4BKSA

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
102
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
molecule tags Protein transport
source organism Homo sapiens
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
total genus 27
structure length 102
sequence length 103
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bksA00
2K6QA 2MWSB 2LGXA 4NQLB 1T0YA 2GBRA 1WR1A 2NPTA 4KIKB 1BT0A 5DPTA 3R7QA 3AULA 2CS4A 2LRUA 2RPQA 5LXIB 2ZNVC 2K39A 2MCNB 2KFKA 2Z59B 1CMXB 1YX5B 3H1UA 2L7RA 2BYVE 4BKSD 2KMAA 2KOXA 1V2YA 2M0XA 4IM2A 3ZNZB 4JLCA 2L76A 3T9LA 3ZNHB 3KVFB 2EMTA 5JZEB 4WJPA 3AU4A 2OOBB 2GMIC 4X57B 3PHXB 2NR2A 4ZRIA 4TV3A 2AWTA 4HLEA 2R2OA 3JSVA 1RAXA 1OQYA 2NBUA 4NY0A 3C0RB 1E8WA 1UGMA 3BY4B 3K9OB 1IYFA 2LVOA 1MG8A 1UELA 3VUXA 3ZDTA 1ZGUB 2CHXA 5AZGA 3PZDA 5G55A 1XQQA 4HCPB 4DHJB 2D3GA 1RLFA 3H9DA 1KJTA 2O6VA 2FCMA 3VH4B 1Z5SB 1ZKHA 2O6VD 2G45B 3DDCB 2LRWA 3KH0A 3KYCD 3QWZB 3WIMA 2FCNA 4PYZA 2IBIB 1V5OA 3VVWB 2XK5A 2KJHB 1WMHA 3ZRFA 4WAAA 3VFKA 4KZCA 3DBRI 3TCAA 2WDTB 3ZDMC 2VRRB 4MSMB 2KNBA 3W1YA 4TKNA 3EC8A 3V61A 3KUCB 1UZXB 1LXDA 4F7ZA 2J7QB 1L7YA 3L17A 4W9EA 3V62A 3EHVA 2QHOA 1WXSA 3WAMA 5JH5C 4NQKE 4KV2A 4XX5A 3SU8X 2KN5A 4GDKB 2M17A 4G3XB 1UH6A 2KJ6A 4IWQA 2KC2A 2GBMA 1G6JA 3ZNID 3TJPA 4K7SA 4G0NB 2DZIA 3IBEA 1WY8A 2HD5B 2O2VB 2JVCA 1EF1A 2FAZA 4B9KA 2KX0A 2ASQA 3EECA 5E6OA 3KYDD 4XC2A 2OJRA 1UBIA 4BVUC 1C1YB 2J0JA 2N7EA 3ZIMA 1Q0WB 4W9KA 2ZNVB 1WXMA 4AJYB 4FJZA 1NI2A 5CTRC 5DCNA 3QIJA 3M3JA 2HTHA 4MELA 4HVBA 4PS3A 5GMVA 4ZDVA 4W9JA 2ZVOA 3MTNB 2WWZA 2XK5B 2AEHA 4FHKA 4II2B 5TR5A 4AP4C 4DWFA 4MGIE 2IO1B 3SD5A 2JF5A 5JHBA 1ISNA 3X0WA 3LJ3A 4BOZB 3QJZA 4DHZE 2N9PC 1NBFC 3TMPB 3DBSA 1V5TA 4RM8A 5CHVC 4EOYA 4CHKA 4IUMB 3DVNV 3WALA 2ZEQA 5D2MB 3DBHI 1PQSA 3UF8A 2ZZPB 3VQIA 4ICUA 2Z0DB 2KMCA 2D11A 2IZVB 4MGYE 3PT2B 4BKGA 4MJSB 3HHMA 4MDKE 3JSVB 4A3PA 3VDZA 5IA7A 2YVCA 3PRZA 4BKSA 2KWVB 3TBLD 4KVGB 3HM3A 1Q1OA 3DVGX 1E5WA 3M62B 4EFOA 1RFAA 1TBEA 2IO2B 2FIFA 3OJ3A 2KFJA 2KJRA 5CHWA 3WANA 4E3CA 4DK5A 2KVRA 4PYUA 1WZ0A 4NJ7A 2ZVNA 3UIOB 3VUWA 2RGFA 1HE8A 5DPSA 2IO3B 2C7NB 2BYEA 1WE7A 3L16A 4BBNC 2AYOB 2MQJA 3T8MA 1YX6B 4M0WB 2V3SA 1M94A 2KLGA 2JT4B 2KD0A 2NPTB 4MH0E 4NJ6A 4WQOB 1FXTB 4ANUA 1KOTA 4A3OA 2DAFA 2GBKA 1YJ1A 3NOBA 2KTRA 4I6NB 4EEWA 4YL8A 2O6VB 3ZVVA 1F9JA 3QQ8B 4LDTB 1E7VA 4W9GA 1KM7A 2KK8A 2PE6B 4NAWA 3IG3A 1GG3A 2DZKA 1U4AA 2C5LC 3A1QB 4GGQA 4HPMB 3QCAA 2LI5A 4W9LA 1YD8U 3NZSA 3SHQA 4HXDA 2BWFA 5LLIA 2DZMA 2C60A 4HDOA 2PEAA 3LDZE 4MEMA 2L8JA 1R4MI 3ONSA 4FHJA 2DAJA 4DDGD 3HM6X 3W1SC 1E90A 1IP9A 4GMVA 3UINB 1D3ZA 4W9CA 2NS5A 4NAWB 1P3QU 3WAPA 2D07B 2KQ7A 4IC7B 1WF9A 2JZZA 3DBLI 3IVFA 3JVZX 4KSLC 3QK0A 4HDQA 4OVUA 3O65B 2O2VA 5DPRA 5J2RA 3H7PA 4E74A 3DOWA 2R2QA 4AOFA 3APCA 2MSED 4ICVA 2N1WA 1VD2A 4G11A 5KHOA 3QX1A 4JGHB 2CHZA 1YIWA 2RD0A 3DCGA 4I6LB 3VH3B 2B3AA 4MGZE 1WIAA 4GDKA 1GUAB 1XD3B 2DHZA 3ML9A 2N9XA 5LXHA 5C1ZA 3B0AA 4G50A 3UGBB 2IO0B 2KLCA 3V6CB 5DPWA 2MLBA 1J19A 3KW5B 2MBBB 2KZRA 3CF6E 2L0FA 4GU2A 1WX8A 2CU1A 4BOSC 4M8NA 2GBNA 4HWIB 1EUVB 2DENB 2JRIB 5E6PA 3ML8A 4TQ1A 1R4NI 3OAWA 3CSTA 4BBNF 4W9DA 4FADA 1E8ZA 2KTRB 2K8CA 3PGEA 4B6WA 4IG7B 3PTFC 1SGHA 4IM0A 4DHJD 4LDTD 2J0KA 5L83A 2DYBA 3NS8A 5D94A 3PS6A 4BKTA 3TL5A 4EKUA 5IAAC 2FCQA 3PLVA 2WX0A 1WX9A 5BO4B 3RUIB 3JW0X 3R66C 2FCSA 3NZUA 1WH3A 2XEWA 2WYQA 4HCNB 3VAWA 1EO6A 5AZHA 3DVNU 2ZCCA 4EZKA 2G4DB 2KDFB 4DBGA 4WJNA 3PV1A 3V6EB 1P1AA 4MJSA 2BKRB 2LUEA 2JZ3B 5E6NA 4KSKC 4GIVA 3N3KB 2JRHA 2D10A 2NBVB 3RD2A 2PE9A 3U7DA 3RT3B 3KUDB 1H4RA 3DVGY 3B1LX 2KHWB 4GN1A 1V49A 4LCDE 1WRDB 2KDIA 1TGZB 5D6JB 3H7SA 1WX7A 3Q3JA 1WM3A 3K9PB 4A20A 4IWPA 1V86A 1V9JA 4F1SA 4GDLB 1E8YA 2RR9A 4RM9A 3H6NA 3UQBA 1WGYA 2HE7A 4AWJA 3TIXA 4K81A 1I42A 2M8SA 5AZFA 5C23A 5EDSA 3VHTC 4EZLA 2I1KA 4MM3A 2AL6A 3U8ZA 2FNJB 1QZEA 3A1QA 2WX1A 2K1FA 1Z2MA 2N9EB 3VTUA 4ANVA 1LM8B 1WXAA 2C7HA 3RZWC 4ZYNA 4WWPA 1P9DU 4TQ0A 4IWOA 4J6IA 2DX5B 2RSUA 2K8HA 1KLVA 2G3QB 3GOEA 3S2AA 2K8BA 3D32A 2C7MB 5L95C 2FUHB 3PREA 3ZTDA 3RYTA 2ZJDA 2KDEB 4M8MA 4CO7A 3IFWB 3X23A 2D2QA 1E7UA 3QC8B 3A33B 4MSQB 1ZW7A 3R7RA 2MBEA 3ZRCA 2Z0EB 5KHQA 3RCZA 1WJNA 4JIOU 3HIZA 3N30A 3ZLZA 2MBHA 2BGFA 2KTFA 4FJVB 4K1RB 3SDLC 3AU5A 4LJPB 2C9WB 4FULA 3OLMD 2IYDB 1WMHB 2J0MA 3VUYA 3MHSD 1WYWB 4URKA 4PS8A 2DYMA 3L54A 4W9IA 2JWZA 2LGDA 1OTRB 4ANWA 2UWQA 1TTNA 4FLHA 2UYZB 4ZRKA 3VTWA 4FA6A 4TUUA 2KWUB 3PLUA 4HJKA 3VXWA 2EMSA 2N1VA 3QHTA 3QA8A 4EUTA 3APDA 2MX2A 1J0GA 2MW5A 4II3B 1GJZA 4JQWC 1LFDA 2KANA 3AXCA 1OEYJ 3ECIA 2JPHA 2JY6A 4AUQC 2IY0B 2AL3A 4KDIC 2PPHA 2LJ5A 2CHWA 1UD7A 2I1JA 2LXCA 2W9NA 2GBJA 1WZ3A 5J17A 3UQAA 4DDID 1YQBA 3M63B 4OVVA 1GNUA 3ZUNA 4WJQA 2MRPA 4CYEA 1J8CA 2ZPNA 3M95A 5J18A 3VTVA 1RRBA 2ZPYA 2PJHA 5D7GA 3WAOA 4GOCA 2BKFA 4NPNA 2KC1A 3PPAA 4KIKA 3I3TB 3A9JB 3L08A 3NHEB 3WA0A 2LD9A 4HPLB 1WXVA 3N32A 3OJ4B 3ZKJC 2A5UA 1WR6E 2NVUI 2LVQA 2K25A 3ZO5B 2JXXA 3CSFA 3W1SA 3ZNGC 3ZTCA 1C3TA 1S3SG 3Q3FA 1SIFA 1JRUA 3IHPC 5G2NA 4GSWA 4ZRJA 2LWPA 2MA9B 1IPGA 4RMAA 4MGKE 2L00B 3V60A 2LZ6A 3RZFA 1WGHA 2KDBA 1X1MA 2Y5BB 3JYUA 1Y8RC 4GXBA 2BPSA 2KXJA 3DQVA 3PRPB 1H8CA 1I35A 3EFUA 5FR6A 4WWOA 2KO3A 3MJWA 1L2NA 5CX3A 4WWNA 3R3MA 2LVPA 1WGDA 1XT9B 4N9F4 3L0WB 3KUZA 1Q5WB 4K7WA 3P2BA 4F8CB 1P98A 4I6PA 4FN2A 2KFKB 2K6DB 4W9FA 4LJOB 2M1MA 3BINA 2MP2A 4ANXA 1GC6A 2V4LA 4B95A 2V1YA 1OEYA 3A9KA 2KKCA 1SE9A 3AI5A 1WGGA 3ALBA 3HK0A 3PHWB 1NDDA 1WJ6A 1WFYA 4NNJB 1LQBA 2CKHB 3B08A 3L13A 1AARA 1WM2A 2KQSA 2BF8B 2N7DA 3GZNI 3U30A 3ZW3A 3QARA 4EZJA 3A4SC 1VCBA 2LXAA 2NCNA 4WJOA 1OGWA 2MBOA 2DZJA 4AJWA 2REXA 1E8XA 2MBQA 3PRMB 2DYOA 5AEKB 4E71A 1WGRA 2BYFA 2HJ8A 2LGYA 2M4NA 3A9KB 2XBBC 2A4ZA 1WJUA 5HKHA 3H7PB 1V6EA 4BFRA 1WJ4A 2JUOA 2G4SA 2L05A 1WI0A 4JL9A 1TZ1A 3PVLA 3A9JA 2CR5A 1S1QB 4W9HA 2LASA 1K8RB 4HK2A 4IM3A 3RULA 2YLMA 1A5RA 4KZ0A 4IW0A 2MP2B 2L0TA 3PSEB 1P0RA 3L10B 1GC7A 3DPDA 2EKEC 2GOWA 4K7UA 4FJYA 2N4FA 2NBWB 4KDLB 2L3ZA 4GB9A 3APFA 4DHZB 4PS7A 3UIPB 5JHAA 4FBJB 2IY1B 1UBQA 2FIDA 2ZCBA 1V81A 3CMMB 2BWES 4DXAB 1EF5A 4P7IA 4XZ4A 3NY5A 3A4RA 3QAQA 4GDLA 1V80A 2KWCA 3ENEA 4ASWC 1WE6A 5CHFA 2KX3A
chains in the Genus database with same CATH superfamily
2LGXA 3R7QA 4KIKB 1BT0A 4N58A 1YX5B 2L7RA 1OFFA 4BKSD 2KMAA 2KOXA 2TSSA 2L76A 5JZEB 2OOBB 3EA6A 4TV3A 4HLEA 1RAXA 1OQYA 2R61A 1HA5A 1IGDA 3K9OB 1MG8A 3NS1A 1WWTA 5AZGA 2G1EA 3H9DA 5HG2A 1KJTA 1Z5SB 1ZKHA 3DDCB 3QWZB 4REZA 2BB6A 2ICIA 3ZRFA 4WAAA 2KMMA 3RN9C 4JPSA 1ZDVA 4ZRQA 1XO3A 1GB4A 4TKNA 3EC8A 3V61A 1UZXB 4F7ZA 2J7QB 2BT6A 2D5GA 4NQKE 2RMMA 4XX5A 1JWSD 2KC2A 2GBMA 3OWEB 1G6JA 3ZNID 3TJPA 4K7SA 4USAA 3FILB 2FAZA 2MJDA 3ABVB 3DHGC 4A6QA 2OJRA 4BVUC 1C1YB 1VR9A 2J53A 2ZNVB 4D2KA 1WXMA 5CTRC 3NVVA 3MTNB 1XLPA 1AWDA 4MGIE 4RCOA 2JF5A 5JHBA 1NBFC 4QAYA 1V5TA 4RM8A 1JWMD 5CHVC 4CQNA 4CHKA 1XLQA 2YEPB 3DVNV 3AV8A 3WALA 3B9JA 1PQSA 3NRZA 4ITKA 2D11A 3DHIC 5C2TB 4BKSA 3TBLD 1Q1OA 2QSDA 3M62B 2E6XA 2FIFA 3DWGC 2KFJA 5CHWA 4C00A 4PYUA 1TIFA 2FUG1 3L16A 4BBNC 3T8MA 1YX6B 2V3SA 1M94A 4WQOB 1FPYA 2DAFA 2KTRA 1SEBD 2O6VB 1C4AA 3U7ZA 4L23A 1V1PB 3VR9B 3O13A 3QCAA 3NZSA 2DZMA 4DXFA 2C60A 3I5JC 1RWSA 4KGTA 4FHJA 4WIPA 2H89B 1FMAD 3Q2AC 1E90A 1IP9A 3UINB 4W9CA 2NS5A 1P3QU 3WAPA 2KDMA 1WF9A 3JVZX 3IVFA 3Q6BA 1SB3C 1VD2A 2JWUA 1MJDA 1YIWA 3VH3B 4I6LB 1NEKB 1WIAA 1XD3B 4M00A 5LXHA 5C1ZA 4WH4A 2PKOA 1JWUD 2IO0B 3ZJVA 2MLBA 2G9HD 2WXMA 4GU2A 3N20C 1EWCA 2BS2B 2JYTA 2UU7A 4IOIE 5E6PA 3AEEB 5AUIA 4W9DA 4FADA 2KTRB 1N61A 3PGEA 4IG7B 3PTFC 1ZXHA 4LDTD 3DBHB 1E7PB 1LGRA 3R2TA 5D94A 3PS6A 2CJOA 2WLBA 2FCQA 3PLVA 1WX9A 3Q8BA 5EE1A 4A9AA 1HTOA 3NZ3A 4WJNA 3GP7A 1P1AA 4LNOA 5E6NA 3KWVA 2D10A 1L6UA 3U7DA 4ARCA 1T0SC 2MH7A 3DVGY 2PIAA 4GN1A 1V49A 3UI3A 5D6JB 1WX7A 4A20A 4HKZE 1ENFA 4WQMA 3UQBA 4AWJA 3VRBB 3AEBB 5AZFA 5JXVA 3TEYA 3U8ZA 2N9EB 3VTUA 2QILA 4TQ0A 4IWOA 3VRAB 2G3QB 2C7MB 4CO7A 2I2YA 1FM0D 4MSQB 1NENB 3ZRCA 2KTFA 4FJVB 3SDLC 2C9WB 2IYDB 1L4ZB 3AE7B 4NAMA 2DYMA 3L54A 4W9IA 4YSYB 4ANWA 3RNBC 4DXGA 4KKIA 1B9RA 4ZRKA 4TUUA 2I38A 4HJKA 3L4PA 4EUTA 3Q14C 1J0GA 1IBXA 3APDA 1GJZA 4JQWC 2INDC 1OEYJ 2JZPA 2IY0B 2AL3A 3HUIA 2LJ5A 1UD7A 2I1JA 2JQRB 4XGAB 2GBJA 5BYRA 4MT5A 4S17A 3AEGB 2ZW0A 1VRAB 2B76B 2MRPA 4CYEA 1YQ3B 1VZ6A 2M19A 2WXOA 3VTVA 3WAOA 2BKFA 1FXAA 3PPAA 2K9XA 1V1OA 3AE2B 3J9CA 3NUHB 1HZ5A 1FNVA 1YN4A 3W1SA 3ZNGC 3ZTCA 1S3SG 1SIFA 3IHPC 1VLBA 4JX1C 4RMAA 4MGKE 2L00B 2LZ6A 2KDBA 1EWYC 1X1MA 1Y8RC 2BPSA 2KXJA 2NMQA 3EFUA 3MJWA 1C79A 1L2NA 1YN5A 5EE0A 4IDIA 3R3MA 1SXTA 3P42A 4K7WA 4P16A 1P98A 4FN2A 2M1MA 3BINA 2MP2A 2WHIA 1GC6A 2V1YA 4XYCA 1SE9A 3ZJUA 1ESFA 1NDDA 1WJ6A 1WFYA 1LQBA 3L13A 3ZW3A 1FNUA 4EZJA 2NCNA 4WJOA 1E8XA 1JQ4A 1UUPA 2LGYA 2XBBC 1TKYA 1V6EA 4HPPA 2WXHA 2G4SA 4JL9A 1HXYD 1TZ1A 3A9JA 4IM3A 3LXFA 1A5RA 4FXCA 3DWMA 4P1CC 2PVGC 4K7UA 4FJYA 4KDLB 3AE3B 2ONQA 3BK1A 1PGXA 3MC9A 3IAM1 2WXNA 5T8IA 4JE3B 4P7IA 2KYWA 1V80A 2WDQB 1WE6A 2K0PA 1T0YA 2GBRA 2LFIA 3AE4B 5LXIB 3AULA 2CS4A 2RPQA 4C80A 1TY2A 1VJKA 2QJLA 2MCNB 2KFKA 2Z59B 1CMXB 3AE6B 2VH2A 1V2YA 3N1ZC 4JLCA 3ZNHB 3AU4A 4X57B 1EU4A 1QKZA 3C0RB 1UGMA 4XWWA 2HTME 3GE3C 5G55A 4HCPB 2D3GA 3VH4B 3KH0A 2V3PA 4KGRA 3WIMA 1YOVB 4K3CA 1PDXA 3MC0B 3VVWB 2XK5A 1HQRD 1WMHA 4OVZA 3DBRI 3ZDMC 1SJED 4MSMB 2KNBA 3W1YA 3V62A 3EHVA 1T3QA 3EGRA 4KV2A 5IO9A 1SE2A 2M17A 3TEXA 1T5XD 1UH6A 2KJ6A 4IWQA 3EUB2 3SFEB 4TMAB 2DZIA 1TZOA 3IBEA 3MC8A 2ASQA 3KYDD 4YTPB 1ZP0B 1UBIA 2J0JA 4W9KA 3H8HA 4AJYB 4FJZA 3MHZA 3QIJA 4MELA 5TSSA 4W9JA 2ZVOA 4FHKA 1V1PA 3AM9A 5HFYA 3LJ3A 3BIID 2IPKD 4KKJA 2NTSA 4OHJA 3UF8A 1XLOA 2INPE 3VQIA 2D3CA 2LJIA 2Z0DB 1FEHA 3PT2B 4BKGA 2BBCA 3PZ8A 1C9FA 5G5GA 1E5WA 3OJ3A 3RFZB 4NJ7A 1DYQA 5DPSA 5MPOA 2IO3B 2SEBD 2EKIA 4AS1A 4M0WB 2JT4B 2NPTB 1V97A 1KRHA 4O1NA 3NOBA 4W9GA 1E7VA 1I4HA 1KM7A 4NAWA 4YT0B 4PT5A 1JROA 1MFWA 3LDZE 4MEMA 1SJHD 1MG4A 1E6EB 4YSZB 2IDYA 3W1SC 1L6VA 4NAWB 3GB1A 3P4SB 1JW9D 2L32A 3AEFB 3DBLI 4KSLC 2KQ4X 3C19A 4BAXA 5DPRA 3H7PA 2CJNA 2MSED 2N1WA 4G11A 3ZXRA 3C8YA 2NTTA 2CHZA 2B3AA 4GDKA 5EE3A 1FNWA 2BW2A 3GE8C 3UGBB 2KLCA 3KW5B 1J19A 2MBBB 1WX8A 4BOSC 2GBNA 4HWIB 1EUVB 4TQ1A 1UF0A 1E8ZA 3T3OA 2BYTA 3W5VB 3ZYYX 5L83A 2DYBA 2MJEA 4EKUA 3TL5A 2V3NA 3DBRB 4HCNB 3VAWA 2K3UA 2JU6X 3DVNU 5AZHA 2G4DB 2KDFB 1D5ZC 3V6EB 1YN3A 2JZ3B 2AQ1B 2X38A 1SF0A 3N3KB 2JRHA 3RD2A 4R3DA 3KUDB 1C76A 1H4RA 3E56A 3P4RB 4IKGA 1OQRA 1UGJA 2KDIA 1WSPA 3H7SA 1I4RA 2WDRB 3K9PB 1V86A 4GDLB 2RR9A 4A55A 1FRRA 2AQ3B 2M8SA 3TSSA 2I1KA 1J7AA 1JWBD 1CJEA 4Q2JA 4WURA 4HRSA 1MHHE 2WX1A 1XXGA 1Z2MA 2V9HA 3FILA 3AE5B 1XCQL 1TS4A 1WXAA 2LMCA 2L52A 3RZWC 4WWPA 4RGTA 1KLVA 3PREA 2HDEA 3ZTDA 3RYTA 2ZJDA 3FC4A 3X23A 4B0MA 2D2QA 2QCZA 1ZW7A 2MBEA 3HIZA 3Q8AA 2MBHA 1DGJA 3AU5A 4C4VA 2KAJA 3MFGA 4PS8A 2LGDA 2M0AA 1OTRB 1AN8A 2KVZA 1K51A 2EMSA 3QA8A 1V8CA 4YTMB 2BS4B 1ACCA 4KX6B 1YMHE 2L1AA 2JSVX 5G5HA 3SFDB 2W9NA 1WZ3A 5J17A 3FAHA 1YQBA 1VDVA 1FO4A 1GNUA 3ZUNA 5BMIA 3N1YC 1SE3A 5D7GA 4NPNA 4KIKA 1R7SA 4YTNB 2CU3A 1F2RI 3NHEB 3WA0A 1C4CA 3N32A 2A5UA 4RFBA 2K25A 4LK0M 2QC8A 4GSWA 4ZRJA 3V60A 2WQYB 2H88B 2XNAC 3AB5A 3JYUA 4GXBA 1UWMA 2BB5A 5CX3A 4WWNA 4N9F4 3L0WB 3KUZA 3BYTB 2E3TA 3IT6B 2K6DB 4ANXA 3URYA 1ZOYB 1OEYA 1WGGA 4C4VB 4NNJB 4XDCA 2LHEA 3B08A 1WM2A 2KQSA 2N7DA 4UDUC 1SBBB 3A4SC 2LXAA 2INCC 1NYQA 1WGRA 3BK2A 2HJ8A 3A9KB 3AE9B 2FBWB 3NVWA 2A4ZA 4L2YA 2N9LA 2LASA 5H92C 2M56B 4KZ0A 1E9MA 1I4XA 2L0TA 3PSEB 1P0RA 2GOWA 2OEDA 2NBWB 2LUMA 2L3ZA 4PS7A 1FRDA 2QEJC 3CMMB 1EF5A 4XZ4A 3QAQA 3V3XA 3RPFC 1F0ZA 3ENEA 3PVLA 3EFCA 3MHSD 2K6QA 2MWSB 1N62A 5DPTA 1WR1A 3I9V1 5H8YE 3AEDB 1SE4A 1D4BA 4ZRPA 4OW0A 2GLSA 2M0XA 3ZNZB 5IN7A 4AQ7A 3KVFB 4WJPA 2GMIC 3PHXB 2NR2A 4ZRIA 2AWTA 3JSVA 2PMVA 3RMKC 3W9CB 1E8WA 3BY4B 3NG0A 1IYFA 2LVOA 1UELA 3ZDTA 1QF6A 1ZGUB 2CHXA 3PZDA 4P1BC 4DHJB 1I4PA 3VR8B 2O6VD 2G45B 2FCNA 1N63A 2WDTB 4N59A 3KUCB 1LXDA 2QHOA 1WXSA 3WAMA 4M02A 3SU8X 2RDBC 2O2VB 2IGDA 2JVCA 5D3IB 5E6OA 3E9SA 3GZNB 4ZOHC 3BZDB 1FCLA 2N7EA 3ZIMA 3CWIA 1WRIA 4YSXB 1GPXA 5BYSA 4HVBA 2HTHA 4II2B 4DWFA 4TSSA 1UWXA 1WXQA 1ISNA 3X0WA 4BOZB 3QJZA 4DHZE 3DBSA 4S0RA 4ACFA 1PUTA 4EOYA 4A90A 1JRPA 1IGCA 3DBHI 4C7ZA 2ZZPB 3I63C 1XCTL 5FK9C 4MGYE 2KWDA 2ON8A 3HHMA 3JSVB 4A3PA 5IA7A 1EU3A 2RPVA 2YVCA 3MP9A 4KVGB 3OG5A 1F52A 1FXIA 1YNTE 1PGAA 4NZLB 1EM7A 1BXTA 2W82A 2KJRA 1T0QC 3WANA 4E3CA 2KVRA 1TYGB 1WZ0A 2ZVNA 2BYEA 4MH0E 1FXTB 4LNKA 2GBKA 4I6NB 1L0YB 5FR3A 1F9JA 4LDTB 2QIEB 3IG3A 4MH8A 1U4AA 3A1QB 4HPMB 4GGQA 2LI5A 4W9LA 3SHQA 1J7BA 3B2FA 2WU2B 2AQ2B 2L8JA 1KTKA 2XN9C 1R4MI 3RI7C 2RDHA 4GMVA 1TS2A 1QLBB 2D07B 2KQ7A 1K52A 2JZZA 1D6EC 3QK0A 4KGSA 1HZ6A 3MJ5A 4OVUA 2O2VA 5J2RA 1E0ZA 3U2SC 4L1BA 1K53A 3APCA 2YEPF 1L4DB 3QX1A 3DCGA 4MGZE 1WGKA 1B1ZA 1XEEA 2WNMA 4A8XC 3SEBA 3U52E 2N9XA 2V4IB 3B0AA 3V6CB 5DPWA 3BVZA 4JWUC 2BTEA 2L0FA 1N5XA 1UNSA 3ETRA 2QDFA 5FKAC 5BMGA 2JRIB 1R4NI 3AE8B 3N1XC 2K8CA 2ACZB 5EE9A 4IM0A 1CQVA 1YQ4B 3IAS1 2WX0A 5BO4B 3R66C 2FCSA 1WH3A 3TUOA 2WYQA 1EO6A 3Q3NC 2ZCCA 1TKGA 4MJSA 3CIRB 5BYQA 2NBVB 1JWAD 3T3NA 3RT3B 3N9YC 4RF0A 3PO0A 3B1LX 2KHWB 4LCDE 1TGZB 2WU5B 4IWPA 2AX5A 4ARIA 1V9JA 1PGBA 1Y56A 2HE7A 3V05A 3TIXA 4NJCA 1I42A 3VHTC 4MM3A 3RNCC 2J52A 1HTQA 3HRDD 1QZEA 1I7HA 4P6VF 4ANVA 2C7HA 2D3AA 2Y5PA 4ZYNA 1P9DU 2WXRA 1F77A 1OQQA 4J6IA 2DX5B 2K8HA 3HVZA 3GOEA 2BQQA 3S2AA 5L95C 1TT5B 4M8MA 3IFWB 1E7UA 1I4GA 3QC8B 1HEZE 2WXLA 3P4PB 2Z0EB 3RCZA 2INNE 3N30A 2BGFA 5IP4D 4FULA 2J0MA 1KLUD 1IBXB 1WYWB 4URKA 2W3SA 2JWZA 1FFVA 1L0VB 2WXFA 3VTWA 1QOFA 3PLUA 3VXWA 3QHTA 2JYEA 2KANA 3AXCA 3ECIA 2JPHA 4AUQC 4OZCA 1ROEA 2PPHA 1ZDXA 1FD6A 5I4DA 3UQAA 4PK1A 3M63B 4YWGG 1F1HA 5IKCM 2ZPNA 1R4MB 4K3BA 3Q8CA 2ZPYA 3PZ7A 3I3TB 3L08A 4XWTA 3DHHC 1WXVA 3ZKJC 2LVQA 4M01A 3AMZA 1FIQA 2LWPA 1RYJA 2N7JA 2N0SB 1I35A 4JWSC 1KH0A 5FR6A 3Q69A 2KO3A 4WWOA 3BYYB 2WXPA 2W3RA 1L5PA 1XT9B 1Q5WB 3P2BA 4F8CB 2Q5WD 2KFKB 4LJOB 3RNAC 4RGNA 2KKCA 3R8BA 3ALBA 3HK0A 3PHWB 2GI9A 3GZNI 3U30A 1OGWA 2DZJA 4AJWA 2MBQA 2DYOA 5AEKB 3P63A 5HKHA 1WJUA 3H7PB 4RH6A 3AEAB 3TEWA 2JUOA 1S1QB 1RFKA 4W9HA 3RULA 3BWUD 2YLMA 4MM3B 2MP2B 1DOIA 3DPDA 1JCKB 1TS3A 4GB9A 1TJEA 3APFA 4DHZB 5JHAA 4FBJB 2IY1B 1UBQA 2ZCBA 4DXAB 3NVYA 1NI3A 3RNGC 1A70A 1ZPSA 3NY5A 2Y5CA 3A4RA 4GDLA 2N9KA 4ZHOA 2BVCA 4ASWC 1ET9A 5CHFA 3TEZA 4NQLB 4DQOC 2NPTA 2LRUA 4US8A 1DOXA 4MACA 2ZNVC 2K39A 1ZUD2 1L0XB 3H1UA 3AECB 2BYVE 1MHXA 4IM2A 2X8XX 3T9LA 2EMTA 2OJWA 2R2OA 3ZGZA 2NBUA 2WXJA 4NY0A 2WS3B 1QT9A 2DWQA 3VUXA 1XQQA 1P7EA 1GOZA 1TKEA 1RLFA 1KFYB 1QOBA 1YJJA 2O6VA 2WGSA 1P7FA 2FCMA 3KYCD 2LRWA 4PYZA 2IBIB 1V5OA 2KJHB 4RF1A 1E10A 3VFKA 4KZCA 3TCAA 2SAKA 2VRRB 1AW7A 1ZE3D 2W55A 3IXSA 1DOYA 1L7YA 3L17A 4W9EA 2GRIA 1K50A 1CZPA 3ZQ4A 1N60A 5JH5C 1FFUA 2KN5A 4GDKB 3B2GA 4G3XB 2IJ0A 1ZXIA 1JMLA 4G0NB 1WY8A 2HD5B 2BS3B 1EF1A 4US9A 2IGGA 3WCQA 3HVDA 4B9KA 2KX0A 3EECA 1GB1A 3ZXVA 4XC2A 2PLPA 1Q0WB 2IGHA 2ZW1A 5C3JB 1NI2A 5DCNA 3M3JA 4ZDVA 4PS3A 5GMVA 5TR5A 1CK1A 2WWZA 2XK5B 2AEHA 4AP4C 1TY0A 1T6BX 2IO1B 1PFDA 3SD5A 1JALA 2N9PC 4WWMA 3TMPB 4IUMB 2ZEQA 2LHDA 5D2MB 1QOAA 2EELA 4ICUA 5E6JA 2KMCA 4XE0A 2IZVB 3NVZA 4MJSB 4MDKE 3VDZA 3PRZA 1WYGA 2KWVB 3HM3A 2WXGA 3DVGX 4EFOA 1RFAA 1TBEA 2IO2B 2JXTA 2DBYA 4DK5A 3UIOB 3VUWA 2RGFA 4RGMA 5D3DA 1HE8A 2C7NB 2PW9A 1WE7A 2AYOB 2MQJA 1BMLC 2KLGA 2KD0A 4NJ6A 4ANUA 3BVMA 1KOTA 1R4NB 4A3OA 1FCCC 1YJ1A 4EEWA 4YL8A 3RNEC 3ZVVA 4ZYSA 3QQ8B 2Z8LA 2KK8A 2PE6B 1GG3A 2DZKA 2Y3AA 2C5LC 4B95A 2W54A 1YD8U 1Q10A 4HXDA 2BWFA 2OHFA 5LLIA 2VZKB 2KT7A 4HDOA 1C78A 2PEAA 3AN1A 3NJTA 3ONSA 1LO5D 2DAJA 4DDGD 3HM6X 1D3ZA 3KWLA 4LNFA 4IC7B 3I57A 2J4XA 4HDQA 2LGSA 3O65B 4E74A 3DOWA 5BMHA 2R2QA 4AOFA 4ICVA 1KF6B 3Q3OC 5KHOA 2GB1A 4JGHB 2RD0A 1XF5L 4HKQA 4M0WA 3FKYA 1D5MC 1GUAB 2DHZA 3ML9A 4G50A 5IOIA 2KZRA 3CF6E 2VZKD 2CU1A 2K5PA 4M8NA 1SIJA 2DENB 3ML8A 1KLGD 3OAWA 3CSTA 4BBNF 3RNFC 4LNNA 1QOGA 4B6WA 5GXGB 4C56C 3Q8FA 1SGHA 4DHJD 2J0KA 2JX5A 3NS8A 5HHDG 4BKTA 5IAAC 2QMTA 3RUIB 3JW0X 3NZUA 2WXQA 2XEWA 2MHJA 4EZKA 2WXIA 4DBGA 3PV1A 2BKRB 2LUEA 3SR6A 4KSKC 4GIVA 4HJGE 2FE8A 2PE9A 1GAQB 2D3BA 4LTUA 3P4QB 1WRDB 1QQRA 1SSNA 3Q3JA 5HI1A 1WM3A 3Q3MC 3ZJTA 4H2AA 4F1SA 3IT4B 1D5XC 1E8YA 4RM9A 4BZAA 3H6NA 1WGYA 4K81A 1BUIC 5C23A 5EDSA 4EZLA 2LEKA 2AL6A 2FNJB 3GS2A 4RNAA 3A1QA 2K1FA 4LNIA 2HJ1A 1LM8B 2MEKA 3AE1B 1QILA 1VZ7A 2WP9B 3LB8C 2RSUA 4WAFA 4EE2A 2K8BA 3D32A 2FUHB 4RGOS 2PTLA 2J42A 2KDEB 2L83A 2RDGA 4XDDA 3A33B 3R7RA 2DLBA 5KHQA 1WJNA 4JIOU 1F2RC 3ZLZA 1C77A 4K1RB 4LJPB 3OLMD 1WMHB 3VUYA 1TS5A 3DBLB 2UWQA 4ZHPA 1TTNA 4FLHA 2UYZB 4N6EB 4FA6A 2DNFA 2KWUB 2N1VA 2MX2A 2MW5A 1C4PA 4II3B 2KACA 1LFDA 3KQ4A 3Q8EA 3R2IA 2JY6A 2V0GA 1MI0A 4KDIC 2CHWA 1T0RC 2LXCA 4DDID 4OVVA 4WJQA 1NVID 1J8CA 3M95A 3LYYA 5J18A 1RRBA 2PJHA 5AUKA 1J7CA 1RM6C 2LGIA 4GOCA 2KC1A 3BVGA 3W2DA 3A9JB 2LD9A 4HPLB 3W5UB 4HROA 3OJ4B 1WR6E 2NVUI 4C7YA 3P1MA 3ZO5B 2JXXA 4J3OD 3CSFA 1C3TA 3Q3FA 1I4QA 1JRUA 5LNK1 5G2NA 2MA9B 1IPGA 3RZFA 1WGHA 2Y5BB 2WDVB 4OZAA 4HEA1 1H8CA 3DQVA 3PRPB 1N6ZA 1M4VA 1YJIA 4OZBA 2LVPA 1WGDA 2VH1A 1ET6A 4GLSC 3AH7A 4I6PA 4W9FA 2V4LA 2KN4A 2PVOD 1IUEA 3A9KA 3AI5A 1VZ8A 2CKHB 1AARA 2BF8B 1NYRA 3QARA 1STEA 1VCBA 2MJ3A 4LLGM 2MBOA 2REXA 3PRMB 4E71A 2BYFA 2M4NA 4BFRA 1WJ4A 3U4EG 2L05A 1WI0A 4B0EA 2CR5A 1N5WA 1K8RB 4HK2A 1XLNA 4IW0A 1PYWD 3KLSX 3L10B 1GC7A 2EKEC 2N4FA 2K22A 1AYFA 2WXKA 4YXDB 3UIPB 1MVKA 2FIDA 1MPEA 1V81A 2BWES 2KWCA 2KX3A
chains in the Genus database with same CATH topology
2K6QA 2MWSB 2LGXA 4NQLB 1T0YA 2GBRA 1WR1A 2NPTA 4KIKB 1BT0A 5DPTA 3R7QA 3AULA 2CS4A 2LRUA 2RPQA 5LXIB 2ZNVC 2K39A 2MCNB 2KFKA 2Z59B 1CMXB 1YX5B 3H1UA 2L7RA 2BYVE 4BKSD 2KMAA 2KOXA 1V2YA 2M0XA 4IM2A 3ZNZB 4JLCA 2L76A 3T9LA 3ZNHB 3KVFB 2EMTA 5JZEB 4WJPA 3AU4A 2OOBB 2GMIC 4X57B 3PHXB 2NR2A 4ZRIA 4TV3A 2AWTA 4HLEA 2R2OA 3JSVA 1RAXA 1OQYA 2NBUA 4NY0A 3C0RB 1E8WA 1UGMA 3BY4B 3K9OB 1IYFA 2LVOA 1MG8A 1UELA 3VUXA 3ZDTA 1ZGUB 2CHXA 5AZGA 3PZDA 5G55A 1XQQA 4HCPB 4DHJB 2D3GA 1RLFA 3H9DA 1KJTA 2O6VA 2FCMA 3VH4B 1Z5SB 1ZKHA 2O6VD 2G45B 3DDCB 2LRWA 3KH0A 3KYCD 3QWZB 3WIMA 2FCNA 4PYZA 2IBIB 1V5OA 3VVWB 2XK5A 2KJHB 1WMHA 3ZRFA 4WAAA 3VFKA 4KZCA 3DBRI 3TCAA 2WDTB 3ZDMC 2VRRB 4MSMB 2KNBA 3W1YA 4TKNA 3EC8A 3V61A 3KUCB 1UZXB 1LXDA 4F7ZA 2J7QB 1L7YA 3L17A 4W9EA 3V62A 3EHVA 2QHOA 1WXSA 3WAMA 5JH5C 4NQKE 4KV2A 4XX5A 3SU8X 2KN5A 4GDKB 2M17A 4G3XB 1UH6A 2KJ6A 4IWQA 2KC2A 2GBMA 1G6JA 3ZNID 3TJPA 4K7SA 4G0NB 2DZIA 3IBEA 1WY8A 2HD5B 2O2VB 2JVCA 1EF1A 2FAZA 4B9KA 2KX0A 2ASQA 3EECA 5E6OA 3KYDD 4XC2A 2OJRA 1UBIA 4BVUC 1C1YB 2J0JA 2N7EA 3ZIMA 1Q0WB 4W9KA 2ZNVB 1WXMA 4AJYB 4FJZA 1NI2A 5CTRC 5DCNA 3QIJA 3M3JA 2HTHA 4MELA 4HVBA 4PS3A 5GMVA 4ZDVA 4W9JA 2ZVOA 3MTNB 2WWZA 2XK5B 2AEHA 4FHKA 4II2B 5TR5A 4AP4C 4DWFA 4MGIE 2IO1B 3SD5A 2JF5A 5JHBA 1ISNA 3X0WA 3LJ3A 4BOZB 3QJZA 4DHZE 2N9PC 1NBFC 3TMPB 3DBSA 1V5TA 4RM8A 5CHVC 4EOYA 4CHKA 4IUMB 3DVNV 3WALA 2ZEQA 5D2MB 3DBHI 1PQSA 3UF8A 2ZZPB 3VQIA 4ICUA 2Z0DB 2KMCA 2D11A 2IZVB 4MGYE 3PT2B 4BKGA 4MJSB 3HHMA 4MDKE 3JSVB 4A3PA 3VDZA 5IA7A 2YVCA 3PRZA 4BKSA 2KWVB 3TBLD 4KVGB 3HM3A 1Q1OA 3DVGX 1E5WA 3M62B 4EFOA 1RFAA 1TBEA 2IO2B 2FIFA 3OJ3A 2KFJA 2KJRA 5CHWA 3WANA 4E3CA 4DK5A 2KVRA 4PYUA 1WZ0A 4NJ7A 2ZVNA 3UIOB 3VUWA 2RGFA 1HE8A 5DPSA 2IO3B 2C7NB 2BYEA 1WE7A 3L16A 4BBNC 2AYOB 2MQJA 3T8MA 1YX6B 4M0WB 2V3SA 1M94A 2KLGA 2JT4B 2KD0A 2NPTB 4MH0E 4NJ6A 4WQOB 1FXTB 4ANUA 1KOTA 4A3OA 2DAFA 2GBKA 1YJ1A 3NOBA 2KTRA 4I6NB 4EEWA 4YL8A 2O6VB 3ZVVA 1F9JA 3QQ8B 4LDTB 1E7VA 4W9GA 1KM7A 2KK8A 2PE6B 4NAWA 3IG3A 1GG3A 2DZKA 1U4AA 2C5LC 3A1QB 4GGQA 4HPMB 3QCAA 2LI5A 4W9LA 1YD8U 3NZSA 3SHQA 4HXDA 2BWFA 5LLIA 2DZMA 2C60A 4HDOA 2PEAA 3LDZE 4MEMA 2L8JA 1R4MI 3ONSA 4FHJA 2DAJA 4DDGD 3HM6X 3W1SC 1E90A 1IP9A 4GMVA 3UINB 1D3ZA 4W9CA 2NS5A 4NAWB 1P3QU 3WAPA 2D07B 2KQ7A 4IC7B 1WF9A 2JZZA 3DBLI 3IVFA 3JVZX 4KSLC 3QK0A 4HDQA 4OVUA 3O65B 2O2VA 5DPRA 5J2RA 3H7PA 4E74A 3DOWA 2R2QA 4AOFA 3APCA 2MSED 4ICVA 2N1WA 1VD2A 4G11A 5KHOA 3QX1A 4JGHB 2CHZA 1YIWA 2RD0A 3DCGA 4I6LB 3VH3B 2B3AA 4MGZE 1WIAA 4GDKA 1GUAB 1XD3B 2DHZA 3ML9A 2N9XA 5LXHA 5C1ZA 3B0AA 4G50A 3UGBB 2IO0B 2KLCA 3V6CB 5DPWA 2MLBA 1J19A 3KW5B 2MBBB 2KZRA 3CF6E 2L0FA 4GU2A 1WX8A 2CU1A 4BOSC 4M8NA 2GBNA 4HWIB 1EUVB 2DENB 2JRIB 5E6PA 3ML8A 4TQ1A 1R4NI 3OAWA 3CSTA 4BBNF 4W9DA 4FADA 1E8ZA 2KTRB 2K8CA 3PGEA 4B6WA 4IG7B 3PTFC 1SGHA 4IM0A 4DHJD 4LDTD 2J0KA 5L83A 2DYBA 3NS8A 5D94A 3PS6A 4BKTA 3TL5A 4EKUA 5IAAC 2FCQA 3PLVA 2WX0A 1WX9A 5BO4B 3RUIB 3JW0X 3R66C 2FCSA 3NZUA 1WH3A 2XEWA 2WYQA 4HCNB 3VAWA 1EO6A 5AZHA 3DVNU 2ZCCA 4EZKA 2G4DB 2KDFB 4DBGA 4WJNA 3PV1A 3V6EB 1P1AA 4MJSA 2BKRB 2LUEA 2JZ3B 5E6NA 4KSKC 4GIVA 3N3KB 2JRHA 2D10A 2NBVB 3RD2A 2PE9A 3U7DA 3RT3B 3KUDB 1H4RA 3DVGY 3B1LX 2KHWB 4GN1A 1V49A 4LCDE 1WRDB 2KDIA 1TGZB 5D6JB 3H7SA 1WX7A 3Q3JA 1WM3A 3K9PB 4A20A 4IWPA 1V86A 1V9JA 4F1SA 4GDLB 1E8YA 2RR9A 4RM9A 3H6NA 3UQBA 1WGYA 2HE7A 4AWJA 3TIXA 4K81A 1I42A 2M8SA 5AZFA 5C23A 5EDSA 3VHTC 4EZLA 2I1KA 4MM3A 2AL6A 3U8ZA 2FNJB 1QZEA 3A1QA 2WX1A 2K1FA 1Z2MA 2N9EB 3VTUA 4ANVA 1LM8B 1WXAA 2C7HA 3RZWC 4ZYNA 4WWPA 1P9DU 4TQ0A 4IWOA 4J6IA 2DX5B 2RSUA 2K8HA 1KLVA 2G3QB 3GOEA 3S2AA 2K8BA 3D32A 2C7MB 5L95C 2FUHB 3PREA 3ZTDA 3RYTA 2ZJDA 2KDEB 4M8MA 4CO7A 3IFWB 3X23A 2D2QA 1E7UA 3QC8B 3A33B 4MSQB 1ZW7A 3R7RA 2MBEA 3ZRCA 2Z0EB 5KHQA 3RCZA 1WJNA 4JIOU 3HIZA 3N30A 3ZLZA 2MBHA 2BGFA 2KTFA 4FJVB 4K1RB 3SDLC 3AU5A 4LJPB 2C9WB 4FULA 3OLMD 2IYDB 1WMHB 2J0MA 3VUYA 3MHSD 1WYWB 4URKA 4PS8A 2DYMA 3L54A 4W9IA 2JWZA 2LGDA 1OTRB 4ANWA 2UWQA 1TTNA 4FLHA 2UYZB 4ZRKA 3VTWA 4FA6A 4TUUA 2KWUB 3PLUA 4HJKA 3VXWA 2EMSA 2N1VA 3QHTA 3QA8A 4EUTA 3APDA 2MX2A 1J0GA 2MW5A 4II3B 1GJZA 4JQWC 1LFDA 2KANA 3AXCA 1OEYJ 3ECIA 2JPHA 2JY6A 4AUQC 2IY0B 2AL3A 4KDIC 2PPHA 2LJ5A 2CHWA 1UD7A 2I1JA 2LXCA 2W9NA 2GBJA 1WZ3A 5J17A 3UQAA 4DDID 1YQBA 3M63B 4OVVA 1GNUA 3ZUNA 4WJQA 2MRPA 4CYEA 1J8CA 2ZPNA 3M95A 5J18A 3VTVA 1RRBA 2ZPYA 2PJHA 5D7GA 3WAOA 4GOCA 2BKFA 4NPNA 2KC1A 3PPAA 4KIKA 3I3TB 3A9JB 3L08A 3NHEB 3WA0A 2LD9A 4HPLB 1WXVA 3N32A 3OJ4B 3ZKJC 2A5UA 1WR6E 2NVUI 2LVQA 2K25A 3ZO5B 2JXXA 3CSFA 3W1SA 3ZNGC 3ZTCA 1C3TA 1S3SG 3Q3FA 1SIFA 1JRUA 3IHPC 5G2NA 4GSWA 4ZRJA 2LWPA 2MA9B 1IPGA 4RMAA 4MGKE 2L00B 3V60A 2LZ6A 3RZFA 1WGHA 2KDBA 1X1MA 2Y5BB 3JYUA 1Y8RC 4GXBA 2BPSA 2KXJA 3DQVA 3PRPB 1H8CA 1I35A 3EFUA 5FR6A 4WWOA 2KO3A 3MJWA 1L2NA 5CX3A 4WWNA 3R3MA 2LVPA 1WGDA 1XT9B 4N9F4 3L0WB 3KUZA 1Q5WB 4K7WA 3P2BA 4F8CB 1P98A 4I6PA 4FN2A 2KFKB 2K6DB 4W9FA 4LJOB 2M1MA 3BINA 2MP2A 4ANXA 1GC6A 2V4LA 4B95A 2V1YA 1OEYA 3A9KA 2KKCA 1SE9A 3AI5A 1WGGA 3ALBA 3HK0A 3PHWB 1NDDA 1WJ6A 1WFYA 4NNJB 1LQBA 2CKHB 3B08A 3L13A 1AARA 1WM2A 2KQSA 2BF8B 2N7DA 3GZNI 3U30A 3ZW3A 3QARA 4EZJA 3A4SC 1VCBA 2LXAA 2NCNA 4WJOA 1OGWA 2MBOA 2DZJA 4AJWA 2REXA 1E8XA 2MBQA 3PRMB 2DYOA 5AEKB 4E71A 1WGRA 2BYFA 2HJ8A 2LGYA 2M4NA 3A9KB 2XBBC 2A4ZA 1WJUA 5HKHA 3H7PB 1V6EA 4BFRA 1WJ4A 2JUOA 2G4SA 2L05A 1WI0A 4JL9A 1TZ1A 3PVLA 3A9JA 2CR5A 1S1QB 4W9HA 2LASA 1K8RB 4HK2A 4IM3A 3RULA 2YLMA 1A5RA 4KZ0A 4IW0A 2MP2B 2L0TA 3PSEB 1P0RA 3L10B 1GC7A 3DPDA 2EKEC 2GOWA 4K7UA 4FJYA 2N4FA 2NBWB 4KDLB 2L3ZA 4GB9A 3APFA 4DHZB 4PS7A 3UIPB 5JHAA 4FBJB 2IY1B 1UBQA 2FIDA 2ZCBA 1V81A 3CMMB 2BWES 4DXAB 1EF5A 4P7IA 4XZ4A 3NY5A 3A4RA 3QAQA 4GDLA 1V80A 2KWCA 3ENEA 4ASWC 1WE6A 5CHFA 2KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6Q A;  2MWS B;  2LGX A;  4NQL B;  1T0Y A;  2GBR A;  1WR1 A;  2NPT A;  4KIK B;  1BT0 A;  5DPT A;  3R7Q A;  3AUL A;  2CS4 A;  2LRU A;  2RPQ A;  5LXI B;  2ZNV C;  2K39 A;  2MCN B;  2KFK A;  2Z59 B;  1CMX B;  1YX5 B;  3H1U A;  2L7R A;  2BYV E;  4BKS D;  2KMA A;  2KOX A;  1V2Y A;  2M0X A;  4IM2 A;  3ZNZ B;  4JLC A;  2L76 A;  3T9L A;  3ZNH B;  3KVF B;  2EMT A;  5JZE B;  4WJP A;  3AU4 A;  2OOB B;  2GMI C;  4X57 B;  3PHX B;  2NR2 A;  4ZRI A;  4TV3 A;  2AWT A;  4HLE A;  2R2O A;  3JSV A;  1RAX A;  1OQY A;  2NBU A;  4NY0 A;  3C0R B;  1E8W A;  1UGM A;  3BY4 B;  3K9O B;  1IYF A;  2LVO A;  1MG8 A;  1UEL A;  3VUX A;  3ZDT A;  1ZGU B;  2CHX A;  5AZG A;  3PZD A;  5G55 A;  1XQQ A;  4HCP B;  4DHJ B;  2D3G A;  1RLF A;  3H9D A;  1KJT A;  2O6V A;  2FCM A;  3VH4 B;  1Z5S B;  1ZKH A;  2O6V D;  2G45 B;  3DDC B;  2LRW A;  3KH0 A;  3KYC D;  3QWZ B;  3WIM A;  2FCN A;  4PYZ A;  2IBI B;  1V5O A;  3VVW B;  2XK5 A;  2KJH B;  1WMH A;  3ZRF A;  4WAA A;  3VFK A;  4KZC A;  3DBR I;  3TCA A;  2WDT B;  3ZDM C;  2VRR B;  4MSM B;  2KNB A;  3W1Y A;  4TKN A;  3EC8 A;  3V61 A;  3KUC B;  1UZX B;  1LXD A;  4F7Z A;  2J7Q B;  1L7Y A;  3L17 A;  4W9E A;  3V62 A;  3EHV A;  2QHO A;  1WXS A;  3WAM A;  5JH5 C;  4NQK E;  4KV2 A;  4XX5 A;  3SU8 X;  2KN5 A;  4GDK B;  2M17 A;  4G3X B;  1UH6 A;  2KJ6 A;  4IWQ A;  2KC2 A;  2GBM A;  1G6J A;  3ZNI D;  3TJP A;  4K7S A;  4G0N B;  2DZI A;  3IBE A;  1WY8 A;  2HD5 B;  2O2V B;  2JVC A;  1EF1 A;  2FAZ A;  4B9K A;  2KX0 A;  2ASQ A;  3EEC A;  5E6O A;  3KYD D;  4XC2 A;  2OJR A;  1UBI A;  4BVU C;  1C1Y B;  2J0J A;  2N7E A;  3ZIM A;  1Q0W B;  4W9K A;  2ZNV B;  1WXM A;  4AJY B;  4FJZ A;  1NI2 A;  5CTR C;  5DCN A;  3QIJ A;  3M3J A;  2HTH A;  4MEL A;  4HVB A;  4PS3 A;  5GMV A;  4ZDV A;  4W9J A;  2ZVO A;  3MTN B;  2WWZ A;  2XK5 B;  2AEH A;  4FHK A;  4II2 B;  5TR5 A;  4AP4 C;  4DWF A;  4MGI E;  2IO1 B;  3SD5 A;  2JF5 A;  5JHB A;  1ISN A;  3X0W A;  3LJ3 A;  4BOZ B;  3QJZ A;  4DHZ E;  2N9P C;  1NBF C;  3TMP B;  3DBS A;  1V5T A;  4RM8 A;  5CHV C;  4EOY A;  4CHK A;  4IUM B;  3DVN V;  3WAL A;  2ZEQ A;  5D2M B;  3DBH I;  1PQS A;  3UF8 A;  2ZZP B;  3VQI A;  4ICU A;  2Z0D B;  2KMC A;  2D11 A;  2IZV B;  4MGY E;  3PT2 B;  4BKG A;  4MJS B;  3HHM A;  4MDK E;  3JSV B;  4A3P A;  3VDZ A;  5IA7 A;  2YVC A;  3PRZ A;  4BKS A;  2KWV B;  3TBL D;  4KVG B;  3HM3 A;  1Q1O A;  3DVG X;  1E5W A;  3M62 B;  4EFO A;  1RFA A;  1TBE A;  2IO2 B;  2FIF A;  3OJ3 A;  2KFJ A;  2KJR A;  5CHW A;  3WAN A;  4E3C A;  4DK5 A;  2KVR A;  4PYU A;  1WZ0 A;  4NJ7 A;  2ZVN A;  3UIO B;  3VUW A;  2RGF A;  1HE8 A;  5DPS A;  2IO3 B;  2C7N B;  2BYE A;  1WE7 A;  3L16 A;  4BBN C;  2AYO B;  2MQJ A;  3T8M A;  1YX6 B;  4M0W B;  2V3S A;  1M94 A;  2KLG A;  2JT4 B;  2KD0 A;  2NPT B;  4MH0 E;  4NJ6 A;  4WQO B;  1FXT B;  4ANU A;  1KOT A;  4A3O A;  2DAF A;  2GBK A;  1YJ1 A;  3NOB A;  2KTR A;  4I6N B;  4EEW A;  4YL8 A;  2O6V B;  3ZVV A;  1F9J A;  3QQ8 B;  4LDT B;  1E7V A;  4W9G A;  1KM7 A;  2KK8 A;  2PE6 B;  4NAW A;  3IG3 A;  1GG3 A;  2DZK A;  1U4A A;  2C5L C;  3A1Q B;  4GGQ A;  4HPM B;  3QCA A;  2LI5 A;  4W9L A;  1YD8 U;  3NZS A;  3SHQ A;  4HXD A;  2BWF A;  5LLI A;  2DZM A;  2C60 A;  4HDO A;  2PEA A;  3LDZ E;  4MEM A;  2L8J A;  1R4M I;  3ONS A;  4FHJ A;  2DAJ A;  4DDG D;  3HM6 X;  3W1S C;  1E90 A;  1IP9 A;  4GMV A;  3UIN B;  1D3Z A;  4W9C A;  2NS5 A;  4NAW B;  1P3Q U;  3WAP A;  2D07 B;  2KQ7 A;  4IC7 B;  1WF9 A;  2JZZ A;  3DBL I;  3IVF A;  3JVZ X;  4KSL C;  3QK0 A;  4HDQ A;  4OVU A;  3O65 B;  2O2V A;  5DPR A;  5J2R A;  3H7P A;  4E74 A;  3DOW A;  2R2Q A;  4AOF A;  3APC A;  2MSE D;  4ICV A;  2N1W A;  1VD2 A;  4G11 A;  5KHO A;  3QX1 A;  4JGH B;  2CHZ A;  1YIW A;  2RD0 A;  3DCG A;  4I6L B;  3VH3 B;  2B3A A;  4MGZ E;  1WIA A;  4GDK A;  1GUA B;  1XD3 B;  2DHZ A;  3ML9 A;  2N9X A;  5LXH A;  5C1Z A;  3B0A A;  4G50 A;  3UGB B;  2IO0 B;  2KLC A;  3V6C B;  5DPW A;  2MLB A;  1J19 A;  3KW5 B;  2MBB B;  2KZR A;  3CF6 E;  2L0F A;  4GU2 A;  1WX8 A;  2CU1 A;  4BOS C;  4M8N A;  2GBN A;  4HWI B;  1EUV B;  2DEN B;  2JRI B;  5E6P A;  3ML8 A;  4TQ1 A;  1R4N I;  3OAW A;  3CST A;  4BBN F;  4W9D A;  4FAD A;  1E8Z A;  2KTR B;  2K8C A;  3PGE A;  4B6W A;  4IG7 B;  3PTF C;  1SGH A;  4IM0 A;  4DHJ D;  4LDT D;  2J0K A;  5L83 A;  2DYB A;  3NS8 A;  5D94 A;  3PS6 A;  4BKT A;  3TL5 A;  4EKU A;  5IAA C;  2FCQ A;  3PLV A;  2WX0 A;  1WX9 A;  5BO4 B;  3RUI B;  3JW0 X;  3R66 C;  2FCS A;  3NZU A;  1WH3 A;  2XEW A;  2WYQ A;  4HCN B;  3VAW A;  1EO6 A;  5AZH A;  3DVN U;  2ZCC A;  4EZK A;  2G4D B;  2KDF B;  4DBG A;  4WJN A;  3PV1 A;  3V6E B;  1P1A A;  4MJS A;  2BKR B;  2LUE A;  2JZ3 B;  5E6N A;  4KSK C;  4GIV A;  3N3K B;  2JRH A;  2D10 A;  2NBV B;  3RD2 A;  2PE9 A;  3U7D A;  3RT3 B;  3KUD B;  1H4R A;  3DVG Y;  3B1L X;  2KHW B;  4GN1 A;  1V49 A;  4LCD E;  1WRD B;  2KDI A;  1TGZ B;  5D6J B;  3H7S A;  1WX7 A;  3Q3J A;  1WM3 A;  3K9P B;  4A20 A;  4IWP A;  1V86 A;  1V9J A;  4F1S A;  4GDL B;  1E8Y A;  2RR9 A;  4RM9 A;  3H6N A;  3UQB A;  1WGY A;  2HE7 A;  4AWJ A;  3TIX A;  4K81 A;  1I42 A;  2M8S A;  5AZF A;  5C23 A;  5EDS A;  3VHT C;  4EZL A;  2I1K A;  4MM3 A;  2AL6 A;  3U8Z A;  2FNJ B;  1QZE A;  3A1Q A;  2WX1 A;  2K1F A;  1Z2M A;  2N9E B;  3VTU A;  4ANV A;  1LM8 B;  1WXA A;  2C7H A;  3RZW C;  4ZYN A;  4WWP A;  1P9D U;  4TQ0 A;  4IWO A;  4J6I A;  2DX5 B;  2RSU A;  2K8H A;  1KLV A;  2G3Q B;  3GOE A;  3S2A A;  2K8B A;  3D32 A;  2C7M B;  5L95 C;  2FUH B;  3PRE A;  3ZTD A;  3RYT A;  2ZJD A;  2KDE B;  4M8M A;  4CO7 A;  3IFW B;  3X23 A;  2D2Q A;  1E7U A;  3QC8 B;  3A33 B;  4MSQ B;  1ZW7 A;  3R7R A;  2MBE A;  3ZRC A;  2Z0E B;  5KHQ A;  3RCZ A;  1WJN A;  4JIO U;  3HIZ A;  3N30 A;  3ZLZ A;  2MBH A;  2BGF A;  2KTF A;  4FJV B;  4K1R B;  3SDL C;  3AU5 A;  4LJP B;  2C9W B;  4FUL A;  3OLM D;  2IYD B;  1WMH B;  2J0M A;  3VUY A;  3MHS D;  1WYW B;  4URK A;  4PS8 A;  2DYM A;  3L54 A;  4W9I A;  2JWZ A;  2LGD A;  1OTR B;  4ANW A;  2UWQ A;  1TTN A;  4FLH A;  2UYZ B;  4ZRK A;  3VTW A;  4FA6 A;  4TUU A;  2KWU B;  3PLU A;  4HJK A;  3VXW A;  2EMS A;  2N1V A;  3QHT A;  3QA8 A;  4EUT A;  3APD A;  2MX2 A;  1J0G A;  2MW5 A;  4II3 B;  1GJZ A;  4JQW C;  1LFD A;  2KAN A;  3AXC A;  1OEY J;  3ECI A;  2JPH A;  2JY6 A;  4AUQ C;  2IY0 B;  2AL3 A;  4KDI C;  2PPH A;  2LJ5 A;  2CHW A;  1UD7 A;  2I1J A;  2LXC A;  2W9N A;  2GBJ A;  1WZ3 A;  5J17 A;  3UQA A;  4DDI D;  1YQB A;  3M63 B;  4OVV A;  1GNU A;  3ZUN A;  4WJQ A;  2MRP A;  4CYE A;  1J8C A;  2ZPN A;  3M95 A;  5J18 A;  3VTV A;  1RRB A;  2ZPY A;  2PJH A;  5D7G A;  3WAO A;  4GOC A;  2BKF A;  4NPN A;  2KC1 A;  3PPA A;  4KIK A;  3I3T B;  3A9J B;  3L08 A;  3NHE B;  3WA0 A;  2LD9 A;  4HPL B;  1WXV A;  3N32 A;  3OJ4 B;  3ZKJ C;  2A5U A;  1WR6 E;  2NVU I;  2LVQ A;  2K25 A;  3ZO5 B;  2JXX A;  3CSF A;  3W1S A;  3ZNG C;  3ZTC A;  1C3T A;  1S3S G;  3Q3F A;  1SIF A;  1JRU A;  3IHP C;  5G2N A;  4GSW A;  4ZRJ A;  2LWP A;  2MA9 B;  1IPG A;  4RMA A;  4MGK E;  2L00 B;  3V60 A;  2LZ6 A;  3RZF A;  1WGH A;  2KDB A;  1X1M A;  2Y5B B;  3JYU A;  1Y8R C;  4GXB A;  2BPS A;  2KXJ A;  3DQV A;  3PRP B;  1H8C A;  1I35 A;  3EFU A;  5FR6 A;  4WWO A;  2KO3 A;  3MJW A;  1L2N A;  5CX3 A;  4WWN A;  3R3M A;  2LVP A;  1WGD A;  1XT9 B;  4N9F 4;  3L0W B;  3KUZ A;  1Q5W B;  4K7W A;  3P2B A;  4F8C B;  1P98 A;  4I6P A;  4FN2 A;  2KFK B;  2K6D B;  4W9F A;  4LJO B;  2M1M A;  3BIN A;  2MP2 A;  4ANX A;  1GC6 A;  2V4L A;  4B95 A;  2V1Y A;  1OEY A;  3A9K A;  2KKC A;  1SE9 A;  3AI5 A;  1WGG A;  3ALB A;  3HK0 A;  3PHW B;  1NDD A;  1WJ6 A;  1WFY A;  4NNJ B;  1LQB A;  2CKH B;  3B08 A;  3L13 A;  1AAR A;  1WM2 A;  2KQS A;  2BF8 B;  2N7D A;  3GZN I;  3U30 A;  3ZW3 A;  3QAR A;  4EZJ A;  3A4S C;  1VCB A;  2LXA A;  2NCN A;  4WJO A;  1OGW A;  2MBO A;  2DZJ A;  4AJW A;  2REX A;  1E8X A;  2MBQ A;  3PRM B;  2DYO A;  5AEK B;  4E71 A;  1WGR A;  2BYF A;  2HJ8 A;  2LGY A;  2M4N A;  3A9K B;  2XBB C;  2A4Z A;  1WJU A;  5HKH A;  3H7P B;  1V6E A;  4BFR A;  1WJ4 A;  2JUO A;  2G4S A;  2L05 A;  1WI0 A;  4JL9 A;  1TZ1 A;  3PVL A;  3A9J A;  2CR5 A;  1S1Q B;  4W9H A;  2LAS A;  1K8R B;  4HK2 A;  4IM3 A;  3RUL A;  2YLM A;  1A5R A;  4KZ0 A;  4IW0 A;  2MP2 B;  2L0T A;  3PSE B;  1P0R A;  3L10 B;  1GC7 A;  3DPD A;  2EKE C;  2GOW A;  4K7U A;  4FJY A;  2N4F A;  2NBW B;  4KDL B;  2L3Z A;  4GB9 A;  3APF A;  4DHZ B;  4PS7 A;  3UIP B;  5JHA A;  4FBJ B;  2IY1 B;  1UBQ A;  2FID A;  2ZCB A;  1V81 A;  3CMM B;  2BWE S;  4DXA B;  1EF5 A;  4P7I A;  4XZ4 A;  3NY5 A;  3A4R A;  3QAQ A;  4GDL A;  1V80 A;  2KWC A;  3ENE A;  4ASW C;  1WE6 A;  5CHF A;  2KX3 A; 
#chains in the Genus database with same CATH topology
 2LGX A;  3R7Q A;  4KIK B;  1BT0 A;  4N58 A;  1YX5 B;  2L7R A;  1OFF A;  4BKS D;  2KMA A;  2KOX A;  2TSS A;  2L76 A;  5JZE B;  2OOB B;  3EA6 A;  4TV3 A;  4HLE A;  1RAX A;  1OQY A;  2R61 A;  1HA5 A;  1IGD A;  3K9O B;  1MG8 A;  3NS1 A;  1WWT A;  5AZG A;  2G1E A;  3H9D A;  5HG2 A;  1KJT A;  1Z5S B;  1ZKH A;  3DDC B;  3QWZ B;  4REZ A;  2BB6 A;  2ICI A;  3ZRF A;  4WAA A;  2KMM A;  3RN9 C;  4JPS A;  1ZDV A;  4ZRQ A;  1XO3 A;  1GB4 A;  4TKN A;  3EC8 A;  3V61 A;  1UZX B;  4F7Z A;  2J7Q B;  2BT6 A;  2D5G A;  4NQK E;  2RMM A;  4XX5 A;  1JWS D;  2KC2 A;  2GBM A;  3OWE B;  1G6J A;  3ZNI D;  3TJP A;  4K7S A;  4USA A;  3FIL B;  2FAZ A;  2MJD A;  3ABV B;  3DHG C;  4A6Q A;  2OJR A;  4BVU C;  1C1Y B;  1VR9 A;  2J53 A;  2ZNV B;  4D2K A;  1WXM A;  5CTR C;  3NVV A;  3MTN B;  1XLP A;  1AWD A;  4MGI E;  4RCO A;  2JF5 A;  5JHB A;  1NBF C;  4QAY A;  1V5T A;  4RM8 A;  1JWM D;  5CHV C;  4CQN A;  4CHK A;  1XLQ A;  2YEP B;  3DVN V;  3AV8 A;  3WAL A;  3B9J A;  1PQS A;  3NRZ A;  4ITK A;  2D11 A;  3DHI C;  5C2T B;  4BKS A;  3TBL D;  1Q1O A;  2QSD A;  3M62 B;  2E6X A;  2FIF A;  3DWG C;  2KFJ A;  5CHW A;  4C00 A;  4PYU A;  1TIF A;  2FUG 1;  3L16 A;  4BBN C;  3T8M A;  1YX6 B;  2V3S A;  1M94 A;  4WQO B;  1FPY A;  2DAF A;  2KTR A;  1SEB D;  2O6V B;  1C4A A;  3U7Z A;  4L23 A;  1V1P B;  3VR9 B;  3O13 A;  3QCA A;  3NZS A;  2DZM A;  4DXF A;  2C60 A;  3I5J C;  1RWS A;  4KGT A;  4FHJ A;  4WIP A;  2H89 B;  1FMA D;  3Q2A C;  1E90 A;  1IP9 A;  3UIN B;  4W9C A;  2NS5 A;  1P3Q U;  3WAP A;  2KDM A;  1WF9 A;  3JVZ X;  3IVF A;  3Q6B A;  1SB3 C;  1VD2 A;  2JWU A;  1MJD A;  1YIW A;  3VH3 B;  4I6L B;  1NEK B;  1WIA A;  1XD3 B;  4M00 A;  5LXH A;  5C1Z A;  4WH4 A;  2PKO A;  1JWU D;  2IO0 B;  3ZJV A;  2MLB A;  2G9H D;  2WXM A;  4GU2 A;  3N20 C;  1EWC A;  2BS2 B;  2JYT A;  2UU7 A;  4IOI E;  5E6P A;  3AEE B;  5AUI A;  4W9D A;  4FAD A;  2KTR B;  1N61 A;  3PGE A;  4IG7 B;  3PTF C;  1ZXH A;  4LDT D;  3DBH B;  1E7P B;  1LGR A;  3R2T A;  5D94 A;  3PS6 A;  2CJO A;  2WLB A;  2FCQ A;  3PLV A;  1WX9 A;  3Q8B A;  5EE1 A;  4A9A A;  1HTO A;  3NZ3 A;  4WJN A;  3GP7 A;  1P1A A;  4LNO A;  5E6N A;  3KWV A;  2D10 A;  1L6U A;  3U7D A;  4ARC A;  1T0S C;  2MH7 A;  3DVG Y;  2PIA A;  4GN1 A;  1V49 A;  3UI3 A;  5D6J B;  1WX7 A;  4A20 A;  4HKZ E;  1ENF A;  4WQM A;  3UQB A;  4AWJ A;  3VRB B;  3AEB B;  5AZF A;  5JXV A;  3TEY A;  3U8Z A;  2N9E B;  3VTU A;  2QIL A;  4TQ0 A;  4IWO A;  3VRA B;  2G3Q B;  2C7M B;  4CO7 A;  2I2Y A;  1FM0 D;  4MSQ B;  1NEN B;  3ZRC A;  2KTF A;  4FJV B;  3SDL C;  2C9W B;  2IYD B;  1L4Z B;  3AE7 B;  4NAM A;  2DYM A;  3L54 A;  4W9I A;  4YSY B;  4ANW A;  3RNB C;  4DXG A;  4KKI A;  1B9R A;  4ZRK A;  4TUU A;  2I38 A;  4HJK A;  3L4P A;  4EUT A;  3Q14 C;  1J0G A;  1IBX A;  3APD A;  1GJZ A;  4JQW C;  2IND C;  1OEY J;  2JZP A;  2IY0 B;  2AL3 A;  3HUI A;  2LJ5 A;  1UD7 A;  2I1J A;  2JQR B;  4XGA B;  2GBJ A;  5BYR A;  4MT5 A;  4S17 A;  3AEG B;  2ZW0 A;  1VRA B;  2B76 B;  2MRP A;  4CYE A;  1YQ3 B;  1VZ6 A;  2M19 A;  2WXO A;  3VTV A;  3WAO A;  2BKF A;  1FXA A;  3PPA A;  2K9X A;  1V1O A;  3AE2 B;  3J9C A;  3NUH B;  1HZ5 A;  1FNV A;  1YN4 A;  3W1S A;  3ZNG C;  3ZTC A;  1S3S G;  1SIF A;  3IHP C;  1VLB A;  4JX1 C;  4RMA A;  4MGK E;  2L00 B;  2LZ6 A;  2KDB A;  1EWY C;  1X1M A;  1Y8R C;  2BPS A;  2KXJ A;  2NMQ A;  3EFU A;  3MJW A;  1C79 A;  1L2N A;  1YN5 A;  5EE0 A;  4IDI A;  3R3M A;  1SXT A;  3P42 A;  4K7W A;  4P16 A;  1P98 A;  4FN2 A;  2M1M A;  3BIN A;  2MP2 A;  2WHI A;  1GC6 A;  2V1Y A;  4XYC A;  1SE9 A;  3ZJU A;  1ESF A;  1NDD A;  1WJ6 A;  1WFY A;  1LQB A;  3L13 A;  3ZW3 A;  1FNU A;  4EZJ A;  2NCN A;  4WJO A;  1E8X A;  1JQ4 A;  1UUP A;  2LGY A;  2XBB C;  1TKY A;  1V6E A;  4HPP A;  2WXH A;  2G4S A;  4JL9 A;  1HXY D;  1TZ1 A;  3A9J A;  4IM3 A;  3LXF A;  1A5R A;  4FXC A;  3DWM A;  4P1C C;  2PVG C;  4K7U A;  4FJY A;  4KDL B;  3AE3 B;  2ONQ A;  3BK1 A;  1PGX A;  3MC9 A;  3IAM 1;  2WXN A;  5T8I A;  4JE3 B;  4P7I A;  2KYW A;  1V80 A;  2WDQ B;  1WE6 A;  2K0P A;  1T0Y A;  2GBR A;  2LFI A;  3AE4 B;  5LXI B;  3AUL A;  2CS4 A;  2RPQ A;  4C80 A;  1TY2 A;  1VJK A;  2QJL A;  2MCN B;  2KFK A;  2Z59 B;  1CMX B;  3AE6 B;  2VH2 A;  1V2Y A;  3N1Z C;  4JLC A;  3ZNH B;  3AU4 A;  4X57 B;  1EU4 A;  1QKZ A;  3C0R B;  1UGM A;  4XWW A;  2HTM E;  3GE3 C;  5G55 A;  4HCP B;  2D3G A;  3VH4 B;  3KH0 A;  2V3P A;  4KGR A;  3WIM A;  1YOV B;  4K3C A;  1PDX A;  3MC0 B;  3VVW B;  2XK5 A;  1HQR D;  1WMH A;  4OVZ A;  3DBR I;  3ZDM C;  1SJE D;  4MSM B;  2KNB A;  3W1Y A;  3V62 A;  3EHV A;  1T3Q A;  3EGR A;  4KV2 A;  5IO9 A;  1SE2 A;  2M17 A;  3TEX A;  1T5X D;  1UH6 A;  2KJ6 A;  4IWQ A;  3EUB 2;  3SFE B;  4TMA B;  2DZI A;  1TZO A;  3IBE A;  3MC8 A;  2ASQ A;  3KYD D;  4YTP B;  1ZP0 B;  1UBI A;  2J0J A;  4W9K A;  3H8H A;  4AJY B;  4FJZ A;  3MHZ A;  3QIJ A;  4MEL A;  5TSS A;  4W9J A;  2ZVO A;  4FHK A;  1V1P A;  3AM9 A;  5HFY A;  3LJ3 A;  3BII D;  2IPK D;  4KKJ A;  2NTS A;  4OHJ A;  3UF8 A;  1XLO A;  2INP E;  3VQI A;  2D3C A;  2LJI A;  2Z0D B;  1FEH A;  3PT2 B;  4BKG A;  2BBC A;  3PZ8 A;  1C9F A;  5G5G A;  1E5W A;  3OJ3 A;  3RFZ B;  4NJ7 A;  1DYQ A;  5DPS A;  5MPO A;  2IO3 B;  2SEB D;  2EKI A;  4AS1 A;  4M0W B;  2JT4 B;  2NPT B;  1V97 A;  1KRH A;  4O1N A;  3NOB A;  4W9G A;  1E7V A;  1I4H A;  1KM7 A;  4NAW A;  4YT0 B;  4PT5 A;  1JRO A;  1MFW A;  3LDZ E;  4MEM A;  1SJH D;  1MG4 A;  1E6E B;  4YSZ B;  2IDY A;  3W1S C;  1L6V A;  4NAW B;  3GB1 A;  3P4S B;  1JW9 D;  2L32 A;  3AEF B;  3DBL I;  4KSL C;  2KQ4 X;  3C19 A;  4BAX A;  5DPR A;  3H7P A;  2CJN A;  2MSE D;  2N1W A;  4G11 A;  3ZXR A;  3C8Y A;  2NTT A;  2CHZ A;  2B3A A;  4GDK A;  5EE3 A;  1FNW A;  2BW2 A;  3GE8 C;  3UGB B;  2KLC A;  3KW5 B;  1J19 A;  2MBB B;  1WX8 A;  4BOS C;  2GBN A;  4HWI B;  1EUV B;  4TQ1 A;  1UF0 A;  1E8Z A;  3T3O A;  2BYT A;  3W5V B;  3ZYY X;  5L83 A;  2DYB A;  2MJE A;  4EKU A;  3TL5 A;  2V3N A;  3DBR B;  4HCN B;  3VAW A;  2K3U A;  2JU6 X;  3DVN U;  5AZH A;  2G4D B;  2KDF B;  1D5Z C;  3V6E B;  1YN3 A;  2JZ3 B;  2AQ1 B;  2X38 A;  1SF0 A;  3N3K B;  2JRH A;  3RD2 A;  4R3D A;  3KUD B;  1C76 A;  1H4R A;  3E56 A;  3P4R B;  4IKG A;  1OQR A;  1UGJ A;  2KDI A;  1WSP A;  3H7S A;  1I4R A;  2WDR B;  3K9P B;  1V86 A;  4GDL B;  2RR9 A;  4A55 A;  1FRR A;  2AQ3 B;  2M8S A;  3TSS A;  2I1K A;  1J7A A;  1JWB D;  1CJE A;  4Q2J A;  4WUR A;  4HRS A;  1MHH E;  2WX1 A;  1XXG A;  1Z2M A;  2V9H A;  3FIL A;  3AE5 B;  1XCQ L;  1TS4 A;  1WXA A;  2LMC A;  2L52 A;  3RZW C;  4WWP A;  4RGT A;  1KLV A;  3PRE A;  2HDE A;  3ZTD A;  3RYT A;  2ZJD A;  3FC4 A;  3X23 A;  4B0M A;  2D2Q A;  2QCZ A;  1ZW7 A;  2MBE A;  3HIZ A;  3Q8A A;  2MBH A;  1DGJ A;  3AU5 A;  4C4V A;  2KAJ A;  3MFG A;  4PS8 A;  2LGD A;  2M0A A;  1OTR B;  1AN8 A;  2KVZ A;  1K51 A;  2EMS A;  3QA8 A;  1V8C A;  4YTM B;  2BS4 B;  1ACC A;  4KX6 B;  1YMH E;  2L1A A;  2JSV X;  5G5H A;  3SFD B;  2W9N A;  1WZ3 A;  5J17 A;  3FAH A;  1YQB A;  1VDV A;  1FO4 A;  1GNU A;  3ZUN A;  5BMI A;  3N1Y C;  1SE3 A;  5D7G A;  4NPN A;  4KIK A;  1R7S A;  4YTN B;  2CU3 A;  1F2R I;  3NHE B;  3WA0 A;  1C4C A;  3N32 A;  2A5U A;  4RFB A;  2K25 A;  4LK0 M;  2QC8 A;  4GSW A;  4ZRJ A;  3V60 A;  2WQY B;  2H88 B;  2XNA C;  3AB5 A;  3JYU A;  4GXB A;  1UWM A;  2BB5 A;  5CX3 A;  4WWN A;  4N9F 4;  3L0W B;  3KUZ A;  3BYT B;  2E3T A;  3IT6 B;  2K6D B;  4ANX A;  3URY A;  1ZOY B;  1OEY A;  1WGG A;  4C4V B;  4NNJ B;  4XDC A;  2LHE A;  3B08 A;  1WM2 A;  2KQS A;  2N7D A;  4UDU C;  1SBB B;  3A4S C;  2LXA A;  2INC C;  1NYQ A;  1WGR A;  3BK2 A;  2HJ8 A;  3A9K B;  3AE9 B;  2FBW B;  3NVW A;  2A4Z A;  4L2Y A;  2N9L A;  2LAS A;  5H92 C;  2M56 B;  4KZ0 A;  1E9M A;  1I4X A;  2L0T A;  3PSE B;  1P0R A;  2GOW A;  2OED A;  2NBW B;  2LUM A;  2L3Z A;  4PS7 A;  1FRD A;  2QEJ C;  3CMM B;  1EF5 A;  4XZ4 A;  3QAQ A;  3V3X A;  3RPF C;  1F0Z A;  3ENE A;  3PVL A;  3EFC A;  3MHS D;  2K6Q A;  2MWS B;  1N62 A;  5DPT A;  1WR1 A;  3I9V 1;  5H8Y E;  3AED B;  1SE4 A;  1D4B A;  4ZRP A;  4OW0 A;  2GLS A;  2M0X A;  3ZNZ B;  5IN7 A;  4AQ7 A;  3KVF B;  4WJP A;  2GMI C;  3PHX B;  2NR2 A;  4ZRI A;  2AWT A;  3JSV A;  2PMV A;  3RMK C;  3W9C B;  1E8W A;  3BY4 B;  3NG0 A;  1IYF A;  2LVO A;  1UEL A;  3ZDT A;  1QF6 A;  1ZGU B;  2CHX A;  3PZD A;  4P1B C;  4DHJ B;  1I4P A;  3VR8 B;  2O6V D;  2G45 B;  2FCN A;  1N63 A;  2WDT B;  4N59 A;  3KUC B;  1LXD A;  2QHO A;  1WXS A;  3WAM A;  4M02 A;  3SU8 X;  2RDB C;  2O2V B;  2IGD A;  2JVC A;  5D3I B;  5E6O A;  3E9S A;  3GZN B;  4ZOH C;  3BZD B;  1FCL A;  2N7E A;  3ZIM A;  3CWI A;  1WRI A;  4YSX B;  1GPX A;  5BYS A;  4HVB A;  2HTH A;  4II2 B;  4DWF A;  4TSS A;  1UWX A;  1WXQ A;  1ISN A;  3X0W A;  4BOZ B;  3QJZ A;  4DHZ E;  3DBS A;  4S0R A;  4ACF A;  1PUT A;  4EOY A;  4A90 A;  1JRP A;  1IGC A;  3DBH I;  4C7Z A;  2ZZP B;  3I63 C;  1XCT L;  5FK9 C;  4MGY E;  2KWD A;  2ON8 A;  3HHM A;  3JSV B;  4A3P A;  5IA7 A;  1EU3 A;  2RPV A;  2YVC A;  3MP9 A;  4KVG B;  3OG5 A;  1F52 A;  1FXI A;  1YNT E;  1PGA A;  4NZL B;  1EM7 A;  1BXT A;  2W82 A;  2KJR A;  1T0Q C;  3WAN A;  4E3C A;  2KVR A;  1TYG B;  1WZ0 A;  2ZVN A;  2BYE A;  4MH0 E;  1FXT B;  4LNK A;  2GBK A;  4I6N B;  1L0Y B;  5FR3 A;  1F9J A;  4LDT B;  2QIE B;  3IG3 A;  4MH8 A;  1U4A A;  3A1Q B;  4HPM B;  4GGQ A;  2LI5 A;  4W9L A;  3SHQ A;  1J7B A;  3B2F A;  2WU2 B;  2AQ2 B;  2L8J A;  1KTK A;  2XN9 C;  1R4M I;  3RI7 C;  2RDH A;  4GMV A;  1TS2 A;  1QLB B;  2D07 B;  2KQ7 A;  1K52 A;  2JZZ A;  1D6E C;  3QK0 A;  4KGS A;  1HZ6 A;  3MJ5 A;  4OVU A;  2O2V A;  5J2R A;  1E0Z A;  3U2S C;  4L1B A;  1K53 A;  3APC A;  2YEP F;  1L4D B;  3QX1 A;  3DCG A;  4MGZ E;  1WGK A;  1B1Z A;  1XEE A;  2WNM A;  4A8X C;  3SEB A;  3U52 E;  2N9X A;  2V4I B;  3B0A A;  3V6C B;  5DPW A;  3BVZ A;  4JWU C;  2BTE A;  2L0F A;  1N5X A;  1UNS A;  3ETR A;  2QDF A;  5FKA C;  5BMG A;  2JRI B;  1R4N I;  3AE8 B;  3N1X C;  2K8C A;  2ACZ B;  5EE9 A;  4IM0 A;  1CQV A;  1YQ4 B;  3IAS 1;  2WX0 A;  5BO4 B;  3R66 C;  2FCS A;  1WH3 A;  3TUO A;  2WYQ A;  1EO6 A;  3Q3N C;  2ZCC A;  1TKG A;  4MJS A;  3CIR B;  5BYQ A;  2NBV B;  1JWA D;  3T3N A;  3RT3 B;  3N9Y C;  4RF0 A;  3PO0 A;  3B1L X;  2KHW B;  4LCD E;  1TGZ B;  2WU5 B;  4IWP A;  2AX5 A;  4ARI A;  1V9J A;  1PGB A;  1Y56 A;  2HE7 A;  3V05 A;  3TIX A;  4NJC A;  1I42 A;  3VHT C;  4MM3 A;  3RNC C;  2J52 A;  1HTQ A;  3HRD D;  1QZE A;  1I7H A;  4P6V F;  4ANV A;  2C7H A;  2D3A A;  2Y5P A;  4ZYN A;  1P9D U;  2WXR A;  1F77 A;  1OQQ A;  4J6I A;  2DX5 B;  2K8H A;  3HVZ A;  3GOE A;  2BQQ A;  3S2A A;  5L95 C;  1TT5 B;  4M8M A;  3IFW B;  1E7U A;  1I4G A;  3QC8 B;  1HEZ E;  2WXL A;  3P4P B;  2Z0E B;  3RCZ A;  2INN E;  3N30 A;  2BGF A;  5IP4 D;  4FUL A;  2J0M A;  1KLU D;  1IBX B;  1WYW B;  4URK A;  2W3S A;  2JWZ A;  1FFV A;  1L0V B;  2WXF A;  3VTW A;  1QOF A;  3PLU A;  3VXW A;  3QHT A;  2JYE A;  2KAN A;  3AXC A;  3ECI A;  2JPH A;  4AUQ C;  4OZC A;  1ROE A;  2PPH A;  1ZDX A;  1FD6 A;  5I4D A;  3UQA A;  4PK1 A;  3M63 B;  4YWG G;  1F1H A;  5IKC M;  2ZPN A;  1R4M B;  4K3B A;  3Q8C A;  2ZPY A;  3PZ7 A;  3I3T B;  3L08 A;  4XWT A;  3DHH C;  1WXV A;  3ZKJ C;  2LVQ A;  4M01 A;  3AMZ A;  1FIQ A;  2LWP A;  1RYJ A;  2N7J A;  2N0S B;  1I35 A;  4JWS C;  1KH0 A;  5FR6 A;  3Q69 A;  2KO3 A;  4WWO A;  3BYY B;  2WXP A;  2W3R A;  1L5P A;  1XT9 B;  1Q5W B;  3P2B A;  4F8C B;  2Q5W D;  2KFK B;  4LJO B;  3RNA C;  4RGN A;  2KKC A;  3R8B A;  3ALB A;  3HK0 A;  3PHW B;  2GI9 A;  3GZN I;  3U30 A;  1OGW A;  2DZJ A;  4AJW A;  2MBQ A;  2DYO A;  5AEK B;  3P63 A;  5HKH A;  1WJU A;  3H7P B;  4RH6 A;  3AEA B;  3TEW A;  2JUO A;  1S1Q B;  1RFK A;  4W9H A;  3RUL A;  3BWU D;  2YLM A;  4MM3 B;  2MP2 B;  1DOI A;  3DPD A;  1JCK B;  1TS3 A;  4GB9 A;  1TJE A;  3APF A;  4DHZ B;  5JHA A;  4FBJ B;  2IY1 B;  1UBQ A;  2ZCB A;  4DXA B;  3NVY A;  1NI3 A;  3RNG C;  1A70 A;  1ZPS A;  3NY5 A;  2Y5C A;  3A4R A;  4GDL A;  2N9K A;  4ZHO A;  2BVC A;  4ASW C;  1ET9 A;  5CHF A;  3TEZ A;  4NQL B;  4DQO C;  2NPT A;  2LRU A;  4US8 A;  1DOX A;  4MAC A;  2ZNV C;  2K39 A;  1ZUD 2;  1L0X B;  3H1U A;  3AEC B;  2BYV E;  1MHX A;  4IM2 A;  2X8X X;  3T9L A;  2EMT A;  2OJW A;  2R2O A;  3ZGZ A;  2NBU A;  2WXJ A;  4NY0 A;  2WS3 B;  1QT9 A;  2DWQ A;  3VUX A;  1XQQ A;  1P7E A;  1GOZ A;  1TKE A;  1RLF A;  1KFY B;  1QOB A;  1YJJ A;  2O6V A;  2WGS A;  1P7F A;  2FCM A;  3KYC D;  2LRW A;  4PYZ A;  2IBI B;  1V5O A;  2KJH B;  4RF1 A;  1E10 A;  3VFK A;  4KZC A;  3TCA A;  2SAK A;  2VRR B;  1AW7 A;  1ZE3 D;  2W55 A;  3IXS A;  1DOY A;  1L7Y A;  3L17 A;  4W9E A;  2GRI A;  1K50 A;  1CZP A;  3ZQ4 A;  1N60 A;  5JH5 C;  1FFU A;  2KN5 A;  4GDK B;  3B2G A;  4G3X B;  2IJ0 A;  1ZXI A;  1JML A;  4G0N B;  1WY8 A;  2HD5 B;  2BS3 B;  1EF1 A;  4US9 A;  2IGG A;  3WCQ A;  3HVD A;  4B9K A;  2KX0 A;  3EEC A;  1GB1 A;  3ZXV A;  4XC2 A;  2PLP A;  1Q0W B;  2IGH A;  2ZW1 A;  5C3J B;  1NI2 A;  5DCN A;  3M3J A;  4ZDV A;  4PS3 A;  5GMV A;  5TR5 A;  1CK1 A;  2WWZ A;  2XK5 B;  2AEH A;  4AP4 C;  1TY0 A;  1T6B X;  2IO1 B;  1PFD A;  3SD5 A;  1JAL A;  2N9P C;  4WWM A;  3TMP B;  4IUM B;  2ZEQ A;  2LHD A;  5D2M B;  1QOA A;  2EEL A;  4ICU A;  5E6J A;  2KMC A;  4XE0 A;  2IZV B;  3NVZ A;  4MJS B;  4MDK E;  3VDZ A;  3PRZ A;  1WYG A;  2KWV B;  3HM3 A;  2WXG A;  3DVG X;  4EFO A;  1RFA A;  1TBE A;  2IO2 B;  2JXT A;  2DBY A;  4DK5 A;  3UIO B;  3VUW A;  2RGF A;  4RGM A;  5D3D A;  1HE8 A;  2C7N B;  2PW9 A;  1WE7 A;  2AYO B;  2MQJ A;  1BML C;  2KLG A;  2KD0 A;  4NJ6 A;  4ANU A;  3BVM A;  1KOT A;  1R4N B;  4A3O A;  1FCC C;  1YJ1 A;  4EEW A;  4YL8 A;  3RNE C;  3ZVV A;  4ZYS A;  3QQ8 B;  2Z8L A;  2KK8 A;  2PE6 B;  1GG3 A;  2DZK A;  2Y3A A;  2C5L C;  4B95 A;  2W54 A;  1YD8 U;  1Q10 A;  4HXD A;  2BWF A;  2OHF A;  5LLI A;  2VZK B;  2KT7 A;  4HDO A;  1C78 A;  2PEA A;  3AN1 A;  3NJT A;  3ONS A;  1LO5 D;  2DAJ A;  4DDG D;  3HM6 X;  1D3Z A;  3KWL A;  4LNF A;  4IC7 B;  3I57 A;  2J4X A;  4HDQ A;  2LGS A;  3O65 B;  4E74 A;  3DOW A;  5BMH A;  2R2Q A;  4AOF A;  4ICV A;  1KF6 B;  3Q3O C;  5KHO A;  2GB1 A;  4JGH B;  2RD0 A;  1XF5 L;  4HKQ A;  4M0W A;  3FKY A;  1D5M C;  1GUA B;  2DHZ A;  3ML9 A;  4G50 A;  5IOI A;  2KZR A;  3CF6 E;  2VZK D;  2CU1 A;  2K5P A;  4M8N A;  1SIJ A;  2DEN B;  3ML8 A;  1KLG D;  3OAW A;  3CST A;  4BBN F;  3RNF C;  4LNN A;  1QOG A;  4B6W A;  5GXG B;  4C56 C;  3Q8F A;  1SGH A;  4DHJ D;  2J0K A;  2JX5 A;  3NS8 A;  5HHD G;  4BKT A;  5IAA C;  2QMT A;  3RUI B;  3JW0 X;  3NZU A;  2WXQ A;  2XEW A;  2MHJ A;  4EZK A;  2WXI A;  4DBG A;  3PV1 A;  2BKR B;  2LUE A;  3SR6 A;  4KSK C;  4GIV A;  4HJG E;  2FE8 A;  2PE9 A;  1GAQ B;  2D3B A;  4LTU A;  3P4Q B;  1WRD B;  1QQR A;  1SSN A;  3Q3J A;  5HI1 A;  1WM3 A;  3Q3M C;  3ZJT A;  4H2A A;  4F1S A;  3IT4 B;  1D5X C;  1E8Y A;  4RM9 A;  4BZA A;  3H6N A;  1WGY A;  4K81 A;  1BUI C;  5C23 A;  5EDS A;  4EZL A;  2LEK A;  2AL6 A;  2FNJ B;  3GS2 A;  4RNA A;  3A1Q A;  2K1F A;  4LNI A;  2HJ1 A;  1LM8 B;  2MEK A;  3AE1 B;  1QIL A;  1VZ7 A;  2WP9 B;  3LB8 C;  2RSU A;  4WAF A;  4EE2 A;  2K8B A;  3D32 A;  2FUH B;  4RGO S;  2PTL A;  2J42 A;  2KDE B;  2L83 A;  2RDG A;  4XDD A;  3A33 B;  3R7R A;  2DLB A;  5KHQ A;  1WJN A;  4JIO U;  1F2R C;  3ZLZ A;  1C77 A;  4K1R B;  4LJP B;  3OLM D;  1WMH B;  3VUY A;  1TS5 A;  3DBL B;  2UWQ A;  4ZHP A;  1TTN A;  4FLH A;  2UYZ B;  4N6E B;  4FA6 A;  2DNF A;  2KWU B;  2N1V A;  2MX2 A;  2MW5 A;  1C4P A;  4II3 B;  2KAC A;  1LFD A;  3KQ4 A;  3Q8E A;  3R2I A;  2JY6 A;  2V0G A;  1MI0 A;  4KDI C;  2CHW A;  1T0R C;  2LXC A;  4DDI D;  4OVV A;  4WJQ A;  1NVI D;  1J8C A;  3M95 A;  3LYY A;  5J18 A;  1RRB A;  2PJH A;  5AUK A;  1J7C A;  1RM6 C;  2LGI A;  4GOC A;  2KC1 A;  3BVG A;  3W2D A;  3A9J B;  2LD9 A;  4HPL B;  3W5U B;  4HRO A;  3OJ4 B;  1WR6 E;  2NVU I;  4C7Y A;  3P1M A;  3ZO5 B;  2JXX A;  4J3O D;  3CSF A;  1C3T A;  3Q3F A;  1I4Q A;  1JRU A;  5LNK 1;  5G2N A;  2MA9 B;  1IPG A;  3RZF A;  1WGH A;  2Y5B B;  2WDV B;  4OZA A;  4HEA 1;  1H8C A;  3DQV A;  3PRP B;  1N6Z A;  1M4V A;  1YJI A;  4OZB A;  2LVP A;  1WGD A;  2VH1 A;  1ET6 A;  4GLS C;  3AH7 A;  4I6P A;  4W9F A;  2V4L A;  2KN4 A;  2PVO D;  1IUE A;  3A9K A;  3AI5 A;  1VZ8 A;  2CKH B;  1AAR A;  2BF8 B;  1NYR A;  3QAR A;  1STE A;  1VCB A;  2MJ3 A;  4LLG M;  2MBO A;  2REX A;  3PRM B;  4E71 A;  2BYF A;  2M4N A;  4BFR A;  1WJ4 A;  3U4E G;  2L05 A;  1WI0 A;  4B0E A;  2CR5 A;  1N5W A;  1K8R B;  4HK2 A;  1XLN A;  4IW0 A;  1PYW D;  3KLS X;  3L10 B;  1GC7 A;  2EKE C;  2N4F A;  2K22 A;  1AYF A;  2WXK A;  4YXD B;  3UIP B;  1MVK A;  2FID A;  1MPE A;  1V81 A;  2BWE S;  2KWC A;  2KX3 A; 
#chains in the Genus database with same CATH homology
 2K6Q A;  2MWS B;  2LGX A;  4NQL B;  1T0Y A;  2GBR A;  1WR1 A;  2NPT A;  4KIK B;  1BT0 A;  5DPT A;  3R7Q A;  3AUL A;  2CS4 A;  2LRU A;  2RPQ A;  5LXI B;  2ZNV C;  2K39 A;  2MCN B;  2KFK A;  2Z59 B;  1CMX B;  1YX5 B;  3H1U A;  2L7R A;  2BYV E;  4BKS D;  2KMA A;  2KOX A;  1V2Y A;  2M0X A;  4IM2 A;  3ZNZ B;  4JLC A;  2L76 A;  3T9L A;  3ZNH B;  3KVF B;  2EMT A;  5JZE B;  4WJP A;  3AU4 A;  2OOB B;  2GMI C;  4X57 B;  3PHX B;  2NR2 A;  4ZRI A;  4TV3 A;  2AWT A;  4HLE A;  2R2O A;  3JSV A;  1RAX A;  1OQY A;  2NBU A;  4NY0 A;  3C0R B;  1E8W A;  1UGM A;  3BY4 B;  3K9O B;  1IYF A;  2LVO A;  1MG8 A;  1UEL A;  3VUX A;  3ZDT A;  1ZGU B;  2CHX A;  5AZG A;  3PZD A;  5G55 A;  1XQQ A;  4HCP B;  4DHJ B;  2D3G A;  1RLF A;  3H9D A;  1KJT A;  2O6V A;  2FCM A;  3VH4 B;  1Z5S B;  1ZKH A;  2O6V D;  2G45 B;  3DDC B;  2LRW A;  3KH0 A;  3KYC D;  3QWZ B;  3WIM A;  2FCN A;  4PYZ A;  2IBI B;  1V5O A;  3VVW B;  2XK5 A;  2KJH B;  1WMH A;  3ZRF A;  4WAA A;  3VFK A;  4KZC A;  3DBR I;  3TCA A;  2WDT B;  3ZDM C;  2VRR B;  4MSM B;  2KNB A;  3W1Y A;  4TKN A;  3EC8 A;  3V61 A;  3KUC B;  1UZX B;  1LXD A;  4F7Z A;  2J7Q B;  1L7Y A;  3L17 A;  4W9E A;  3V62 A;  3EHV A;  2QHO A;  1WXS A;  3WAM A;  5JH5 C;  4NQK E;  4KV2 A;  4XX5 A;  3SU8 X;  2KN5 A;  4GDK B;  2M17 A;  4G3X B;  1UH6 A;  2KJ6 A;  4IWQ A;  2KC2 A;  2GBM A;  1G6J A;  3ZNI D;  3TJP A;  4K7S A;  4G0N B;  2DZI A;  3IBE A;  1WY8 A;  2HD5 B;  2O2V B;  2JVC A;  1EF1 A;  2FAZ A;  4B9K A;  2KX0 A;  2ASQ A;  3EEC A;  5E6O A;  3KYD D;  4XC2 A;  2OJR A;  1UBI A;  4BVU C;  1C1Y B;  2J0J A;  2N7E A;  3ZIM A;  1Q0W B;  4W9K A;  2ZNV B;  1WXM A;  4AJY B;  4FJZ A;  1NI2 A;  5CTR C;  5DCN A;  3QIJ A;  3M3J A;  2HTH A;  4MEL A;  4HVB A;  4PS3 A;  5GMV A;  4ZDV A;  4W9J A;  2ZVO A;  3MTN B;  2WWZ A;  2XK5 B;  2AEH A;  4FHK A;  4II2 B;  5TR5 A;  4AP4 C;  4DWF A;  4MGI E;  2IO1 B;  3SD5 A;  2JF5 A;  5JHB A;  1ISN A;  3X0W A;  3LJ3 A;  4BOZ B;  3QJZ A;  4DHZ E;  2N9P C;  1NBF C;  3TMP B;  3DBS A;  1V5T A;  4RM8 A;  5CHV C;  4EOY A;  4CHK A;  4IUM B;  3DVN V;  3WAL A;  2ZEQ A;  5D2M B;  3DBH I;  1PQS A;  3UF8 A;  2ZZP B;  3VQI A;  4ICU A;  2Z0D B;  2KMC A;  2D11 A;  2IZV B;  4MGY E;  3PT2 B;  4BKG A;  4MJS B;  3HHM A;  4MDK E;  3JSV B;  4A3P A;  3VDZ A;  5IA7 A;  2YVC A;  3PRZ A;  4BKS A;  2KWV B;  3TBL D;  4KVG B;  3HM3 A;  1Q1O A;  3DVG X;  1E5W A;  3M62 B;  4EFO A;  1RFA A;  1TBE A;  2IO2 B;  2FIF A;  3OJ3 A;  2KFJ A;  2KJR A;  5CHW A;  3WAN A;  4E3C A;  4DK5 A;  2KVR A;  4PYU A;  1WZ0 A;  4NJ7 A;  2ZVN A;  3UIO B;  3VUW A;  2RGF A;  1HE8 A;  5DPS A;  2IO3 B;  2C7N B;  2BYE A;  1WE7 A;  3L16 A;  4BBN C;  2AYO B;  2MQJ A;  3T8M A;  1YX6 B;  4M0W B;  2V3S A;  1M94 A;  2KLG A;  2JT4 B;  2KD0 A;  2NPT B;  4MH0 E;  4NJ6 A;  4WQO B;  1FXT B;  4ANU A;  1KOT A;  4A3O A;  2DAF A;  2GBK A;  1YJ1 A;  3NOB A;  2KTR A;  4I6N B;  4EEW A;  4YL8 A;  2O6V B;  3ZVV A;  1F9J A;  3QQ8 B;  4LDT B;  1E7V A;  4W9G A;  1KM7 A;  2KK8 A;  2PE6 B;  4NAW A;  3IG3 A;  1GG3 A;  2DZK A;  1U4A A;  2C5L C;  3A1Q B;  4GGQ A;  4HPM B;  3QCA A;  2LI5 A;  4W9L A;  1YD8 U;  3NZS A;  3SHQ A;  4HXD A;  2BWF A;  5LLI A;  2DZM A;  2C60 A;  4HDO A;  2PEA A;  3LDZ E;  4MEM A;  2L8J A;  1R4M I;  3ONS A;  4FHJ A;  2DAJ A;  4DDG D;  3HM6 X;  3W1S C;  1E90 A;  1IP9 A;  4GMV A;  3UIN B;  1D3Z A;  4W9C A;  2NS5 A;  4NAW B;  1P3Q U;  3WAP A;  2D07 B;  2KQ7 A;  4IC7 B;  1WF9 A;  2JZZ A;  3DBL I;  3IVF A;  3JVZ X;  4KSL C;  3QK0 A;  4HDQ A;  4OVU A;  3O65 B;  2O2V A;  5DPR A;  5J2R A;  3H7P A;  4E74 A;  3DOW A;  2R2Q A;  4AOF A;  3APC A;  2MSE D;  4ICV A;  2N1W A;  1VD2 A;  4G11 A;  5KHO A;  3QX1 A;  4JGH B;  2CHZ A;  1YIW A;  2RD0 A;  3DCG A;  4I6L B;  3VH3 B;  2B3A A;  4MGZ E;  1WIA A;  4GDK A;  1GUA B;  1XD3 B;  2DHZ A;  3ML9 A;  2N9X A;  5LXH A;  5C1Z A;  3B0A A;  4G50 A;  3UGB B;  2IO0 B;  2KLC A;  3V6C B;  5DPW A;  2MLB A;  1J19 A;  3KW5 B;  2MBB B;  2KZR A;  3CF6 E;  2L0F A;  4GU2 A;  1WX8 A;  2CU1 A;  4BOS C;  4M8N A;  2GBN A;  4HWI B;  1EUV B;  2DEN B;  2JRI B;  5E6P A;  3ML8 A;  4TQ1 A;  1R4N I;  3OAW A;  3CST A;  4BBN F;  4W9D A;  4FAD A;  1E8Z A;  2KTR B;  2K8C A;  3PGE A;  4B6W A;  4IG7 B;  3PTF C;  1SGH A;  4IM0 A;  4DHJ D;  4LDT D;  2J0K A;  5L83 A;  2DYB A;  3NS8 A;  5D94 A;  3PS6 A;  4BKT A;  3TL5 A;  4EKU A;  5IAA C;  2FCQ A;  3PLV A;  2WX0 A;  1WX9 A;  5BO4 B;  3RUI B;  3JW0 X;  3R66 C;  2FCS A;  3NZU A;  1WH3 A;  2XEW A;  2WYQ A;  4HCN B;  3VAW A;  1EO6 A;  5AZH A;  3DVN U;  2ZCC A;  4EZK A;  2G4D B;  2KDF B;  4DBG A;  4WJN A;  3PV1 A;  3V6E B;  1P1A A;  4MJS A;  2BKR B;  2LUE A;  2JZ3 B;  5E6N A;  4KSK C;  4GIV A;  3N3K B;  2JRH A;  2D10 A;  2NBV B;  3RD2 A;  2PE9 A;  3U7D A;  3RT3 B;  3KUD B;  1H4R A;  3DVG Y;  3B1L X;  2KHW B;  4GN1 A;  1V49 A;  4LCD E;  1WRD B;  2KDI A;  1TGZ B;  5D6J B;  3H7S A;  1WX7 A;  3Q3J A;  1WM3 A;  3K9P B;  4A20 A;  4IWP A;  1V86 A;  1V9J A;  4F1S A;  4GDL B;  1E8Y A;  2RR9 A;  4RM9 A;  3H6N A;  3UQB A;  1WGY A;  2HE7 A;  4AWJ A;  3TIX A;  4K81 A;  1I42 A;  2M8S A;  5AZF A;  5C23 A;  5EDS A;  3VHT C;  4EZL A;  2I1K A;  4MM3 A;  2AL6 A;  3U8Z A;  2FNJ B;  1QZE A;  3A1Q A;  2WX1 A;  2K1F A;  1Z2M A;  2N9E B;  3VTU A;  4ANV A;  1LM8 B;  1WXA A;  2C7H A;  3RZW C;  4ZYN A;  4WWP A;  1P9D U;  4TQ0 A;  4IWO A;  4J6I A;  2DX5 B;  2RSU A;  2K8H A;  1KLV A;  2G3Q B;  3GOE A;  3S2A A;  2K8B A;  3D32 A;  2C7M B;  5L95 C;  2FUH B;  3PRE A;  3ZTD A;  3RYT A;  2ZJD A;  2KDE B;  4M8M A;  4CO7 A;  3IFW B;  3X23 A;  2D2Q A;  1E7U A;  3QC8 B;  3A33 B;  4MSQ B;  1ZW7 A;  3R7R A;  2MBE A;  3ZRC A;  2Z0E B;  5KHQ A;  3RCZ A;  1WJN A;  4JIO U;  3HIZ A;  3N30 A;  3ZLZ A;  2MBH A;  2BGF A;  2KTF A;  4FJV B;  4K1R B;  3SDL C;  3AU5 A;  4LJP B;  2C9W B;  4FUL A;  3OLM D;  2IYD B;  1WMH B;  2J0M A;  3VUY A;  3MHS D;  1WYW B;  4URK A;  4PS8 A;  2DYM A;  3L54 A;  4W9I A;  2JWZ A;  2LGD A;  1OTR B;  4ANW A;  2UWQ A;  1TTN A;  4FLH A;  2UYZ B;  4ZRK A;  3VTW A;  4FA6 A;  4TUU A;  2KWU B;  3PLU A;  4HJK A;  3VXW A;  2EMS A;  2N1V A;  3QHT A;  3QA8 A;  4EUT A;  3APD A;  2MX2 A;  1J0G A;  2MW5 A;  4II3 B;  1GJZ A;  4JQW C;  1LFD A;  2KAN A;  3AXC A;  1OEY J;  3ECI A;  2JPH A;  2JY6 A;  4AUQ C;  2IY0 B;  2AL3 A;  4KDI C;  2PPH A;  2LJ5 A;  2CHW A;  1UD7 A;  2I1J A;  2LXC A;  2W9N A;  2GBJ A;  1WZ3 A;  5J17 A;  3UQA A;  4DDI D;  1YQB A;  3M63 B;  4OVV A;  1GNU A;  3ZUN A;  4WJQ A;  2MRP A;  4CYE A;  1J8C A;  2ZPN A;  3M95 A;  5J18 A;  3VTV A;  1RRB A;  2ZPY A;  2PJH A;  5D7G A;  3WAO A;  4GOC A;  2BKF A;  4NPN A;  2KC1 A;  3PPA A;  4KIK A;  3I3T B;  3A9J B;  3L08 A;  3NHE B;  3WA0 A;  2LD9 A;  4HPL B;  1WXV A;  3N32 A;  3OJ4 B;  3ZKJ C;  2A5U A;  1WR6 E;  2NVU I;  2LVQ A;  2K25 A;  3ZO5 B;  2JXX A;  3CSF A;  3W1S A;  3ZNG C;  3ZTC A;  1C3T A;  1S3S G;  3Q3F A;  1SIF A;  1JRU A;  3IHP C;  5G2N A;  4GSW A;  4ZRJ A;  2LWP A;  2MA9 B;  1IPG A;  4RMA A;  4MGK E;  2L00 B;  3V60 A;  2LZ6 A;  3RZF A;  1WGH A;  2KDB A;  1X1M A;  2Y5B B;  3JYU A;  1Y8R C;  4GXB A;  2BPS A;  2KXJ A;  3DQV A;  3PRP B;  1H8C A;  1I35 A;  3EFU A;  5FR6 A;  4WWO A;  2KO3 A;  3MJW A;  1L2N A;  5CX3 A;  4WWN A;  3R3M A;  2LVP A;  1WGD A;  1XT9 B;  4N9F 4;  3L0W B;  3KUZ A;  1Q5W B;  4K7W A;  3P2B A;  4F8C B;  1P98 A;  4I6P A;  4FN2 A;  2KFK B;  2K6D B;  4W9F A;  4LJO B;  2M1M A;  3BIN A;  2MP2 A;  4ANX A;  1GC6 A;  2V4L A;  4B95 A;  2V1Y A;  1OEY A;  3A9K A;  2KKC A;  1SE9 A;  3AI5 A;  1WGG A;  3ALB A;  3HK0 A;  3PHW B;  1NDD A;  1WJ6 A;  1WFY A;  4NNJ B;  1LQB A;  2CKH B;  3B08 A;  3L13 A;  1AAR A;  1WM2 A;  2KQS A;  2BF8 B;  2N7D A;  3GZN I;  3U30 A;  3ZW3 A;  3QAR A;  4EZJ A;  3A4S C;  1VCB A;  2LXA A;  2NCN A;  4WJO A;  1OGW A;  2MBO A;  2DZJ A;  4AJW A;  2REX A;  1E8X A;  2MBQ A;  3PRM B;  2DYO A;  5AEK B;  4E71 A;  1WGR A;  2BYF A;  2HJ8 A;  2LGY A;  2M4N A;  3A9K B;  2XBB C;  2A4Z A;  1WJU A;  5HKH A;  3H7P B;  1V6E A;  4BFR A;  1WJ4 A;  2JUO A;  2G4S A;  2L05 A;  1WI0 A;  4JL9 A;  1TZ1 A;  3PVL A;  3A9J A;  2CR5 A;  1S1Q B;  4W9H A;  2LAS A;  1K8R B;  4HK2 A;  4IM3 A;  3RUL A;  2YLM A;  1A5R A;  4KZ0 A;  4IW0 A;  2MP2 B;  2L0T A;  3PSE B;  1P0R A;  3L10 B;  1GC7 A;  3DPD A;  2EKE C;  2GOW A;  4K7U A;  4FJY A;  2N4F A;  2NBW B;  4KDL B;  2L3Z A;  4GB9 A;  3APF A;  4DHZ B;  4PS7 A;  3UIP B;  5JHA A;  4FBJ B;  2IY1 B;  1UBQ A;  2FID A;  2ZCB A;  1V81 A;  3CMM B;  2BWE S;  4DXA B;  1EF5 A;  4P7I A;  4XZ4 A;  3NY5 A;  3A4R A;  3QAQ A;  4GDL A;  1V80 A;  2KWC A;  3ENE A;  4ASW C;  1WE6 A;  5CHF A;  2KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...