4BKPA

Crystal structure of human gdp-l-fucose synthase with bound nadp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
324
Chain Sequence
DLGTENLYFQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GDP-L-FUCOSE SYNTHASE
total genus 104
structure length 324
sequence length 324
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bkpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4bkpA02
1QYWA 1R4MA 3MTGA 2Q45A 3QY9A 2AA3A 4WCFA 4CV2A 1DAOA 4YAIA 1N1GA 3DL2A 4CMIB 3DOOA 1NR1A 2HJSA 3JTMA 1WPQA 4BUCA 9LDBA 2CF5A 3BHIA 4LW8A 3Q1LA 2X5JO 5EQDA 1UP7A 5G0TA 4UEOA 1M67A 1NTOA 1VL0A 3BHMA 3LC7O 4E3ZA 2V65A 4QUKA 3V2HA 4F45A 3I4FA 4MVJM 4Q39A 1WDKA 3W6ZA 2VOEA 4NMHA 4EJ6A 4PLFA 8ADHA 3MJEA 4IIUA 1Z73A 2IE0A 4PLVA 4G65A 1VPDA 1M75A 3VPXA 1P0FA 1GZ4A 2JAHA 4RZIA 1DXYA 3E5RA 4G5HA 3QWAA 3KXDA 4MO2A 2D4AA 4M55A 2C59A 2YW9A 4PLGA 3A28A 4HWKA 2PKQO 3GDFA 2P9EA 3H9QA 4BNUA 4E5PA 3OEWA 4BKOA 2NUAA 3DZGA 4GWKA 5JE8A 4PIVA 1YDWA 1Y8QA 4UVEA 3HN7A 4ND3A 1AHIA 1R66A 4YVFA 4ALJA 2VWQA 1LUAA 4GH5A 4KZPA 4OGWA 4PZEA 1KVSA 4KMSA 3PYMA 3EK2A 5COQA 4YT5A 1SB8A 3QLJA 4J0EA 5CFZA 3F6YA 2AEMA 4ND4A 4C4OA 1ZCJA 2XAAA 2BRUA 2EW8A 2GO1A 2FSSA 3OQ6A 3QQPA 5FYDA 4IZHA 4JN6B 5G4KB 5COAA 5BNTA 1E0DA 2VT2A 1ADCA 5C3MA 1YL7A 3AY6A 2JKVA 3NRCA 3MOGA 1KVUA 1OBFO 2VTDA 4GGPA 1ENPA 3BMNB 3KVOA 3L6OO 4BO3A 1ZUD1 1HSZA 4CV3A 3JQ8B 2H5LA 2ZTMA 4KUEA 2HCTA 4YJHA 4A2CA 5TF4A 1Y8RB 1K3TA 1OC4A 3ZHZA 1VKOA 3OJLA 4ZQBA 4J43A 3L4BA 3OQBA 1PZFA 1GR0A 3ANNA 2B0JA 1E3SA 1C0IA 1U8FO 2H1SA 4Z9YA 2V6BA 1I10A 1PJBA 3RU9A 4HADA 4YB8A 3WOHA 3KYDB 4CQMD 4DIFA 3PJGA 3WQSB 1FDVA 5H81A 1ISJA 4DREA 1LQTA 2FR8A 1B3BA 2HUNA 4INAA 1GTMA 1YOVB 4OYRA 3DZFA 1G0NA 1U1IA 2X9NA 3PZRA 4Y9DA 4FFLA 4LISA 4XGNA 5A06A 1PIWA 1GFSA 1E5QA 4B7XA 1DJNA 2ZB4A 3RI3A 4ZU3A 4CM8B 3LQFA 3G79A 4QO8A 3BHJA 1BW9A 3DOJA 3P2OA 2RIRA 4IDCA 2HO5A 1CDOA 3JD3A 2P91A 3D4OA 4MOWA 1GCUA 4ITUA 5B37A 3WG9A 4C7JA 2HJRA 1VC2A 1BHSA 3PGXA 1V6AA 4MVJI 1HF3A 2JFFA 3F4LA 3F46A 4OM8A 4JBIA 4MVJF 4ZICA 2DBVO 1ZK1A 3BMCA 3EAGA 5J23A 3ROKA 1P1IA 3IIEA 2Y66A 2VTEA 2QRJA 3O8QA 3WICA 5IZ4A 4Z9XA 2X0NA 4DQUA 5ICSA 1HDRA 4PLTA 4BQRA 1U4OA 3B1KA 1NVMB 1I2CA 1UAGA 3HQ4O 3WGQA 5L4NA 2A9FA 1MLDA 1VKNA 4WKGA 3H2ZA 1JN0A 4CM6A 3HG7A 5CDGA 1PJSA 3W4JA 1BGVA 1LI4A 1MXFA 1EZ4A 1Z45A 4BIIA 3GEGA 4GSKA 2AHRA 4ZD6A 2UVDA 1QG6A 2AEJA 1YRLA 3D7LA 3TL3A 4CV0A 5I8WA 5CPFA 3ZWPA 2OBNA 3PHGA 3JD2A 1DIRA 4O0LA 4E2ZA 4D46A 3ADOA 4NK5A 3A4VA 1HE4A 4L74A 2EGHA 1QKIA 3K2EA 2Q50A 3TN7A 5C37A 2DBRA 4NJMA 4CQLB 3C7DB 3ZWOA 3SXPA 2YYYA 3B6ZA 1EQ2A 4E5YA 2EJWA 1NQAO 1T4BA 3EGOA 5L40A 1DFIA 2NNLD 3DXFA 4H7PA 1TT7A 3MJTA 1U8XX 1O95A 1QYCA 2X8LA 4QFCA 2FZWA 3DAGA 3STHA 1HDOA 1IHYA 1YL6A 2HMSA 2O3UA 4GAEA 1QXSA 3O9ZA 4RPLA 4TRRA 1GPDG 1WDMA 3K9QO 4BNNA 1RKXA 2BI7A 1PR9A 3ZWMA 1A27A 4I5FA 4GX1A 4LSWA 4BO6A 5ENVA 1GY8A 3RUIA 3Q6IA 2O7QA 3I9LA 1GDHA 4MIEA 4XJTA 1LXCA 2O48X 1YB4A 5L4LA 3D4PA 4OQYA 1DIAA 2B5VA 3H7AA 3X2EA 5JDIC 3DTTA 1XLTA 2PZMA 1KBZA 4D0SA 3CTMA 2IZZA 4NJMB 4CQLA 3AUAA 5IDXA 5DBGA 2IYOA 4KUGA 4QX6A 3ZV3A 3Q11A 1T2FA 4DMLA 5IXSA 2QRLA 1O94A 1SEVA 3P5SA 1JTVA 3ZWCA 4HP8A 3PHJA 1ULUA 2QYSA 4UREA 4P38A 4D43A 4WLVA 1Q7CA 3GUCA 3I9JA 2Q46A 1F14A 3F5QA 4MVJE 3UAGA 3ADPA 4R1UA 2CY0A 2UV8A 3DZJA 5ILOA 3BMOB 3GEMA 4EGFA 2B37A 5JDCC 3TPCA 3GGOA 2IODA 1RYEA 2X9VA 4A03A 2QG4A 5ES3A 2VCYA 1D8AA 4XB1A 4K9DA 4QEDA 1XQ6A 5FI3A 3LC2O 4RJTA 4HV4A 1Q2XA 2IEBA 2SCUA 3RUDA 1CWUA 1HE3A 1IPEA 3KYCB 1AXEA 1Y9AA 3CINA 5ENDA 3BZUA 5MGBA 2GR9A 4NZ9A 2JAPA 5DOZA 1QSGA 2NM0A 3Q9NA 3QWIA 4RQUA 5ILGA 5C5IA 4NHEA 3GUYA 1JW9B 3ZNOA 1K5HA 4EEZA 2LDXA 4JIGA 4XIYA 2J3JA 1F8FA 5TSDA 3D3WB 1Y5MA 1GQQA 2JFHA 3GHHA 5AOVA 4BO8A 4M1QA 1LLUA 1JVBA 3C8MA 4TZTA 3DFUA 1TLTA 1QLHA 1B16A 2VYND 1Q7GA 1IOLA 1WAMA 4HFMA 4JJGA 5A9SA 2OP1A 4IQ8A 3H9UA 2HLPA 4J4TA 2ZYAA 4CMKA 3LK7A 4E33A 3PI7A 5BSHA 5CG1A 3U4DA 2I6TA 3EDMA 4WASA 3ROPA 1O9BA 4IGEA 4RO0A 4O1MA 4EJ0A 2YZ7A 3RJ9A 3PIIA 2NSDA 3FN4A 4NFYA 5G2OA 5KIAA 3U4IA 2EP5A 1W73A 3HDQA 4JBHA 2E49A 3QHAA 5GZ6A 4AJEA 2O2SA 3HJAA 3WYCA 4RZHA 1K2WA 1G1AA 1LA2A 3CZRA 3ULKA 1DBVO 4MKRA 2WDZA 5BSEA 3ZNPA 4FFPA 1AHHA 1DB3A 4Z3DA 3VH4A 5L51A 1ZJYA 1O6ZA 2VYNA 4YAEA 4RPJA 3CE6A 3ZZNA 3MJ4A 4I1IA 4XB2A 2C5EA 4YJGB 4E32A 3BTVA 4WLFA 1B14A 1LC3A 5MDHA 4YJDA 1BVUA 3AI2A 1NWCA 1U3UA 2V6FA 1DSSG 1D4FA 1YH3A 3ZV4A 3BIOA 2RAFA 5A3JA 3COSA 1JAXA 3PPIA 3OM9A 4I5GA 4AJJA 4XEHA 2A4KA 4R1SA 3UH1A 1E7SA 2YY7A 3M1LA 3GNQA 3GRPA 5JY1A 2C07A 5JNLA 3PLRA 4J9UE 2Q4EA 2EIHA 3HE3A 4R9RA 4QO7A 1LDGA 3GZNA 4YCAA 1OMOA 2FY8A 3T4XA 1C0PA 1UUFA 3LC1O 4ZGWA 3D5QA 3DR3A 4PG6A 2RHRA 1KOLA 4WOKA 4B4UA 4A27A 2AXQA 4RF5A 4J4BA 5ER9A 4BNFA 2B69A 1I3LA 4KTTE 2Q2VA 2DUUA 2OHXA 1FDUA 2FR0A 1CETA 2DTEA 4PVDA 4CL3A 3EMKA 1P45A 1O89A 2XF8A 4CV1A 3G1UA 1RM0A 1R37A 3JYQA 3PYXA 3ZN2A 1H5QA 1DLJA 3D4NA 3W4KA 3H4VA 4BO5A 4N54A 1ZEMA 1DRVA 3ZV6A 4DXHA 4TZKA 2W98A 2Z5LA 3KB6A 3D3WA 5FI5A 2X22A 4CUZA 4R69A 4UUMA 3TZQA 4FJ0A 3GN2A 4YT2A 2LDBA 3KSUA 3AWDA 3F4BA 2NU9A 5JDCA 2WM3A 1ZXLA 3DZBA 3RASA 1EE2A 3AU8A 2J5KA 1KC3A 4PZCA 3M2PA 4GSLA 1Q0QA 4RDHA 4E2XA 3U5TA 1HE5A 2I76A 3UVEA 3S8MA 1HTBA 3GFGA 5I8ZA 3RU7A 2BFMA 1UXKA 2W4QA 2NLOA 2BKAA 4CUJA 4F3YA 3HB5X 5IDWA 3OA0A 4CQMA 3I9MA 5ITVA 4EYEA 1R12A 4J1TA 1LDEA 2ZQYA 3PQDA 1CRWG 2Y1DA 3H2SA 5IZCA 1PQWA 2EEZA 2VYVD 2V6GA 1HRDA 4PLCA 2VZ0A 1P3DA 2WYVA 1NHWA 4YT8A 2DKNA 4Y8VA 3ZGYA 4CR6A 1KS9A 4FD3A 1PR3A 3AU9A 1KVTA 1T2AA 2OGUA 3Q0EA 3JSAA 4OMUA 4P4GA 2AMFA 3RSHA 1H2HA 3AUSA 4XYMA 2R6JA 3MWEB 3K30A 3PHHA 2DAPA 3GFBA 4NBRA 4Z6KA 2HAEA 1KYQA 2DPGA 1KEUA 4R1NA 1N1EA 2FR1A 1MUUA 3KO8A 3KV3O 2JL1A 5KVSA 3ZWVA 3GMDA 2C29D 2JHFA 3QWFA 4JXKA 1I3KA 3GNTA 4CLRA 4BNTA 1N7GA 3FRJA 1MFPA 3SVTA 1V3UA 2J5RA 2O3RA 4DLBA 1TB4A 4P22A 4CLOB 2VRCD 2O3JA 1RM3A 3KM0A 3L0DA 1H2BA 3S55A 3LT0A 1GEEA 1HE2A 1EVYA 3K2BA 5I7EA 1DC5A 1ZSNA 1LSUA 3HZZA 1IY8A 1H93A 2DLDA 1NVGA 2ZIZA 1EBUA 5JPIA 1PS8A 2GNAA 3GAFA 3U0BA 1B3RA 4OSOA 1UR5A 4AJIA 2DT5A 5DBIA 2PD4A 1XDWA 5CEFA 5T57A 4GWGA 4OKIA 1ZNQO 4WJZA 3VDRA 1JA9A 3GG9A 3MWDB 4IMPA 1LDBA 1HYEA 3WYEA 1YWGO 3E8XA 4J6FA 1XCBA 2YQ5A 3FNEA 4PGFA 3UF0A 1UH5A 4LGVA 1HL3A 4MDHA 3WSWA 3ITDA 3NDJA 4W82A 5F1KA 3ZWXA 2JHGA 3BTSA 4QFDA 4YQYA 4YR9A 2Q2WA 3F1LA 4BV8A 2C7VA 1BVRA 5F3RA 4KQWA 2Y0DA 4N5MA 4HXYA 1EFLA 4WNIA 2Y1CA 2Y1FA 5L7TA 5EERA 6ADHA 1EK5A 1W0CA 3FBGA 4ILKA 1BSVA 4AJHA 5DZSA 4E5MA 3ORFA 4WEOA 2GZ2A 2D0IA 2RBEA 4TRJA 3QRWA 3RAJA 1B8PA 2GLXA 3SC6A 4XCVA 1EQUA 1RM4A 4TKLA 1CIVA 3ETEA 1QV6A 4EZBA 3EY4A 3OICA 4CLDA 3EW7A 4RF4A 5HS4A 4R01A 3HUDA 3I3OA 1DHRA 2VNSA 2NTJA 1EMDA 1MXHA 3ITKA 1Y8RA 1YS4A 4AICA 4YBZA 3NT4A 3DC2A 2P9CA 1B8VA 1PWZA 1I3NA 4IDAA 3WLEA 3DHNA 5G0SA 3HFGA 4J3FA 1WLYA 1B26A 4OQZA 5DCUA 4NIMA 1I2BA 1LBEA 3NGXA 4A0SA 3JQAD 4P4NA 1GZ6A 1JLLA 3NTQA 4KTVE 4YJFA 1NHGA 4XWYA 4GPD1 5HWSA 1ENYA 3TL2A 4QQRA 4CM1A 4RVSA 1GUYA 2D5AA 1KY5A 2ZYGA 3KZVA 3A9WA 4FQ8A 2NVWA 3L9XA 3OSUA 2YV1A 3KBOA 5I7VA 3N58A 1Y81A 1NAIA 3LSYA 1R15A 4BB5A 1U7HA 4GVXA 5JCXA 3RBVA 4D0RA 2CMDA 4B3IA 2J3KA 2QYTA 4ZVVA 2WYUA 2PK3A 3F5SA 3ZV5A 2PR2A 2R00C 1J4AA 5AQ1A 2PZLA 1BTOA 2W2LD 2VZ8A 2CVOA 3RC2A 3L07A 1X0XA 5JSFA 2FRDA 3MOIA 2YFHA 3TZCA 4R68A 4WK6A 4W9NC 5L4SA 3NEPX 2Q49A 1E5LA 1MGOA 2QHXA 4J7UA 4TWRA 1P1HA 3WYBA 1CEQA 1NWHA 1A4UA 1LQUA 1EVIA 1HYHA 1PJ4A 4UAGA 4PRLA 3W8DA 4WNCA 1NQOA 1HYGA 1A7KA 3BXXA 2ET6A 3I4CA 4YQZA 4M86A 3UCFA 4CM8A 4D41A 3QVSA 1WWKA 2GZ1A 1BW9B 4DYVA 4J9VA 3JQ7A 2PLAA 3PQEA 1X15A 3VDQA 3KUXA 3WGGA 2W2LA 3VHRA 3I5MA 3HSKA 3ICCA 4BMNA 1DC6A 4K28A 4CMBA 5FEUA 1PGJA 4CLHA 4FW8A 4E12A 5JMWA 3DQPA 4OH1A 4EJMA 1U3VA 2HRBA 5BNFA 5BSFA 3WNQA 5K0ZA 3QVWA 5CPBA 4Z0HO 2ZB7A 2C7GA 2G1UA 3JYOA 2Y93A 3S2IA 3EUWA 5A5FA 4WGGA 3IKTA 1EUDA 4NI5A 1PWXA 1Y6JA 3PZBA 7ADHA 5L7YA 5EPOA 3QWBA 5TGDA 2NVUB 4CODB 3FR8A 3OBBA 4K6FA 4Y67A 1E7WA 3QWHA 3C7AA 4UUPA 4CLXA 3W1VA 3S2FA 4E13A 4TRMA 5KNLA 1NASA 4GX2A 1JU9A 3NUGA 4MP8A 1RM5A 4RVGA 1JKJA 3H5RA 3NT2A 4KDFA 3GC6A 1J49A 1PJ3A 2Q1UA 3HWRA 4UVGA 3DBLB 1C1DB 3ZWYA 4WOJA 3I23A 1QYVA 2X1HA 3R3SA 3L6DA 2OOSA 4CLOA 4DQVA 3C24A 4HKTA 2PKRA 3U4CA 3GY0A 4Y6SA 4Y6PA 4IJKA 3JQGB 5TT0A 1V3VA 3IUPA 2OMEA 1LDYA 5A5EA 3I9NA 2GF2A 3H9JA 4QXMA 1EFKA 4QSMA 3EHEA 2XXJA 4EW6A 3KEQA 1XIVA 1Z75A 2G76A 4CM9D 1RWBA 1ISMA 4JJIA 3RC9A 1IULA 4FOSA 1I32A 1I24A 4XJSA 3RKRA 2WYWA 1OAAA 2VN8A 1V9LA 1R16A 7MDHA 5FF9A 1LEHA 1FF9A 1NP3A 3SX2A 5CHEA 4J2HA 1UXIA 4IGFA 4NPCA 4DTIA 2EERA 1YO6A 1VI2A 5JC8A 3DHYA 2VWHA 3DZIA 1I2ZA 1V0JA 1DPGA 4PLPA 4PRKA 5A3VA 5I9LA 3LDHA 4R4JA 3ZWNA 3VH2A 1PZHA 4MKXA 1EBFA 2CVZA 3BYZA 5EL0A 4RLSA 4Q3DA 4DPLA 5TRTA 1N9GA 3WSVA 3AM4A 1LX6A 3SJ7A 4IIVA 4EBFA 2E48A 5TIIA 3EVTA 2XOXA 2RHCA 5L3ZA 1E1LA 4ROSA 2O50A 1DDOA 1M2WA 2DPHA 3U49A 1U4SA 5A05A 1P31A 1E3LA 1R4NA 2UUOA 1XKQA 3IDSA 2QIOA 3ZNQA 4YJHB 4CJXA 4E6PA 2I65A 1L1FA 5L95A 3H8VA 4NBVA 5H82A 3FNGA 2Y99A 3ETGA 3WJ7A 4ZQHA 1XEAA 3B1FA 1TVEA 3GHYA 3MCVA 1ADFA 3PGJA 1WW8A 2Y1GA 1A7AA 2Y0EA 1ZZEA 3ZW8A 4XQ9A 3DBHA 2VHWA 4MKZA 4CMJA 3G3EA 3PDUA 1P1RA 3AFNA 1NPYA 2HMTA 4HUJA 4WECA 4B7UA 3FBTA 1ENOA 2BF7A 5JS6A 4LK3A 3FHLA 1EVJA 2O3TA 2DU8A 4DIOA 3OJEA 3IKVA 2PA3A 3AUUA 4AG3A 3UXYA 3NKLA 3UKOA 3E18A 3SJUA 2HKIA 3H9GA 3V1YA 3QIVA 4RQTA 2NV6A 5L7WA 2QW8A 4NQZA 5KCZA 1ZK2A 2X9GA 4WCDA 1PU2A 1ISGA 3ENKA 1L7EA 2W2KA 4CQMB 1SO8A 2PZKA 1QP8A 4J16A 2AQ8A 3BTOA 4DGSA 1A5ZA 3INTA 4XQEA 5A03A 3WFJA 1QV7A 2FPGA 1NYTA 3JQFA 3ZH2A 1VSUA 3IP3A 4TVOA 3CMCO 1F12A 2J5QA 1YBAA 3DMTC 3OHSX 4DBVO 4LVCA 3GRKA 4OXYA 4GLLA 1LTHR 3DBRA 4ZN6A 2PGDA 3ONFA 3GVCA 4NFSA 1GCOA 2OBYA 1SAYA 2Q99A 3GZ4A 4CMEA 4JLWA 1D1TA 4D42A 4BV9A 2EJVA 2ZCVA 3WIEA 2PGLA 4DC1A 2EGGA 4U5QA 1LSOA 3DZKA 2C2YA 4GX0A 1C1XA 1YQGA 4A26A 1HKUA 4R51A 3QJ5A 4IQ0A 1E6UA 4L4XA 4PLHA 2Q1SA 2QZ9A 3PP8A 3FNFA 4KWIA 1Q1NA 2GN8A 3GMSA 3FPCA 4O6VA 3H5AA 2WJPA 1VL6A 4AJKA 3TJRA 2AQIA 3FTPA 1HDXA 2ZTLA 4Z0PA 2EG9A 4GKBA 3HDYA 1FDWA 1ZK0A 2VRCA 2Q2QA 3OF2A 3DBRB 3RUFA 3UN1A 3ZI0A 5GZ1A 4XYBA 1N92A 4RF2A 2HK7A 3GPDG 2B4RO 4K6CA 2JFGA 4OHUA 2DVMA 3DBVO 2HDHA 3ANLA 1EUZA 1E6EA 4IDDA 1NBOA 1XELA 5JCJA 3RKUA 1E7YA 4Q9NA 3T7EA 2H6EA 3JQBC 2Y05A 5HM8A 1GADO 3UHAA 5AYVA 2BFAA 3INGA 3WTCA 2GN6A 4ND5A 3PRJA 1KVRA 3MJCA 3NDRA 1C3VA 1JVSA 4RL6A 1J5PA 5F1OA 1XU7A 4BMVA 4JBGA 2FHSA 3N74A 2P4HX 4Z0TA 1XHLA 2BGMA 3K96A 4LMRA 1JDJA 4OXNA 1IB6A 1P1FA 3F9IA 4XRRA 2F00A 2AE1A 3SLGA 3DTYA 2J3IA 2NU8A 1DOHA 2BGLA 4FFOA 1VLLA 4Q3CA 5G4LA 3MEQA 1HZJA 4GX5A 4ALKA 3PK0A 4E5NA 4IDFA 3VKUA 3KETA 2F1KA 1ZO8A 4P4LA 1X7GA 2PV7A 3OIDA 2HK9A 2AEFA 3KRTA 2X0JA 1PJQA 1DHTA 3HN2A 1W8DA 3O03A 2QQ5A 4AFNA 5U9CA 4EDFA 1NFRA 3ROQA 3WTBA 2X5KO 3WWZA 2YV2A 3H9EO 1EDZA 1ISHA 1LNQA 3I6QA 3KHUA 5TC4A 4YDRA 5K6AC 2EP7A 1ENZA 2YUTA 5IDYA 5CEJA 4NH4A 3RC1A 4Q3EA 1DAPA 1VSVA 2Z1MA 1M6WA 2P5UA 4M89A 3T7CA 1YJ8A 4E2YA 4B79A 5COBA 4IPTA 4PLZA 4YAKA 2GPTA 3OEYA 3SLKA 4BO1A 3HHPA 2BGKA 2D2IA 5KJ6A 4L4RA 4BO7A 4J7CA 3G0OA 4YACA 4H3VA 2GGSA 4MJLA 4OAQA 4GMGA 3G1TA 2I3GA 1GU7A 5KJFA 4R3NA 1EK6A 4D45A 3UCEA 2O3QA 2BH9A 1FDTA 3KLMX 3S2EA 3K6JA 2R00A 4O59O 1ULSA 2B35A 4U0KA 4I08A 5IZCC 3E48A 4WCFB 1P74A 1HLPA 4B7CA 3O4RA 4CR7A 4IXWA 2OORA 5F5LA 5TJ9A 5JY6A 3X2FA 1YBMA 2I5PO 2JCYA 5IFLA 3ZWBA 4YAJA 3EC7A 4X54A 1HXHA 2E37A 4CM5A 4E4YA 1ZEJA 1E3WB 3VOSA 3WDSA 1I01A 2VUUA 3RFVA 3QV1A 2A92A 3B1JA 1CF2O 4HFRA 1Z7BA 1HSOA 3R3JA 1SMKA 3NTRA 5ADHA 4B4VA 3WGOA 3ANMA 4ZRNA 2O2YA 4RVFA 3SBOA 1S6YA 5A4DA 1C1DA 5KKAA 5K6AA 1GV1A 4XKJA 2P2SA 5T8KC 1HEUA 4D44A 5L9AA 5JAIA 3VTZA 3PYLA 5L53A 1NVTA 1WVGA 3WFIA 1PJLA 1YJQA 2JD1A 1VL8A 3F47A 3JQAA 1BWSA 2BI8A 2FN7A 4FJ1A 4WE3A 5KJEA 3WB9A 4JX8A 1DEHA 5TT1A 4KP7A 4J1NA 4DC0A 2GN4A 3TZKA 5JAMA 2G0TA 5B4VA 1Y7TA 3A14A 3QSGA 4PG5A 3ZWAA 4F46A 3C85A 3O38A 5HRUA 3ZW9A 1PTJA 3BA1A 3BTUA 4TVBA 3SC4A 1X7DA 1E7RA 3DDNA 1MA0A 1ZFNA 1FMCA 2Z1NA 4MIOA 1LLCA 4AVYA 1GEGA 3A06A 3P2YA 3E6AA 4Q3NA 5A9RA 4XX0A 1E7MA 3VH1A 1FJHA 4E21A 2HQ1A 4QTZA 4RPHA 4E0BA 1U28A 3KEOA 3VAZA 4LCEA 1LDNA 3RBXA 3GOHA 2HMVA 3R0IA 4M49A 2XXBA 3GVXA 3RQSA 1E92A 1ZJZA 3JQDA 1PSDA 3PDJA 5DNAA 4UVIA 4NJOA 3TNLA 3I1JA 4BNZA 2UDPA 3IJRA 1RJWA 2GERA 5ITWA 4M54A 4LMPA 4EUHA 1IE3A 1ZH8A 4ALLA 1K6JA 2B36A 4IINA 2FSVA 1OZAA 3WQRA 1RPNA 4H16A 2AQHA 3IS3A 5JBIA 1H9AA 2BELA 4XA8A 4JJFA 5EESA 1NFFA 5ICMA 2P9GA 3JD0A 1DIGA 4PLYA 2BFPA 3L4SO 2O4UX 1P44A 1DO8A 2WD8A 1SBYA 4Z3KA 3ZU2A 2P4QA 4ALMA 1ZVMA 4FJ2A 1UZMA 3IQDB 4NR0A 3V5NA 2NACA 4AL4A 5GMOA 2ZATA 1LRLA 2IXBA 1DRWA 4PVCA 3GGGA 1WMAA 4J7XA 1H6AA 3K92A 4R5HA 5AXDA 3ASVA 5LDHA 5IXYA 4D79A 4N7RA 3TRIA 4DQXA 2VNAA 2RCYA 4IJWA 1YDEA 1WP4A 3LT4A 1YQXA 1GUZA 1YQDA 1GYPA 3M2TA 1QMGA 3PQFA 3Q2KA 2CUKA 2X7HA 4RCVA 1GD1O 5KWEA 4J90A 1DFHA 2NU7A 4XRGA 4UUNA 4BMSA 1Z6ZA 3JQ7B 5TJHA 2ZTVA 2X0IA 2W8ZA 4RF3A 4FBGA 3UCXA 5A04A 3ZU3A 2NWQA 3BMQA 4J1SA 2JCVA 3FF4A 4FS3A 3RVDA 2IRWA 3CPSA 4YRBA 3D5TA 2PD6A 2EKPA 4CMIA 4RGBA 4GLOA 3NYWA 2NVUA 4GQAA 3RWBA 3GR6A 1PS9A 3E9MA 4D7AA 2FZEA 4XGKA 4A5OA 5A02A 3JV7A 1DIHA 4PLWA 4WLNA 4B3HA 4BO0A 3U3XA 1J0XO 4ZQFA 1NAHA 2IDZA 1VM6A 4WUVA 3OJ0A 1DLIA 2C0CA 4BGEA 4CLRB 4B8WA 1H94A 1RYDA 3CZMA 1T4DA 1M76A 3K8ZA 1A4IA 3L9WA 3CXRA 4ZQEA 4LRSB 3VTFA 3GF4A 1Q0LA 3GVHA 2Q1TA 4IS3A 1LRKA 3GNSA 2P68A 2WSBA 1YL5A 3GLQA 3WS7A 4FGSA 1YOVA 2DFDA 4TKMA 5KTKA 4G2NA 1E3WA 1KERA 1ADBA 4OO3A 1IUKA 1GV0A 1XR3A 4XYGA 4UVHA 4BNVA 5DDIP 3VZQA 4CM4A 3OIFA 3WQQA 2IXAA 3HFSA 1AE1A 1NQ5A 3I52A 6LDHA 3FTNA 3GG2A 2O7SA 3C3XA 3GEDA 4DBZA 2X6TA 4R9SA 2PWZA 1UXJA 2IZ1A 3ENNA 2C5AA 4NBTA 4PG7A 1T1SA 4YA6A 4B4WA 3DO5A 2YDYA 3ABIA 4L76A 2NADA 3AI3A 3ZHBA 4D3FA 4TSKA 5KJCA 4ESOA 5G4KA 2ZB8A 3BMCB 4I9NA 1T2DA 4XQCA 4CLEA 3D1LA 5CDYA 2C20A 2NVBA 4M87A 4IBOA 4CR8A 4I5EA 3TWOA 3DHEA 1F17A 1ZSYA 2PH5A 3ZWWA 3HB4X 4HFNA 1IHXA 3P7MA 2CVQA 3EYWA 1PJTA 3FNHA 1KEPA 3DBHB 3GT0A 3WGZA 4NNJA 1Y8QB 3NDIA 1QYXA 1KEVA 2FMUA 3T4EA 4JQCA 3RJ5A 1NNUA 5IJZA 1SEPA 3UFXA 1E1NA 3R6DA 4A10A 1KETA 5JO0A 1GPJA 2CDAA 2YV3A 5JO9A 5B1YA 4BL5A 1PX0A 2OFPA 2EF1A 1N7HA 3PJDA 2NQTA 1R4NB 4BGIA 4PCVA 4BKPA 2E6UX 4YYZA 1EUCA 5F1PA 5THQA 1P1KA 4CM4B 3S2GA 1U3WA 1YVEI 3V2GA 3TSCA 2IEDA 1W6UA 2VHZA 2OZPA 3CH6A 3PVZA 2DC1A 1XA0A 2VT3A 1AXGA 3KYDA 3PFWO 4R41A 5A9TA 2EXXA 2NTVA 2VHXA 4MVJH 3L6EA 3MJSA 3VKVA 3RROA 2WD7B 4ALNA 5KVCA 5IG2A 3GAZA 4P8RA 1IL0A 3HDHA 1A9YA 2JD0A 4G81A 1IYZA 5KOIA 1KEWA 1HWYA 5HA5A 3ZU4A 3D64A 3GDOA 1JAYA 4ND2A 2ZB3A 1Z74A 2Q3EA 5JYEA 4DLAA 4IM7A 3EZLA 3OETA 1FXSA 3H6KA 4H15A 1OI7A 2C54A 4CUKA 3IAHA 5JCJD 4J49A 4R5MA 3H3JA 3KYCA 2ZQZA 5TQVA 3CEAA 5ER6A 2BD0A 4CMCA 4CMEC 4CMGA 4BKUA 2YJZA 3AY3A 2O4CA 3RIHA 1UDCA 3DAPA 1U7TA 1E3EA 1AUPA 4U7WA 4II3A 5AXBA 3RCBA 5A9SB 4C7KA 1D3AA 5IF3A 5F5NA 4FCCA 1ZKMA 2HSDA 3DBLA 3V1TC 2OP0A 2O23A 4MINA 1ZSVA 3AFMA 5B12A 1UZNA 3L77A 1U5AA 3OIGA 5EINA 5CEEA 1BDBA 1R0SA 2DTDA 2BHLA 1K0UA 1LLDA 4N5NA 3LLSA 4KUHA 3O26A 1Z7EA 2CDCA 4L8VA 1GZ3A 3OQ1A 4IXTA 1V3TA 1UXHA 5HBRA 2VOJA 3BMOA 5HTOA 2HU2A 1ZK3A 4UULA 2I9PA 1PL6A 3ZHXA 4WPGA 3E1KA 1I5RA 5U4QA 5T8KA 5LCXA 3TZHA 4JGBA 4N18A 3AI1A 3WLFA 3NT5A 4I5DA 4XDZA 4BNXA 2NQ8A 1L7DA 3ZNNA 1CERA 1JKFA 1JWAB 1PGPA 2E4AA 3MJVA 1EVZA 3WR5A 4O5OA 1HZZA 2RH8A 3WWYA 1I8TA 1ADGA 3VC7A 1F8GA 1SC6A 4BNLA 4CMAA 4Y6RA 4TROA 1ISFA 4ZRMA 3C1AA 3LLVA 1KVQA 3MTJA 5JAZA 1IZ0A 2X23A 4E31A 1MC4A 3B70A 5DBFA 4FIZA 1N5DA 4BO9A 3F3SA 5KKCA 3WNVA 2VUSA 1U3TA 4WLUA 4DYDA 4MPDA 3D0OA 3ICPA 5THKA 3DMYA 4JK3A 1DC4A 5DOVA 1OC2A 1GQ2A 1PEDA 2Z95A 3WBFA 4AJOA 4GGOA 5JYDA 1EEHA 1QYDA 4R3WA 1VRWA 2NU6A 4OOFA 1G0OA 3I9KA 1PJCA 5KVVA 4L73A 1I36A 1VJ0A 2P5YA 3PWSA 3U4HA 3AK4A 5JC1A 2X58A 4W9NA 1Y1PA 1YB5A 1XWFA 2J8ZA 5TS3A 4UEJA 4BVAA 4YEDA 1PGQA 3FD8A 2J3HA 1TEHA 2AG5A 1OOEA 3N7UA 3ON5A 3FR7A 4WLOA 1SOWA 5T5QA 4FC7A 3ROMA 2GCGA 9LDTA 1PJ2A 1B2LA 3PLNA 4FR5A 1P9LA 3FWZA 1ML3A 2VRBA 4W6ZA 3JQEA 3RUAA 1K6IA 5BR7A 5CAEA 3BAZA 4BNMA 2DUWA 3HDJA 2DQ4A 3M6IA 3ST7A 3K73O 2IZ0A 1Q7BA 3OH8A 4FC6A 2BLLA 5I7SA 3K31A 4RPGA 3PJEA 1NR7A 4ALIA 4J2OA 5T67A 1NXQA 5DT9A 3WGTA 3WGYA 2FPIA 5KVQA 3RUHA 4MVJP 3VZPA 1HDCA 8LDHA 3KLPX 4YT4A 3NTOA 4JNKA 1LJ8A 2J6IA 1N2SA 3GH3A 2EW2A 3AOEA 1Q0HA 1PQPA 4U6SA 1S7CA 4IMRA 4GVLA 1N9GB 4E5KA 1HETA 3U09A 1H6BA 1O0SA 3KSZO 4OIMA 3E9NA 4W7IA 3JQGA 3C7CB 4FFRA 4L4SA 1SPXA 1J6UA 1YE3A 4I9HA 4RVHA 4WEQA 2A94A 4BO2A 4B4OA 1ID1A 1HLDA 3CIFA 1PL7A 2VUTA 2I3AA 3JYPA 4Q3AA 5AXCA 3NJ4A 4CPDA 1VJ1A 1Y9EA 4LRTB 1NPDA 2X86A 3ASUA 4YWJA 4DPMA 5DP1A 1SB9A 3H65A 2C2XA 1UAYA 4GL4A 5BQFA 1B7GO 3IP1A 1O8CA 5C7IO 1K6XA 1ONNA 4IJVA 2R2GA 4N5LA 4KQXA 3RUEA 1D1SA 3NAQA 1T24A 3E82A 4RVUA 2WMDA 1M6HA 4OJNA 2I67A 1V35A 2FWMX 3JYNA 3JQFC 4XDYA 4DVJA 2EHDA 2D59A 4OOEA 1SOVA 1U5CA 1R6DA 4M8SA 4AJPA 3JQ8A 2POQX 2VHVA 3WGHA 4B3JA 3UICA 1ZMOA 4JROA 3V8BA 4FGWA 4BKQA 4CM9A 4YRAA 2X0RA 5F21A 2ZCUA 3FCOA 3GQVA 4W7HA 4F6LA 2RH4A 1XG5A 2YDXA 5HS6A 1V8BA 1YB1A 4MP6A 4NG5A 1EDOA 2FOIA 3TOZA 2UUPA 3FPLA 3GPIA 2PY6A 4FOOA 4YJFB 5BNIA 3E9QA 4W4TA 3BMNA 4TQGA 4IDEA 4JCOA 1DC3A 1BXGB 1BMDA 2Y1OA 3WMXA 3ETDA 1ZBQA 3PJFA 3A1NA 1MFZA 4J1QA 1ARZA 2W90A 3AOEC 2ZJ1A 4YTEA 3W8FA 4EITA 2EV9A 4OKNA 5IN5A 3WJAA 4Y98A 5K9ZA 3PWZA 1NX6A 1BRMA 4RORA 4QT0A 3KYBA 5LC1A 4WLEA 4DLLA 4BGUA 3V1UA 1SNYA 4MVJA 3TF5A 4DA9A 3AOGA 4MIYA 1F06A 1LDMA 1KIFA 3ZHYA 4LCJA 4NDNE 3PXXA 1WMBA 4PN3A 4ID9A 4EI2A 1D7OA 2PZJA 5JDIA 2FP4A 1JKIA 3GGPA 4PZDA 1B15A 1T2EA 1X7HA 2TMGA 3W8EA 1ISIA 2UAGA 3INRA 4BNWA 5L45A 1SZJG 3CUKA 3NJ8A 3JQ9C 4BNHA 1HT0A 5LDGA 4PG4A 4IJUA 4DPKA 2GN9A 2I66A 3OA2A 4YXFA 4J4HA 3LYLA 4CL8A 5TNXA 1DIBA 2HMWA 5DF1A 1YKFA 5GY7A 4U8GA 3OECA 5C7OO 4XQGA 2EWMA 4NU6A 1PL8A 3CKYA 5CDSA 1XQ1A 1TXGA 2PH3A 1IPFA 3ZCXA 2VYVA 1NFQA 2IYPA 1BDMA 1PGOA 3C1TA 3QA9A 5B4UA 3W4IA 3JQBA 4AJ1A 3OMLA 1I33A 2G17A 4IY1A 3Q2IA 1MG0A 1U9JA 4WCFC 4A7PA 1GL3A 4HFJA 3DEYX 4UEKA 1AN9A 2XPCA 1CJCA 4I8XA 3WBBA 4RVDA 1PZGA 2OXIA 3WXBA 2O3SA 4OSPA 2AQKA 1M66A 3B20A 3WIDA 3AUTA 2B4QA 1K89A 1PS0A 5JW6A 2ZJ0A 3CSDA 4HX5A 3ONDA 5GZ3A 5DP2A 5TLSA 3NGLA 5EN4A 4YPOA 3MZ0A 2OL4A 1PQUA 2D1YA 4XZ3A 4DRYA 3ZDFA 1G6KA 1HDZA 4B8ZA 1P33A 3KOUA 1JWBB 3R1IA 4ZQGA 1H9BA 4K1LA 4YRDA 3KSDO 1X14A 4KOAA 2UYYA 2PKQP 1GYQA 1W4ZA 3IOYA 4Z9FA 3ZU5A 3K5PA 4D3SA 1QRRA 3SEFA 1WDLA 4NBUA 2X5OA 1F0YA 4II2A 1BXKA 4S1VA 1ZMTA 4PFJA 4A73A 3AW9A 5FWNA 4E30A 2Q4BA 3S1LA 1NPTO 4DIBA 1UDBA 2CD9A 2OO5A 5KJ1A 3V2UA 5CG2A 3FWNA 4BNKA 4BNJA 2PD3A 5T6BA 1MX3A 3I9OA 2CNBA 4IUYA 2Y68A 5BT9A 1X13A 5TX7A 4IDBA 1A71A 2BFOA 4RLHA 2VZ9A 3GN1A 1LSSA 2GRAA 3VZRA 2B5WA 1N8KA 2DBZA 1B8UA 2YHIA 4GI2A 5I9MA 1T1RA 4ZHSA 4YAGA 1HDYA 3H3FA 5T64A 5JMPA 3BMQB 4TMFA 2PNFA 4O63O 3JQ6A 4NFHA 1U2DA 1UZLA 1WZEA 2QRKA 3DWFA 2JD2A 5EJ2A 1H6DA 4LN1A 4J91A 1LU9A 1MB4A 5DN9A 2V7PA 1BXGA 3KTDA 4JP3A 1TI7A 5CDTA 2PTGA 4PG8A 2GD1O 3AM5A 5JXWA 2AG8A 2QZZA 1OFGA 3QP9A 3AY7A 1MC5A 1IZ9A 1MG5A 3VZSA 4BNYA 4GBJA 1LC0A 1Y5RA 3Q3CA 2GZ3A 1R0KA 2PGJA 3JYLA 3UOGA 3PFFA 5CP8A 3RC7A 4XR4A 4HNGA 4BB6A 3C1OA 1GUFA 3PIDA 4L9RA 5DULA 3UW3A 1ONPA 3VPSA 3GA0A 3JD1A 2V6MA 4QECA 2WTBA 4AJ2A 2YFQA 2YQ4A 4KDEA 4DMMA 2GASA 1WXDA 3IJPA 3JQCA 4FFNA 4HY3A 4BO4A 1TT5A 4IZIA 1P77A 5A1TA 1E77A 3PWKA 1LRJA 1R0LA 3DMTA 2GUGA 2DTXA 2VHYA 3DAFA 2ILTA 2HMUA 2D3TA 1UDAA 3GK3A 5EIOA 4OL9A 1LLQA 3TFOA 1QLJA 5I9NA 3QVTA 3RFTA 1WNTA 2CDBA 3W6UA 4XD2A 2TMDA 4EUFA 1UP6A 1XGKA 1BG6A 1E6WA 3ONEA 3P19A 4AJNA 1AGNA 4E2WA 2GDZA 3GDGA 1Z82A 2AW5A 3LVFO 4XYLA 1ONOA 2H9IA 2C82A 3OP4A 1DJQA 1T26A 1FDSA 2Y0CA 4MVJG 4RDIA 2GYYA 4URFA 1H0KA 1X1TA 3PHLA 4EUEA 5C7LO 1A9ZA 1C0LA 3TFQA 3EZYA 4ZA2A 4CM7A 1E7QA 1P1JA 3VH3A 5BSGA 2QX7A 4F6CA 2VWGA 4KWHA 4XYEA 4AJLA 5IDQA 4D3DA 4U0JA 1LSJA 5B4TA 4BNGA 4DUPA 1XYGA 2VWPA 4W99A 1WZIA 1YGYA 5JAQA 1BXZA 1ZXBA 3LT1A 4R54A 1YBVA 4IDGA 3G49A 4Q3BA 2D5CA 2ZK7A 1I30A 3DB2A 1FK8A 4BKRA 4BQPA 3IMFA 3H5NA 4CMHA 3NV9A 3OFSA 5DCWA 4GMFA 2X4GA 3U62A 3PHIA 2CZCA 5FFFA 1DFGA 2Y1EA 3VPGA 5JLAA 3WGIA 2G82A 3GZNB 1MP0A 3QVOA 3RBZA 2CF6A 1EE9A 4L75A 1UJMA 1GAEO 5I7FA 1NQTA 4FB5A 4JP2A 3GVIA 3JD4A 2PFGA 3IL2A 4TRNA 3QW2A 5AVOA 3DOCA 1HDGO 1KY4A 2ZTUA 4FN4A 1GYRA 5U1PA 4BS9A 2W2KB 2DBQA 3CMMA 2WE8A 1X0VA 2JCXA 2HRZA 5H83A 3LF1A 1E1KA 1ZW1A 1ZIDA 3RUCA 3IC5A 2AE2A 4J0FA 3LU1A 4IS2A 1ORRA 4YJGA 3VPHA 4ONEA 1MV8A 3UGKA 3E5MA 5EMHA 1XSEA 5IAAA 1PZEA 1VE9A 2OUIA 3NX4A 1H6CA 4FPXA 2YHUA 2CSUA 4IQGA 1TA4A 3AJRA 3GVPA 5IN4A 3IUSA 2DFVA 4HBGA 3VPFA 2D8AA 3LZ6A 3PTZA 3QE3A 1O5IA 3TZ6A 5JFOA 4UVDA 5EQFA 1U2GA 4MP3A 3U9LA 4BGVA 2WWRA 3VVCA 5DCYA 3OJOA 4I9UA 4DWVA 1SCUA 2YHIB 2I99A 4RPKA 3QVXA 1TT5B 2FPPA 2NTNA 2ZKLA 3DFZA 3I83A 2E82A 3OJFA 1CQJA 1E1MA 1QORA 1R4MB 1NM5A 3DONA 1I0ZA 4NK4A 5AXAA 1GQYA 1A72A 4LSMA 4S3MA 4DL9A 2B83A 1E3IA 2VQ3A 3RD5A 5G0VA 1C0KA 1JQBA 4EEXA 4R16A 4L0QA 3Q9UA 4ND1A 1KC1A 3VVBA 2EKLA 5CDUA 4XR9A 3LF2A 4FFMA 4OXKA 3FSRA 3HADA 4BHTA 3PEFA 3JQ9A 3UUWA 1VJTA 3E03A 3I6IA 1XU9A 2WEKA 1E3JA 1UXGA 2WE7A 2A35A 3AM3A 3F1KA 3M1AA 3O8QB 4NU5A 2H63A 4BNIA 4XGIA 3JQAB 2CFCA 4MVJD 2B4TO 1CQIA 1DRUA 3FI9A 3G17A 4ZJUA 1C1XB 3L4BC 4FSHA 1YXMA 1QR6A 1YONA 4HNHA 4NBWA 2JJYA 1C14A 3TDKA 1P0CA 4UUOA 3WX0A 3RFXA 1I3MA 1CYDA 4LVUA 4AJ4A 4U6QA 2ZYDA 1B0AA 4K26A 2WD7A 3DZHA 3TQHA 1T2CA 4BOYA 4R1TA 2GSDA 2G5CA 4CM3A 4XIJA 3WMWA 2Q1WA 3JCZA 1UP4A 4RV9A 1T25A 1ZK4A 2HK8A 4GKVA 5G0UA 3TOXA 2DM6A 3LT2A 2EKQA 2Y67A 3HNPA 5G0WA 2BMAA 1X1EA 4FDAA 1PGNA 3D3EA 3EVNA
chains in the Genus database with same CATH superfamily
1UC4B 3O2QB 4H7FA 2OUKA 4MW9A 5D3KA 4AZ0B 2IA5A 2VAVA 2AA3A 1DAOA 3DL2A 1EB9A 2VPWA 4MXDA 4RU1A 4DFDA 4YUWA 4LFBB 4HRAA 4BUCA 1SU7A 1YCFA 2JGKA 3RSFA 4DG8A 4RTLA 1XL0A 4XLTA 1U0JA 1TA0A 5EQDA 3KWJA 4N4AA 5G0TA 2A5LA 1BXRA 3H0KA 3LDGA 4IIHA 5ALEA 4CIVA 1BEUB 4F97A 5M5BA 3SYNA 3V2HA 3ZCSA 1Q22A 1TZMA 3I4FA 1WDKA 3QKIA 4Q39A 1E2JA 1T5OA 3EDYA 2MSDB 3V80A 1WABA 2PU5A 2QW0X 4RENA 2DETA 4TYMA 2D1TA 1X1RA 3T6KA 2ZRHA 1JE1A 3UAXA 5EC8A 2FI1A 2O52A 1M75A 4A16A 1NJFA 3ZZTA 4W9MC 3VPXA 4BFZA 2QR2A 3S27A 3AQ4A 4G4GA 4ZVOA 3MXOA 2F43B 2FZLA 3DF7A 4JJKA 2OV4A 2XDQB 2VK8A 4LY0A 4YH1A 3ZY2A 3EDOA 3VNQA 1QGAA 3KXDA 4MO2A 1G8GA 1EWQA 1DAEA 1H1LA 2DCUA 1FA9A 2D74A 2DPXA 2CXRA 2E85A 4L2IB 4PLGA 4TQUS 5KTMA 1CUUA 3ZQUA 2OO7A 3QBVA 2Z09A 4KAAA 4PIVA 3MIZA 4UVEA 1Y8QA 4M7WA 3KU4A 1WDWB 3WLKX 1JHXA 2O0MA 4YVFA 3U19A 1VG9B 3T0IA 4YRJA 4EHHA 4GH5A 1I6MA 4JFRA 3EK2A 3O2SB 3SQMA 3QOYA 5DW0A 4JC4A 2JBAB 2AOTB 1Z18A 3PTLA 1F5NA 2O14A 5I47A 1RS0A 2BRUA 4LV5B 2PBLA 1RHKA 5SZHB 5EJGA 2BUCA 1EJ2A 2QRVA 4ZCSA 4BYMA 1RWVA 3AEUB 3M5PA 5FYDA 5BR4A 2AN1A 3W78A 4IZHA 4JN6B 2VF4X 1H2EA 1FFBA 5G4KB 3UAVA 3ZW7A 1QGDA 1ADCA 5K3FA 2ATVA 5JNVA 1D6MA 3GBSA 3AY6A 1TU3A 5EJ7A 4O5AA 3ACBA 4TWZA 3LLMA 1KH2A 4AU1A 1KZYC 1OBFO 3K9BA 4TYNA 1BA3A 1PR4A 4GGPA 1ENPA 1MPXA 2G1AA 3I1FA 3KVOA 4BO3A 1R6AA 4LHVA 3JQ8B 4F3CA 3IERA 5BV8A 3AP3A 4IL5A 4PHHA 3N0TA 4YJHA 2W6ZA 2BSXA 2QAJA 1OC4A 3ZHZA 2I7XA 2CUNA 4ZFNA 3OJLA 2A1UB 4K6MA 3OQBA 1PZFA 3ANNA 1E3SA 3KHKA 4Z9YA 2C04A 1I10A 3C5HA 3FBWA 4HADA 1L4UA 3J81A 2HQRA 5CW1A 1M74A 1TQ8A 1N4DA 3WQSB 5ALSA 1F8YA 5KYWB 1ISJA 5JADA 4DREA 2ECQA 4OP2A 3GGDA 1E2EA 1RWQA 4TSFA 1TAQA 4DV6B 1YOVB 3HDTA 4KWEA 4DUGA 3ZWQA 2V1UA 1U1IA 4FSDA 4C4AA 2G77B 3M3PA 4BRZA 4FFLA 3QU5A 2V55B 3VO1A 2VXYA 4LISA 4FYWA 4XGNA 1CLUA 3CO5A 4MWCA 2GOYA 1CE8A 2II6A 3VRHA 1YBHA 4QO8A 4Q24A 1BW9A 1JA0A 1GFZA 4IDCA 5AVTA 2HO5A 2NYAA 2P91A 3EEQA 3D4OA 1JR3E 2XOKA 3MELA 4N0PA 1C41A 3VNAA 3WG9A 4AYWA 4WBNB 1TM3E 5AKLA 4GC5A 2PKYX 1XQXA 2NNWB 3P20A 4M60A 3KTOA 4Q93A 5C53B 2ZIAA 1P7WA 4IGAA 2ACKA 1SPBS 2NO5A 3EVBA 5IT5A 3CX6A 2PAAA 5AKZA 2OHOA 2DBVO 2GHIA 3K0FA 5J23A 4RMIA 5JH7F 2QLTA 1DQPA 1TEZA 3L5OA 3LOPA 4O4HA 1Q0RA 3PL1A 4EP1A 4HNVA 2EOAA 2Y66A 3PCXA 4OHYA 3P97A 3WICA 1AA9A 3JAKA 5IZ4A 3I12A 3AR4A 1PK7A 1A7JA 4B09A 4BQRA 1FDIA 4BWFB 5CBPB 3HM9A 1U4OA 2GT1A 5H1YA 2C61A 1MCZA 1A69A 1V5WA 3V4ZA 1XLUA 5I48A 3ORQA 4WKGA 1FOEB 1JN0A 3H2ZA 3N8HA 4MUJA 1W2HA 1Y7LA 1PJSA 2HY7A 3VOBA 5CDGA 2Y71A 2GEVA 3WAJA 5BVHA 1L7BA 4I8DA 1NZDA 3RS4A 1T4CA 2GA9A 4GSKA 2HHLA 2UYGA 4JLAA 1J8VA 4ZD6A 3RG8A 2PRYA 2RI6A 2AEJA 3D7LA 5I8WA 1P4GA 3TNFA 5CPFA 3KP1A 3PHGA 3JD2A 1DIRA 1Y37A 1ZA2A 3O94A 5KTPA 5CM9C 1G291 2G70A 5BUQA 2RAVA 4OJQA 4QHTA 3BD6A 2JIOA 1VLJA 1XK7A 1XNHA 1FNCA 3F90A 2CHUA 3HFRA 3A4VA 3IJEB 4HNAB 1JXQA 1KP3A 2EGHA 1QKIA 4JI0B 1V26A 1QNFA 2ZEJA 2H54A 3TN7A 2GBCA 2XTJA 2L42A 3IBCA 4R7GA 3C41J 4U4AA 3NLLA 3SXPA 2JJ8A 5J5CA 1VOTA 1J25A 1NNI1 3X1MA 3EGOA 5HUHA 2P5TB 3L1VA 3LZDA 5IMBA 3GFOA 3DL4A 5AM5A 3LBFA 2GM4A 2KM1A 1CQWA 5CGZA 1SKUA 2X8LA 2Q9BA 5MFPA 3KB8A 1U6KA 4MEBA 1BMTA 3SG0A 2VR1A 1KPIA 1O3YA 1T9AA 3L06A 5E6SA 3SKVA 1Y8CA 1VLHA 4RIIA 4CG2A 2ZT7A 3O9ZA 5DW3A 2ECPA 1NE2A 3EIUA 2XQIA 2LIPA 2O2ZA 2OCBA 5DHAA 4LSWA 5FD8A 3OQIA 1EZ1A 3L02A 5ENVA 3RUIA 2RB4A 3ZVRA 3IVAA 4EY6A 4S04A 1GRNA 2VT6A 2E1RA 3NYIA 1LXCA 1LCIA 4C03A 2J7PD 2QNIA 4X1IB 3GT3A 4OYYA 1AZSC 1DIAA 1THTA 2B5VA 1JBQA 2VK1A 3H7AA 3WIBA 2VDQB 2QI9C 3X2EA 1XLTA 1NUTA 1GUBA 4V1CB 4V0SA 5DVZA 3B85A 4CQLA 5KTOA 5A4FS 3AUAA 2ODAA 1SCIA 3IDQA 4DR5B 1U02A 3ZV3A 3KOXA 1C7FA 2Y2UA 3D8SA 3DJYA 1L2TA 1PYOA 3TLYA 1YHNA 2QRLA 4RK0A 5D5QA 5IXSA 2W22A 1US8A 3PHJA 2MJLA 4IH4A 1ULUA 1VSBA 1F0NA 2GVZC 4HVTA 2FX5A 4UREA 4CKYA 1NF2A 4P38A 4I81A 3PNVA 4O8ZA 4N8EA 3ZGLA 1Z0UA 4QGHA 3I9JA 1XX6A 2Q46A 2I29A 2MMGA 1NIPA 4YCDA 1M0WA 3ADPA 3LHFA 3K9LA 3LHIA 2ZYSA 2WYIA 4FBLA 2D7DA 2HXSA 2NU6B 1RLOA 2P78A 4M0MA 5K0CA 4QSHA 4CHGA 5JLJA 3QG1A 1WXXA 2XMDA 2WVGA 1FTNA 2IODA 3FHOA 3TPCA 1PNVA 1XZCA 2QG4A 1JILA 1E9EA 1SWWA 3DG9A 5CJPA 5HW0A 2VXOA 3LQQA 5FLKA 4DIUA 3AW8A 1X9HA 1ND5A 3LFUA 4K9DA 5EIBC 5FI3A 5E6RB 1IXKA 2FVXA 3QXCA 4HV4A 1YZKA 3ICVA 1AGYA 4WNAB 1CWUA 1EFUA 2Q9AA 2R5NA 1RQXA 2WKPA 5GOTA 3WKDA 5HP4A 2JANA 1QFJA 4B34A 4IF6A 2ZBFA 2NPIA 1DCTA 1VJDA 2EFHB 2WSLA 2HIAA 2WKQA 2JAPA 2ZG6A 3NHJA 4NZ9A 1OT5A 2J3LA 5DOZA 3RANA 5JQWA 4M1KA 5JU6A 1Z25A 1GVNB 5HF6A 4EVSA 2ARKA 3ZHOA 1JW9B 2AMYA 4G97A 5AI4A 4HI0E 3VDXA 2GB4A 1IEQA 1ZI9A 2NX2A 1DBWA 2LDXA 3IXMA 3FPBA 5FWDA 4ZV4A 4LF4B 2RHTA 2XUPA 1OGYA 5TSDA 3D3WB 4UTZA 3ZXUB 1V16A 3CRQA 3GHHA 1GGNA 5KNDA 3HKDB 1EGQA 3LY9A 2BVNA 4M1QA 1ONBA 2IYTA 4FYYA 1FSGA 3QBTA 1Y1SA 3ZK9A 4OBBA 5FOQA 2XUFA 3OIYA 1RZRD 2PXCA 4GMKA 5KSYA 2L19A 4HO1X 1WXQA 3HVIA 4TN1A 4B3FX 2R62A 2MCFA 4TYPA 5HRCA 2PGOA 2KHZA 2IL1A 4IDXA 3NQ41 3GRCA 3CBGA 1FL9A 1Q7GA 2JJQA 2AK3A 2Q6KA 1IOLA 1WAMA 4HOYA 1F8XA 1KJWA 3UANA 2OQ2A 2FQXA 2W6CX 1CY8A 1D2CA 3NANA 5L3SA 1GOTA 1NMQA 1FUKA 2LKCA 4E33A 1ULZA 1LBHA 1O4VA 4J8PA 4Q9JA 3T5GA 1E0AA 3U48A 3Q87B 1K8QA 2MSCB 4X6UA 5HKLA 3AFGA 1CIJA 5K2MA 1OIVA 4IH9A 1YBFA 5DNCA 4JX9A 3QUBA 4KI7A 4MLDA 3D3JA 1TNDA 3I6MA 3CKMA 3RJ9A 3VPAA 4LF9B 1EVKA 3TRHA 1DWQA 2WJHA 4C21A 5KIAA 4DV2B 1G4AE 1CQIB 3U4IA 2EP5A 3D54D 1W73A 3UJNA 3L7MA 4LDZA 3UATA 1XZ8A 3NHLA 3SR0A 2V7QD 2JBAA 3ZVLA 2UZ0A 1RQPA 1YC2A 4AO6A 1O57A 2W9XA 1WMSA 3CZRA 3ULKA 2WDZA 3N07A 4MQEA 4KREA 1ODTC 1V48A 4FFPA 1GFWA 1UBKS 4Q5IA 1DB3A 1RPAA 4W5HA 3ZNPA 1ZJYA 5AW4A 1PN3A 3DEFA 4YAEA 1WCWA 4LHEA 3BGIA 1JNXX 4QXRA 5ALLA 3WV4A 2Q2OA 3DNMA 4ACBA 4AY3A 4EUSA 1ZVVA 3STYA 1G16A 2NZXA 3WLIA 2QN1A 3U7FB 2G80A 3I8OA 4MGIR 2QLMA 5A4AA 1M8PA 2IPAB 3KOMA 2P3LA 4MJXA 1X80A 2VG8A 1W44A 2GETA 4GRIA 1CY0A 2ZOSA 5I5GA 1U3UA 1XTUA 3RS9A 1UEXC 1YH3A 3B2NA 1O5OA 3HCBA 4G63A 3ZV4A 4P7FA 4PS0A 1TD9A 2RAFA 5A3JA 1W36D 2ATEA 4EK9A 1M7BA 3OM9A 1KJZA 1KDTA 1V4VA 3C5CA 3PBKA 5DRYA 4FHDA 1E9AA 2A4KA 2JH9A 4K88A 3VBEA 5DHPA 3RNOA 2BHSA 1JFFA 1VKJA 2AI3A 2AJTA 2V03A 1JIJA 2WAXA 4HMPA 3HV0A 4NAUA 5GAJA 1LBQA 3AESB 3AF3A 1L8QA 4J9UE 1J2EA 4OREX 1FS4A 1A1SA 3HE3A 4RTOA 3SYMA 4NPAA 4PAQA 3USZA 3RSSA 4YRRA 3C4JA 3COYA 2BZSA 4XWGA 1QWOA 3DVAA 2E18A 1UUFA 1LPPA 4UNRA 2D5LA 3LC1O 1QGED 3MYYA 1YFKA 1T9KA 2GMWA 4N7BA 1Z7GA 4OHMA 4ZCRA 3M9XA 3DR3A 4FR0A 4PG6A 2ZT5A 4A1OA 4B4UA 1XNRB 5B3JA 2OV6A 2BFEB 4GMDA 4J4BA 4BNFA 5BR8B 5DLEA 2IIPA 4CIDA 4KTTE 4C0JA 4D0LB 4F8EA 4LVOA 3KUDA 2OHXA 1I0LA 5EP3A 3KD3A 4FGJA 4EX6A 1CETA 1ZG3A 3IT3A 1N9ZA 3WHIA 4CL3A 1P45A 4CDNA 2AKEA 1O89A 3QX3A 4A6PA 4EZIA 4QPPA 3H17A 2WTUA 4QJ5A 3D4NA 1GNRA 3FMPB 3FFWA 1RCFA 2FLKA 3NH9A 4DJJA 5LNK6 3UT5B 3ZV6A 3OUZA 3QELA 3AJEA 3EGWA 4ZC8A 2XLCA 5D3ZA 3V1MA 3CFYA 4KE8A 4E03A 5C18A 4Y6QA 2R9VA 3I6BA 5A3SA 4OA8A 4LFCB 3E9ZA 2NSHA 4WFKA 3DZBA 2HFJA 2C2GA 3AU8A 4CIWA 2R79A 3M2PA 4GSLA 1J0AA 4RDHA 4U9IS 1USUA 4KFTA 4C4YA 3AVYA 1FQJA 2ZZMA 4TTQA 3DTVA 5EZSA 5C46F 1NYQA 1N9KA 4HVCA 4NV1A 5BR1A 3CJQA 1BQEA 1KJQA 1XHEA 2P30A 3EHDA 3OT1B 4RV4A 3MAGA 3N7TA 4P35A 5IYZB 3HXQA 4L50A 3JZDA 4R7TA 3DE4X 4PF1A 5DM4A 4EYEA 1LDEA 3ZKWA 1ZD5A 2QY9A 2ZQYA 4BMCA 1U63A 4JD5A 1DTEA 4DJ5X 3EEFA 5AKEA 1M8FA 4HS4A 2PHZA 4OQXA 4PLCA 4MDEA 2WYVA 5JRZA 1ZY2A 4YT8A 4XLZA 2X19A 2Z9BA 1NLZA 1X94A 5CU7A 3ZGYA 4XE5A 3T1NA 4ETIA 1DJOA 5FTLA 1W5EA 1PR3A 1OAOC 1KK2A 1KVTA 3RIYA 2F9FA 2H1LA 2OGUA 4P4GA 3JSAA 2WFMA 3PXAA 2AMFA 1D4OA 1W35A 5H02A 5H0IA 3TH5A 1WBBA 4FYVA 3AEYA 3MWEB 2ZUWA 3Q72A 4I4LA 4RGYA 3ZDRA 4V0NA 1FFEA 1L3BA 2HAEA 2WFLB 3VSBA 1RQ2A 1AK1A 4KJXA 2B94A 3N28A 3VYSB 1AURA 2AI1A 1M2JA 1QKJA 2PZAA 2JL1A 4IRMA 4BCBA 3RARA 5A2GA 5CFNA 2XUQA 3QWFA 1W5BA 1QFSA 1I3KA 4CLRA 1JGTA 3MS4A 4PQFA 2E6KA 2JI9A 1MFPA 5D87A 3FHTA 3K6RA 1V3UA 2J5RA 4I9FA 5TMDA 1TB4A 1JQ5A 1NSYA 1QVAA 2HADA 3EVAA 4N41A 3BD9A 3C6ZA 2XD9A 4PFQA 3LDFA 2Q3DA 3HABA 1LV8A 2J6BA 1GEEA 1HE2A 2XUZA 3B1WA 2XRFA 4EGCB 1LSUA 1IMJA 3MGBA 3ER6A 1NVGA 4DADA 4QL3A 1WU7A 3GAFA 3U0BA 1B3RA 3U81A 4DHEA 1P8AA 1WS6A 2RMKA 1L4EA 5ECDA 2RHWA 1G9XA 3OWOA 2ZI9A 4FONA 2ZJ5A 3BIXA 3OLQA 3ZGOA 1C80A 2YW2A 4GWGA 3D0RA 2J07A 4V2UA 1YIOA 4RSHA 4WK4B 2Z8YA 3AUXA 1HYEA 1I7NA 2ECOA 3NR2A 4X6LA 4H08A 4IZ6A 4Q1BA 1QHHB 3UF0A 1KXJA 3H6GA 4LGVA 3QI2A 5LB2A 5KTTA 3S81A 1FP7A 4NTZA 5LDDC 4YUVA 4D4HA 1V1RA 1T8SA 3HTXA 1XTIA 3TLJA 2CNOA 4QFDA 5HOEA 1UJCA 2ZIXA 4QVKA 4PYNA 4G1MB 2MSKA 4DNPA 5ARCA 1GT6A 4RHEA 4N5MA 5DASA 1EFLA 3LCRA 4WNIA 2VA8A 2Y1CA 2HRQA 1JDNA 1EM8B 3EAFA 2Y1FA 2A14A 4PAMA 1W5TA 3NKFA 2D5BA 5EERA 2YJ3A 5K5EA 1L4NA 1UK8A 1C8VB 2O2IA 3ZYCA 3QE0A 3H04A 3A37A 1KH3A 1XV5A 2QU8A 4G1CA 5DZSA 4KSYA 4CG1A 3ORFA 3OE1A 1SBIA 4WEOA 5AW7A 5FWYA 2RBEA 5LXTA 2J9RA 3QRWA 1DBRA 2KMLA 3BWVA 5TMPA 1DELA 2VBIA 3SC6A 2YJ6A 1Z6QA 2FSVC 2W6IA 4DR1B 4XCVA 2DQSA 4TKLA 4YLYA 4EZBA 2OXRA 4CLDA 2XYVA 4RF4A 1E89A 3NTVA 5NULA 5FUXA 2D7CA 4R01A 5HS4A 1J07A 3BJZA 3IAS6 1S02A 1G3RA 1TMYA 3T5CA 5B3LA 2C5FA 4ND6A 1MXHA 5DSXA 1LH0A 3O0TA 3B3JA 4PCAA 2IH4A 3LA6A 1N6RA 4YBZA 4G5YA 1B8VA 1II0A 1W4AA 2ZAOA 3EQ2A 3BL6A 4OQQA 5AKGA 3IO5A 3GA5A 1EGHA 4DQ0A 5ULLA 4I8IA 2DG2A 4K86A 4R40A 5CT5A 4OQZA 1VSQA 3LGXA 2J0UB 4MKIA 1RE0A 1RWOA 2PGXA 1DPFA 1JLLA 3UAWA 3WYGA 3OU6A 5CDHA 3FF1A 4KH0A 5FHQA 3R8CA 3VV3A 4GPD1 1PV1A 4K3VA 4TUYF 2C9DA 4CM1A 3CTPA 2JK1A 2D6FA 4RVSA 4M0FA 5E6UB 1KY5A 4OQNA 2B99A 1UL1X 2WHYA 1DARA 1QO0D 1RZ3A 4FQ8A 2UZ4A 4NMXB 3OSUA 3GB9A 3Q7SA 3BCSA 3KBOA 4MS3A 4RJIA 1NAIA 2VDLB 5JHGB 2BM9A 3EBPA 2LW7A 4ABYA 1IZ7A 2GS9A 2WWFA 2Y4NA 3IUYA 4D0RA 2CMDA 1W34A 3M6VA 2J3KA 4Q1FA 1TCAA 2FFRA 2PK3A 3F5SA 3ZV5A 1CY2A 1PK8A 3ELBA 2NP6A 2V0GA 2QUAA 3GLIE 5AQ1A 1L5OA 3P9ZA 5LB4A 4Q7MB 1II8B 3CXUA 4DLXA 3MOIA 2VBCA 1JF8A 3GROA 4GGMX 3O8LA 4ZDJA 2FH5B 2ONYA 4WK6A 2O1EA 4W9NC 4MLZA 3Q3JB 4E11A 1MGOA 3N5KA 2POCA 3DCYA 1P1HA 1QX3A 5FBHA 4GZLA 1CEQA 3MT9A 3LS2A 2UYCA 1A4UA 1GN9A 1LQUA 1EVIA 2A5JA 3NKVA 3T9BA 3BCHA 3JALA 2VIIA 3H5WA 4C06A 3H2YA 2BCGY 1XJCA 4ILEA 5JWHA 4F38A 2ZXFA 1KY3A 3N6VA 2PL9A 2ET6A 3MPOA 5INTA 1TK9A 4M86A 4O4LA 2MINB 3UCFA 4DEVA 4DLTA 4EG8A 1ZM9A 1KIMA 3VYVA 3REFA 3PQEA 4BN0A 2OR3A 3IIMA 4JWKA 2ZM5A 4H7HA 4KIJA 2Z04A 3LOUA 1C3OB 3VHRA 3URMA 3C74A 4IWNA 3I5MA 1BJRE 4NWIA 1UCFA 6YASA 3NHBA 5BRAA 3W5VA 4ML3A 4WZZA 3WP0A 4AZTA 4K28A 1QGUA 1ZL2A 4B6FA 5FEUA 2E2WA 4UMVA 4BZZA 4E12A 5JMWA 4F7WA 3FMOB 2ZU6A 5TJHA 4OH1A 2IYUA 5LR6A 2XYGA 1U3VA 4RWEA 4EJMA 4I6GA 4I36A 1K66A 2OMKA 3CPJB 5ALIA 5FOSA 3CZ5A 4ZEMA 3QVWA 5IMSA 1EK0A 4RNDB 2OQVA 1XD2B 1QIDA 1JFRA 3O3OB 2IIBA 4D0NA 3IRUA 2I54A 3V4LA 2EQAA 2C7GA 2XDYA 2JI4A 2FEKA 2YBDA 3NHUA 4LZOA 2B5OA 4YNBA 2XUJA 3T7IA 1AVTA 4KQCA 1EUDA 3PENA 4HUQA 3FGZA 1DDIA 4NICA 3R5JA 3TPFA 3JAWA 3LTNC 4NI5A 1QCZA 1SXQA 2VA9A 2PX5A 3LXXA 1HNZB 7ADHA 4UHCA 4BIIA 2QX6A 1EWTA 4PO1A 1ZNYA 2JGRA 3RFCA 4P9NA 4Y67A 4UUPA 4RMNA 4HGZA 4BC1A 1XCPA 2NO9A 2ZGVA 4OQPA 3VR3D 4Q1EA 5AJHA 3S2FA 3QXHA 4LHSA 5KNLA 4ZI5A 4P2BA 3T95A 2QX8A 3KJHA 2JW5A 4YP9A 4CKEB 2YV4A 3CEMA 5KS2A 1RM5A 1JHYA 5TXGA 3SU8A 3T3GA 3TJMA 1YMQA 4B6RA 2BH2A 1X1QA 2I03A 3HLYA 2YXDA 4BN4A 2Z58A 3CF4G 5AW9A 4QGFA 3QIAA 4CWAA 3ADDA 4EPYA 1NN0A 1S4MA 1YGPA 4XJXA 1HQKA 2PS0A 3ELDA 1DG1G 2J08A 3UJDA 1XQ9A 4FE4A 2IYYA 3WDMA 1H2YA 3Q7TA 4Z4QA 5JSHA 1AGXA 3DXZA 1XN4A 5TPWB 1MDFA 3C24A 4BX2A 1U0EA 1JQAA 2HC9A 3RW9A 5AM3A 1T9GR 1U0LA 3PGLA 1Y6RA 6Q21A 2JGMA 3C5VA 4IJKA 3KVVA 3ED5A 4UUAA 1S2DA 3KJNA 2PMEA 1V3VA 3IUPA 4BWGA 1TYZA 1LDYA 2Q6TA 5E4YA 2VRNA 4QTTB 3I9NA 3R3ZA 4EAQA 5CFOA 1R3DA 3FETA 3T4UA 4KB5A 1CQXA 4G1BA 2XE8A 2IPXA 3C3JA 1G21B 1I5EA 4DCUA 1YDFA 1R2QA 1U0GA 2G76A 3TS1A 2HU5A 4JJIA 5IM4A 4DMKA 4LHXA 4PYOA 4HB3A 2X0DA 2V6IA 3KAKA 3RH0A 4IX1A 4ZT3A 2FW1A 2LVBA 1AA6A 2R8ZA 5FF9A 4YUAA 1TLLA 4PX9A 3ABOB 3LBHA 3AF1A 4F9TA 3FDIA 3GJ8A 3SX2A 1F60A 5GINE 4J2HA 4QE3A 4IGFA 4JUCA 4KVGA 4WGFA 2PUTA 1GAQA 1XZMA 2NN3C 4UM9D 4IV0A 4J2TA 3BD8A 3HRIA 3SHQA 1NI4B 2AI2A 3DHYA 4LDQA 5FL3A 3FWPA 4B2IA 1MRSA 4MUAA 1TFUA 3VH2A 1D2NA 3UIEA 3AIKA 3VSCA 2HF8A 1VLZA 1T3ZA 4WUTA 1L4BA 5EL0A 7REQB 3CR7A 2ZIFA 4XX1A 1RXEA 3UC9A 4DPLA 2CDNA 5TRTA 1JYSA 2NTEA 1QWSA 3P0JA 5IF9A 4W5RA 3QKSA 4G0UA 5TIIA 3UWMA 2QZJA 4C89A 4ENRA 3WB0A 3NHPA 1WKBA 4OLAA 3RHZA 2XZTA 3NP7A 4IIJF 1CUJA 1EWKA 2CXNA 2XOXA 3F6CA 3OQJA 2O50A 4D8VA 1F51E 3TJZA 1U4SA 1ES9A 1E3LA 1P31A 1R4NA 1XKQA 1Z2PX 2REQB 2UUOA 2BCJQ 2YVKA 4MPPA 4TOIA 5FL7A 2WF7A 2GARA 4YJKA 1Q50A 2UYOA 3ZNQA 3FA2A 1ZOIA 1L1FA 2P0YA 4DCMA 4KXFB 5I7OA 3Q0IA 3AEKA 3H19A 5L95A 1Z5ZA 3D1VA 2QBYB 1EVLA 2RGWA 2Y99A 4KN6A 1KOFA 4RWZA 5LLTA 2ZUFA 2XODA 4KLAA 3FSGA 3GHYA 3MCVA 1ADFA 5JQGF 1NP6A 4UPEA 1LNSA 2Y1GA 1A7AA 3A9RA 3G7UA 2FMHA 4XQ9A 1V4NA 2VHWA 3DBHA 1E3DA 3TMAA 1LY1A 2Z4RA 3G3EA 1OI4A 4B7UA 1OLUB 2GBGA 3KYIB 2AMJA 3FBTA 2R4QA 2RHOA 2ZIXB 3ZX5A 3OOWA 1VHWA 3HCPA 1DG3A 4KQ1A 4R8MA 5F73A 5JS6A 4UHFA 1GO2A 2DU8A 4G0XA 3KHSA 3OJEA 3SZ3A 4O4LF 2HEGA 3IKVA 3AUUA 4OY3A 4KK4A 3RVPA 1VQ1A 3CWCA 3NKLA 4IIJA 3ZTYA 4RY9A 3N2EA 2J4FA 3UKOA 3SJUA 2IOYA 3E9YA 1VZ3A 3H9GA 2W2MA 4K40A 4KDCA 1VTKA 2GKSA 4HNUA 1LPBB 4D9GA 2AR9A 3D81A 2I55A 3PNMA 4CN9A 3DMGA 4WCDA 3QG5A 1INLA 1Q6YA 3OKPA 4J07A 5G1OA 2H7XA 4L8GA 2W2KA 4YBRA 1JPUA 3L0CA 4A23A 4JOCA 4XSGA 5C8YA 1H0RA 2WWYA 4E22A 4P3NA 5EZ6B 5KWVA 2IZ6A 3NHZA 4UM9B 3IEUA 5DN6A 1V5IA 1Z7WA 3NPAA 1J20A 3INTA 4OH7A 5KO2A 1GQSA 1MORA 1P7PA 3CCBA 3CX3A 1N6NA 4NY1A 3ZH2A 1T9GS 2J5QA 3BB4A 1SXPA 3DMTC 1SA0A 3TLBA 5DYYA 2OBMA 4OHOA 4EVQA 4O08A 1TRHA 1WTCA 2B6NA 2QRHA 2HV9A 3OG9A 1CE8B 1UIMA 1YNSA 3NB0A 5B53A 3S44A 1SN7A 1OX4B 1U3CA 1T4GA 3GVCA 2W8BB 1A9OA 2GYVA 1GCOA 4NFSA 3GZ4A 1HYQA 5AK5A 4HAIA 1U65A 2BFNA 1OH5A 1BMFA 2HCBA 1Z8DA 4XTRA 5H3CA 4C2BA 3I01A 4EX7A 5BWBA 4B32A 2PGLA 4D4IA 3IVGA 1QHYA 4GX0A 3QXJA 4Q18A 2QG9A 3UTCA 3DL7A 4C7OA 5ADUS 1HKUA 1T0JB 2G5TA 2ZWOA 1QUEA 1TPYA 1Y3AA 1Z12A 2N75A 1YOBA 2VQSA 2WAAA 1X1DA 4FDMA 3M1IA 5KYTA 5HSGA 2WF8A 5DLQC 4QODA 4DQKA 4PLHA 5GADl 3FNFA 2I71A 1R8SA 2R4UA 2BEUA 2VNKA 5KYXB 3URKA 5KNBD 4PYJA 1PDOA 4MYTA 4CFZA 5GIOE 4TXLA 1VL6A 1SXHA 4QFMA 1TZBA 4H59A 2P2ZA 5J2UA 3C6QA 3NP9A 3VV2A 3UUFA 2X8JB 5FQNA 3VPDA 4EPXA 3PC6A 1ZK0A 1TYCA 2Q41A 4H0NA 5EGNA 3L6BA 5HIMA 3TIFA 4X1YB 3UN1A 3ZI0A 4F6RB 1N92A 3WLAA 4D9CA 3SKYA 3CF6R 2Q5CA 1L7QA 5C0OE 4UMFA 3HJUA 3U4QA 1ELOA 2HDHA 5FWXA 4CKEA 3CLVA 1E6EA 4FMCB 4IDDA 5FNVB 2SICE 4FQ7A 3DLHA 3ZD9A 5DB4A 4Q9NA 2H6EA 3R7BA 2Y05A 1L6RA 3B6EA 3BB3A 3UHAA 2NO4A 2DQKA 4BAUA 2BFAA 3INGA 3WTCA 4UNQA 5JSZB 3PRJA 3DTVB 1VJGA 2B9EA 2QXUA 1JA1A 1ZN2A 4RL6A 3NHFA 3ZZ1A 3BWMA 1Q0ZA 4GWLA 3WLSA 4BMVA 1RSZA 1ESDA 1K8XB 1K8RA 3N74A 2GZRA 3QKRB 1U8TA 1Z4LA 1T9CA 4H1UA 5CH5A 2IV3A 1EA7A 3GQBB 4B6SA 4B75A 4D74A 2BGMA 3KL4A 2FXIA 1RQNA 1JDJA 4C20A 4QM7A 3HWWA 3ZTTA 3U9SA 1RQRA 1GPKA 2GESA 2WVHA 1TVKA 1XZEA 2FMKA 3N8NA 2FNAA 4R2MA 3WMFA 4ENUA 1MO3A 3USES 4Z4CA 2J3IA 1QIGA 2NU8A 2BGLA 1CJSA 2ZRFA 1THMA 1JEDA 2BKLA 2R1VA 3MHPA 4AZ0A 2YICA 4PBSA 2DFLA 2ZE6A 4E1BA 2FEOA 3I0ZA 2HA5A 3ZEIA 4MPJA 3BULA 1N7JA 3MM4A 3VKUA 3KETA 2F1KA 1Y7HA 1XDZA 2R48A 3IDAA 2H4YA 3E61A 3PITA 4RA6A 5AK0A 5F76A 2KX7A 3CUVA 4FNMA 4IKOA 4EB6B 3ABRB 3RYIA 1OFTA 3OIDA 4BNDB 2ZUVA 1ACMA 1TQ4A 4D80A 1PJQA 1XO1A 1W8DA 5BOSB 2P2DA 4DWWA 3S99A 4KAFA 3O3MB 1OD6A 4RW0A 1E99A 3MD0A 5KTNA 3WBJA 1NMEA 4ZOCA 3QENA 1F2TA 3WTBA 3LUAA 5LOVB 1QU2A 1R7RA 2YVQA 2DR3A 1I5OA 2B3DA 3DQZA 3I28A 4GICA 2L0XA 3SIWA 2H1WA 4I1PA 2HA7A 1WSAA 3LVQE 3KT3A 3QOWA 1ENZA 2Y8EA 3H1AA 2Q5EA 4G85A 4KXXA 1OXVA 1T8YA 1OIWA 2PZFA 4GYKA 4U2BA 1KO8A 4BLRA 4G0PA 4F06A 1RI4A 2ZDHA 3NWEA 2Z1MA 4UZEA 1L7RA 5ED4A 2H08A 3K1YA 4IVQA 4R0VA 4UBIA 4JC8A 4IPTA 2V6JA 4GM1A 3SLKA 2ZVDA 3KJIA 1RRGA 2D2IA 4R83A 1Z13A 1QKKA 3RRXA 5BN4A 3CZCA 3F96A 5I9IA 3I9V1 4BCDA 1W36C 4H3VA 6REQB 1PSWA 2I6QA 2L18A 1K86A 2YVUA 3T52A 4BU1A 5EIEA 4MQLA 1KSGA 1IN4A 1YI0A 4PZ9A 2OVFA 3ZJ4A 3G1TA 2I3GA 5HBGA 4D45A 4D5GA 4FYIA 1FDTA 4HZGA 1U2GC 1M2NA 1UJ4A 2A9JA 4AD8A 2XCLA 3K6JA 4RFSA 1FNNA 4NMMA 1KDZA 1G7SA 5ESRA 4B84A 1AO0A 1P74A 2J9FA 1HLPA 1XALA 4D92A 3S1AB 1RC0A 2X77A 2D2VA 4IXWA 4F4CA 3ICEA 1IPHA 5JY6A 2CC2A 5IUNC 3VX4A 2AYYA 4ZOLA 3S2SA 3ZHCA 4AMVA 3ZWBA 3TSZA 2V7VA 3N87A 1HXHA 5HZKA 3DE0X 2XITA 3T34A 4HDKA 3T1VA 1V25A 1ZINA 2ODBA 4RPIA 3QV1A 3PA8A 2KI5A 2ZS9A 2QDXA 3Q8XB 5FR1A 3AR6A 3NTRA 4BVBA 3H1BA 2BHTA 4UU1A 4F2DA 5BV2P 1L1EA 3ANMA 2P75A 1R10A 1U8EA 1YJCA 2ZYWX 3CSSA 1GIAA 1TD1A 2W43A 4ZRNA 5EIAA 3CLTD 3E7PA 4IFTA 5ALTA 1C1DA 5EE3A 5A4DA 3A4TA 1H2ZA 1OLSB 1SKAA 2P2SA 2PM8A 1HEUA 3O4HA 4QG7A 5T8KC 3VR6A 2QRMA 4YYEA 5JAIA 5KOHA 1M6NA 2QVZX 3C14C 4X3OA 1NLMA 3B3AA 1X7XA 3LX8A 1VL8A 2BI8A 2WT9A 3DGEC 3PGVA 1Y63A 5ALJA 1GG8A 4PZZA 3MUEA 2AJCA 4KP7A 3UOWA 2Z6QA 4X95A 3EXIA 1KAQA 1BS1A 2G0TA 3IP8A 4WI1A 3TGPA 3QSGA 3O2NA 1REQB 2AT1A 3REGA 1C30A 4F46A 5JAHA 5AW3A 1PR0A 5IUKC 1SCBA 2CWDA 2I7VA 3LO5A 4IGIA 3U60B 1EFVA 1YUNA 1GPAA 4LWPA 5T4FA 3QU9A 2O57A 4PZPA 1DKUA 2Q3LA 1FMCA 3A26A 4UEQA 1M54A 1BROA 4MIOA 4CXMA 1GEGA 2BC9A 3A06A 3N5CA 3P2YA 4FVTA 2TYSB 2WKSA 2Y77A 4INPA 3VH1A 1FJHA 4D9HA 1JR6A 2EYUA 4V0QA 4KO3S 1JSCA 2V1XA 3VAZA 2XKAA 4MW2A 4J3NA 1SIWA 1SD5A 1FPMA 3L7OA 4X8LA 3RBXA 3CT4A 3BXPA 1DQRA 1UMBA 2XXBA 1QC5A 2B34A 1WSDA 2XT0A 4K7JA 3ZH9B 2WHRA 4EY3A 2PVPA 2HREA 2ZETA 4RAQA 3F5MA 2J9GA 4NHOA 4K2HA 4OK5A 3R5HA 2JLSA 2ZWAA 3ROEA 2V5VA 4M7RA 2R7LA 2AMVA 4UVIA 4EARA 2P2LA 1EKXA 3U13A 2AN5A 1U5BA 4DWJA 2BGRA 3BMXA 3I1YA 3ZE0B 2OHFA 1NRXA 3A9UA 3FCXA 4KIGA 3TVDA 1NLYA 4EPRA 4LFAB 1YDGA 2G8LA 1L7PA 2GNOA 3SX4A 4BP8A 5KKNB 1AUXA 1L7NA 3Q3VA 3GMIA 1S2IA 1E8MA 4J03A 1G21E 4XOIA 4WESA 5LLDA 2W2XA 4WA8A 5C34B 3E22A 4COKA 4KX3A 3UJ3X 3IS3A 3TVYA 4PQRA 2BELA 2KQUA 5ICMA 4V38A 4GSYA 4BX9A 2CCJA 3QYAA 2H8GA 1DIGA 3JD0A 4ZO8A 1FEZA 4DCNA 4ZGBA 4XIIA 1DO8A 2WD8A 2BEVB 2OAEA 1ZVMA 4KQIA 4GI3A 3AHFA 1JB9A 1G7RA 5DRTA 3FYDA 5HKKD 2ZATA 3WKBA 1QOPB 1J8FA 1DRWA 1U7WA 2ZRQA 4IYJA 1H6AA 3K92A 3WY9A 5AXDA 4CL2A 1KQ3A 3E70C 4TN5A 3TRIA 1LB1B 1JSZA 4BMYA 3HB7A 4GR4A 2VJPA 1Q44A 4DQXA 1ODKA 2Q3MA 2QSJA 2CW5A 3TL6A 2OYSA 2YNMA 1WP4A 4DMUB 2A9KA 1GYPA 3M2TA 2QUIA 2XTMA 4QAJA 4U7JA 3VNUA 1JHAA 2A1TR 2O5VA 3OO0A 3CG4A 3Q8MA 1ZR2A 1KWKA 1JLMA 2HU8A 1ZUNA 3E15A 5L7WA 3F8TA 3R20A 3RJMA 2PZBA 1KKMA 1KKLA 3IDOA 1GRCA 2QVYX 4C30A 3KZKA 2A9QA 2GILA 2CMKA 1GT91 3BMQA 3IPAA 4FS3A 3BM5A 3AZOA 4U2KA 3T41A 1LPMA 2IRWA 3VJMA 2FCAA 3ROFA 3INNA 4BIMA 4PV7A 5EVJA 4JP8A 5CT6A 4YRBA 4CF7A 4LGMA 4GLOA 1PFUA 1BHO1 2NVUA 5F7OA 4JL8A 2EWVA 3RWBA 2GEJA 3AP1A 4ISBA 1ZA1A 1PS9A 4B5LA 2WJAA 4QEKA 1XNQB 4D7AA 2QMZA 3UJ8A 5BN5A 1DIHA 3QU2A 4WWHA 5HUQA 1P73A 2VDPB 2IXFA 5FHRA 4ZQFA 1NAHA 3VR0A 3OJ0A 1DLIA 2C0CA 4YV2A 3NVMB 5ESXA 4CEIB 2CBZA 2G4CA 1UM8A 3MGKA 3JR3A 1A4IA 3SGLA 3CXRA 2FUG1 3HCAA 2Q3HA 3U1TA 4DLZA 2OPBA 2H4WA 4Z5XA 2Q1TA 3DVRX 1LRKA 1C9KA 1JIXA 4IS3A 5EXTA 1M34A 1NVXQ 2WSBA 3R3HA 3LPMA 3U3ZA 1DP4A 2UZIR 3WS7A 3N7AA 3ZHVA 2DFDA 2A0FA 2OV1A 4BVFA 1M2HA 3ZLAA 4HDKB 4Q48A 2XDAA 4XM0A 5EKDA 4LCBA 4DAOA 5KOJB 2XUHA 1G64A 4QU5A 4CKBA 1KERA 1NV9A 3NUZA 1GV0A 5HNKA 1K3FA 4RXMA 1N5LA 1IQ0A 4KOEC 1KJ9A 4YMSA 2YOGA 3EGDA 5ELMA 1ZD1A 3VZQA 3WA6A 3HFSA 2OBXA 1WUIS 4YRKA 3SVLA 1CUVA 6LDHA 4GYJA 4TTSA 2O7SA 3REQA 3GEDA 3ISTA 2X6TA 1Q83A 4JL5A 2PWZA 1IUOA 1FSSA 1MIOB 1X38A 1NM5C 5KU7A 2WT4A 3ENNA 4PG7A 2WP0A 2AJ8A 2X76A 2YDYA 4Q4HA 3GLGB 4YAUA 3RYIB 1G59A 3IAS1 4D3FA 1UT6A 5HCNA 1WB5A 1OGJA