FN2 A;  2KWV B;  2MW5 A;  4GDK B;  4PS3 A;  3NS8 A;  4TUU A;  3RCZ A;  4A3O A;  4LDT B;  4WJQ A;  3M95 A;  2JY6 A;  3V6E B;  3BIN A;  4JLC A;  4NJ7 A;  3IFW B;  2C7H A;  3ZRC A;  2A5U A;  3H7P A;  4RM9 A;  2ZEQ A;  3RZF A;  2L3Z A;  3ZDT A;  3EFU A;  3APD A;  2KX0 A;  1GNU A;  3MJW A;  2NPT B;  2M4N A;  2MP2 B;  4HXD A;  2ZNV B;  4WJN A;  2WWZ A;  2LRW A;  4ZYN A;  2N7D A;  3NZU A;  3R7R A;  4A3P A;  4GSW A;  5EDS A;  2KX3 A;  4ZRK A;  3AXC A;  2DX5 B;  5AZG A;  3L0W B;  4W9E A;  1WZ0 A;  1MG8 A;  2PEA A;  2KDF B;  4ANV A;  3TCA A;  1A5R A;  4HK2 A;  3PT2 B;  2AYO B;  5C23 A;  3VFK A;  2KTF A;  5CHF A;  2L00 B;  1P3Q U;  1WF9 A;  4MGK E;  3ENE A;  4OVV A;  2C5L C;  4IW0 A;  3U30 A;  2O2V A;  2IO1 B;  5AZH A;  1YD8 U;  3TMP B;  3A4S C;  4X57 B;  4W9C A;  5DPS A;  3UF8 A;  1LXD A;  2NPT A;  4BBN C;  3DBR I;  3VVW B;  1HE8 A;  3JSV B;  2MBE A;  4K7S A;  2KWU B;  3ZDM C;  3WAN A;  4FJV B;  4MSM B;  1OEY J;  3JW0 X;  3HHM A;  4TKN A;  2WDT B;  1P0R A;  3PGE A;  2FAZ A;  1C1Y B;  3W1Y A;  4MGI E;  4HPL B;  1P98 A;  4KVG B;  2IYD B;  4W9I A;  2JXX A;  1Y8R C;  3QJZ A;  4MEM A;  5D6J B;  4PS7 A;  4HCP B;  1H4R A;  1WGR A;  3R7Q A;  2MA9 B;  2Y5B B;  2ZVO A;  2KC2 A;  2DZK A;  1GC7 A;  2MQJ A;  1ZKH A;  4II2 B;  5C1Z A;  3L10 B;  5IAA C;  4K81 A;  3ZO5 B;  2LAS A;  2AL3 A;  2MP2 A;  2MRP A;  3N3K B;  2BF8 B;  4HLE A;  2AEH A;  1WXM A;  1ZGU B;  2RR9 A;  3L16 A;  3VUW A;  3SU8 X;  3K9O B;  2V3S A;  1S3S G;  1E8W A;  2CR5 A;  5JHB A;  1WMH A;  1E8Z A;  2OJR A;  4KIK B;  1V81 A;  3PV1 A;  2LVO A;  4FUL A;  3RUL A;  2GBN A;  2FCM A;  2R2Q A;  2KLG A;  3WIM A;  2PE6 B;  2D10 A;  4K7U A;  2BYE A;  2KJH B;  4TV3 A;  2LVP A;  2ZCB A;  2O2V B;  2W9N A;  2C7M B;  3PS6 A;  1I35 A;  3K9P B;  1GC6 A;  1LM8 B;  4LDT D;  4AOF A;  1SGH A;  1P1A A;  1WXA A;  4W9K A;  3PTF C;  3RYT A;  5L95 C;  4GDL B;  4P7I A;  4EZL A;  2V1Y A;  4G50 A;  2ZJD A;  3UIN B;  3LDZ E;  3ONS A;  2JVC A;  4HCN B;  3SD5 A;  1V9J A;  2KZR A;  4E71 A;  2CKH B;  4OVU A;  2C9W B;  3CST A;  1WE7 A;  1UBI A;  5CX3 A;  5D2M B;  3V60 A;  4DHZ E;  1WJ6 A;  1NBF C;  2C7N B;  3TBL D;  2G3Q B;  3RT3 B;  1KLV A;  4NQL B;  4BFR A;  2BYF A;  3PRE A;  3ZUN A;  2J0K A;  2LI5 A;  4CO7 A;  4BKG A;  3QC8 B;  2JF5 A;  4PYU A;  4GGQ A;  4RMA A;  4DHZ B;  1V86 A;  3QAR A;  4DHJ B;  1WX9 A;  2LWP A;  3UQA A;  2PPH A;  1OQY A;  3WAP A;  2KMA A;  1YIW A;  2FUH B;  3VH3 B;  3QCA A;  1V49 A;  2XK5 B;  3S2A A;  3VH4 B;  2LGY A;  1Q5W B;  2LXC A;  2IO2 B;  4GXB A;  4MH0 E;  1YX6 B;  2REX A;  1WXV A;  4WAA A;  2V4L A;  4TQ0 A;  4B9K A;  4W9G A;  3KUC B;  3TL5 A; 
#chains in the Genus database with same CATH topology
 3Q8C A;  1QOF A;  3GP7 A;  3N20 C;  2QIL A;  1MPE A;  2DLB A;  4ITK A;  2MJ3 A;  2FCN A;  5G55 A;  5LXH A;  2ACZ B;  4MAC A;  4PK1 A;  4AWJ A;  4GDL A;  1K53 A;  2BKF A;  2DZM A;  4M0W A;  3U8Z A;  2QCZ A;  3I63 C;  1QT9 A;  1GAQ B;  4W9D A;  1MJD A;  2KAJ A;  3AEB B;  3OWE B;  1Y56 A;  4DDG D;  1C79 A;  3FIL A;  1WRD B;  3DBL I;  3AN1 A;  4F8C B;  1UD7 A;  2LGD A;  1FXT B;  2QJL A;  2ZZP B;  4GOC A;  3EFC A;  3Q8B A;  3L08 A;  1YQ3 B;  2KDI A;  1N5W A;  3DVN V;  5DCN A;  1WY8 A;  1Q10 A;  1NYQ A;  2JYT A;  3OLM D;  1YNT E;  3C19 A;  2FBW B;  2RMM A;  1FO4 A;  3R8B A;  1UWM A;  2IZV B;  2MLB A;  2RSU A;  1V97 A;  3IHP C;  3D32 A;  3SFE B;  4BKS D;  4F7Z A;  1F77 A;  4UDU C;  4M0W B;  4LCD E;  2PW9 A;  2JUO A;  2J4X A;  2WXG A;  1F0Z A;  4DWF A;  4NJC A;  4M8M A;  1TKG A;  5J18 A;  3DWM A;  3EGR A;  2LXA A;  2VRR B;  4ACF A;  3VUX A;  2LGS A;  1PDX A;  1PYW D;  3Q3O C;  3ML8 A;  2N1V A;  1X1M A;  4PYZ A;  1YN4 A;  1XLP A;  2MEK A;  1ZDV A;  2BS4 B;  4KGS A;  1ZDX A;  2UWQ A;  1LGR A;  3L54 A;  3MFG A;  4KDL B;  1T5X D;  4M8N A;  1KLG D;  1K51 A;  2G4D B;  2WXH A;  3URY A;  2Y3A A;  1E6E B;  2LUE A;  2GOW A;  1E7V A;  3GZN I;  4GIV A;  3B0A A;  3X0W A;  3JYU A;  4ZRJ A;  4HVB A;  1SJE D;  1JWU D;  3N1Y C;  1UWX A;  2CS4 A;  2PKO A;  3RNE C;  3ZVV A;  3V61 A;  2K6D B;  1SEB D;  3N9Y C;  5E6N A;  2N7E A;  3EA6 A;  3RNG C;  2FUG 1;  2WLB A;  3QX1 A;  1ISN A;  4ANX A;  1MI0 A;  2K8B A;  1UEL A;  3PZ8 A;  2B3A A;  4O1N A;  1CQV A;  3RNB C;  2ZW0 A;  3HVZ A;  1VDV A;  4GDK A;  3OJ3 A;  1GUA B;  2JZP A;  2LUM A;  2JWU A;  2AQ2 B;  4MH8 A;  1BT0 A;  3ZIM A;  4REZ A;  1J8C A;  1VZ8 A;  2BBC A;  4BAX A;  4RGM A;  1OQQ A;  1WGG A;  3W9C B;  3NRZ A;  2I1J A;  1WGY A;  1ZXI A;  2INN E;  2D5G A;  4AP4 C;  1ESF A;  5GXG B;  3RN9 C;  2MJE A;  2N1W A;  3VTW A;  3L17 A;  1D5M C;  3BWU D;  4AS1 A;  3APF A;  3AI5 A;  3DHG C;  2WXO A;  1KOT A;  1YMH E;  4XX5 A;  4MJS A;  3MC0 B;  1L2N A;  4B0M A;  3V62 A;  3HUI A;  1ZW7 A;  1RLF A;  4I6L B;  4JIO U;  1T0R C;  3TEY A;  1WI0 A;  1QQR A;  3DCG A;  4HDQ A;  5BMH A;  2WXI A;  1ZXH A;  4RCO A;  2KT7 A;  4KSK C;  2ONQ A;  3KQ4 A;  1UZX B;  4K1R B;  3RNA C;  4C7Z A;  4JE3 B;  2QDF A;  4N6E B;  4DBG A;  1QKZ A;  4DHJ D;  3DPD A;  4HRS A;  3RZW C;  2ZVN A;  1R4N I;  3A9J A;  2PE9 A;  4US8 A;  5J2R A;  4A6Q A;  1XLO A;  4A55 A;  2IY1 B;  3BY4 B;  4DDI D;  5CHV C;  1TYG B;  2IBI B;  2Z0E B;  4KIK A;  3BVZ A;  1FRR A;  4EKU A;  4HPP A;  3GE8 C;  5C3J B;  2HD5 B;  5GMV A;  2EMS A;  3PLU A;  3H7P B;  2VZK B;  3ZNI D;  3U7Z A;  2K8C A;  1HQR D;  3Q3M C;  5CHW A;  3UIP B;  5JXV A;  2EKI A;  4W9H A;  1IBX A;  3Q2A C;  3AED B;  1D4B A;  1SJH D;  3U2S C;  3PPA A;  1FD6 A;  4HJG E;  2KDB A;  4A20 A;  1TTN A;  5TSS A;  1T0S C;  1KM7 A;  2PTL A;  2RPQ A;  4WH4 A;  5BYQ A;  4FJZ A;  4XE0 A;  2BKR B;  2MJD A;  3NOB A;  4IG7 B;  3H6N A;  3W5V B;  1XCT L;  3Q69 A;  1C9F A;  4A3O A;  2JY6 A;  2BB5 A;  4NJ7 A;  3IFW B;  2C7H A;  1HEZ E;  2L32 A;  1EM7 A;  2D3A A;  3RZF A;  3APD A;  1GNU A;  1WWT A;  1ROE A;  2LRW A;  3DBL B;  2FE8 A;  3WCQ A;  1MG8 A;  1FNV A;  2D3B A;  1A5R A;  4ZRQ A;  2AYO B;  5CHF A;  4MGK E;  3ENE A;  3U30 A;  1JWB D;  3A4S C;  2J42 A;  3O13 A;  1EWC A;  4YTM B;  1LXD A;  3AE4 B;  3DBR I;  3VVW B;  1AWD A;  3ZDM C;  1DOI A;  3NG0 A;  1NYR A;  2L83 A;  3I57 A;  4TKN A;  2WDT B;  2WS3 B;  3MC9 A;  1P0R A;  3PGE A;  1C1Y B;  1DOX A;  3W1Y A;  1NEK B;  4HPL B;  3DWG C;  5FK9 C;  2JXX A;  1Y8R C;  4DXF A;  4PS7 A;  2MHJ A;  2WXQ A;  1SE4 A;  2KC2 A;  1C77 A;  2MQJ A;  1R4M B;  4CQN A;  5IAA C;  3ZO5 B;  3N3K B;  3ZJU A;  4RGN A;  1WXM A;  1LO5 D;  2V3S A;  1E8W A;  2OJR A;  1AYF A;  2LVO A;  1V1O A;  3AEF B;  1E7P B;  2KLG A;  2CU3 A;  3WIM A;  2D10 A;  4K7U A;  2BYE A;  2KJH B;  3BZD B;  2ZCB A;  2O2V B;  5HFY A;  2JQR B;  4LDT D;  1SGH A;  1P1A A;  1WXA A;  4W9K A;  2IJ0 A;  3VR9 B;  3RYT A;  2JSV X;  2V1Y A;  2ZJD A;  3UIN B;  3P4S B;  3ONS A;  4E71 A;  3PO0 A;  4OVU A;  1WE7 A;  2W3R A;  1R7S A;  3TBL D;  3EUB 2;  1L0Y B;  4Q2J A;  2G3Q B;  4BFR A;  3GZN B;  2J0K A;  4PYU A;  3I9V 1;  1WX9 A;  4C56 C;  2FUH B;  2XK5 B;  3S2A A;  3VH4 B;  2LXC A;  2IO2 B;  4GXB A;  4MH0 E;  1YX6 B;  1WXV A;  1JW9 D;  4WAA A;  2V4L A;  4W9G A;  3KUC B;  3ZNZ B;  1YJ1 A;  2J53 A;  2SEB D;  1DYQ A;  4KKJ A;  3MJ5 A;  1VR9 A;  3WAO A;  4OHJ A;  1B1Z A;  3AU5 A;  4RGO S;  2XEW A;  1HA5 A;  4NZL B;  1I4Q A;  1KRH A;  2J0J A;  4US9 A;  3U52 E;  1UGM A;  3IT6 B;  4L23 A;  1L4Z B;  2WQY B;  2LGI A;  2K3U A;  4MJS B;  4NAW B;  5FR6 A;  3P4P B;  1FNU A;  3RNF C;  1IUE A;  3UQB A;  4XZ4 A;  2HE7 A;  2MBB B;  2JZ3 B;  3R66 C;  1TS3 A;  4QAY A;  3KH0 A;  3IVF A;  1WR1 A;  2VZK D;  3JSV A;  3LYY A;  3ML9 A;  3RD2 A;  1IYF A;  1C78 A;  1ZOY B;  4A90 A;  4MM3 A;  4IWQ A;  1DGJ A;  4IUM B;  2BS2 B;  2DYB A;  4IC7 B;  3OAW A;  1FFU A;  1P9D U;  2IO0 B;  4AJY B;  4KZC A;  2PIA A;  3PHW B;  2IGG A;  2JZZ A;  2QEJ C;  1J7C A;  4RF1 A;  1WX8 A;  3ZXR A;  1I4R A;  5BMI A;  4LNN A;  4B6W A;  3AE7 B;  4ANU A;  3Q8F A;  4YTN B;  1JQ4 A;  1UH6 A;  1FXA A;  2GBR A;  2LEK A;  2WP9 B;  1WR6 E;  3KUZ A;  2KDM A;  3V3X A;  1WJU A;  4EOY A;  4MT5 A;  1SIJ A;  2KMC A;  2AL6 A;  3PZD A;  3L13 A;  1IP9 A;  1ET9 A;  1Z5S B;  4JGH B;  2QMT A;  3MHZ A;  4IOI E;  1WX7 A;  1E5W A;  3QQ8 B;  1AAR A;  1E10 A;  3B1L X;  4GN1 A;  2J0M A;  1FNW A;  2WHI A;  3H7S A;  4YL8 A;  2WYQ A;  3C8Y A;  3Q14 C;  4C4V B;  1RYJ A;  2GBM A;  3KUD B;  1XO3 A;  1SE2 A;  2KLC A;  5BO4 B;  2I38 A;  3GE3 C;  4WUR A;  2NVU I;  1WM3 A;  2L7R A;  1QOA A;  4WWN A;  1LQB A;  2J7Q B;  4FHJ A;  4IWP A;  3M3J A;  4IM2 A;  2K5P A;  2L52 A;  3L4P A;  1J7A A;  2KDE B;  2KO3 A;  2VH2 A;  3VRB B;  2AX5 A;  4BKT A;  3DBS A;  5D7G A;  5JZE B;  4MGY E;  2ZCC A;  4FXC A;  4BOS C;  4ICV A;  3A9J B;  5KHQ A;  4FLH A;  1F2R C;  2KMM A;  2ICI A;  1Q1O A;  2WX0 A;  3MC8 A;  2KYW A;  1V1P A;  1D3Z A;  1SE9 A;  3W5U B;  1PQS A;  4KGT A;  2RGF A;  1F2R I;  1V6E A;  4NQK E;  3BK1 A;  3ZKJ C;  4NY0 A;  2V4I B;  3I3T B;  5E6P A;  2ZPN A;  3Q3F A;  4AJW A;  1RFK A;  3DBR B;  2BWF A;  4MEL A;  3PLV A;  4BBN F;  3PRZ A;  1J0G A;  1TKE A;  4XWT A;  2DWQ A;  1ZE3 D;  2WU5 B;  1JWM D;  1SIF A;  2KWD A;  2NCN A;  1WMH B;  1WXS A;  5C2T B;  3RNC C;  2MH7 A;  2BT6 A;  4EZJ A;  2EKE C;  4PS8 A;  2PVG C;  1LFD A;  1V1P B;  2M0X A;  2QHO A;  2KQ7 A;  3DDC B;  1SE3 A;  1VJK A;  1TBE A;  4C7Y A;  2K6Q A;  1NVI D;  2I1K A;  1M94 A;  2Q5W D;  1WSP A;  1YN3 A;  3TEX A;  3U4E G;  3VQI A;  5EE0 A;  1XF5 L;  4KKI A;  1WH3 A;  4I6P A;  1KH0 A;  2KXJ A;  1TKY A;  2BPS A;  4WWO A;  3DBH I;  1C3T A;  3VTV A;  5IKC M;  3A9K A;  3AH7 A;  3EC8 A;  4NJ6 A;  3ZNG C;  1K52 A;  2XK5 A;  3AE9 B;  1QLB B;  2SAK A;  4N58 A;  2HJ1 A;  3A1Q B;  3CF6 E;  4ARI A;  2WNM A;  3Q8E A;  1V5T A;  4ICU A;  3PRM B;  5DPT A;  2L0T A;  2R61 A;  5AZF A;  4EUT A;  1E8X A;  2G45 B;  1IGD A;  5FKA C;  3ABV B;  3P2B A;  5JHA A;  5D94 A;  1F52 A;  2M1M A;  2AWT A;  2CJO A;  4RF0 A;  1PGA A;  1WM2 A;  4FN2 A;  4RFB A;  1WGK A;  2MW5 A;  4YXD B;  2IDY A;  3RCZ A;  3Q3N C;  3DBH B;  4JLC A;  1L4D B;  3ZRC A;  3ZGZ A;  2ZEQ A;  4ZHP A;  3EFU A;  2K0P A;  2TSS A;  2MP2 B;  3P4Q B;  4HXD A;  2HDE A;  3BII D;  2ZNV B;  3BVM A;  5EDS A;  4A3P A;  2DBY A;  4ZRK A;  3AXC A;  1WYG A;  4W9E A;  4YSZ B;  5IOI A;  3VFK A;  2L00 B;  4OVV A;  3BK2 A;  2O2V A;  3TEW A;  5AZH A;  3ZYY X;  4X57 B;  4W9C A;  5DPS A;  3FC4 A;  1HE8 A;  2MBE A;  2V3P A;  2KWU B;  1BML C;  1ZUD 2;  2V0G A;  1EWY C;  2KAC A;  3IAM 1;  1FMA D;  2FAZ A;  1P98 A;  4KVG B;  2OHF A;  4MEM A;  3HRD D;  4OZB A;  3AE1 B;  2MA9 B;  2ZVO A;  1KTK A;  2VH1 A;  1TZO A;  1YOV B;  2WXR A;  5LNK 1;  2LAS A;  2AL3 A;  2MP2 A;  3R2I A;  5HG2 A;  4HLE A;  2RR9 A;  3VRA B;  2N0S B;  1V81 A;  4AQ7 A;  2PE6 B;  3KLS X;  5EE1 A;  2LVP A;  4BZA A;  1GC6 A;  4OVZ A;  3PZ7 A;  1I4G A;  4HEA 1;  3V05 A;  4IKG A;  2PLP A;  2RDG A;  4C00 A;  2KZR A;  4LNO A;  1C4C A;  5I4D A;  1UBI A;  5CX3 A;  1WJ6 A;  3RT3 B;  1KLV A;  3ZUN A;  3QC8 B;  2JF5 A;  2PMV A;  3N1X C;  4GGQ A;  4DHZ B;  1I7H A;  1E0Z A;  2DNF A;  3QAR A;  2LWP A;  3N1Z C;  2OED A;  3UQA A;  1OQY A;  3WAP A;  1V49 A;  1VZ6 A;  2LGY A;  5BYR A;  3H8H A;  1FIQ A;  5EE3 A;  4B9K A;  5E6J A;  4XDD A;  1N63 A;  1EU3 A;  1IGC A;  1L6V A;  4MSQ B;  3SDL C;  3W1S A;  2KVZ A;  1MVK A;  2KD0 A;  2FNJ B;  4DK5 A;  4GLS C;  5FR3 A;  1L7Y A;  2JRI B;  2LRU A;  3P63 A;  2NTT A;  2NBU A;  2ASQ A;  1GB1 A;  3X23 A;  2DZJ A;  1ZPS A;  4FHK A;  1OTR B;  1FRD A;  3AU4 A;  5TR5 A;  2FID A;  4RGT A;  2WU2 B;  4FA6 A;  1T0Q C;  2C60 A;  2K1F A;  3NZS A;  5MPO A;  1XEE A;  3AE6 B;  3TJP A;  1I4H A;  2RD0 A;  3FAH A;  2I2Y A;  1E8Y A;  2A4Z A;  3M62 B;  4J6I A;  1UGJ A;  2N9X A;  1CZP A;  4HKQ A;  1V5O A;  2FIF A;  4S0R A;  1WGH A;  1FFV A;  1TY0 A;  3HK0 A;  3U7D A;  4FAD A;  2JT4 B;  1JRP A;  3VUY A;  5DPW A;  3QIJ A;  3QK0 A;  4EZK A;  2Z59 B;  2WXJ A;  2HTH A;  3DQV A;  2MWS B;  5H92 C;  3AM9 A;  3O65 B;  3RFZ B;  3UGB B;  2IGH A;  2KHW B;  3V6C B;  3UI3 A;  3Q6B A;  4A9A A;  1S1Q B;  1ENF A;  3DVN U;  4ARC A;  4G3X B;  2YVC A;  4EFO A;  2NMQ A;  1TT5 B;  1QOB A;  4G0N B;  1IPG A;  4WJP A;  1XQQ A;  3QA8 A;  3HM6 X;  4JL9 A;  4AUQ C;  1RWS A;  2D2Q A;  1EUV B;  1WJN A;  3B08 A;  4E3C A;  1XD3 B;  4ZYS A;  3TSS A;  5T8I A;  4GU2 A;  4R3D A;  1TZ1 A;  4L1B A;  4EEW A;  2KOX A;  2KJ6 A;  3TEZ A;  1G6J A;  4KV2 A;  3CIR B;  1OFF A;  3CWI A;  5HHD G;  4WWP A;  1IBX B;  1SSN A;  4OZC A;  3VHT C;  3M63 B;  2ZPY A;  4M01 A;  2BWE S;  1NEN B;  2OJW A;  3JVZ X;  1HZ6 A;  3MHS D;  3NVW A;  3LJ3 A;  1C4A A;  1K50 A;  2L8J A;  1WZ3 A;  4ZRI A;  3DVG Y;  4DXG A;  1GPX A;  2LD9 A;  4G11 A;  4LNF A;  5G2N A;  1FPY A;  2O6V D;  1C76 A;  1QZE A;  5H8Y E;  1TJE A;  2WXF A;  4LNK A;  3IG3 A;  3SR6 A;  3I5J C;  2Y5C A;  3AB5 A;  3HM3 A;  4P1C C;  4YTP B;  2IPK D;  4P16 A;  2NR2 A;  2LZ6 A;  1K8R B;  2WXK A;  1VCB A;  2X38 A;  4XWW A;  3Q8A A;  4BOZ B;  5LXI B;  3ZTC A;  4OW0 A;  4BVU C;  3DVG X;  2Y5P A;  2D3C A;  1R4N B;  3GS2 A;  1I42 A;  2M17 A;  3GB1 A;  4M00 A;  3TUO A;  4GMV A;  5J17 A;  2E3T A;  4IWO A;  3A1Q A;  3T9L A;  2BVC A;  4RNA A;  2KN4 A;  4A8X C;  2J52 A;  4IM0 A;  5L83 A;  1YJI A;  3B2F A;  2ZNV C;  1RRB A;  3AE8 B;  1E9M A;  2EMT A;  2XNA C;  2HTM E;  2WDQ B;  1B9R A;  1PGB A;  1RAX A;  2QSD A;  3NZ3 A;  3CMM B;  4RM8 A;  2N9E B;  5E6O A;  1H8C A;  2YLM A;  4WJO A;  3DOW A;  2BS3 B;  4URK A;  2K25 A;  2HJ8 A;  3AUL A;  1OGW A;  3FIL B;  2KJR A;  2R2O A;  2LFI A;  4FBJ B;  2L76 A;  3ZW3 A;  2K22 A;  2BGF A;  2O6V A;  3A9K B;  1SF0 A;  1JRU A;  1AW7 A;  2KFK B;  2B76 B;  2CJN A;  1UNS A;  4N9F 4;  2MX2 A;  2RPV A;  1U4A A;  1SBB B;  3CSF A;  3W1S C;  2Z0D B;  3J9C A;  2KAN A;  3QWZ B;  3OG5 A;  1GJZ A;  2FCS A;  3NHE B;  2KFJ A;  3NVV A;  3H1U A;  1WFY A;  2CHZ A;  4BKS A;  3ETR A;  1WE6 A;  1FM0 D;  3T3N A;  4J3O D;  1Q0W B;  4NPN A;  1E90 A;  1WGD A;  1YN5 A;  2GMI C;  2KNB A;  1CK1 A;  2K8H A;  1R4M I;  4IM3 A;  1WYW B;  4NNJ B;  1JWA D;  2OOB B;  3H9D A;  3E56 A;  4D2K A;  3DHH C;  3IXS A;  2KFK A;  4JWU C;  4YSX B;  1RFA A;  4MM3 B;  2KWV B;  1HTQ A;  4GDK B;  1YQ4 B;  4TUU A;  4LDT B;  4RH6 A;  3M95 A;  4WJQ A;  2NTS A;  1FEH A;  3KWL A;  3P42 A;  2L3Z A;  3MJW A;  2M4N A;  4WJN A;  2JXT A;  4ZYN A;  2LMC A;  2N7D A;  3B9J A;  3NZU A;  1PFD A;  4GSW A;  3R7R A;  4EE2 A;  2KX3 A;  3B2G A;  3L0W B;  2KDF B;  4WIP A;  4ANV A;  1YJJ A;  4HK2 A;  1NI3 A;  2YEP B;  2GI9 A;  1WF9 A;  2WGS A;  4P6V F;  1MG4 A;  2C5L C;  1VLB A;  3NJT A;  4XYC A;  4IW0 A;  1ACC A;  2IO1 B;  1YD8 U;  1D6E C;  3TMP B;  3UF8 A;  4BBN C;  2NPT A;  3JSV B;  2V9H A;  4FJV B;  4MSM B;  1F1H A;  2Z8L A;  2GRI A;  3HHM A;  2INP E;  1J7B A;  3VR8 B;  2IYD B;  4W9I A;  5D6J B;  2RDH A;  1BUI C;  1H4R A;  2WXM A;  1FCL A;  2KQ4 X;  1GC7 A;  4II2 B;  3L10 B;  2MRP A;  1HZ5 A;  2BF8 B;  2QC8 A;  5AUI A;  3SU8 X;  3K9O B;  1S3S G;  4N59 A;  1WMH A;  4KIK B;  4FUL A;  1N61 A;  3RUL A;  2GBN A;  2R2Q A;  1UUP A;  1VRA B;  2W9N A;  1LM8 B;  1TS5 A;  5IP4 D;  4AOF A;  3PTF C;  2L1A A;  4P7I A;  3AEC B;  4S17 A;  4G50 A;  3FKY A;  2BW2 A;  4K3B A;  4HCN B;  1V9J A;  1QOG A;  2BYT A;  3NS1 A;  2CKH B;  4HKZ E;  2C9W B;  5D2M B;  4DHZ E;  2C7N B;  4LTU A;  3R2T A;  4C4V A;  2BYF A;  4B0E A;  4CO7 A;  4BKG A;  1P7F A;  4M02 A;  2N9L A;  2M56 B;  1V86 A;  4DHJ B;  2H89 B;  2PPH A;  1YIW A;  3E9S A;  1KF6 B;  1Q5W B;  1L0X B;  1GOZ A;  3ZJT A;  1HTO A;  3TL5 A;  3RMK C;  2CHX A;  1A70 A;  5D3D A;  2CHW A;  1TIF A;  3GOE A;  4ASW C;  3AEE B;  1KJT A;  4TMA B;  4MGZ E;  3T3O A;  1GG3 A;  4XGA B;  3P4R B;  1EU4 A;  2NBW B;  1TS4 A;  2JPH A;  1MHH E;  3ALB A;  1WXQ A;  3VAW A;  3ZQ4 A;  4KGR A;  2KC1 A;  1EF1 A;  5IA7 A;  4WQO B;  4CYE A;  2DHZ A;  3HIZ A;  4F1S A;  3WAM A;  2M8S A;  2JU6 X;  4P1B C;  4KZ0 A;  1L6U A;  1YX5 B;  1V80 A;  4TSS A;  1Z2M A;  2JYE A;  4E74 A;  3A4R A;  4H2A A;  2NS5 A;  2MBQ A;  5KHO A;  2GLS A;  1JCK B;  1HXY D;  1ZP0 B;  2BB6 A;  1STE A;  3VXW A;  1I4P A;  2FCQ A;  1N6Z A;  4JQW C;  1J19 A;  2JRH A;  1CMX B;  1ET6 A;  2DAJ A;  2ZW1 A;  3APC A;  4W9L A;  4JX1 C;  1T6B X;  1JAL A;  2KTR B;  1L5P A;  4I6N B;  4HDO A;  2UYZ B;  4LJP B;  3QAQ A;  1E7U A;  4XC2 A;  5JH5 C;  4W9J A;  4LK0 M;  3ZJV A;  4ZDV A;  1FCC C;  1MFW A;  5AEK B;  3KVF B;  3AE5 B;  4IDI A;  3ZTD A;  5G5H A;  2LJI A;  1DOY A;  5CTR C;  1WIA A;  3WA0 A;  1T3Q A;  1OQR A;  1I4X A;  1NI2 A;  4B95 A;  1TGZ B;  4MDK E;  1TS2 A;  2DYO A;  2XBB C;  4HWI B;  4NAM A;  2QIE B;  4LJO B;  1PGX A;  2IY0 B;  4ZHO A;  1V8C A;  2MCN B;  1NDD A;  1EO6 A;  3BVG A;  4CHK A;  3KW5 B;  3PVL A;  2N9K A;  3IBE A;  2KQS A;  4TQ1 A;  2K39 A;  5HI1 A;  1XXG A;  2IND C;  2MSE D;  1QF6 A;  2H88 B;  3LXF A;  2DEN B;  2LGX A;  4K7W A;  4KSL C;  2L0F A;  3SEB A;  3KWV A;  3RUI B;  4II3 B;  2KTR A;  4GB9 A;  3ZLZ A;  1C4P A;  2MBH A;  3ECI A;  1V2Y A;  1EF5 A;  1RM6 C;  3KYC D;  1JML A;  1F9J A;  3C0R B;  4HRO A;  3NUH B;  3PSE B;  3VTU A;  2EEL A;  2L05 A;  2WXN A;  4WWM A;  1WJ4 A;  1T0Y A;  3QHT A;  2E6X A;  2LHE A;  3EHV A;  5IN7 A;  3ZNH B;  1AN8 A;  4WAF A;  5G5G A;  3DHI C;  4KX6 B;  2GBJ A;  3HVD A;  4DXA B;  4HJK A;  4FJY A;  1XCQ L;  4KDI C;  2N9P C;  1UBQ A;  3RPF C;  2CU1 A;  3N32 A;  2WDR B;  2BYV E;  2IO3 B;  3SHQ A;  4OZA A;  1XLQ A;  2KKC A;  2W54 A;  3UIO B;  2O6V B;  5LLI A;  2BTE A;  2W3S A;  2DYM A;  4ZRP A;  2DZI A;  3AE2 B;  3AV8 A;  1FXI A;  4ANW A;  2KVR A;  2AQ3 B;  1JRO A;  1VZ7 A;  1CJE A;  2JX5 A;  4ZOH C;  4NAW A;  2MBO A;  2DAF A;  2WX1 A;  1UF0 A;  2GBK A;  1VD2 A;  4JPS A;  2G4S A;  1XT9 B;  2KK8 A;  2KN5 A;  3EEC A;  4W9F A;  2LVQ A;  3AEG B;  1YQB A;  3IAS 1;  2D07 B;  3SFD B;  2W82 A;  1MHX A;  3A33 B;  2ON8 A;  3RI7 C;  2YEP F;  5HKH A;  2WDV B;  4YWG G;  3KYD D;  3MTN B;  3PRP B;  2N4F A;  3T8M A;  4DQO C;  3AMZ A;  3PHX B;  2JWZ A;  2D11 A;  3Q3J A;  1OEY A;  2NBV B;  2K9X A;  3OJ4 B;  2LJ5 A;  5DPR A;  2PJH A;  2UU7 A;  2G9H D;  3WAL A;  4K3C A;  2D3G A;  3R3M A;  1PUT A;  2KWC A;  1SXT A;  3NY5 A;  2N7J A;  3TIX A;  2AQ1 B;  3N30 A;  2WXL A;  3ZRF A;  3VDZ A;  4HPM B;  2M0A A;  4PS3 A;  3NS8 A;  2X8X X;  4USA A;  3V6E B;  3BIN A;  1TY2 A;  5BYS A;  2A5U A;  3H7P A;  4RM9 A;  4L2Y A;  3ZDT A;  2KX0 A;  2PVO D;  2NPT B;  5EE9 A;  2W55 A;  3LB8 C;  4WQM A;  1XLN A;  1N62 A;  1WRI A;  2WWZ A;  3BYY B;  4JWS C;  2G1E A;  1N60 A;  2DX5 B;  5AZG A;  1WZ0 A;  5D3I B;  2PEA A;  4C80 A;  3TCA A;  4YSY B;  3PT2 B;  5C23 A;  2KTF A;  1M4V A;  4LNI A;  1P3Q U;  4PT5 A;  2LHD A;  1KFY B;  1N5X A;  2RDB C;  1P7E A;  3MP9 A;  1SB3 C;  1KLU D;  4K7S A;  3WAN A;  2BQQ A;  1OEY J;  3JW0 X;  2V3N A;  1D5Z C;  5BMG A;  4MGI E;  1QIL A;  3ZXV A;  3P1M A;  3QJZ A;  4HCP B;  1WGR A;  3R7Q A;  2Y5B B;  2DZK A;  1ZKH A;  3NVY A;  5C1Z A;  3AE3 B;  4K81 A;  2AEH A;  4XDC A;  1ZGU B;  3L16 A;  3VUW A;  2CR5 A;  5JHB A;  1E8Z A;  3PV1 A;  2FCM A;  1JWS D;  4TV3 A;  2M19 A;  2C7M B;  3PS6 A;  1BXT A;  1I35 A;  3K9P B;  3AEA B;  4YT0 B;  4LLG M;  5L95 C;  3IT4 B;  3BYT B;  4GDL B;  4EZL A;  3W2D A;  3LDZ E;  2WXP A;  5AUK A;  2JVC A;  3SD5 A;  1GB4 A;  3CST A;  3V60 A;  1NBF C;  2GB1 A;  4NQL B;  3PRE A;  2LI5 A;  2IGD A;  4RMA A;  2XN9 C;  2KMA A;  3VH3 B;  3QCA A;  5IO9 A;  1L0V B;  2INC C;  3NVZ A;  2REX A;  1D5X C;  4TQ0 A; 
#chains in the Genus database with same CATH homology
 4MSQ B;  3ZNZ B;  1YJ1 A;  3SDL C;  2CHX A;  3W1S A;  2KD0 A;  2FNJ B;  4DK5 A;  2FCN A;  5G55 A;  5LXH A;  2CHW A;  3GOE A;  3WAO A;  3AU5 A;  4ASW C;  4AWJ A;  1L7Y A;  1KJT A;  2JRI B;  2LRU A;  2XEW A;  4GDL A;  2BKF A;  2DZM A;  4MGZ E;  1GG3 A;  3U8Z A;  2NBU A;  2NBW B;  2ASQ A;  2J0J A;  2JPH A;  1UGM A;  3ALB A;  3X23 A;  2DZJ A;  4W9D A;  3VAW A;  4FHK A;  1OTR B;  4MJS B;  4NAW B;  4DDG D;  5FR6 A;  1WRD B;  3AU4 A;  3DBL I;  5TR5 A;  2KC1 A;  4F8C B;  3UQB A;  2FID A;  4XZ4 A;  1UD7 A;  1EF1 A;  2HE7 A;  2MBB B;  4FA6 A;  5IA7 A;  4WQO B;  2LGD A;  2JZ3 B;  4CYE A;  2C60 A;  1FXT B;  3R66 C;  2DHZ A;  2K1F A;  3NZS A;  3HIZ A;  4F1S A;  3KH0 A;  2ZZP B;  4GOC A;  3IVF A;  2M8S A;  1WR1 A;  3WAM A;  3JSV A;  3ML9 A;  3L08 A;  3TJP A;  3RD2 A;  1IYF A;  2KDI A;  3DVN V;  4KZ0 A;  5DCN A;  1WY8 A;  1YX5 B;  2RD0 A;  4MM3 A;  1V80 A;  4IWQ A;  1Z2M A;  4IUM B;  4E74 A;  1E8Y A;  2A4Z A;  2DYB A;  3A4R A;  3M62 B;  3OLM D;  3OAW A;  4IC7 B;  4J6I A;  2N9X A;  1P9D U;  2IO0 B;  2NS5 A;  4AJY B;  2MBQ A;  5KHO A;  1V5O A;  2MLB A;  2FIF A;  2IZV B;  2RSU A;  1WGH A;  4KZC A;  3HK0 A;  3PHW B;  3U7D A;  4FAD A;  2JZZ A;  3IHP C;  2JT4 B;  2FCQ A;  1WX8 A;  4JQW C;  3VUY A;  3D32 A;  3VXW A;  1J19 A;  2JRH A;  5DPW A;  3QIJ A;  3QK0 A;  1CMX B;  4BKS D;  4EZK A;  4F7Z A;  4B6W A;  2Z59 B;  2DAJ A;  4ANU A;  2HTH A;  3APC A;  4W9L A;  4M0W B;  3DQV A;  2MWS B;  4LCD E;  3O65 B;  3UGB B;  2KHW B;  1UH6 A;  2JUO A;  3V6C B;  2KTR B;  4I6N B;  1S1Q B;  2GBR A;  4DWF A;  3KUZ A;  1WR6 E;  4HDO A;  4M8M A;  5J18 A;  2UYZ B;  3DVN U;  4LJP B;  1WJU A;  4EOY A;  3QAQ A;  1E7U A;  2LXA A;  4G3X B;  4XC2 A;  2VRR B;  2KMC A;  5JH5 C;  4W9J A;  3VUX A;  2YVC A;  2AL6 A;  4ZDV A;  3PZD A;  4EFO A;  3L13 A;  1IP9 A;  3ML8 A;  2N1V A;  1Z5S B;  5AEK B;  1X1M A;  4JGH B;  3KVF B;  4G0N B;  3ZTD A;  4PYZ A;  1IPG A;  4WJP A;  1XQQ A;  3QA8 A;  3HM6 X;  4JL9 A;  1WX7 A;  5CTR C;  4AUQ C;  1WIA A;  2D2Q A;  1E5W A;  3QQ8 B;  1EUV B;  3WA0 A;  1WJN A;  1NI2 A;  3B08 A;  2UWQ A;  1AAR A;  4E3C A;  3B1L X;  3L54 A;  4GN1 A;  2J0M A;  4B95 A;  1TGZ B;  4MDK E;  2DYO A;  1XD3 B;  3H7S A;  2XBB C;  4HWI B;  4YL8 A;  4KDL B;  2WYQ A;  4LJO B;  4M8N A;  4GU2 A;  2IY0 B;  1TZ1 A;  2MCN B;  4EEW A;  1NDD A;  2GBM A;  1EO6 A;  2KJ6 A;  2KOX A;  3KUD B;  4CHK A;  2G4D B;  1G6J A;  4KV2 A;  2KLC A;  5BO4 B;  3KW5 B;  3PVL A;  3IBE A;  2LUE A;  2KQS A;  4TQ1 A;  2K39 A;  2GOW A;  4WWP A;  2NVU I;  1E7V A;  3GZN I;  4GIV A;  1WM3 A;  2L7R A;  2MSE D;  4WWN A;  3VHT C;  1LQB A;  3M63 B;  3B0A A;  2DEN B;  2J7Q B;  2LGX A;  2ZPY A;  2L0F A;  3JYU A;  4K7W A;  4KSL C;  4ZRJ A;  2BWE S;  3X0W A;  3RUI B;  3JVZ X;  4HVB A;  4FHJ A;  4IWP A;  3M3J A;  4II3 B;  4IM2 A;  2CS4 A;  2KTR A;  3MHS D;  4GB9 A;  3ZLZ A;  3ZVV A;  3V61 A;  2K6D B;  2KDE B;  2KO3 A;  2MBH A;  3ECI A;  3LJ3 A;  4BKT A;  2L8J A;  5E6N A;  2N7E A;  1WZ3 A;  3DBS A;  5D7G A;  4MGY E;  4ZRI A;  5JZE B;  2ZCC A;  1V2Y A;  3DVG Y;  1EF5 A;  2LD9 A;  3QX1 A;  4G11 A;  5G2N A;  1ISN A;  3KYC D;  1F9J A;  4ANX A;  3C0R B;  4BOS C;  4ICV A;  3A9J B;  2O6V D;  5KHQ A;  2K8B A;  4FLH A;  1UEL A;  1QZE A;  3PSE B;  3VTU A;  2B3A A;  2L05 A;  3IG3 A;  3HM3 A;  4GDK A;  3OJ3 A;  1GUA B;  1Q1O A;  2WX0 A;  1WJ4 A;  1BT0 A;  1T0Y A;  3ZIM A;  2NR2 A;  3QHT A;  1J8C A;  2LZ6 A;  1D3Z A;  1K8R B;  1SE9 A;  3EHV A;  1PQS A;  1WGG A;  2RGF A;  3ZNH B;  2I1J A;  1WGY A;  1VCB A;  4BOZ B;  5LXI B;  4AP4 C;  1V6E A;  3ZTC A;  4NQK E;  2N1W A;  4BVU C;  3DVG X;  3VTW A;  2GBJ A;  3L17 A;  4DXA B;  3ZKJ C;  4HJK A;  1I42 A;  2M17 A;  4NY0 A;  4FJY A;  3I3T B;  5E6P A;  2ZPN A;  3APF A;  3Q3F A;  4GMV A;  3AI5 A;  5J17 A;  4IWO A;  3A1Q A;  4KDI C;  1KOT A;  3T9L A;  2N9P C;  1UBQ A;  4AJW A;  4XX5 A;  2CU1 A;  3N32 A;  4MJS A;  2BYV E;  2IO3 B;  3SHQ A;  1L2N A;  2BWF A;  2KKC A;  4IM0 A;  3V62 A;  3UIO B;  2O6V B;  4MEL A;  5L83 A;  1ZW7 A;  1RLF A;  4I6L B;  4JIO U;  5LLI A;  3PLV A;  2ZNV C;  1RRB A;  2DYM A;  1WI0 A;  4BBN F;  2DZI A;  3PRZ A;  1J0G A;  2EMT A;  3DCG A;  4HDQ A;  1RAX A;  4KSK C;  3RZW C;  3CMM B;  4RM8 A;  1UZX B;  2N9E B;  5E6O A;  4ANW A;  1H8C A;  4K1R B;  1SIF A;  2KVR A;  2YLM A;  4WJO A;  3DOW A;  2NCN A;  1WMH B;  1WXS A;  4URK A;  2K25 A;  2HJ8 A;  3AUL A;  4NAW A;  2MBO A;  1OGW A;  2EKE C;  4EZJ A;  4PS8 A;  2DAF A;  2KJR A;  2R2O A;  2WX1 A;  1LFD A;  4FBJ B;  2M0X A;  2L76 A;  3ZW3 A;  2GBK A;  2QHO A;  2BGF A;  2KQ7 A;  2O6V A;  3DDC B;  4DBG A;  1VD2 A;  4DHJ D;  3A9K B;  3DPD A;  1TBE A;  2G4S A;  1XT9 B;  2K6Q A;  2ZVN A;  2KK8 A;  1R4N I;  2KN5 A;  2PE9 A;  3A9J A;  2I1K A;  1M94 A;  1JRU A;  5J2R A;  3EEC A;  2KFK B;  2IY1 B;  3BY4 B;  4W9F A;  3VQI A;  2LVQ A;  4DDI D;  5CHV C;  2IBI B;  4N9F 4;  2MX2 A;  2Z0E B;  4KIK A;  1YQB A;  2D07 B;  1WH3 A;  1U4A A;  4I6P A;  3CSF A;  4EKU A;  2KXJ A;  3W1S C;  2HD5 B;  2Z0D B;  3A33 B;  5GMV A;  2EMS A;  2KAN A;  3QWZ B;  2BPS A;  4WWO A;  5HKH A;  3DBH I;  3PLU A;  3H7P B;  3KYD D;  1C3T A;  3VTV A;  3MTN B;  3ZNI D;  1GJZ A;  3PRP B;  2N4F A;  3T8M A;  2K8C A;  2FCS A;  2JWZ A;  3PHX B;  3A9K A;  3NHE B;  2KFJ A;  2D11 A;  5CHW A;  3Q3J A;  3UIP B;  3EC8 A;  1OEY A;  4NJ6 A;  2NBV B;  3ZNG C;  3H1U A;  4W9H A;  2XK5 A;  3OJ4 B;  1WFY A;  2CHZ A;  4BKS A;  3A1Q B;  2LJ5 A;  5DPR A;  2PJH A;  3CF6 E;  3WAL A;  1WE6 A;  3PPA A;  2D3G A;  3R3M A;  2KDB A;  4A20 A;  2KWC A;  1Q0W B;  4NPN A;  1E90 A;  1TTN A;  3NY5 A;  1WGD A;  2GMI C;  2KNB A;  3TIX A;  1KM7 A;  1V5T A;  2RPQ A;  3N30 A;  4ICU A;  3ZRF A;  2K8H A;  3PRM B;  4FJZ A;  5DPT A;  1R4M I;  4IM3 A;  1WYW B;  4NNJ B;  2L0T A;  5AZF A;  4EUT A;  1E8X A;  3VDZ A;  2BKR B;  2OOB B;  3H9D A;  2G45 B;  3P2B A;  3NOB A;  4IG7 B;  5JHA A;  5D94 A;  4HPM B;  2M1M A;  2KFK A;  2AWT A;  1RFA A;  1WM2 A;  3H6N A;  4FN2 A;  2KWV B;  2MW5 A;  4GDK B;  4PS3 A;  3NS8 A;  4TUU A;  3RCZ A;  4A3O A;  4LDT B;  4WJQ A;  3M95 A;  2JY6 A;  3V6E B;  3BIN A;  4JLC A;  4NJ7 A;  3IFW B;  2C7H A;  3ZRC A;  2A5U A;  3H7P A;  4RM9 A;  2ZEQ A;  3RZF A;  2L3Z A;  3ZDT A;  3EFU A;  3APD A;  2KX0 A;  1GNU A;  3MJW A;  2NPT B;  2M4N A;  2MP2 B;  4HXD A;  2ZNV B;  4WJN A;  2WWZ A;  2LRW A;  4ZYN A;  2N7D A;  3NZU A;  3R7R A;  4A3P A;  4GSW A;  5EDS A;  2KX3 A;  4ZRK A;  3AXC A;  2DX5 B;  5AZG A;  3L0W B;  4W9E A;  1WZ0 A;  1MG8 A;  2PEA A;  2KDF B;  4ANV A;  3TCA A;  1A5R A;  4HK2 A;  3PT2 B;  2AYO B;  5C23 A;  3VFK A;  2KTF A;  5CHF A;  2L00 B;  1P3Q U;  1WF9 A;  4MGK E;  3ENE A;  4OVV A;  2C5L C;  4IW0 A;  3U30 A;  2O2V A;  2IO1 B;  5AZH A;  1YD8 U;  3TMP B;  3A4S C;  4X57 B;  4W9C A;  5DPS A;  3UF8 A;  1LXD A;  2NPT A;  4BBN C;  3DBR I;  3VVW B;  1HE8 A;  3JSV B;  2MBE A;  4K7S A;  2KWU B;  3ZDM C;  3WAN A;  4FJV B;  4MSM B;  1OEY J;  3JW0 X;  3HHM A;  4TKN A;  2WDT B;  1P0R A;  3PGE A;  2FAZ A;  1C1Y B;  3W1Y A;  4MGI E;  4HPL B;  1P98 A;  4KVG B;  2IYD B;  4W9I A;  2JXX A;  1Y8R C;  3QJZ A;  4MEM A;  5D6J B;  4PS7 A;  4HCP B;  1H4R A;  1WGR A;  3R7Q A;  2MA9 B;  2Y5B B;  2ZVO A;  2KC2 A;  2DZK A;  1GC7 A;  2MQJ A;  1ZKH A;  4II2 B;  5C1Z A;  3L10 B;  5IAA C;  4K81 A;  3ZO5 B;  2LAS A;  2AL3 A;  2MP2 A;  2MRP A;  3N3K B;  2BF8 B;  4HLE A;  2AEH A;  1WXM A;  1ZGU B;  2RR9 A;  3L16 A;  3VUW A;  3SU8 X;  3K9O B;  2V3S A;  1S3S G;  1E8W A;  2CR5 A;  5JHB A;  1WMH A;  1E8Z A;  2OJR A;  4KIK B;  1V81 A;  3PV1 A;  2LVO A;  4FUL A;  3RUL A;  2GBN A;  2FCM A;  2R2Q A;  2KLG A;  3WIM A;  2PE6 B;  2D10 A;  4K7U A;  2BYE A;  2KJH B;  4TV3 A;  2LVP A;  2ZCB A;  2O2V B;  2W9N A;  2C7M B;  3PS6 A;  1I35 A;  3K9P B;  1GC6 A;  1LM8 B;  4LDT D;  4AOF A;  1SGH A;  1P1A A;  1WXA A;  4W9K A;  3PTF C;  3RYT A;  5L95 C;  4GDL B;  4P7I A;  4EZL A;  2V1Y A;  4G50 A;  2ZJD A;  3UIN B;  3LDZ E;  3ONS A;  2JVC A;  4HCN B;  3SD5 A;  1V9J A;  2KZR A;  4E71 A;  2CKH B;  4OVU A;  2C9W B;  3CST A;  1WE7 A;  1UBI A;  5CX3 A;  5D2M B;  3V60 A;  4DHZ E;  1WJ6 A;  1NBF C;  2C7N B;  3TBL D;  2G3Q B;  3RT3 B;  1KLV A;  4NQL B;  4BFR A;  2BYF A;  3PRE A;  3ZUN A;  2J0K A;  2LI5 A;  4CO7 A;  4BKG A;  3QC8 B;  2JF5 A;  4PYU A;  4GGQ A;  4RMA A;  4DHZ B;  1V86 A;  3QAR A;  4DHJ B;  1WX9 A;  2LWP A;  3UQA A;  2PPH A;  1OQY A;  3WAP A;  2KMA A;  1YIW A;  2FUH B;  3VH3 B;  3QCA A;  1V49 A;  2XK5 B;  3S2A A;  3VH4 B;  2LGY A;  1Q5W B;  2LXC A;  2IO2 B;  4GXB A;  4MH0 E;  1YX6 B;  2REX A;  1WXV A;  4WAA A;  2V4L A;  4TQ0 A;  4B9K A;  4W9G A;  3KUC B;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...