4BKSA

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-1-ethanoyl-n-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 27
structure length 102
sequence length 103
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bksA00
2L8JA 3QIJA 1L7YA 2FCNA 3I3TB 4URKA 4M8NA 3OJ3A 2N9EB 1WZ3A 3H7PA 4ICVA 3S2AA 1YX5B 3WAOA 3L0WB 2GBMA 3PT2B 1TTNA 3DQVA 4DHJD 4W9IA 2N7DA 1P3QU 2C5LC 3U7DA 5DPSA 2KTFA 3A9KA 3OAWA 3X0WA 4IWOA 1V5OA 4FJZA 4JIOU 3ALBA 2BYEA 3L13A 4K1RB 3VTUA 1IP9A 2JWZA 4PS8A 3AU4A 3KYDD 2PJHA 3CSTA 1Q0WB 3QQ8B 3T8MA 1UELA 4AJYB 2MBHA 4IM2A 1WIAA 4CYEA 1XQQA 2FNJB 2GOWA 4ZRKA 2PE9A 1WE6A 3PHWB 2MLBA 4WJQA 3QC8B 4KDLB 4EKUA 3QK0A 4MGKE 2C60A 1YIWA 3M95A 2N1WA 3L08A 3PRPB 5DCNA 1LFDA 3VAWA 2AWTA 3ZNZB 4E74A 3EECA 3NS8A 3LJ3A 3PSEB 3ZRFA 4BKSA 1SGHA 4FBJB 1KJTA 4WAAA 2JPHA 1M94A 2NBVB 4B95A 2K25A 2L00B 2LWPA 3SDLC 3ML9A 1VCBA 2MCNB 4LCDE 2O6VA 2BWFA 1UH6A 1TBEA 2LVPA 3A1QA 3NOBA 5IAAC 2J7QB 1WJNA 2LXAA 1GG3A 2JF5A 2LVOA 2D3GA 4I6PA 2WYQA 2IZVB 2LJ5A 4GGQA 4BKSD 1K8RB 3AU5A 3CF6E 3RULA 1S1QB 3ZIMA 5JZEB 3VUYA 3V62A 1OQYA 3R66C 3RCZA 3ZNID 1V81A 2O6VD 3JYUA 4FJYA 2DYOA 1T0YA 2D11A 3X23A 2B3AA 1YX6B 2RSUA 4TUUA 2KQSA 4JL9A 2EKEC 3SHQA 3VTVA 3NHEB 2R2QA 4ANXA 3OJ4B 2RD0A 2L05A 2BKRB 1WRDB 4XC2A 4A3PA 1C1YB 1V49A 4K7SA 3SD5A 4W9CA 2L76A 1LQBA 1C3TA 4IUMB 4EOYA 2KX3A 2KDEB 5AZGA 2N4FA 2L3ZA 2A5UA 3M62B 1RLFA 2KJ6A 1WJ6A 4PYZA 3VFKA 4NNJB 4WWNA 3SU8X 1L2NA 5CTRC 2JVCA 2GBRA 2DAJA 2KO3A 2KWUB 3IBEA 1WR1A 1V2YA 5FR6A 3W1YA 1RAXA 4IWPA 3DVGX 2MP2A 5CHWA 1QZEA 4CHKA 2Z0EB 4ZRIA 2ZVNA 2JT4B 2K8CA 2LASA 2NBUA 2DHZA 3A33B 2GBJA 4PS3A 1IPGA 2KFKB 1E8WA 2N1VA 3ENEA 2IY0B 4NAWB 1V86A 3U30A 2LRUA 2BWES 2MBQA 2PE6B 3DBLI 5LXHA 2NPTB 1HE8A 5D2MB 3UIOB 1WMHA 1R4NI 2DYBA 4MELA 3R7QA 4WJNA 4WWOA 4GDKA 1WGHA 1KM7A 4W9JA 4BFRA 4GDLB 2J0MA 4GXBA 1P1AA 1WYWB 2NS5A 3BINA 2N7EA 4NQKE 1NDDA 2KANA 3V61A 2KNBA 2MBEA 2ZCCA 2DZKA 4HPMB 2LUEA 3ONSA 4KDIC 4KIKB 3PZDA 1YD8U 4HPLB 2MW5A 3PRMB 4DWFA 3WANA 1V5TA 2HJ8A 5GMVA 1KLVA 2UYZB 3HHMA 4K7WA 2N9XA 2KKCA 4FULA 2OJRA 1ZGUB 2KC2A 3LDZE 4JLCA 3ZVVA 1D3ZA 4FJVB 2KMCA 1WXSA 3NZUA 4FADA 5DPTA 1WJUA 2AL3A 2FAZA 2M1MA 4GB9A 3L54A 4GN1A 3UF8A 1WJ4A 1I35A 3AI5A 4MGIE 3PLVA 3H9DA 1I42A 3HM3A 1Q5WB 3A9JA 3ZNGC 4W9KA 4HVBA 2WX0A 4WQOB 4MM3A 2IO0B 3QJZA 3KW5B 4MEMA 2WWZA 2GBNA 2OOBB 3TMPB 1WGYA 2LZ6A 4YL8A 4B6WA 1TZ1A 1WXVA 4HXDA 2FCQA 3K9OB 3KYCD 3L16A 3V60A 4KSKC 3ZO5B 4ZDVA 4W9HA 3A4RA 4ASWC 3PPAA 2DAFA 3QX1A 1WI0A 1AARA 2I1JA 3KH0A 2IY1B 3N3KB 5JHBA 2CHXA 2M0XA 3WAPA 2JUOA 2DYMA 2CHWA 1WX9A 1GC6A 3L17A 2EMSA 1EUVB 3NZSA 3KUZA 3VUXA 3EFUA 2FCSA 2RR9A 3DVGY 3H6NA 4KV2A 3MJWA 4KZ0A 2W9NA 3HK0A 4IM3A 5J18A 3UIPB 3TCAA 4HLEA 1S3SG 3H7SA 1CMXB 4ZYNA 5LXIB 2G4DB 3ZKJC 2C7NB 3VVWB 3C0RB 2ASQA 3K9PB 3O65B 5AZHA 2MSED 4MSQB 3DPDA 5E6NA 2VRRB 1Z5SB 2BGFA 3DBHI 4DHZB 4OVVA 2XBBC 4AUQC 3ZTDA 2KTRA 4E71A 2RPQA 1WZ0A 2J0KA 3ZNHB 2XK5B 2JRIB 1XT9B 2L0TA 4XZ4A 3DCGA 3NY5A 3U8ZA 3UGBB 4DHJB 4MJSA 3QA8A 3KUDB 2N9PC 1V6EA 3RD2A 2C7HA 2DX5B 4HDOA 4GU2A 5LLIA 4TV3A 5L95C 4JQWC 3RZFA 4ANWA 1P9DU 4E3CA 4W9FA 3N32A 1UD7A 1NI2A 2KZRA 4CO7A 4HCNB 1F9JA 1XD3B 4II2B 3PLUA 1UBIA 3V6CB 3A9KB 3W1SC 4G3XB 2ZEQA 1WGDA 2GMIC 5AZFA 4FHKA 3WAMA 2LGDA 4BBNC 2M4NA 1OTRB 4GOCA 3VTWA 2HE7A 3EHVA 3JSVA 4NQLB 3DOWA 4NY0A 3AXCA 3TBLD 2IBIB 3MHSD 1TGZB 3PHXB 4J6IA 1YJ1A 1FXTB 2LGYA 4XX5A 1MG8A 2M8SA 1G6JA 3TIXA 2C9WB 2REXA 1JRUA 2ZVOA 2D2QA 5IA7A 2BYVE 3PVLA 2FIFA 2KX0A 5JH5C 2G45B 3VQIA 2IYDB 2PPHA 4LDTD 2ZNVB 4BOZB 1SE9A 2O6VB 3R7RA 2BPSA 3WA0A 4EZJA 3A1QB 4MH0E 2BYFA 2MBBB 1OEYA 2CHZA 3WIMA 4I6LB 4MGYE 1WX7A 3L10B 4PS7A 2V4LA 4BKGA 5J2RA 4KZCA 2DZJA 2KWVB 3IVFA 4BKTA 2KMAA 3H1UA 1RRBA 2GBKA 4P7IA 1WF9A 1E8ZA 1WH3A 2KOXA 4F7ZA 2CR5A 3P2BA 4FLHA 1J0GA 3B08A 2KLCA 1YQBA 1V9JA 2CKHB 2AYOB 4DHZE 4JGHB 1WFYA 3Q3FA 3ZRCA 1H8CA 2MRPA 3UINB 3UQBA 3AULA 4X57B 2KK8A 2ZZPB 4DBGA 4AOFA 2Y5BB 1E90A 1Z2MA 2NVUI 2LGXA 2LRWA 2ZCBA 4F8CB 5CX3A 3APDA 2V1YA 4LJPB 3VHTC 1LXDA 4HJKA 1PQSA 4W9EA 4G11A 5DPRA 5L83A 2BF8B 4BVUC 2QHOA 4GMVA 3B0AA 2LVQA 1E7VA 4I6NB 1RFAA 5CHVC 2KQ7A 2NBWB 1WR6E 1EF5A 3WALA 4HK2A 1OEYJ 2YVCA 2MP2B 2KFJA 3GOEA 4A20A 1GNUA 3GZNI 4G0NB 2KDIA 1U4AA 1EF1A 2JY6A 4MDKE 5AEKB 4HDQA 2AEHA 1VD2A 2V3SA 3HIZA 2A4ZA 4RMAA 5D94A 4WJOA 4AWJA 4ANVA 1WM3A 2O2VB 4IG7B 4G50A 4MGZE 3OLMD 1WMHB 2DZIA 2XEWA 4TQ0A 2KJHB 3ZDMC 3N30A 1GUAB 4GDKB 2ZNVC 3QCAA 1V80A 3KUCB 5TR5A 2G4SA 1H4RA 4FN2A 2JZ3B 3APCA 3MTNB 2K8BA 4KVGB 2KDFB 3VDZA 3B1LX 4NJ6A 1WGRA 2IO3B 2NCNA 1Y8RC 1E5WA 4PYUA 3D32A 3QHTA 3BY4B 2KD0A 3VH4B 4KSLC 4WWPA 2I1KA 2KFKA 4A3OA 2WX1A 2D07B 3PGEA 1WE7A 4NAWA 3RZWC 4F1SA 4W9GA 1J19A 1UZXB 2C7MB 2K8HA 4TQ1A 4FHJA 2KVRA 2NPTA 3RUIB 1GJZA 4AJWA 4RM9A 4EZLA 4W9DA 3VH3B 3PRZA 2Z59B 1IYFA 2KLGA 1GC7A 3H7PB 4NPNA 3EC8A 3A9JB 4EFOA 3RYTA 2JXXA 4M8MA 4GDLA 1P0RA 2KN5A 4EUTA 2CU1A 4DDGD 2MX2A 1SIFA 4II3B 3QWZB 1A5RA 4WJPA 4KIKA 2KC1A 2ZJDA 4FA6A 3JW0X 3CMMB 2WDTB 5E6PA 1BT0A 2KJRA 5G55A 1EO6A 4TKNA 3ZLZA 3DBSA 1E7UA 2MQJA 3R3MA 4ZRJA 1ZKHA 3ZTCA 1OGWA 2KDBA 3ZDTA 2YLMA 3JVZX 1LM8B 2HTHA 5BO4B 4K81A 4BBNF 2K39A 2MBOA 3UQAA 3Q3JA 4IC7B 2IO1B 2LI5A 4ICUA 4IM0A 3TL5A 2FIDA 2DENB 3W1SA 4AP4C 4ANUA 5CHFA 4K7UA 4M0WB 2UWQA 1J8CA 1WM2A 1WXMA 1X1MA 5E6OA 1WXAA 1KOTA 4EZKA 4DDID 2HD5B 2LD9A 3DDCB 2JZZA 4IWQA 2CS4A 2AL6A 5C1ZA 3PS6A 3QARA 4IW0A 3PREA 2JRHA 5G2NA 4GSWA 2KTRB 5HKHA 3ZW3A 3IFWB 2NR2A 1E8YA 3ECIA 3PTFC 2J0JA 1ZW7A 1E8XA 5D6JB 3VUWA 4DK5A 5KHQA 3CSFA 4W9LA 2FCMA 2DZMA 2PEAA 1UGMA 5KHOA 2MWSB 4B9KA 3DBRI 4EEWA 5J17A 2O2VA 4MJSB 3VXWA 3RT3B 4MSMB 1NBFC 3DVNU 3QAQA 5C23A 1P98A 2BKFA 2D10A 2K1FA 2KXJA 5D7GA 2RGFA 3M3JA 4HWIB 4BOSC 4LJOB 3T9LA 3PV1A 4GIVA 2M17A 4DXAB 5DPWA 2L0FA 2Z0DB 2FUHB 4HCPB 2LXCA 2ZPNA 1R4MI 2L7RA 2KHWB 1Q1OA 4RM8A 1UBQA 1WGGA 5JHAA 3A4SC 2K6QA 3IG3A 2EMTA 5EDSA 4NJ7A 2IO2B 2G3QB 2K6DB 2XK5A 3ZUNA 2KWCA 2ZPYA 3APFA 3JSVB 3KVFB 3ML8A 2R2OA 3IHPC 2MA9B 1WY8A 1WX8A 4OVUA 3TJPA 3HM6X 3DVNV 1ISNA 3V6EB 4N9F4 4LDTB 3M63B
chains in the Genus database with same CATH superfamily
2L8JA 2FUG1 1D6EC 3R2TA 3H7PA 3VR8B 4ZRPA 5D3DA 1XCQL 2WXJA 4OZAA 4K1RB 3L13A 1ZE3D 1L0XB 2JWZA 3AU4A 3CSTA 3QQ8B 3T8MA 4K3CA 2MBHA 3MJ5A 1XQQA 4ZRKA 1WE6A 2MLBA 1TKGA 2W82A 2J53A 4MGKE 2C60A 4ARCA 1A70A 2N1WA 5DCNA 4EE2A 3VAWA 2AWTA 4YTMB 4BKSA 1SGHA 4FBJB 1M94A 1TS4A 3BYTB 2G1EA 2MCNB 1UH6A 3O13A 2LVPA 2PMVA 4YSZB 4I6PA 4N59A 2LJ5A 3Q3NC 3CF6E 3RULA 1I4HA 3VUYA 2NMQA 3R66C 2O6VD 4AQ7A 3RMKC 3VR9B 2D11A 1YX6B 4TUUA 3ZQ4A 2KN4A 3SHQA 1PUTA 3OJ4B 1HEZE 1XLOA 1PGXA 1KTKA 2IGHA 3SD5A 4W9CA 1LQBA 2KDEB 1EU4A 2N4FA 5IOIA 3VFKA 2KJ6A 1TS3A 4WWNA 3R8BA 5CTRC 2GBRA 1WR1A 3AM9A 2Z0EB 4ZRIA 2GBJA 2M19A 1YN3A 4NAWB 4A8XC 5LXHA 1RM6C 2NPTB 1R4NB 2J4XA 1WMHA 4WJNA 4WWOA 1PFDA 4W9JA 2K9XA 1P1AA 2NS5A 1QILA 3BINA 2N7EA 2LUEA 3AB5A 4HPLB 1V5TA 4HEA1 4K7WA 2VH2A 4FJVB 2ZW1A 2KMCA 3V05A 3BK2A 2M1MA 4MH8A 1BUIC 3AH7A 3L54A 3UF8A 3DWGC 3FILA 3H9DA 3HM3A 3IAS1 3AEBB 1JRPA 1Q10A 2LZ6A 4B6WA 4HXDA 1PGBA 4UDUC 1FNVA 3KH0A 3GB1A 2CHXA 3WAPA 2JUOA 1VLBA 2EMSA 1EUVB 3NZSA 1P7EA 3EFUA 2FCSA 4KZ0A 3HK0A 2AQ1B 1S3SG 4NZLB 3OG5A 1CMXB 1V1PB 2JYTA 4OHJA 2G4DB 1QOFA 3K9PB 3O65B 2MSED 3DPDA 2CJNA 1F52A 1YQ3B 4AUQC 2Y3AA 4WH4A 1XT9B 3DCGA 3NY5A 4DHJB 4XGAB 3RNFC 3BZDB 2KT7A 3KUDB 2N9PC 2C7HA 3AE9B 2DX5B 4GU2A 4JQWC 3P4SB 3E56A 4W9FA 1E7PB 1UD7A 1ZUD2 1JWMD 4II2B 1UBIA 2HJ1A 1WGDA 1STEA 4GOCA 3JSVA 2K0PA 3GP7A 3TBLD 3MHSD 2PTLA 3BIID 4M00A 1TGZB 4J6IA 3I63C 1YJ1A 1FXTB 1M4VA 1MG8A 3TIXA 3TEZA 5JH5C 1L5PA 2G45B 4XWWA 2IYDB 4LDTD 4BOZB 1SE9A 1TIFA 4EZJA 4MH0E 1FRRA 2BYFA 2MBBB 2INCC 1WX7A 3AEEB 2DZJA 4BKTA 4A55A 2KMAA 1E8ZA 2KOXA 2OHFA 4FLHA 1J0GA 3LB8C 3LYYA 2AYOB 4JGHB 2BTEA 1N61A 1RWSA 1P7FA 3BVMA 3UQBA 3CWIA 5H8YE 2MJEA 4KGTA 4AOFA 2NVUI 4LNFA 4F8CB 4N58A 5T8IA 5CX3A 4LK0M 4G11A 4BVUC 3RPFC 2WDVB 2LVQA 1E7VA 1RFAA 1MI0A 5CHVC 1YOVB 3W5VB 4RGOS 3V3XA 1WR6E 3GOEA 2KMMA 1HZ6A 3AMZA 1SB3C 4HDQA 1VD2A 3HIZA 3IT4B 4RMAA 2WDRB 4WJOA 4ANVA 2DBYA 1DOIA 3U52E 1WMHB 1E0ZA 4TQ0A 2KJHB 3KUCB 5TR5A 2G4SA 1H4RA 4KVGB 1CJEA 3DHHC 1QKZA 4NJ6A 1I4PA 4JE3B 4XDDA 1Y8RC 4Q2JA 3C19A 2V4IB 4ARIA 3BY4B 4RH6A 1NYQA 3VH4B 4KSLC 1XLPA 4A3OA 2WX1A 3TEWA 1D4BA 1SF0A 4F1SA 1L6UA 2C7MB 4RM9A 4EZLA 2Z59B 3FILB 3TSSA 2YEPF 1SE3A 1XEEA 4YSXB 4DDGD 4OZBA 1SIFA 3QWZB 4WJPA 1K53A 2WDTB 1L4ZB 4WAFA 1TYGB 4HKQA 2BT6A 1HXYD 3JVZX 1XLQA 2VZKB 5BO4B 4BBNF 2QMTA 2K39A 3Q6BA 3UQAA 4JPSA 3RFZB 2LI5A 5FKAC 3I57A 5EE3A 4AP4C 3IXSA 1KH0A 1WXMA 1X1MA 2LD9A 2MHJA 3NG0A 1RFKA 2AL6A 2JRHA 2X8XX 4GSWA 2NR2A 1E8YA 5D6JB 2WXPA 3TEXA 3CSFA 1WSPA 3DBRB 1C4AA 5BMHA 3P63A 5C23A 2M56B 5D7GA 2RGFA 4LJOB 3GE8C 3Q8EA 3URYA 2FUHB 1Q1OA 1UNSA 2K6QA 3AE6B 4NJ7A 2G3QB 1ENFA 3JSVB 2MA9B 4OVUA 3HM6X 3V6EB 1ZDXA 2FCNA 3I3TB 1JWSD 3I5JC 4M8NA 3WAOA 2GBMA 4HRSA 4DHJD 2N7DA 3U7DA 3C8YA 1SIJA 4IWOA 3VTUA 4FJZA 3BYYB 1K51A 1IP9A 2KQ4X 3KYDD 1VRAB 1Q0WB 1DGJA 1UELA 4IM2A 2PE9A 1C77A 2PIAA 4JWSC 4WJQA 1FPYA 3QK0A 3KQ4A 1YIWA 3L08A 1C79A 2E6XA 4XYCA 3ZNZB 3LJ3A 3PSEB 4WAAA 1LO5D 2JPHA 4C00A 3ML9A 4B0EA 3A1QA 1VR9A 1WJNA 1GG3A 2J42A 1YJJA 4YTPB 3MC8A 2OEDA 4BKSD 5BYSA 1E6EB 5JXVA 1TS5A 3JYUA 4FJYA 2DYOA 2GB1A 2RSUA 4ZHPA 4JL9A 4O1NA 2EKEC 2PVGC 1F2RC 4S0RA 1WRDB 2WDQB 1D5XC 4A3PA 2IJ0A 3AN1A 4H2AA 2M0AA 4OW0A 2L76A 4IUMB 4EOYA 2INNE 1L2NA 1K52A 3SU8X 2JVCA 2KO3A 3IBEA 1V2YA 2PKOA 1OQRA 3W5UB 2W55A 2JU6X 2JT4B 2LASA 2WGSA 2BB5A 1IPGA 1D5ZC 2KACA 3MC9A 2N1VA 2IY0B 3GE3C 3DBLI 2MBQA 2PE6B 1HE8A 3R7QA 2D3CA 2MJ3A 2GRIA 4XWTA 1FMAD 3EA6A 3MC0B 2ACZB 2IGGA 2ZCCA 4KDIC 2YEPB 1YD8U 1N5WA 3AECB 4WQMA 3WANA 3ZYYX 2N9XA 4QAYA 1VDVA 3DHGC 4FULA 2QSDA 4JLCA 3ZVVA 4C7YA 1NI3A 2N7JA 3RNCC 3NZUA 1WJUA 2AL3A 5EE9A 4A90A 2B76B 1F2RI 5BMIA 4MGIE 4YSYB 4HVBA 1SXTA 2WX0A 1FNWA 2OOBB 2QJLA 1FNUA 4IOIE 3SEBA 1TY2A 3A4RA 1AARA 1AN8A 1ROEA 3E9SA 3Q8FA 3KUZA 3N9YC 3DVGY 3TEYA 5J18A 4OZCA 4HLEA 1ZXIA 2WXQA 1YN4A 2ON8A 2PW9A 4M0WA 2C7NB 4KGSA 2VZKD 5AZHA 3CIRB 5E6NA 2VRRB 2XBBC 3AV8A 3ZTDA 3AE8B 4B0MA 2JRIB 2V9HA 3QA8A 4C4VA 2V0GA 1XXGA 1WWTA 3RD2A 1C9FA 5LLIA 3HVZA 4E3CA 3RZFA 4ANWA 1N60A 2Y5PA 1NI2A 4HCNB 3AEFB 4US9A 4HKZE 3PLUA 4KX6B 4G3XB 4LNKA 3GS2A 2Y5CA 3WAMA 2QEJC 4BBNC 1K50A 3VTWA 4ZYSA 3IAM1 5G5HA 4NY0A 3AXCA 1C78A 1WXQA 3KWLA 2BVCA 3DHIC 5HHDG 2XN9C 4XX5A 1UWXA 1QOGA 2REXA 4DXFA 2ZVOA 1FFVA 1V8CA 1FIQA 3PVLA 2FIFA 1ET6A 2BPSA 3WA0A 3A1QB 2CHZA 4OVZA 1AWDA 1NYRA 2ONQA 2GBKA 4P7IA 2SAKA 1QF6A 4RNAA 3MP9A 4F7ZA 2CR5A 3B08A 2NTTA 2CKHB 2WP9B 1WFYA 1QT9A 3Q3FA 2MRPA 3UINB 4X57B 2KK8A 3NZ3A 2ZZPB 4DBGA 2Y5BB 4P1CC 4DXGA 4P1BC 2LGXA 3P4PB 3AE3B 2V1YA 4W9EA 5L83A 4HROA 3B0AA 4LNIA 2LFIA 2YVCA 3GZNI 5AEKB 2AEHA 2A4ZA 3B9JA 2JXTA 1IGDA 4IDIA 4M01A 4G50A 2DZIA 2XEWA 2D5GA 1GUAB 4KGRA 2V3NA 1ACCA 3MTNB 2TSSA 1EM7A 1E5WA 4PYUA 3D32A 3QHTA 2V3PA 2Z8LA 4WWPA 2GLSA 2K8HA 1TKYA 1GJZA 1FCCC 4W9DA 1IYFA 3H7PB 2WXIA 3EUB2 2AQ2B 3IT6B 4EFOA 1P0RA 2MX2A 1I4QA 4FA6A 4ZHOA 3CMMB 1QQRA 1FD6A 1BT0A 2KJRA 1EO6A 2BS4B 3ZLZA 3DBSA 2MQJA 1TZOA 3R3MA 4ZRJA 2I2YA 1ZKHA 3HRDD 2JX5A 3VRAB 3TL5A 3W1SA 4K7UA 2WNMA 4M0WB 2BQQA 1DOXA 4A9AA 1WXAA 4L23A 3NRZA 4IWQA 4IW0A 3AE2B 3ZW3A 2J0JA 1ZW7A 1E8XA 2WHIA 1QLBB 5KHOA 4K3BA 2WXGA 2KVZA 5J17A 2O2VA 3QAQA 2K1FA 4C4VB 2D10A 4BOSC 1FXAA 1J7BA 4CQNA 4HJGE 4GIVA 1ZPSA 1AYFA 4LNNA 5E6JA 4L2YA 2L0FA 2QDFA 1JMLA 2Z0DB 3T3NA 3AE1B 1WGGA 1SBBB 3A4SC 2EMTA 2IO2B 3ZUNA 2XK5A 2KWCA 2ZPYA 3KVFB 1XCTL 3ML8A 1WY8A 2KAJA 3TJPA 1ISNA 1E9MA 4RGTA 3M63B 4URKA 1SE4A 3OJ3A 1WZ3A 2X38A 4ICVA 1YX5B 4J3OD 1QOAA 3PT2B 1TTNA 3DQVA 1P3QU 2C5LC 5DPSA 1SJED 5G5GA 2KTFA 3AE7B 2BYEA 2NTSA 2PJHA 4A6QA 1JWUD 1I4RA 2N9KA 2GOWA 3P4RB 4PT5A 1VZ8A 3PHWB 3QC8B 3M95A 2L1AA 3EECA 2NBVB 1XF5L 3U2SC 1IGCA 2L00B 2LWPA 3SDLC 4LCDE 1IUEA 3RNEC 1UWMA 2LXAA 5C2TB 4M02A 2D3GA 2WXHA 2WYQA 2IZVB 3SFDB 3AU5A 1PGAA 1S1QB 3U7ZA 3V62A 2LGIA 3HUIA 2KQSA 3VTVA 2R2QA 1VZ6A 2RD0A 2L05A 2BKRB 2LEKA 2CU3A 1C1YB 2WU2B 3EGRA 3SR6A 1YJIA 2KX3A 1PDXA 3L4PA 3W9CB 2L3ZA 4PYZA 1RLFA 1WJ6A 4NNJB 3NJTA 1MJDA 2KWUB 1NENB 4IWPA 2IPKD 1T6BX 2MP2A 4CHKA 2ZVNA 2K8CA 1GPXA 2JQRB 4RF1A 2EELA 5EE0A 3ENEA 3DBLB 1V86A 3U30A 4RF0A 2BWES 5D2MB 3UIOB 1JCKB 1CZPA 2DYBA 2QC8A 4MELA 2JZPA 2LGSA 4DQOC 4GXBA 3FC4A 1NDDA 2KNBA 2DZKA 4HPMB 3ONSA 3PZDA 2WLBA 4DWFA 3PRMB 4YTNB 3HHMA 2JYEA 2OJRA 1ZGUB 2KC2A 1D3ZA 2BS3B 3NUHB 2AQ3B 1WXSA 4FADA 5DPTA 2FAZA 2INPE 2BYTA 4GB9A 4GN1A 3N1ZC 1WJ4A 1HZ5A 1I35A 3AI5A 4LTUA 1UUPA 2MJDA 4W9KA 2H88B 4WQOB 4MM3A 1XLNA 2IO0B 4YWGG 2WWZA 2WXKA 1CQVA 1TZ1A 1WXVA 2FCQA 4KSKC 4ZDVA 4W9HA 4ASWC 3PPAA 2L52A 1HQRD 3QX1A 3B2GA 2IY1B 2JWUA 3Q3MC 3Q8CA 1ZXHA 2DYMA 1WX9A 1GC6A 3L17A 3BVGA 2RR9A 3H6NA 3MJWA 2WS3B 3UIPB 3AEGB 4ZYNA 1YN5A 1RYJA 5LXIB 3ZKJC 2W54A 1FFUA 3NVYA 1Z5SB 2BGFA 4DHZB 4E71A 2KTRA 1WZ0A 1L6VA 2J0KA 2XK5B 4C7ZA 3NVVA 4XZ4A 3U8ZA 3UGBB 1F0ZA 2FBWB 1JWBD 5HI1A 2N9LA 4HDOA 2H89B 4TV3A 1I4XA 5L95C 1P9DU 2XNAC 4CO7A 1F9JA 1XD3B 1JWAD 2KWDA 3P42A 5IO9A 3W1SC 4FHKA 2WXMA 4L1BA 2DNFA 2W3RA 3EHVA 1BXTA 3DOWA 2KYWA 2IBIB 2BW2A 1NEKB 2QCZA 2M8SA 1JRUA 3P1MA 2WXLA 2D2QA 2BYVE 3B2FA 3VQIA 2PPHA 1SE2A 3R7RA 3N1YC 1OEYA 4MGYE 2WXRA 4S17A 2V4LA 4ZRQA 4KZCA 1JW9D 2KWVB 3ZXRA 4ITKA 3H1UA 1RRBA 4MT5A 2WU5B 2KLCA 2ZW0A 1Y56A 1YQBA 2AX5A 1QOBA 4KKIA 4PK1A 3ZRCA 1H8CA 5TSSA 1HTQA 3ABVB 1E90A 1Z2MA 2MEKA 4ZOHC 3KWVA 4LJPB 1LXDA 1WRIA 1PQSA 5DPRA 2BF8B 2QHOA 1EF5A 3WALA 2MP2B 2KFJA 3GZNB 4A20A 2LUMA 1GNUA 4MDKE 2KDIA 2JY6A 1FEHA 2RDHA 2V3SA 1MHHE 4AWJA 3PO0A 1FCLA 1WM3A 3ZJTA 4MGZE 3OLMD 1IBXA 3AE4B 3ZDMC 3HVDA 3RN9C 1HTOA 3QCAA 3I9V1 1V80A 5LNK1 4FN2A 2JZ3B 2WQYB 3B1LX 2IO3B 1L0YB 1TS2A 1KF6B 3ZXVA 2KD0A 1JQ4A 5IKCM 2I1KA 1T0SC 2KFKA 3RZWC 1ZOYB 1J19A 4C56C 4FHJA 4FXCA 4BZAA 2VH1A 4N6EB 4AJWA 3PRZA 1B1ZA 4YXDB 2KLGA 1GC7A 2K5PA 3RYTA 1SEBD 4GDLA 4MM3B 1FXIA 5D3IB 2CU1A 4XE0A 4KIKA 2ZJDA 3MFGA 5E6PA 5G55A 1YQ4B 4TKNA 1E7UA 4NJCA 3ZTCA 3ZDTA 2YLMA 1N5XA 1LM8B 1VZ7A 2HTHA 4K81A 2L83A 1TT5B 3Q3JA 4IM0A 4ICUA 2DENB 4ACFA 5CHFA 2UWQA 1SSNA 4WWMA 1XO3A 1KOTA 5FK9C 4EZKA 1R7SA 2HD5B 1J7CA 2JZZA 2CS4A 5C1ZA 1TY0A 3PREA 2KTRB 1GB4A 2GI9A 3EFCA 3ECIA 3VUWA 1OQQA 5KHQA 5BYRA 2DZMA 2PEAA 4EEWA 4KKJA 1P98A 3RI7C 3M3JA 3Q8AA 3ZGZA 3AE5B 4DXAB 5DPWA 3MHZA 1EWCA 2ZPNA 2L7RA 2KHWB 4RM8A 1UBQA 1F77A 1JROA 1CK1A 5EDSA 2K6DB 3U4EG 1NVID 4RCOA 3IHPC 3DVNV 3ETRA 3QIJA 1L7YA 4MACA 2N9EB 3S2AA 3PZ8A 4GLSC 3L0WB 3OWEB 2HDEA 1L0VB 4W9IA 3A9KA 3OAWA 2N0SB 3X0WA 1V5OA 4JIOU 3ALBA 4PS8A 1N6ZA 5BMGA 4AJYB 1WIAA 4CYEA 2FNJB 3Q8BA 3RNBC 5IP4D 4KDLB 4EKUA 3PRPB 1LFDA 4E74A 3NS8A 4C80A 3ZRFA 2RPVA 1B9RA 1KJTA 1AW7A 4B95A 2K25A 1VCBA 2G9HD 2O6VA 2BWFA 3W2DA 3DBHB 1TBEA 3NOBA 5IAAC 2J7QB 2JF5A 2LVOA 3Q14C 4GGQA 3BK1A 1K8RB 5JZEB 3ZIMA 1I7HA 1KRHA 1OQYA 3RCZA 3ZNID 1V81A 1T0YA 3X23A 2B3AA 2IGDA 2OJWA 3TUOA 1YMHE 3NHEB 4ANXA 1T3QA 4XC2A 2J52A 1V49A 4K7SA 1KFYB 1KLGD 2EKIA 1C3TA 1IBXB 3N20C 5AZGA 1TJEA 2A5UA 3M62B 2DAJA 5FR6A 3W1YA 1RAXA 4TSSA 3DVGX 2I38A 5CHWA 1QZEA 3R2IA 4BAXA 2NBUA 4XDCA 4RGNA 2DHZA 3A33B 4PS3A 2KFKB 1E8WA 2UU7A 2LRUA 2JSVX 3NS1A 1J7AA 1E10A 3Q69A 1R4NI 1LGRA 3NVWA 4GDKA 1GOZA 1WGHA 1KM7A 4BFRA 4GDLB 2J0MA 2MH7A 1WYWB 4NQKE 2KANA 3V61A 2MBEA 4KIKB 2MW5A 2HJ8A 5GMVA 1KLVA 2UYZB 2KKCA 2LJIA 3LDZE 1T0RC 2RDBC 1PYWD 1I4GA 1MPEA 2RMMA 3PLVA 1I42A 3N1XC 1Q5WB 3A9JA 3AEAB 3ZNGC 1C4PA 3QJZA 3KW5B 1GB1A 4MEMA 2GBNA 3TMPB 1WGYA 4YL8A 3K9OB 3L16A 3KYCD 3V60A 3ZO5B 2WXOA 2DAFA 1WI0A 3N3KB 2I1JA 5JHBA 4REZA 2M0XA 2CHWA 1BMLC 1D5MC 3VUXA 4KV2A 2W9NA 4IM3A 3TCAA 3H7SA 1MVKA 3VVWB 3C0RB 2ASQA 5C3JB 4NAMA 4MSQB 4RFBA 3DBHI 4OVVA 1SJHD 2BBCA 2RPQA 5IN7A 4YT0B 3ZNHB 2L0TA 3BWUD 3KLSX 1N62A 3NVZA 2Q5WD 4MJSA 2RDGA 1V6EA 2LHDA 1EWYC 2K3UA 3N32A 1DOYA 2KZRA 3P4QB 1DYQA 3V6CB 3A9KB 5AZFA 2ZEQA 2GMIC 2LGDA 1ZDVA 2M4NA 4P6VF 1OTRB 2HE7A 4NQLB 1ET9A 5HFYA 3PHXB 5EE1A 4LNOA 1MHXA 2LGYA 3WCQA 1G6JA 2C9WB 5IA7A 1OFFA 2CJOA 2KX0A 1HA5A 2BS2B 2ZNVB 2O6VB 2IDYA 3ZJVA 1C4CA 3WIMA 4I6LB 5I4DA 3L10B 4PS7A 4BKGA 5J2RA 1UGJA 3IVFA 2INDC 4D2KA 1EU3A 1N63A 1WF9A 3Q3OC 1WH3A 4USAA 3P2BA 1ZP0B 1V9JA 2PLPA 1FRDA 1R4MB 1GAQB 4LLGM 3AULA 3Q2AC 1V97A 2LRWA 2ZCBA 3APDA 3VHTC 4HJKA 3T3OA 5MPOA 4GMVA 5GXGB 1FO4A 4I6NB 2KQ7A 2NBWB 4DHZE 4HK2A 1OEYJ 4IKGA 4G0NB 3RNGC 1U4AA 1EF1A 5D94A 2O2VB 1MG4A 4IG7B 2LHEA 2FE8A 1V1OA 2BB6A 4RGMA 2PVOD 3N30A 4GDKB 2ZNVC 3APCA 2K8BA 1T5XD 2KDFB 1WYGA 3VDZA 4JX1C 1WGRA 2NCNA 5H92C 2LMCA 1T0QC 5FR3A 2D07B 3PGEA 4R3DA 1WE7A 3LXFA 4NAWA 4W9GA 1UZXB 4TQ1A 3RUIB 2KVRA 2NPTA 3VH3B 3FAHA 2WXFA 3ZJUA 3BVZA 4NPNA 3EC8A 3A9JB 5AUKA 2JXXA 2L32A 4M8MA 1WGKA 2KN5A 4EUTA 2K22A 3H8HA 4II3B 1A5RA 2KC1A 4WURA 3JW0X 4TMAB 4WIPA 3UI3A 1MFWA 1YNTE 1OGWA 2KDBA 1L4DB 1ESFA 1C76A 3AEDB 3J9CA 2MBOA 1UF0A 2ICIA 5HG2A 4IC7B 2IO1B 2DWQA 2FIDA 4ANUA 2R61A 4JWUC 2D3AA 1J8CA 1WM2A 5E6OA 4DDID 3DDCB 1KLUD 1VJKA 3PS6A 5AUIA 3QARA 4US8A 5G2NA 5HKHA 2WXNA 3IFWB 2QIEB 3PTFC 4DK5A 3DWMA 4W9LA 2FCMA 2D3BA 1UGMA 4B9KA 2MWSB 3DBRI 4MJSB 3VXWA 3RT3B 4MSMB 1NBFC 3DVNU 2BKFA 2KXJA 1TKEA 4HWIB 3T9LA 4HPPA 3PV1A 2W3SA 2E3TA 1V1PA 2M17A 3SFEB 2KDMA 5BYQA 3PZ7A 4HCPB 2LXCA 1R4MI 1F1HA 5JHAA 1FM0D 2DLBA 3RNAC 3IG3A 2QILA 3VRBB 3APFA 3FKYA 2R2OA 1WX8A 1JALA 4AS1A 2HTME 4N9F4 4LDTB 4P16A 2SEBD
chains in the Genus database with same CATH topology
2L8JA 3QIJA 1L7YA 2FCNA 3I3TB 4URKA 4M8NA 3OJ3A 2N9EB 1WZ3A 3H7PA 4ICVA 3S2AA 1YX5B 3WAOA 3L0WB 2GBMA 3PT2B 1TTNA 3DQVA 4DHJD 4W9IA 2N7DA 1P3QU 2C5LC 3U7DA 5DPSA 2KTFA 3A9KA 3OAWA 3X0WA 4IWOA 1V5OA 4FJZA 4JIOU 3ALBA 2BYEA 3L13A 4K1RB 3VTUA 1IP9A 2JWZA 4PS8A 3AU4A 3KYDD 2PJHA 3CSTA 1Q0WB 3QQ8B 3T8MA 1UELA 4AJYB 2MBHA 4IM2A 1WIAA 4CYEA 1XQQA 2FNJB 2GOWA 4ZRKA 2PE9A 1WE6A 3PHWB 2MLBA 4WJQA 3QC8B 4KDLB 4EKUA 3QK0A 4MGKE 2C60A 1YIWA 3M95A 2N1WA 3L08A 3PRPB 5DCNA 1LFDA 3VAWA 2AWTA 3ZNZB 4E74A 3EECA 3NS8A 3LJ3A 3PSEB 3ZRFA 4BKSA 1SGHA 4FBJB 1KJTA 4WAAA 2JPHA 1M94A 2NBVB 4B95A 2K25A 2L00B 2LWPA 3SDLC 3ML9A 1VCBA 2MCNB 4LCDE 2O6VA 2BWFA 1UH6A 1TBEA 2LVPA 3A1QA 3NOBA 5IAAC 2J7QB 1WJNA 2LXAA 1GG3A 2JF5A 2LVOA 2D3GA 4I6PA 2WYQA 2IZVB 2LJ5A 4GGQA 4BKSD 1K8RB 3AU5A 3CF6E 3RULA 1S1QB 3ZIMA 5JZEB 3VUYA 3V62A 1OQYA 3R66C 3RCZA 3ZNID 1V81A 2O6VD 3JYUA 4FJYA 2DYOA 1T0YA 2D11A 3X23A 2B3AA 1YX6B 2RSUA 4TUUA 2KQSA 4JL9A 2EKEC 3SHQA 3VTVA 3NHEB 2R2QA 4ANXA 3OJ4B 2RD0A 2L05A 2BKRB 1WRDB 4XC2A 4A3PA 1C1YB 1V49A 4K7SA 3SD5A 4W9CA 2L76A 1LQBA 1C3TA 4IUMB 4EOYA 2KX3A 2KDEB 5AZGA 2N4FA 2L3ZA 2A5UA 3M62B 1RLFA 2KJ6A 1WJ6A 4PYZA 3VFKA 4NNJB 4WWNA 3SU8X 1L2NA 5CTRC 2JVCA 2GBRA 2DAJA 2KO3A 2KWUB 3IBEA 1WR1A 1V2YA 5FR6A 3W1YA 1RAXA 4IWPA 3DVGX 2MP2A 5CHWA 1QZEA 4CHKA 2Z0EB 4ZRIA 2ZVNA 2JT4B 2K8CA 2LASA 2NBUA 2DHZA 3A33B 2GBJA 4PS3A 1IPGA 2KFKB 1E8WA 2N1VA 3ENEA 2IY0B 4NAWB 1V86A 3U30A 2LRUA 2BWES 2MBQA 2PE6B 3DBLI 5LXHA 2NPTB 1HE8A 5D2MB 3UIOB 1WMHA 1R4NI 2DYBA 4MELA 3R7QA 4WJNA 4WWOA 4GDKA 1WGHA 1KM7A 4W9JA 4BFRA 4GDLB 2J0MA 4GXBA 1P1AA 1WYWB 2NS5A 3BINA 2N7EA 4NQKE 1NDDA 2KANA 3V61A 2KNBA 2MBEA 2ZCCA 2DZKA 4HPMB 2LUEA 3ONSA 4KDIC 4KIKB 3PZDA 1YD8U 4HPLB 2MW5A 3PRMB 4DWFA 3WANA 1V5TA 2HJ8A 5GMVA 1KLVA 2UYZB 3HHMA 4K7WA 2N9XA 2KKCA 4FULA 2OJRA 1ZGUB 2KC2A 3LDZE 4JLCA 3ZVVA 1D3ZA 4FJVB 2KMCA 1WXSA 3NZUA 4FADA 5DPTA 1WJUA 2AL3A 2FAZA 2M1MA 4GB9A 3L54A 4GN1A 3UF8A 1WJ4A 1I35A 3AI5A 4MGIE 3PLVA 3H9DA 1I42A 3HM3A 1Q5WB 3A9JA 3ZNGC 4W9KA 4HVBA 2WX0A 4WQOB 4MM3A 2IO0B 3QJZA 3KW5B 4MEMA 2WWZA 2GBNA 2OOBB 3TMPB 1WGYA 2LZ6A 4YL8A 4B6WA 1TZ1A 1WXVA 4HXDA 2FCQA 3K9OB 3KYCD 3L16A 3V60A 4KSKC 3ZO5B 4ZDVA 4W9HA 3A4RA 4ASWC 3PPAA 2DAFA 3QX1A 1WI0A 1AARA 2I1JA 3KH0A 2IY1B 3N3KB 5JHBA 2CHXA 2M0XA 3WAPA 2JUOA 2DYMA 2CHWA 1WX9A 1GC6A 3L17A 2EMSA 1EUVB 3NZSA 3KUZA 3VUXA 3EFUA 2FCSA 2RR9A 3DVGY 3H6NA 4KV2A 3MJWA 4KZ0A 2W9NA 3HK0A 4IM3A 5J18A 3UIPB 3TCAA 4HLEA 1S3SG 3H7SA 1CMXB 4ZYNA 5LXIB 2G4DB 3ZKJC 2C7NB 3VVWB 3C0RB 2ASQA 3K9PB 3O65B 5AZHA 2MSED 4MSQB 3DPDA 5E6NA 2VRRB 1Z5SB 2BGFA 3DBHI 4DHZB 4OVVA 2XBBC 4AUQC 3ZTDA 2KTRA 4E71A 2RPQA 1WZ0A 2J0KA 3ZNHB 2XK5B 2JRIB 1XT9B 2L0TA 4XZ4A 3DCGA 3NY5A 3U8ZA 3UGBB 4DHJB 4MJSA 3QA8A 3KUDB 2N9PC 1V6EA 3RD2A 2C7HA 2DX5B 4HDOA 4GU2A 5LLIA 4TV3A 5L95C 4JQWC 3RZFA 4ANWA 1P9DU 4E3CA 4W9FA 3N32A 1UD7A 1NI2A 2KZRA 4CO7A 4HCNB 1F9JA 1XD3B 4II2B 3PLUA 1UBIA 3V6CB 3A9KB 3W1SC 4G3XB 2ZEQA 1WGDA 2GMIC 5AZFA 4FHKA 3WAMA 2LGDA 4BBNC 2M4NA 1OTRB 4GOCA 3VTWA 2HE7A 3EHVA 3JSVA 4NQLB 3DOWA 4NY0A 3AXCA 3TBLD 2IBIB 3MHSD 1TGZB 3PHXB 4J6IA 1YJ1A 1FXTB 2LGYA 4XX5A 1MG8A 2M8SA 1G6JA 3TIXA 2C9WB 2REXA 1JRUA 2ZVOA 2D2QA 5IA7A 2BYVE 3PVLA 2FIFA 2KX0A 5JH5C 2G45B 3VQIA 2IYDB 2PPHA 4LDTD 2ZNVB 4BOZB 1SE9A 2O6VB 3R7RA 2BPSA 3WA0A 4EZJA 3A1QB 4MH0E 2BYFA 2MBBB 1OEYA 2CHZA 3WIMA 4I6LB 4MGYE 1WX7A 3L10B 4PS7A 2V4LA 4BKGA 5J2RA 4KZCA 2DZJA 2KWVB 3IVFA 4BKTA 2KMAA 3H1UA 1RRBA 2GBKA 4P7IA 1WF9A 1E8ZA 1WH3A 2KOXA 4F7ZA 2CR5A 3P2BA 4FLHA 1J0GA 3B08A 2KLCA 1YQBA 1V9JA 2CKHB 2AYOB 4DHZE 4JGHB 1WFYA 3Q3FA 3ZRCA 1H8CA 2MRPA 3UINB 3UQBA 3AULA 4X57B 2KK8A 2ZZPB 4DBGA 4AOFA 2Y5BB 1E90A 1Z2MA 2NVUI 2LGXA 2LRWA 2ZCBA 4F8CB 5CX3A 3APDA 2V1YA 4LJPB 3VHTC 1LXDA 4HJKA 1PQSA 4W9EA 4G11A 5DPRA 5L83A 2BF8B 4BVUC 2QHOA 4GMVA 3B0AA 2LVQA 1E7VA 4I6NB 1RFAA 5CHVC 2KQ7A 2NBWB 1WR6E 1EF5A 3WALA 4HK2A 1OEYJ 2YVCA 2MP2B 2KFJA 3GOEA 4A20A 1GNUA 3GZNI 4G0NB 2KDIA 1U4AA 1EF1A 2JY6A 4MDKE 5AEKB 4HDQA 2AEHA 1VD2A 2V3SA 3HIZA 2A4ZA 4RMAA 5D94A 4WJOA 4AWJA 4ANVA 1WM3A 2O2VB 4IG7B 4G50A 4MGZE 3OLMD 1WMHB 2DZIA 2XEWA 4TQ0A 2KJHB 3ZDMC 3N30A 1GUAB 4GDKB 2ZNVC 3QCAA 1V80A 3KUCB 5TR5A 2G4SA 1H4RA 4FN2A 2JZ3B 3APCA 3MTNB 2K8BA 4KVGB 2KDFB 3VDZA 3B1LX 4NJ6A 1WGRA 2IO3B 2NCNA 1Y8RC 1E5WA 4PYUA 3D32A 3QHTA 3BY4B 2KD0A 3VH4B 4KSLC 4WWPA 2I1KA 2KFKA 4A3OA 2WX1A 2D07B 3PGEA 1WE7A 4NAWA 3RZWC 4F1SA 4W9GA 1J19A 1UZXB 2C7MB 2K8HA 4TQ1A 4FHJA 2KVRA 2NPTA 3RUIB 1GJZA 4AJWA 4RM9A 4EZLA 4W9DA 3VH3B 3PRZA 2Z59B 1IYFA 2KLGA 1GC7A 3H7PB 4NPNA 3EC8A 3A9JB 4EFOA 3RYTA 2JXXA 4M8MA 4GDLA 1P0RA 2KN5A 4EUTA 2CU1A 4DDGD 2MX2A 1SIFA 4II3B 3QWZB 1A5RA 4WJPA 4KIKA 2KC1A 2ZJDA 4FA6A 3JW0X 3CMMB 2WDTB 5E6PA 1BT0A 2KJRA 5G55A 1EO6A 4TKNA 3ZLZA 3DBSA 1E7UA 2MQJA 3R3MA 4ZRJA 1ZKHA 3ZTCA 1OGWA 2KDBA 3ZDTA 2YLMA 3JVZX 1LM8B 2HTHA 5BO4B 4K81A 4BBNF 2K39A 2MBOA 3UQAA 3Q3JA 4IC7B 2IO1B 2LI5A 4ICUA 4IM0A 3TL5A 2FIDA 2DENB 3W1SA 4AP4C 4ANUA 5CHFA 4K7UA 4M0WB 2UWQA 1J8CA 1WM2A 1WXMA 1X1MA 5E6OA 1WXAA 1KOTA 4EZKA 4DDID 2HD5B 2LD9A 3DDCB 2JZZA 4IWQA 2CS4A 2AL6A 5C1ZA 3PS6A 3QARA 4IW0A 3PREA 2JRHA 5G2NA 4GSWA 2KTRB 5HKHA 3ZW3A 3IFWB 2NR2A 1E8YA 3ECIA 3PTFC 2J0JA 1ZW7A 1E8XA 5D6JB 3VUWA 4DK5A 5KHQA 3CSFA 4W9LA 2FCMA 2DZMA 2PEAA 1UGMA 5KHOA 2MWSB 4B9KA 3DBRI 4EEWA 5J17A 2O2VA 4MJSB 3VXWA 3RT3B 4MSMB 1NBFC 3DVNU 3QAQA 5C23A 1P98A 2BKFA 2D10A 2K1FA 2KXJA 5D7GA 2RGFA 3M3JA 4HWIB 4BOSC 4LJOB 3T9LA 3PV1A 4GIVA 2M17A 4DXAB 5DPWA 2L0FA 2Z0DB 2FUHB 4HCPB 2LXCA 2ZPNA 1R4MI 2L7RA 2KHWB 1Q1OA 4RM8A 1UBQA 1WGGA 5JHAA 3A4SC 2K6QA 3IG3A 2EMTA 5EDSA 4NJ7A 2IO2B 2G3QB 2K6DB 2XK5A 3ZUNA 2KWCA 2ZPYA 3APFA 3JSVB 3KVFB 3ML8A 2R2OA 3IHPC 2MA9B 1WY8A 1WX8A 4OVUA 3TJPA 3HM6X 3DVNV 1ISNA 3V6EB 4N9F4 4LDTB 3M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8J A;  3QIJ A;  1L7Y A;  2FCN A;  3I3T B;  4URK A;  4M8N A;  3OJ3 A;  2N9E B;  1WZ3 A;  3H7P A;  4ICV A;  3S2A A;  1YX5 B;  3WAO A;  3L0W B;  2GBM A;  3PT2 B;  1TTN A;  3DQV A;  4DHJ D;  4W9I A;  2N7D A;  1P3Q U;  2C5L C;  3U7D A;  5DPS A;  2KTF A;  3A9K A;  3OAW A;  3X0W A;  4IWO A;  1V5O A;  4FJZ A;  4JIO U;  3ALB A;  2BYE A;  3L13 A;  4K1R B;  3VTU A;  1IP9 A;  2JWZ A;  4PS8 A;  3AU4 A;  3KYD D;  2PJH A;  3CST A;  1Q0W B;  3QQ8 B;  3T8M A;  1UEL A;  4AJY B;  2MBH A;  4IM2 A;  1WIA A;  4CYE A;  1XQQ A;  2FNJ B;  2GOW A;  4ZRK A;  2PE9 A;  1WE6 A;  3PHW B;  2MLB A;  4WJQ A;  3QC8 B;  4KDL B;  4EKU A;  3QK0 A;  4MGK E;  2C60 A;  1YIW A;  3M95 A;  2N1W A;  3L08 A;  3PRP B;  5DCN A;  1LFD A;  3VAW A;  2AWT A;  3ZNZ B;  4E74 A;  3EEC A;  3NS8 A;  3LJ3 A;  3PSE B;  3ZRF A;  4BKS A;  1SGH A;  4FBJ B;  1KJT A;  4WAA A;  2JPH A;  1M94 A;  2NBV B;  4B95 A;  2K25 A;  2L00 B;  2LWP A;  3SDL C;  3ML9 A;  1VCB A;  2MCN B;  4LCD E;  2O6V A;  2BWF A;  1UH6 A;  1TBE A;  2LVP A;  3A1Q A;  3NOB A;  5IAA C;  2J7Q B;  1WJN A;  2LXA A;  1GG3 A;  2JF5 A;  2LVO A;  2D3G A;  4I6P A;  2WYQ A;  2IZV B;  2LJ5 A;  4GGQ A;  4BKS D;  1K8R B;  3AU5 A;  3CF6 E;  3RUL A;  1S1Q B;  3ZIM A;  5JZE B;  3VUY A;  3V62 A;  1OQY A;  3R66 C;  3RCZ A;  3ZNI D;  1V81 A;  2O6V D;  3JYU A;  4FJY A;  2DYO A;  1T0Y A;  2D11 A;  3X23 A;  2B3A A;  1YX6 B;  2RSU A;  4TUU A;  2KQS A;  4JL9 A;  2EKE C;  3SHQ A;  3VTV A;  3NHE B;  2R2Q A;  4ANX A;  3OJ4 B;  2RD0 A;  2L05 A;  2BKR B;  1WRD B;  4XC2 A;  4A3P A;  1C1Y B;  1V49 A;  4K7S A;  3SD5 A;  4W9C A;  2L76 A;  1LQB A;  1C3T A;  4IUM B;  4EOY A;  2KX3 A;  2KDE B;  5AZG A;  2N4F A;  2L3Z A;  2A5U A;  3M62 B;  1RLF A;  2KJ6 A;  1WJ6 A;  4PYZ A;  3VFK A;  4NNJ B;  4WWN A;  3SU8 X;  1L2N A;  5CTR C;  2JVC A;  2GBR A;  2DAJ A;  2KO3 A;  2KWU B;  3IBE A;  1WR1 A;  1V2Y A;  5FR6 A;  3W1Y A;  1RAX A;  4IWP A;  3DVG X;  2MP2 A;  5CHW A;  1QZE A;  4CHK A;  2Z0E B;  4ZRI A;  2ZVN A;  2JT4 B;  2K8C A;  2LAS A;  2NBU A;  2DHZ A;  3A33 B;  2GBJ A;  4PS3 A;  1IPG A;  2KFK B;  1E8W A;  2N1V A;  3ENE A;  2IY0 B;  4NAW B;  1V86 A;  3U30 A;  2LRU A;  2BWE S;  2MBQ A;  2PE6 B;  3DBL I;  5LXH A;  2NPT B;  1HE8 A;  5D2M B;  3UIO B;  1WMH A;  1R4N I;  2DYB A;  4MEL A;  3R7Q A;  4WJN A;  4WWO A;  4GDK A;  1WGH A;  1KM7 A;  4W9J A;  4BFR A;  4GDL B;  2J0M A;  4GXB A;  1P1A A;  1WYW B;  2NS5 A;  3BIN A;  2N7E A;  4NQK E;  1NDD A;  2KAN A;  3V61 A;  2KNB A;  2MBE A;  2ZCC A;  2DZK A;  4HPM B;  2LUE A;  3ONS A;  4KDI C;  4KIK B;  3PZD A;  1YD8 U;  4HPL B;  2MW5 A;  3PRM B;  4DWF A;  3WAN A;  1V5T A;  2HJ8 A;  5GMV A;  1KLV A;  2UYZ B;  3HHM A;  4K7W A;  2N9X A;  2KKC A;  4FUL A;  2OJR A;  1ZGU B;  2KC2 A;  3LDZ E;  4JLC A;  3ZVV A;  1D3Z A;  4FJV B;  2KMC A;  1WXS A;  3NZU A;  4FAD A;  5DPT A;  1WJU A;  2AL3 A;  2FAZ A;  2M1M A;  4GB9 A;  3L54 A;  4GN1 A;  3UF8 A;  1WJ4 A;  1I35 A;  3AI5 A;  4MGI E;  3PLV A;  3H9D A;  1I42 A;  3HM3 A;  1Q5W B;  3A9J A;  3ZNG C;  4W9K A;  4HVB A;  2WX0 A;  4WQO B;  4MM3 A;  2IO0 B;  3QJZ A;  3KW5 B;  4MEM A;  2WWZ A;  2GBN A;  2OOB B;  3TMP B;  1WGY A;  2LZ6 A;  4YL8 A;  4B6W A;  1TZ1 A;  1WXV A;  4HXD A;  2FCQ A;  3K9O B;  3KYC D;  3L16 A;  3V60 A;  4KSK C;  3ZO5 B;  4ZDV A;  4W9H A;  3A4R A;  4ASW C;  3PPA A;  2DAF A;  3QX1 A;  1WI0 A;  1AAR A;  2I1J A;  3KH0 A;  2IY1 B;  3N3K B;  5JHB A;  2CHX A;  2M0X A;  3WAP A;  2JUO A;  2DYM A;  2CHW A;  1WX9 A;  1GC6 A;  3L17 A;  2EMS A;  1EUV B;  3NZS A;  3KUZ A;  3VUX A;  3EFU A;  2FCS A;  2RR9 A;  3DVG Y;  3H6N A;  4KV2 A;  3MJW A;  4KZ0 A;  2W9N A;  3HK0 A;  4IM3 A;  5J18 A;  3UIP B;  3TCA A;  4HLE A;  1S3S G;  3H7S A;  1CMX B;  4ZYN A;  5LXI B;  2G4D B;  3ZKJ C;  2C7N B;  3VVW B;  3C0R B;  2ASQ A;  3K9P B;  3O65 B;  5AZH A;  2MSE D;  4MSQ B;  3DPD A;  5E6N A;  2VRR B;  1Z5S B;  2BGF A;  3DBH I;  4DHZ B;  4OVV A;  2XBB C;  4AUQ C;  3ZTD A;  2KTR A;  4E71 A;  2RPQ A;  1WZ0 A;  2J0K A;  3ZNH B;  2XK5 B;  2JRI B;  1XT9 B;  2L0T A;  4XZ4 A;  3DCG A;  3NY5 A;  3U8Z A;  3UGB B;  4DHJ B;  4MJS A;  3QA8 A;  3KUD B;  2N9P C;  1V6E A;  3RD2 A;  2C7H A;  2DX5 B;  4HDO A;  4GU2 A;  5LLI A;  4TV3 A;  5L95 C;  4JQW C;  3RZF A;  4ANW A;  1P9D U;  4E3C A;  4W9F A;  3N32 A;  1UD7 A;  1NI2 A;  2KZR A;  4CO7 A;  4HCN B;  1F9J A;  1XD3 B;  4II2 B;  3PLU A;  1UBI A;  3V6C B;  3A9K B;  3W1S C;  4G3X B;  2ZEQ A;  1WGD A;  2GMI C;  5AZF A;  4FHK A;  3WAM A;  2LGD A;  4BBN C;  2M4N A;  1OTR B;  4GOC A;  3VTW A;  2HE7 A;  3EHV A;  3JSV A;  4NQL B;  3DOW A;  4NY0 A;  3AXC A;  3TBL D;  2IBI B;  3MHS D;  1TGZ B;  3PHX B;  4J6I A;  1YJ1 A;  1FXT B;  2LGY A;  4XX5 A;  1MG8 A;  2M8S A;  1G6J A;  3TIX A;  2C9W B;  2REX A;  1JRU A;  2ZVO A;  2D2Q A;  5IA7 A;  2BYV E;  3PVL A;  2FIF A;  2KX0 A;  5JH5 C;  2G45 B;  3VQI A;  2IYD B;  2PPH A;  4LDT D;  2ZNV B;  4BOZ B;  1SE9 A;  2O6V B;  3R7R A;  2BPS A;  3WA0 A;  4EZJ A;  3A1Q B;  4MH0 E;  2BYF A;  2MBB B;  1OEY A;  2CHZ A;  3WIM A;  4I6L B;  4MGY E;  1WX7 A;  3L10 B;  4PS7 A;  2V4L A;  4BKG A;  5J2R A;  4KZC A;  2DZJ A;  2KWV B;  3IVF A;  4BKT A;  2KMA A;  3H1U A;  1RRB A;  2GBK A;  4P7I A;  1WF9 A;  1E8Z A;  1WH3 A;  2KOX A;  4F7Z A;  2CR5 A;  3P2B A;  4FLH A;  1J0G A;  3B08 A;  2KLC A;  1YQB A;  1V9J A;  2CKH B;  2AYO B;  4DHZ E;  4JGH B;  1WFY A;  3Q3F A;  3ZRC A;  1H8C A;  2MRP A;  3UIN B;  3UQB A;  3AUL A;  4X57 B;  2KK8 A;  2ZZP B;  4DBG A;  4AOF A;  2Y5B B;  1E90 A;  1Z2M A;  2NVU I;  2LGX A;  2LRW A;  2ZCB A;  4F8C B;  5CX3 A;  3APD A;  2V1Y A;  4LJP B;  3VHT C;  1LXD A;  4HJK A;  1PQS A;  4W9E A;  4G11 A;  5DPR A;  5L83 A;  2BF8 B;  4BVU C;  2QHO A;  4GMV A;  3B0A A;  2LVQ A;  1E7V A;  4I6N B;  1RFA A;  5CHV C;  2KQ7 A;  2NBW B;  1WR6 E;  1EF5 A;  3WAL A;  4HK2 A;  1OEY J;  2YVC A;  2MP2 B;  2KFJ A;  3GOE A;  4A20 A;  1GNU A;  3GZN I;  4G0N B;  2KDI A;  1U4A A;  1EF1 A;  2JY6 A;  4MDK E;  5AEK B;  4HDQ A;  2AEH A;  1VD2 A;  2V3S A;  3HIZ A;  2A4Z A;  4RMA A;  5D94 A;  4WJO A;  4AWJ A;  4ANV A;  1WM3 A;  2O2V B;  4IG7 B;  4G50 A;  4MGZ E;  3OLM D;  1WMH B;  2DZI A;  2XEW A;  4TQ0 A;  2KJH B;  3ZDM C;  3N30 A;  1GUA B;  4GDK B;  2ZNV C;  3QCA A;  1V80 A;  3KUC B;  5TR5 A;  2G4S A;  1H4R A;  4FN2 A;  2JZ3 B;  3APC A;  3MTN B;  2K8B A;  4KVG B;  2KDF B;  3VDZ A;  3B1L X;  4NJ6 A;  1WGR A;  2IO3 B;  2NCN A;  1Y8R C;  1E5W A;  4PYU A;  3D32 A;  3QHT A;  3BY4 B;  2KD0 A;  3VH4 B;  4KSL C;  4WWP A;  2I1K A;  2KFK A;  4A3O A;  2WX1 A;  2D07 B;  3PGE A;  1WE7 A;  4NAW A;  3RZW C;  4F1S A;  4W9G A;  1J19 A;  1UZX B;  2C7M B;  2K8H A;  4TQ1 A;  4FHJ A;  2KVR A;  2NPT A;  3RUI B;  1GJZ A;  4AJW A;  4RM9 A;  4EZL A;  4W9D A;  3VH3 B;  3PRZ A;  2Z59 B;  1IYF A;  2KLG A;  1GC7 A;  3H7P B;  4NPN A;  3EC8 A;  3A9J B;  4EFO A;  3RYT A;  2JXX A;  4M8M A;  4GDL A;  1P0R A;  2KN5 A;  4EUT A;  2CU1 A;  4DDG D;  2MX2 A;  1SIF A;  4II3 B;  3QWZ B;  1A5R A;  4WJP A;  4KIK A;  2KC1 A;  2ZJD A;  4FA6 A;  3JW0 X;  3CMM B;  2WDT B;  5E6P A;  1BT0 A;  2KJR A;  5G55 A;  1EO6 A;  4TKN A;  3ZLZ A;  3DBS A;  1E7U A;  2MQJ A;  3R3M A;  4ZRJ A;  1ZKH A;  3ZTC A;  1OGW A;  2KDB A;  3ZDT A;  2YLM A;  3JVZ X;  1LM8 B;  2HTH A;  5BO4 B;  4K81 A;  4BBN F;  2K39 A;  2MBO A;  3UQA A;  3Q3J A;  4IC7 B;  2IO1 B;  2LI5 A;  4ICU A;  4IM0 A;  3TL5 A;  2FID A;  2DEN B;  3W1S A;  4AP4 C;  4ANU A;  5CHF A;  4K7U A;  4M0W B;  2UWQ A;  1J8C A;  1WM2 A;  1WXM A;  1X1M A;  5E6O A;  1WXA A;  1KOT A;  4EZK A;  4DDI D;  2HD5 B;  2LD9 A;  3DDC B;  2JZZ A;  4IWQ A;  2CS4 A;  2AL6 A;  5C1Z A;  3PS6 A;  3QAR A;  4IW0 A;  3PRE A;  2JRH A;  5G2N A;  4GSW A;  2KTR B;  5HKH A;  3ZW3 A;  3IFW B;  2NR2 A;  1E8Y A;  3ECI A;  3PTF C;  2J0J A;  1ZW7 A;  1E8X A;  5D6J B;  3VUW A;  4DK5 A;  5KHQ A;  3CSF A;  4W9L A;  2FCM A;  2DZM A;  2PEA A;  1UGM A;  5KHO A;  2MWS B;  4B9K A;  3DBR I;  4EEW A;  5J17 A;  2O2V A;  4MJS B;  3VXW A;  3RT3 B;  4MSM B;  1NBF C;  3DVN U;  3QAQ A;  5C23 A;  1P98 A;  2BKF A;  2D10 A;  2K1F A;  2KXJ A;  5D7G A;  2RGF A;  3M3J A;  4HWI B;  4BOS C;  4LJO B;  3T9L A;  3PV1 A;  4GIV A;  2M17 A;  4DXA B;  5DPW A;  2L0F A;  2Z0D B;  2FUH B;  4HCP B;  2LXC A;  2ZPN A;  1R4M I;  2L7R A;  2KHW B;  1Q1O A;  4RM8 A;  1UBQ A;  1WGG A;  5JHA A;  3A4S C;  2K6Q A;  3IG3 A;  2EMT A;  5EDS A;  4NJ7 A;  2IO2 B;  2G3Q B;  2K6D B;  2XK5 A;  3ZUN A;  2KWC A;  2ZPY A;  3APF A;  3JSV B;  3KVF B;  3ML8 A;  2R2O A;  3IHP C;  2MA9 B;  1WY8 A;  1WX8 A;  4OVU A;  3TJP A;  3HM6 X;  3DVN V;  1ISN A;  3V6E B;  4N9F 4;  4LDT B;  3M63 B; 
#chains in the Genus database with same CATH topology
 2L8J A;  2FUG 1;  1D6E C;  3R2T A;  3H7P A;  3VR8 B;  4ZRP A;  5D3D A;  1XCQ L;  2WXJ A;  4OZA A;  4K1R B;  3L13 A;  1ZE3 D;  1L0X B;  2JWZ A;  3AU4 A;  3CST A;  3QQ8 B;  3T8M A;  4K3C A;  2MBH A;  3MJ5 A;  1XQQ A;  4ZRK A;  1WE6 A;  2MLB A;  1TKG A;  2W82 A;  2J53 A;  4MGK E;  2C60 A;  4ARC A;  1A70 A;  2N1W A;  5DCN A;  4EE2 A;  3VAW A;  2AWT A;  4YTM B;  4BKS A;  1SGH A;  4FBJ B;  1M94 A;  1TS4 A;  3BYT B;  2G1E A;  2MCN B;  1UH6 A;  3O13 A;  2LVP A;  2PMV A;  4YSZ B;  4I6P A;  4N59 A;  2LJ5 A;  3Q3N C;  3CF6 E;  3RUL A;  1I4H A;  3VUY A;  2NMQ A;  3R66 C;  2O6V D;  4AQ7 A;  3RMK C;  3VR9 B;  2D11 A;  1YX6 B;  4TUU A;  3ZQ4 A;  2KN4 A;  3SHQ A;  1PUT A;  3OJ4 B;  1HEZ E;  1XLO A;  1PGX A;  1KTK A;  2IGH A;  3SD5 A;  4W9C A;  1LQB A;  2KDE B;  1EU4 A;  2N4F A;  5IOI A;  3VFK A;  2KJ6 A;  1TS3 A;  4WWN A;  3R8B A;  5CTR C;  2GBR A;  1WR1 A;  3AM9 A;  2Z0E B;  4ZRI A;  2GBJ A;  2M19 A;  1YN3 A;  4NAW B;  4A8X C;  5LXH A;  1RM6 C;  2NPT B;  1R4N B;  2J4X A;  1WMH A;  4WJN A;  4WWO A;  1PFD A;  4W9J A;  2K9X A;  1P1A A;  2NS5 A;  1QIL A;  3BIN A;  2N7E A;  2LUE A;  3AB5 A;  4HPL B;  1V5T A;  4HEA 1;  4K7W A;  2VH2 A;  4FJV B;  2ZW1 A;  2KMC A;  3V05 A;  3BK2 A;  2M1M A;  4MH8 A;  1BUI C;  3AH7 A;  3L54 A;  3UF8 A;  3DWG C;  3FIL A;  3H9D A;  3HM3 A;  3IAS 1;  3AEB B;  1JRP A;  1Q10 A;  2LZ6 A;  4B6W A;  4HXD A;  1PGB A;  4UDU C;  1FNV A;  3KH0 A;  3GB1 A;  2CHX A;  3WAP A;  2JUO A;  1VLB A;  2EMS A;  1EUV B;  3NZS A;  1P7E A;  3EFU A;  2FCS A;  4KZ0 A;  3HK0 A;  2AQ1 B;  1S3S G;  4NZL B;  3OG5 A;  1CMX B;  1V1P B;  2JYT A;  4OHJ A;  2G4D B;  1QOF A;  3K9P B;  3O65 B;  2MSE D;  3DPD A;  2CJN A;  1F52 A;  1YQ3 B;  4AUQ C;  2Y3A A;  4WH4 A;  1XT9 B;  3DCG A;  3NY5 A;  4DHJ B;  4XGA B;  3RNF C;  3BZD B;  2KT7 A;  3KUD B;  2N9P C;  2C7H A;  3AE9 B;  2DX5 B;  4GU2 A;  4JQW C;  3P4S B;  3E56 A;  4W9F A;  1E7P B;  1UD7 A;  1ZUD 2;  1JWM D;  4II2 B;  1UBI A;  2HJ1 A;  1WGD A;  1STE A;  4GOC A;  3JSV A;  2K0P A;  3GP7 A;  3TBL D;  3MHS D;  2PTL A;  3BII D;  4M00 A;  1TGZ B;  4J6I A;  3I63 C;  1YJ1 A;  1FXT B;  1M4V A;  1MG8 A;  3TIX A;  3TEZ A;  5JH5 C;  1L5P A;  2G45 B;  4XWW A;  2IYD B;  4LDT D;  4BOZ B;  1SE9 A;  1TIF A;  4EZJ A;  4MH0 E;  1FRR A;  2BYF A;  2MBB B;  2INC C;  1WX7 A;  3AEE B;  2DZJ A;  4BKT A;  4A55 A;  2KMA A;  1E8Z A;  2KOX A;  2OHF A;  4FLH A;  1J0G A;  3LB8 C;  3LYY A;  2AYO B;  4JGH B;  2BTE A;  1N61 A;  1RWS A;  1P7F A;  3BVM A;  3UQB A;  3CWI A;  5H8Y E;  2MJE A;  4KGT A;  4AOF A;  2NVU I;  4LNF A;  4F8C B;  4N58 A;  5T8I A;  5CX3 A;  4LK0 M;  4G11 A;  4BVU C;  3RPF C;  2WDV B;  2LVQ A;  1E7V A;  1RFA A;  1MI0 A;  5CHV C;  1YOV B;  3W5V B;  4RGO S;  3V3X A;  1WR6 E;  3GOE A;  2KMM A;  1HZ6 A;  3AMZ A;  1SB3 C;  4HDQ A;  1VD2 A;  3HIZ A;  3IT4 B;  4RMA A;  2WDR B;  4WJO A;  4ANV A;  2DBY A;  1DOI A;  3U52 E;  1WMH B;  1E0Z A;  4TQ0 A;  2KJH B;  3KUC B;  5TR5 A;  2G4S A;  1H4R A;  4KVG B;  1CJE A;  3DHH C;  1QKZ A;  4NJ6 A;  1I4P A;  4JE3 B;  4XDD A;  1Y8R C;  4Q2J A;  3C19 A;  2V4I B;  4ARI A;  3BY4 B;  4RH6 A;  1NYQ A;  3VH4 B;  4KSL C;  1XLP A;  4A3O A;  2WX1 A;  3TEW A;  1D4B A;  1SF0 A;  4F1S A;  1L6U A;  2C7M B;  4RM9 A;  4EZL A;  2Z59 B;  3FIL B;  3TSS A;  2YEP F;  1SE3 A;  1XEE A;  4YSX B;  4DDG D;  4OZB A;  1SIF A;  3QWZ B;  4WJP A;  1K53 A;  2WDT B;  1L4Z B;  4WAF A;  1TYG B;  4HKQ A;  2BT6 A;  1HXY D;  3JVZ X;  1XLQ A;  2VZK B;  5BO4 B;  4BBN F;  2QMT A;  2K39 A;  3Q6B A;  3UQA A;  4JPS A;  3RFZ B;  2LI5 A;  5FKA C;  3I57 A;  5EE3 A;  4AP4 C;  3IXS A;  1KH0 A;  1WXM A;  1X1M A;  2LD9 A;  2MHJ A;  3NG0 A;  1RFK A;  2AL6 A;  2JRH A;  2X8X X;  4GSW A;  2NR2 A;  1E8Y A;  5D6J B;  2WXP A;  3TEX A;  3CSF A;  1WSP A;  3DBR B;  1C4A A;  5BMH A;  3P63 A;  5C23 A;  2M56 B;  5D7G A;  2RGF A;  4LJO B;  3GE8 C;  3Q8E A;  3URY A;  2FUH B;  1Q1O A;  1UNS A;  2K6Q A;  3AE6 B;  4NJ7 A;  2G3Q B;  1ENF A;  3JSV B;  2MA9 B;  4OVU A;  3HM6 X;  3V6E B;  1ZDX A;  2FCN A;  3I3T B;  1JWS D;  3I5J C;  4M8N A;  3WAO A;  2GBM A;  4HRS A;  4DHJ D;  2N7D A;  3U7D A;  3C8Y A;  1SIJ A;  4IWO A;  3VTU A;  4FJZ A;  3BYY B;  1K51 A;  1IP9 A;  2KQ4 X;  3KYD D;  1VRA B;  1Q0W B;  1DGJ A;  1UEL A;  4IM2 A;  2PE9 A;  1C77 A;  2PIA A;  4JWS C;  4WJQ A;  1FPY A;  3QK0 A;  3KQ4 A;  1YIW A;  3L08 A;  1C79 A;  2E6X A;  4XYC A;  3ZNZ B;  3LJ3 A;  3PSE B;  4WAA A;  1LO5 D;  2JPH A;  4C00 A;  3ML9 A;  4B0E A;  3A1Q A;  1VR9 A;  1WJN A;  1GG3 A;  2J42 A;  1YJJ A;  4YTP B;  3MC8 A;  2OED A;  4BKS D;  5BYS A;  1E6E B;  5JXV A;  1TS5 A;  3JYU A;  4FJY A;  2DYO A;  2GB1 A;  2RSU A;  4ZHP A;  4JL9 A;  4O1N A;  2EKE C;  2PVG C;  1F2R C;  4S0R A;  1WRD B;  2WDQ B;  1D5X C;  4A3P A;  2IJ0 A;  3AN1 A;  4H2A A;  2M0A A;  4OW0 A;  2L76 A;  4IUM B;  4EOY A;  2INN E;  1L2N A;  1K52 A;  3SU8 X;  2JVC A;  2KO3 A;  3IBE A;  1V2Y A;  2PKO A;  1OQR A;  3W5U B;  2W55 A;  2JU6 X;  2JT4 B;  2LAS A;  2WGS A;  2BB5 A;  1IPG A;  1D5Z C;  2KAC A;  3MC9 A;  2N1V A;  2IY0 B;  3GE3 C;  3DBL I;  2MBQ A;  2PE6 B;  1HE8 A;  3R7Q A;  2D3C A;  2MJ3 A;  2GRI A;  4XWT A;  1FMA D;  3EA6 A;  3MC0 B;  2ACZ B;  2IGG A;  2ZCC A;  4KDI C;  2YEP B;  1YD8 U;  1N5W A;  3AEC B;  4WQM A;  3WAN A;  3ZYY X;  2N9X A;  4QAY A;  1VDV A;  3DHG C;  4FUL A;  2QSD A;  4JLC A;  3ZVV A;  4C7Y A;  1NI3 A;  2N7J A;  3RNC C;  3NZU A;  1WJU A;  2AL3 A;  5EE9 A;  4A90 A;  2B76 B;  1F2R I;  5BMI A;  4MGI E;  4YSY B;  4HVB A;  1SXT A;  2WX0 A;  1FNW A;  2OOB B;  2QJL A;  1FNU A;  4IOI E;  3SEB A;  1TY2 A;  3A4R A;  1AAR A;  1AN8 A;  1ROE A;  3E9S A;  3Q8F A;  3KUZ A;  3N9Y C;  3DVG Y;  3TEY A;  5J18 A;  4OZC A;  4HLE A;  1ZXI A;  2WXQ A;  1YN4 A;  2ON8 A;  2PW9 A;  4M0W A;  2C7N B;  4KGS A;  2VZK D;  5AZH A;  3CIR B;  5E6N A;  2VRR B;  2XBB C;  3AV8 A;  3ZTD A;  3AE8 B;  4B0M A;  2JRI B;  2V9H A;  3QA8 A;  4C4V A;  2V0G A;  1XXG A;  1WWT A;  3RD2 A;  1C9F A;  5LLI A;  3HVZ A;  4E3C A;  3RZF A;  4ANW A;  1N60 A;  2Y5P A;  1NI2 A;  4HCN B;  3AEF B;  4US9 A;  4HKZ E;  3PLU A;  4KX6 B;  4G3X B;  4LNK A;  3GS2 A;  2Y5C A;  3WAM A;  2QEJ C;  4BBN C;  1K50 A;  3VTW A;  4ZYS A;  3IAM 1;  5G5H A;  4NY0 A;  3AXC A;  1C78 A;  1WXQ A;  3KWL A;  2BVC A;  3DHI C;  5HHD G;  2XN9 C;  4XX5 A;  1UWX A;  1QOG A;  2REX A;  4DXF A;  2ZVO A;  1FFV A;  1V8C A;  1FIQ A;  3PVL A;  2FIF A;  1ET6 A;  2BPS A;  3WA0 A;  3A1Q B;  2CHZ A;  4OVZ A;  1AWD A;  1NYR A;  2ONQ A;  2GBK A;  4P7I A;  2SAK A;  1QF6 A;  4RNA A;  3MP9 A;  4F7Z A;  2CR5 A;  3B08 A;  2NTT A;  2CKH B;  2WP9 B;  1WFY A;  1QT9 A;  3Q3F A;  2MRP A;  3UIN B;  4X57 B;  2KK8 A;  3NZ3 A;  2ZZP B;  4DBG A;  2Y5B B;  4P1C C;  4DXG A;  4P1B C;  2LGX A;  3P4P B;  3AE3 B;  2V1Y A;  4W9E A;  5L83 A;  4HRO A;  3B0A A;  4LNI A;  2LFI A;  2YVC A;  3GZN I;  5AEK B;  2AEH A;  2A4Z A;  3B9J A;  2JXT A;  1IGD A;  4IDI A;  4M01 A;  4G50 A;  2DZI A;  2XEW A;  2D5G A;  1GUA B;  4KGR A;  2V3N A;  1ACC A;  3MTN B;  2TSS A;  1EM7 A;  1E5W A;  4PYU A;  3D32 A;  3QHT A;  2V3P A;  2Z8L A;  4WWP A;  2GLS A;  2K8H A;  1TKY A;  1GJZ A;  1FCC C;  4W9D A;  1IYF A;  3H7P B;  2WXI A;  3EUB 2;  2AQ2 B;  3IT6 B;  4EFO A;  1P0R A;  2MX2 A;  1I4Q A;  4FA6 A;  4ZHO A;  3CMM B;  1QQR A;  1FD6 A;  1BT0 A;  2KJR A;  1EO6 A;  2BS4 B;  3ZLZ A;  3DBS A;  2MQJ A;  1TZO A;  3R3M A;  4ZRJ A;  2I2Y A;  1ZKH A;  3HRD D;  2JX5 A;  3VRA B;  3TL5 A;  3W1S A;  4K7U A;  2WNM A;  4M0W B;  2BQQ A;  1DOX A;  4A9A A;  1WXA A;  4L23 A;  3NRZ A;  4IWQ A;  4IW0 A;  3AE2 B;  3ZW3 A;  2J0J A;  1ZW7 A;  1E8X A;  2WHI A;  1QLB B;  5KHO A;  4K3B A;  2WXG A;  2KVZ A;  5J17 A;  2O2V A;  3QAQ A;  2K1F A;  4C4V B;  2D10 A;  4BOS C;  1FXA A;  1J7B A;  4CQN A;  4HJG E;  4GIV A;  1ZPS A;  1AYF A;  4LNN A;  5E6J A;  4L2Y A;  2L0F A;  2QDF A;  1JML A;  2Z0D B;  3T3N A;  3AE1 B;  1WGG A;  1SBB B;  3A4S C;  2EMT A;  2IO2 B;  3ZUN A;  2XK5 A;  2KWC A;  2ZPY A;  3KVF B;  1XCT L;  3ML8 A;  1WY8 A;  2KAJ A;  3TJP A;  1ISN A;  1E9M A;  4RGT A;  3M63 B;  4URK A;  1SE4 A;  3OJ3 A;  1WZ3 A;  2X38 A;  4ICV A;  1YX5 B;  4J3O D;  1QOA A;  3PT2 B;  1TTN A;  3DQV A;  1P3Q U;  2C5L C;  5DPS A;  1SJE D;  5G5G A;  2KTF A;  3AE7 B;  2BYE A;  2NTS A;  2PJH A;  4A6Q A;  1JWU D;  1I4R A;  2N9K A;  2GOW A;  3P4R B;  4PT5 A;  1VZ8 A;  3PHW B;  3QC8 B;  3M95 A;  2L1A A;  3EEC A;  2NBV B;  1XF5 L;  3U2S C;  1IGC A;  2L00 B;  2LWP A;  3SDL C;  4LCD E;  1IUE A;  3RNE C;  1UWM A;  2LXA A;  5C2T B;  4M02 A;  2D3G A;  2WXH A;  2WYQ A;  2IZV B;  3SFD B;  3AU5 A;  1PGA A;  1S1Q B;  3U7Z A;  3V62 A;  2LGI A;  3HUI A;  2KQS A;  3VTV A;  2R2Q A;  1VZ6 A;  2RD0 A;  2L05 A;  2BKR B;  2LEK A;  2CU3 A;  1C1Y B;  2WU2 B;  3EGR A;  3SR6 A;  1YJI A;  2KX3 A;  1PDX A;  3L4P A;  3W9C B;  2L3Z A;  4PYZ A;  1RLF A;  1WJ6 A;  4NNJ B;  3NJT A;  1MJD A;  2KWU B;  1NEN B;  4IWP A;  2IPK D;  1T6B X;  2MP2 A;  4CHK A;  2ZVN A;  2K8C A;  1GPX A;  2JQR B;  4RF1 A;  2EEL A;  5EE0 A;  3ENE A;  3DBL B;  1V86 A;  3U30 A;  4RF0 A;  2BWE S;  5D2M B;  3UIO B;  1JCK B;  1CZP A;  2DYB A;  2QC8 A;  4MEL A;  2JZP A;  2LGS A;  4DQO C;  4GXB A;  3FC4 A;  1NDD A;  2KNB A;  2DZK A;  4HPM B;  3ONS A;  3PZD A;  2WLB A;  4DWF A;  3PRM B;  4YTN B;  3HHM A;  2JYE A;  2OJR A;  1ZGU B;  2KC2 A;  1D3Z A;  2BS3 B;  3NUH B;  2AQ3 B;  1WXS A;  4FAD A;  5DPT A;  2FAZ A;  2INP E;  2BYT A;  4GB9 A;  4GN1 A;  3N1Z C;  1WJ4 A;  1HZ5 A;  1I35 A;  3AI5 A;  4LTU A;  1UUP A;  2MJD A;  4W9K A;  2H88 B;  4WQO B;  4MM3 A;  1XLN A;  2IO0 B;  4YWG G;  2WWZ A;  2WXK A;  1CQV A;  1TZ1 A;  1WXV A;  2FCQ A;  4KSK C;  4ZDV A;  4W9H A;  4ASW C;  3PPA A;  2L52 A;  1HQR D;  3QX1 A;  3B2G A;  2IY1 B;  2JWU A;  3Q3M C;  3Q8C A;  1ZXH A;  2DYM A;  1WX9 A;  1GC6 A;  3L17 A;  3BVG A;  2RR9 A;  3H6N A;  3MJW A;  2WS3 B;  3UIP B;  3AEG B;  4ZYN A;  1YN5 A;  1RYJ A;  5LXI B;  3ZKJ C;  2W54 A;  1FFU A;  3NVY A;  1Z5S B;  2BGF A;  4DHZ B;  4E71 A;  2KTR A;  1WZ0 A;  1L6V A;  2J0K A;  2XK5 B;  4C7Z A;  3NVV A;  4XZ4 A;  3U8Z A;  3UGB B;  1F0Z A;  2FBW B;  1JWB D;  5HI1 A;  2N9L A;  4HDO A;  2H89 B;  4TV3 A;  1I4X A;  5L95 C;  1P9D U;  2XNA C;  4CO7 A;  1F9J A;  1XD3 B;  1JWA D;  2KWD A;  3P42 A;  5IO9 A;  3W1S C;  4FHK A;  2WXM A;  4L1B A;  2DNF A;  2W3R A;  3EHV A;  1BXT A;  3DOW A;  2KYW A;  2IBI B;  2BW2 A;  1NEK B;  2QCZ A;  2M8S A;  1JRU A;  3P1M A;  2WXL A;  2D2Q A;  2BYV E;  3B2F A;  3VQI A;  2PPH A;  1SE2 A;  3R7R A;  3N1Y C;  1OEY A;  4MGY E;  2WXR A;  4S17 A;  2V4L A;  4ZRQ A;  4KZC A;  1JW9 D;  2KWV B;  3ZXR A;  4ITK A;  3H1U A;  1RRB A;  4MT5 A;  2WU5 B;  2KLC A;  2ZW0 A;  1Y56 A;  1YQB A;  2AX5 A;  1QOB A;  4KKI A;  4PK1 A;  3ZRC A;  1H8C A;  5TSS A;  1HTQ A;  3ABV B;  1E90 A;  1Z2M A;  2MEK A;  4ZOH C;  3KWV A;  4LJP B;  1LXD A;  1WRI A;  1PQS A;  5DPR A;  2BF8 B;  2QHO A;  1EF5 A;  3WAL A;  2MP2 B;  2KFJ A;  3GZN B;  4A20 A;  2LUM A;  1GNU A;  4MDK E;  2KDI A;  2JY6 A;  1FEH A;  2RDH A;  2V3S A;  1MHH E;  4AWJ A;  3PO0 A;  1FCL A;  1WM3 A;  3ZJT A;  4MGZ E;  3OLM D;  1IBX A;  3AE4 B;  3ZDM C;  3HVD A;  3RN9 C;  1HTO A;  3QCA A;  3I9V 1;  1V80 A;  5LNK 1;  4FN2 A;  2JZ3 B;  2WQY B;  3B1L X;  2IO3 B;  1L0Y B;  1TS2 A;  1KF6 B;  3ZXV A;  2KD0 A;  1JQ4 A;  5IKC M;  2I1K A;  1T0S C;  2KFK A;  3RZW C;  1ZOY B;  1J19 A;  4C56 C;  4FHJ A;  4FXC A;  4BZA A;  2VH1 A;  4N6E B;  4AJW A;  3PRZ A;  1B1Z A;  4YXD B;  2KLG A;  1GC7 A;  2K5P A;  3RYT A;  1SEB D;  4GDL A;  4MM3 B;  1FXI A;  5D3I B;  2CU1 A;  4XE0 A;  4KIK A;  2ZJD A;  3MFG A;  5E6P A;  5G55 A;  1YQ4 B;  4TKN A;  1E7U A;  4NJC A;  3ZTC A;  3ZDT A;  2YLM A;  1N5X A;  1LM8 B;  1VZ7 A;  2HTH A;  4K81 A;  2L83 A;  1TT5 B;  3Q3J A;  4IM0 A;  4ICU A;  2DEN B;  4ACF A;  5CHF A;  2UWQ A;  1SSN A;  4WWM A;  1XO3 A;  1KOT A;  5FK9 C;  4EZK A;  1R7S A;  2HD5 B;  1J7C A;  2JZZ A;  2CS4 A;  5C1Z A;  1TY0 A;  3PRE A;  2KTR B;  1GB4 A;  2GI9 A;  3EFC A;  3ECI A;  3VUW A;  1OQQ A;  5KHQ A;  5BYR A;  2DZM A;  2PEA A;  4EEW A;  4KKJ A;  1P98 A;  3RI7 C;  3M3J A;  3Q8A A;  3ZGZ A;  3AE5 B;  4DXA B;  5DPW A;  3MHZ A;  1EWC A;  2ZPN A;  2L7R A;  2KHW B;  4RM8 A;  1UBQ A;  1F77 A;  1JRO A;  1CK1 A;  5EDS A;  2K6D B;  3U4E G;  1NVI D;  4RCO A;  3IHP C;  3DVN V;  3ETR A;  3QIJ A;  1L7Y A;  4MAC A;  2N9E B;  3S2A A;  3PZ8 A;  4GLS C;  3L0W B;  3OWE B;  2HDE A;  1L0V B;  4W9I A;  3A9K A;  3OAW A;  2N0S B;  3X0W A;  1V5O A;  4JIO U;  3ALB A;  4PS8 A;  1N6Z A;  5BMG A;  4AJY B;  1WIA A;  4CYE A;  2FNJ B;  3Q8B A;  3RNB C;  5IP4 D;  4KDL B;  4EKU A;  3PRP B;  1LFD A;  4E74 A;  3NS8 A;  4C80 A;  3ZRF A;  2RPV A;  1B9R A;  1KJT A;  1AW7 A;  4B95 A;  2K25 A;  1VCB A;  2G9H D;  2O6V A;  2BWF A;  3W2D A;  3DBH B;  1TBE A;  3NOB A;  5IAA C;  2J7Q B;  2JF5 A;  2LVO A;  3Q14 C;  4GGQ A;  3BK1 A;  1K8R B;  5JZE B;  3ZIM A;  1I7H A;  1KRH A;  1OQY A;  3RCZ A;  3ZNI D;  1V81 A;  1T0Y A;  3X23 A;  2B3A A;  2IGD A;  2OJW A;  3TUO A;  1YMH E;  3NHE B;  4ANX A;  1T3Q A;  4XC2 A;  2J52 A;  1V49 A;  4K7S A;  1KFY B;  1KLG D;  2EKI A;  1C3T A;  1IBX B;  3N20 C;  5AZG A;  1TJE A;  2A5U A;  3M62 B;  2DAJ A;  5FR6 A;  3W1Y A;  1RAX A;  4TSS A;  3DVG X;  2I38 A;  5CHW A;  1QZE A;  3R2I A;  4BAX A;  2NBU A;  4XDC A;  4RGN A;  2DHZ A;  3A33 B;  4PS3 A;  2KFK B;  1E8W A;  2UU7 A;  2LRU A;  2JSV X;  3NS1 A;  1J7A A;  1E10 A;  3Q69 A;  1R4N I;  1LGR A;  3NVW A;  4GDK A;  1GOZ A;  1WGH A;  1KM7 A;  4BFR A;  4GDL B;  2J0M A;  2MH7 A;  1WYW B;  4NQK E;  2KAN A;  3V61 A;  2MBE A;  4KIK B;  2MW5 A;  2HJ8 A;  5GMV A;  1KLV A;  2UYZ B;  2KKC A;  2LJI A;  3LDZ E;  1T0R C;  2RDB C;  1PYW D;  1I4G A;  1MPE A;  2RMM A;  3PLV A;  1I42 A;  3N1X C;  1Q5W B;  3A9J A;  3AEA B;  3ZNG C;  1C4P A;  3QJZ A;  3KW5 B;  1GB1 A;  4MEM A;  2GBN A;  3TMP B;  1WGY A;  4YL8 A;  3K9O B;  3L16 A;  3KYC D;  3V60 A;  3ZO5 B;  2WXO A;  2DAF A;  1WI0 A;  3N3K B;  2I1J A;  5JHB A;  4REZ A;  2M0X A;  2CHW A;  1BML C;  1D5M C;  3VUX A;  4KV2 A;  2W9N A;  4IM3 A;  3TCA A;  3H7S A;  1MVK A;  3VVW B;  3C0R B;  2ASQ A;  5C3J B;  4NAM A;  4MSQ B;  4RFB A;  3DBH I;  4OVV A;  1SJH D;  2BBC A;  2RPQ A;  5IN7 A;  4YT0 B;  3ZNH B;  2L0T A;  3BWU D;  3KLS X;  1N62 A;  3NVZ A;  2Q5W D;  4MJS A;  2RDG A;  1V6E A;  2LHD A;  1EWY C;  2K3U A;  3N32 A;  1DOY A;  2KZR A;  3P4Q B;  1DYQ A;  3V6C B;  3A9K B;  5AZF A;  2ZEQ A;  2GMI C;  2LGD A;  1ZDV A;  2M4N A;  4P6V F;  1OTR B;  2HE7 A;  4NQL B;  1ET9 A;  5HFY A;  3PHX B;  5EE1 A;  4LNO A;  1MHX A;  2LGY A;  3WCQ A;  1G6J A;  2C9W B;  5IA7 A;  1OFF A;  2CJO A;  2KX0 A;  1HA5 A;  2BS2 B;  2ZNV B;  2O6V B;  2IDY A;  3ZJV A;  1C4C A;  3WIM A;  4I6L B;  5I4D A;  3L10 B;  4PS7 A;  4BKG A;  5J2R A;  1UGJ A;  3IVF A;  2IND C;  4D2K A;  1EU3 A;  1N63 A;  1WF9 A;  3Q3O C;  1WH3 A;  4USA A;  3P2B A;  1ZP0 B;  1V9J A;  2PLP A;  1FRD A;  1R4M B;  1GAQ B;  4LLG M;  3AUL A;  3Q2A C;  1V97 A;  2LRW A;  2ZCB A;  3APD A;  3VHT C;  4HJK A;  3T3O A;  5MPO A;  4GMV A;  5GXG B;  1FO4 A;  4I6N B;  2KQ7 A;  2NBW B;  4DHZ E;  4HK2 A;  1OEY J;  4IKG A;  4G0N B;  3RNG C;  1U4A A;  1EF1 A;  5D94 A;  2O2V B;  1MG4 A;  4IG7 B;  2LHE A;  2FE8 A;  1V1O A;  2BB6 A;  4RGM A;  2PVO D;  3N30 A;  4GDK B;  2ZNV C;  3APC A;  2K8B A;  1T5X D;  2KDF B;  1WYG A;  3VDZ A;  4JX1 C;  1WGR A;  2NCN A;  5H92 C;  2LMC A;  1T0Q C;  5FR3 A;  2D07 B;  3PGE A;  4R3D A;  1WE7 A;  3LXF A;  4NAW A;  4W9G A;  1UZX B;  4TQ1 A;  3RUI B;  2KVR A;  2NPT A;  3VH3 B;  3FAH A;  2WXF A;  3ZJU A;  3BVZ A;  4NPN A;  3EC8 A;  3A9J B;  5AUK A;  2JXX A;  2L32 A;  4M8M A;  1WGK A;  2KN5 A;  4EUT A;  2K22 A;  3H8H A;  4II3 B;  1A5R A;  2KC1 A;  4WUR A;  3JW0 X;  4TMA B;  4WIP A;  3UI3 A;  1MFW A;  1YNT E;  1OGW A;  2KDB A;  1L4D B;  1ESF A;  1C76 A;  3AED B;  3J9C A;  2MBO A;  1UF0 A;  2ICI A;  5HG2 A;  4IC7 B;  2IO1 B;  2DWQ A;  2FID A;  4ANU A;  2R61 A;  4JWU C;  2D3A A;  1J8C A;  1WM2 A;  5E6O A;  4DDI D;  3DDC B;  1KLU D;  1VJK A;  3PS6 A;  5AUI A;  3QAR A;  4US8 A;  5G2N A;  5HKH A;  2WXN A;  3IFW B;  2QIE B;  3PTF C;  4DK5 A;  3DWM A;  4W9L A;  2FCM A;  2D3B A;  1UGM A;  4B9K A;  2MWS B;  3DBR I;  4MJS B;  3VXW A;  3RT3 B;  4MSM B;  1NBF C;  3DVN U;  2BKF A;  2KXJ A;  1TKE A;  4HWI B;  3T9L A;  4HPP A;  3PV1 A;  2W3S A;  2E3T A;  1V1P A;  2M17 A;  3SFE B;  2KDM A;  5BYQ A;  3PZ7 A;  4HCP B;  2LXC A;  1R4M I;  1F1H A;  5JHA A;  1FM0 D;  2DLB A;  3RNA C;  3IG3 A;  2QIL A;  3VRB B;  3APF A;  3FKY A;  2R2O A;  1WX8 A;  1JAL A;  4AS1 A;  2HTM E;  4N9F 4;  4LDT B;  4P16 A;  2SEB D; 
#chains in the Genus database with same CATH homology
 2L8J A;  3QIJ A;  1L7Y A;  2FCN A;  3I3T B;  4URK A;  4M8N A;  3OJ3 A;  2N9E B;  1WZ3 A;  3H7P A;  4ICV A;  3S2A A;  1YX5 B;  3WAO A;  3L0W B;  2GBM A;  3PT2 B;  1TTN A;  3DQV A;  4DHJ D;  4W9I A;  2N7D A;  1P3Q U;  2C5L C;  3U7D A;  5DPS A;  2KTF A;  3A9K A;  3OAW A;  3X0W A;  4IWO A;  1V5O A;  4FJZ A;  4JIO U;  3ALB A;  2BYE A;  3L13 A;  4K1R B;  3VTU A;  1IP9 A;  2JWZ A;  4PS8 A;  3AU4 A;  3KYD D;  2PJH A;  3CST A;  1Q0W B;  3QQ8 B;  3T8M A;  1UEL A;  4AJY B;  2MBH A;  4IM2 A;  1WIA A;  4CYE A;  1XQQ A;  2FNJ B;  2GOW A;  4ZRK A;  2PE9 A;  1WE6 A;  3PHW B;  2MLB A;  4WJQ A;  3QC8 B;  4KDL B;  4EKU A;  3QK0 A;  4MGK E;  2C60 A;  1YIW A;  3M95 A;  2N1W A;  3L08 A;  3PRP B;  5DCN A;  1LFD A;  3VAW A;  2AWT A;  3ZNZ B;  4E74 A;  3EEC A;  3NS8 A;  3LJ3 A;  3PSE B;  3ZRF A;  4BKS A;  1SGH A;  4FBJ B;  1KJT A;  4WAA A;  2JPH A;  1M94 A;  2NBV B;  4B95 A;  2K25 A;  2L00 B;  2LWP A;  3SDL C;  3ML9 A;  1VCB A;  2MCN B;  4LCD E;  2O6V A;  2BWF A;  1UH6 A;  1TBE A;  2LVP A;  3A1Q A;  3NOB A;  5IAA C;  2J7Q B;  1WJN A;  2LXA A;  1GG3 A;  2JF5 A;  2LVO A;  2D3G A;  4I6P A;  2WYQ A;  2IZV B;  2LJ5 A;  4GGQ A;  4BKS D;  1K8R B;  3AU5 A;  3CF6 E;  3RUL A;  1S1Q B;  3ZIM A;  5JZE B;  3VUY A;  3V62 A;  1OQY A;  3R66 C;  3RCZ A;  3ZNI D;  1V81 A;  2O6V D;  3JYU A;  4FJY A;  2DYO A;  1T0Y A;  2D11 A;  3X23 A;  2B3A A;  1YX6 B;  2RSU A;  4TUU A;  2KQS A;  4JL9 A;  2EKE C;  3SHQ A;  3VTV A;  3NHE B;  2R2Q A;  4ANX A;  3OJ4 B;  2RD0 A;  2L05 A;  2BKR B;  1WRD B;  4XC2 A;  4A3P A;  1C1Y B;  1V49 A;  4K7S A;  3SD5 A;  4W9C A;  2L76 A;  1LQB A;  1C3T A;  4IUM B;  4EOY A;  2KX3 A;  2KDE B;  5AZG A;  2N4F A;  2L3Z A;  2A5U A;  3M62 B;  1RLF A;  2KJ6 A;  1WJ6 A;  4PYZ A;  3VFK A;  4NNJ B;  4WWN A;  3SU8 X;  1L2N A;  5CTR C;  2JVC A;  2GBR A;  2DAJ A;  2KO3 A;  2KWU B;  3IBE A;  1WR1 A;  1V2Y A;  5FR6 A;  3W1Y A;  1RAX A;  4IWP A;  3DVG X;  2MP2 A;  5CHW A;  1QZE A;  4CHK A;  2Z0E B;  4ZRI A;  2ZVN A;  2JT4 B;  2K8C A;  2LAS A;  2NBU A;  2DHZ A;  3A33 B;  2GBJ A;  4PS3 A;  1IPG A;  2KFK B;  1E8W A;  2N1V A;  3ENE A;  2IY0 B;  4NAW B;  1V86 A;  3U30 A;  2LRU A;  2BWE S;  2MBQ A;  2PE6 B;  3DBL I;  5LXH A;  2NPT B;  1HE8 A;  5D2M B;  3UIO B;  1WMH A;  1R4N I;  2DYB A;  4MEL A;  3R7Q A;  4WJN A;  4WWO A;  4GDK A;  1WGH A;  1KM7 A;  4W9J A;  4BFR A;  4GDL B;  2J0M A;  4GXB A;  1P1A A;  1WYW B;  2NS5 A;  3BIN A;  2N7E A;  4NQK E;  1NDD A;  2KAN A;  3V61 A;  2KNB A;  2MBE A;  2ZCC A;  2DZK A;  4HPM B;  2LUE A;  3ONS A;  4KDI C;  4KIK B;  3PZD A;  1YD8 U;  4HPL B;  2MW5 A;  3PRM B;  4DWF A;  3WAN A;  1V5T A;  2HJ8 A;  5GMV A;  1KLV A;  2UYZ B;  3HHM A;  4K7W A;  2N9X A;  2KKC A;  4FUL A;  2OJR A;  1ZGU B;  2KC2 A;  3LDZ E;  4JLC A;  3ZVV A;  1D3Z A;  4FJV B;  2KMC A;  1WXS A;  3NZU A;  4FAD A;  5DPT A;  1WJU A;  2AL3 A;  2FAZ A;  2M1M A;  4GB9 A;  3L54 A;  4GN1 A;  3UF8 A;  1WJ4 A;  1I35 A;  3AI5 A;  4MGI E;  3PLV A;  3H9D A;  1I42 A;  3HM3 A;  1Q5W B;  3A9J A;  3ZNG C;  4W9K A;  4HVB A;  2WX0 A;  4WQO B;  4MM3 A;  2IO0 B;  3QJZ A;  3KW5 B;  4MEM A;  2WWZ A;  2GBN A;  2OOB B;  3TMP B;  1WGY A;  2LZ6 A;  4YL8 A;  4B6W A;  1TZ1 A;  1WXV A;  4HXD A;  2FCQ A;  3K9O B;  3KYC D;  3L16 A;  3V60 A;  4KSK C;  3ZO5 B;  4ZDV A;  4W9H A;  3A4R A;  4ASW C;  3PPA A;  2DAF A;  3QX1 A;  1WI0 A;  1AAR A;  2I1J A;  3KH0 A;  2IY1 B;  3N3K B;  5JHB A;  2CHX A;  2M0X A;  3WAP A;  2JUO A;  2DYM A;  2CHW A;  1WX9 A;  1GC6 A;  3L17 A;  2EMS A;  1EUV B;  3NZS A;  3KUZ A;  3VUX A;  3EFU A;  2FCS A;  2RR9 A;  3DVG Y;  3H6N A;  4KV2 A;  3MJW A;  4KZ0 A;  2W9N A;  3HK0 A;  4IM3 A;  5J18 A;  3UIP B;  3TCA A;  4HLE A;  1S3S G;  3H7S A;  1CMX B;  4ZYN A;  5LXI B;  2G4D B;  3ZKJ C;  2C7N B;  3VVW B;  3C0R B;  2ASQ A;  3K9P B;  3O65 B;  5AZH A;  2MSE D;  4MSQ B;  3DPD A;  5E6N A;  2VRR B;  1Z5S B;  2BGF A;  3DBH I;  4DHZ B;  4OVV A;  2XBB C;  4AUQ C;  3ZTD A;  2KTR A;  4E71 A;  2RPQ A;  1WZ0 A;  2J0K A;  3ZNH B;  2XK5 B;  2JRI B;  1XT9 B;  2L0T A;  4XZ4 A;  3DCG A;  3NY5 A;  3U8Z A;  3UGB B;  4DHJ B;  4MJS A;  3QA8 A;  3KUD B;  2N9P C;  1V6E A;  3RD2 A;  2C7H A;  2DX5 B;  4HDO A;  4GU2 A;  5LLI A;  4TV3 A;  5L95 C;  4JQW C;  3RZF A;  4ANW A;  1P9D U;  4E3C A;  4W9F A;  3N32 A;  1UD7 A;  1NI2 A;  2KZR A;  4CO7 A;  4HCN B;  1F9J A;  1XD3 B;  4II2 B;  3PLU A;  1UBI A;  3V6C B;  3A9K B;  3W1S C;  4G3X B;  2ZEQ A;  1WGD A;  2GMI C;  5AZF A;  4FHK A;  3WAM A;  2LGD A;  4BBN C;  2M4N A;  1OTR B;  4GOC A;  3VTW A;  2HE7 A;  3EHV A;  3JSV A;  4NQL B;  3DOW A;  4NY0 A;  3AXC A;  3TBL D;  2IBI B;  3MHS D;  1TGZ B;  3PHX B;  4J6I A;  1YJ1 A;  1FXT B;  2LGY A;  4XX5 A;  1MG8 A;  2M8S A;  1G6J A;  3TIX A;  2C9W B;  2REX A;  1JRU A;  2ZVO A;  2D2Q A;  5IA7 A;  2BYV E;  3PVL A;  2FIF A;  2KX0 A;  5JH5 C;  2G45 B;  3VQI A;  2IYD B;  2PPH A;  4LDT D;  2ZNV B;  4BOZ B;  1SE9 A;  2O6V B;  3R7R A;  2BPS A;  3WA0 A;  4EZJ A;  3A1Q B;  4MH0 E;  2BYF A;  2MBB B;  1OEY A;  2CHZ A;  3WIM A;  4I6L B;  4MGY E;  1WX7 A;  3L10 B;  4PS7 A;  2V4L A;  4BKG A;  5J2R A;  4KZC A;  2DZJ A;  2KWV B;  3IVF A;  4BKT A;  2KMA A;  3H1U A;  1RRB A;  2GBK A;  4P7I A;  1WF9 A;  1E8Z A;  1WH3 A;  2KOX A;  4F7Z A;  2CR5 A;  3P2B A;  4FLH A;  1J0G A;  3B08 A;  2KLC A;  1YQB A;  1V9J A;  2CKH B;  2AYO B;  4DHZ E;  4JGH B;  1WFY A;  3Q3F A;  3ZRC A;  1H8C A;  2MRP A;  3UIN B;  3UQB A;  3AUL A;  4X57 B;  2KK8 A;  2ZZP B;  4DBG A;  4AOF A;  2Y5B B;  1E90 A;  1Z2M A;  2NVU I;  2LGX A;  2LRW A;  2ZCB A;  4F8C B;  5CX3 A;  3APD A;  2V1Y A;  4LJP B;  3VHT C;  1LXD A;  4HJK A;  1PQS A;  4W9E A;  4G11 A;  5DPR A;  5L83 A;  2BF8 B;  4BVU C;  2QHO A;  4GMV A;  3B0A A;  2LVQ A;  1E7V A;  4I6N B;  1RFA A;  5CHV C;  2KQ7 A;  2NBW B;  1WR6 E;  1EF5 A;  3WAL A;  4HK2 A;  1OEY J;  2YVC A;  2MP2 B;  2KFJ A;  3GOE A;  4A20 A;  1GNU A;  3GZN I;  4G0N B;  2KDI A;  1U4A A;  1EF1 A;  2JY6 A;  4MDK E;  5AEK B;  4HDQ A;  2AEH A;  1VD2 A;  2V3S A;  3HIZ A;  2A4Z A;  4RMA A;  5D94 A;  4WJO A;  4AWJ A;  4ANV A;  1WM3 A;  2O2V B;  4IG7 B;  4G50 A;  4MGZ E;  3OLM D;  1WMH B;  2DZI A;  2XEW A;  4TQ0 A;  2KJH B;  3ZDM C;  3N30 A;  1GUA B;  4GDK B;  2ZNV C;  3QCA A;  1V80 A;  3KUC B;  5TR5 A;  2G4S A;  1H4R A;  4FN2 A;  2JZ3 B;  3APC A;  3MTN B;  2K8B A;  4KVG B;  2KDF B;  3VDZ A;  3B1L X;  4NJ6 A;  1WGR A;  2IO3 B;  2NCN A;  1Y8R C;  1E5W A;  4PYU A;  3D32 A;  3QHT A;  3BY4 B;  2KD0 A;  3VH4 B;  4KSL C;  4WWP A;  2I1K A;  2KFK A;  4A3O A;  2WX1 A;  2D07 B;  3PGE A;  1WE7 A;  4NAW A;  3RZW C;  4F1S A;  4W9G A;  1J19 A;  1UZX B;  2C7M B;  2K8H A;  4TQ1 A;  4FHJ A;  2KVR A;  2NPT A;  3RUI B;  1GJZ A;  4AJW A;  4RM9 A;  4EZL A;  4W9D A;  3VH3 B;  3PRZ A;  2Z59 B;  1IYF A;  2KLG A;  1GC7 A;  3H7P B;  4NPN A;  3EC8 A;  3A9J B;  4EFO A;  3RYT A;  2JXX A;  4M8M A;  4GDL A;  1P0R A;  2KN5 A;  4EUT A;  2CU1 A;  4DDG D;  2MX2 A;  1SIF A;  4II3 B;  3QWZ B;  1A5R A;  4WJP A;  4KIK A;  2KC1 A;  2ZJD A;  4FA6 A;  3JW0 X;  3CMM B;  2WDT B;  5E6P A;  1BT0 A;  2KJR A;  5G55 A;  1EO6 A;  4TKN A;  3ZLZ A;  3DBS A;  1E7U A;  2MQJ A;  3R3M A;  4ZRJ A;  1ZKH A;  3ZTC A;  1OGW A;  2KDB A;  3ZDT A;  2YLM A;  3JVZ X;  1LM8 B;  2HTH A;  5BO4 B;  4K81 A;  4BBN F;  2K39 A;  2MBO A;  3UQA A;  3Q3J A;  4IC7 B;  2IO1 B;  2LI5 A;  4ICU A;  4IM0 A;  3TL5 A;  2FID A;  2DEN B;  3W1S A;  4AP4 C;  4ANU A;  5CHF A;  4K7U A;  4M0W B;  2UWQ A;  1J8C A;  1WM2 A;  1WXM A;  1X1M A;  5E6O A;  1WXA A;  1KOT A;  4EZK A;  4DDI D;  2HD5 B;  2LD9 A;  3DDC B;  2JZZ A;  4IWQ A;  2CS4 A;  2AL6 A;  5C1Z A;  3PS6 A;  3QAR A;  4IW0 A;  3PRE A;  2JRH A;  5G2N A;  4GSW A;  2KTR B;  5HKH A;  3ZW3 A;  3IFW B;  2NR2 A;  1E8Y A;  3ECI A;  3PTF C;  2J0J A;  1ZW7 A;  1E8X A;  5D6J B;  3VUW A;  4DK5 A;  5KHQ A;  3CSF A;  4W9L A;  2FCM A;  2DZM A;  2PEA A;  1UGM A;  5KHO A;  2MWS B;  4B9K A;  3DBR I;  4EEW A;  5J17 A;  2O2V A;  4MJS B;  3VXW A;  3RT3 B;  4MSM B;  1NBF C;  3DVN U;  3QAQ A;  5C23 A;  1P98 A;  2BKF A;  2D10 A;  2K1F A;  2KXJ A;  5D7G A;  2RGF A;  3M3J A;  4HWI B;  4BOS C;  4LJO B;  3T9L A;  3PV1 A;  4GIV A;  2M17 A;  4DXA B;  5DPW A;  2L0F A;  2Z0D B;  2FUH B;  4HCP B;  2LXC A;  2ZPN A;  1R4M I;  2L7R A;  2KHW B;  1Q1O A;  4RM8 A;  1UBQ A;  1WGG A;  5JHA A;  3A4S C;  2K6Q A;  3IG3 A;  2EMT A;  5EDS A;  4NJ7 A;  2IO2 B;  2G3Q B;  2K6D B;  2XK5 A;  3ZUN A;  2KWC A;  2ZPY A;  3APF A;  3JSV B;  3KVF B;  3ML8 A;  2R2O A;  3IHP C;  2MA9 B;  1WY8 A;  1WX8 A;  4OVU A;  3TJP A;  3HM6 X;  3DVN V;  1ISN A;  3V6E B;  4N9F 4;  4LDT B;  3M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...