4BKTC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 137
sequence length 140
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bktC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bktC01
4W9IC 4BKTC 4W9HC 4W9DC 5LLIC 3ZTDC 4BKSC 3ZTCC 4W9FC 4W9EC 4B95C 4W9JC 1LM8V 3ZRCC 1LQBC 3ZUNC 4W9GC 3ZRFC 1VCBC 4AWJC 4W9LC 4AJYV 4B9KC 4W9CC 4WQOA 4W9KC
chains in the Genus database with same CATH superfamily
3WEXB 2VRQA 3TASA 3LPOA 4FFYA 1WBYA 2J88L 2M83A 2CK2A 4HIJB 4TQEL 4EUPH 3U4EB 1I3GL 5CLZA 2NOYA 3EGDA 3KPSA 1GS7A 3I6LD 3PGFH 1N6UA 4JN2B 4I3GA 4L4TE 4XCFH 1PAMA 3DOSA 4GAGL 4M5SA 1CFSB 1G43A 2EKJA 2L7UA 3MV9A 5CD5D 4URKA 5GJSL 3NH7H 4PRBB 2XCMC 1JZ2A 2VLKA 3ZN6A 4Z7VE 1XWVA 4AV0A 2OMWB 5IB3A 3A5VA 2RIKA 3QFDA 1S3KH 4HZLB 2ZSVB 2WWMC 2CGRL 1QBMH 1DLHB 1FL6A 4OR1A 3QK0A 4WU7A 2J7LA 4PTUA 3TVMC 3GLEA 4LVOC 3VI3E 3NA9L 1AHWC 4I0PB 3WIIH 4H8WH 4OH2A 3HE7A 2DIJA 4JANA 1JBJA 4BZ2A 1NFKA 4QHUB 3THML 4GAJL 1ANUA 1T03L 1ZJAA 3V4PB 2CDEA 2QHRL 4LDCA 5CZXC 1MCOH 4MJ5B 1SYVB 4NP9A 4PCKA 1KUMA 1P2CB 3FSWA 4ODSL 1I1FB 4PRPB 4TN9A 4XOBA 1HZHL 5I1KL 2OX5B 1DJGA 4UDTB 4LVNC 2X53A 3UFIA 4PHZA 3HC0B 4JRXB 5HI5D 5L4JA 3LRHA 3T65A 4L1SA 4NAQA 3E80A 4K5NA 1TTGA 5DSCA 1B0IA 3G5ZA 1CFVH 1QSFA 3OTTA 1J9RA 4HK0A 3MROA 2MPVA 4HHGA 1OAUH 1BF5A 1T4KB 5TGBA 2H8PA 3FTWA 4GKLA 2ENSA 1E6OH 2J12B 2SODB 2CCLA 2IWKA 3ELQA 2NX5D 3HI6H 2P44B 1LMKA 5JHDD 2DWSA 3QUZD 1Z6JT 1KIPA 3DVNA 3MZTA 2BVPA 4WJG3 1Z5LB 3POCA 4HK3J 3VUAA 5B39B 1BF8A 5ETUB 3UZQA 4CW1A 2Y5QA 1YEIL 3MUGA 5C0IB 2QFRA 4M02A 5KVEH 4FDWA 4H88H 1IILE 1XR9A 1H3WM 3FQRB 5KUKA 5LBVA 3UPRB 1MJ8H 3L9YA 4QXGH 1AQHA 3LNGA 1RHFA 4XP6L 1JGLL 4Y9GA 4PUBH 2CZNA 4FQIL 3OHXA 3WJJA 1KCSH 3GSVB 2O5XL 5DK0B 4AL8H 4PVMA 4PWFA 2K7PA 3F7YB 4GBXA 4ORGB 5A7BA 3NTCH 3RWDB 2W0FA 3W0WA 5JHBA 2KC0A 4FKHA 4M6OL 3VA6A 5BCAA 1PVHA 3LS4L 4RNRB 1BOYA 3FB8B 3TURA 3BQUA 5ICYB 1S9YA 2EUXA 3RL1A 3MRRA 3DX9B 3F2LA 3MA9L 3MNWB 2NUPA 4PJHE 3VXSE 3MRLA 3BD3A 4LKCA 1MJJA 4W6WB 3ZZ1A 3S35X 5I0XA 1XZ0B 1HQ4B 4YDZA 4YE0A 2V5SA 2VR5A 5H94A 1RU9L 1SHXA 1Z3GL 1NKOA 1UGKA 4MBRA 4TPRL 4TRPL 3U4AA 5JQ6H 1PKQA 2H2PC 1R3LA 5JOPD 5D71L 4L8CA 2VDRB 5C0AD 3NGBC 1ZXKA 4YHLL 1H3TA 5D1ZA 5FB8A 2HVKB 2V5YA 2MTPA 3ZE1E 2KZ1B 4L0YA 2BVUA 1LHZA 1TTBA 1YMMB 4FF9A 4G59C 4O4YL 3QUKA 4JN1L 3X13B 3QRBA 4H8HA 2D0FA 1QFWI 4HJSA 4IU3B 5EH1A 1RZJC 1T04A 5DC2A 2J1WA 2DQUH 1KJVB 4JHWL 5DYOB 4E41B 1JF1A 3RWHB 4HSAC 2H6PB 1NFDF 5DS8B 4NDMA 1W2KT 5IQOA 4P46D 4Y4KB 3ESUF 3NIGF 3RJDA 5D7JA 3RGHA 2YPLB 1C5BH 4X4XA 2Y5TB 3H2WA 4PR5A 1UZ6E 4P49A 3VWJD 4FXKC 4JPKL 1OT4A 2WB1A 3QIWC 4CU7A 5MHSD 4UDUB 5DHYB 2D7NA 2VITA 3AAZB 1LE9A 3LZFH 1FFNA 4S1SL 1IE5A 2ADIB 1TVBA 3WGUB 4EE2A 1FAIL 1CDJA 5E5UB 2NY3D 3CSTA 3HBPA 2A74C 2IGFL 4X80L 1O9ZA 1HI6A 2GJ6B 2AQ3A 3TPKA 1OAYL 3SGEI 4OCWH 4OF3A 1N59A 4ADJA 3AABA 2YOCA 4R7XA 1U8IB 1SJEB 1PG7H 4Y2DD 2CHWA 3DV4A 3NDYE 3P73B 1J86A 4KZEL 2QGDA 2YGNA 1UJ3B 5CILH 1NAMB 1AG6A 4HGMA 3HZVA 1SMOA 3T0BA 2CMRH 2F5BL 4K9JA 3MV01 3S97C 3DO7A 1JPEA 3ES6B 4XWOC 3ECWA 2PP7A 4XH2B 2MCPL 4P2YA 1W16A 4H2CA 2DI9A 2WINB 2H26A 3VRIA 3K6SA 1AC0A 1CLYL 3FBKA 4MVBC 4LRIA 5DFVC 2EIZB 3BP7B 2FK9A 2BY3A 3X12A 2LU5A 2DQFB 5GS0L 5AG8A 3SCMA 1I9JH 4JFPB 5DVMA 4JPIB 1BDYA 1A9BA 5CJ8A 5TQ2H 1S9XB 4BKTC 2Y7QA 4FTVA 3HZ3A 4J3OG 4X6DA 2XWJA 1DQJA 1CC3A 2J44A 4K0OA 4LGSB 4Q8BA 2Y1YA 1RK7A 4WHTA 3B34A 2DTMH 2GHZA 1JHLH 5F7FA 1NIBA 2DQIL 4XVUC 2R4RL 3QDGE 4BUGA 3MODH 1QKZL 1Z9OA 1ZV5A 4Y1AB 4E68A 1KTDA 2X4TA 3O8XA 4QYOA 3STLA 1UWGH 3W39B 5E8EA 3IJYB 2V9QA 2ZOUA 1A21A 4Z5RB 3UC0L 3MRFA 1AGEB 1SUHA 4KTDL 2HMIC 3P2DA 1D9KD 1M42A 3Q2LA 2OSLB 3TVMB 4LVOB 4A6YH 1AHWB 4OZGF 1L9QA 5F8QC 4H1LH 4HWEL 5JYLA 2Y6SC 1DFBH 2J8UB 1KBWA 3CVHB 3D4YA 4PS8A 5IMOB 1XV8A 1HHHB 7CGTA 5DLMH 2BWQA 2G0KA 3EDKA 3QO0B 1FGNH 1PU0A 4N6RA 3UYPA 4EI5D 3TN0C 4LVNB 4UQ3B 2VJ8A 2C3VB 3SY0A 5E5RB 5I16A 5IY5B 3EGXB 3NPSC 4ELME 2LLGA 2ZWSA 1CXIA 2TRYA 3BESR 3UL4A 5H35A 1E9OA 1UGNA 3ULUF 5DUML 2VZVA 3HMXA 4HWBL 4K7PX 3OF6D 4ABWA 3D2TA 2WVTA 5ABAA 1RUAH 2ADJA 1VFUA 2CIKB 2VQUA 5HDWA 4NM8H 2C9PA 3V52L 1QFPA 4S0HA 3MBWA 1ADQA 3PWUB 3PL6D 1HHKB 4AV4A 1ZSDB 4ZTPL 3DGDA 3VXUD 1BFVH 5EZIL 3V0WL 4TMPA 4HCRL 4KPHL 3X1GA 1CZ8H 1KB9J 4K55A 5KN5B 1IBYA 4WDIA 4AT6B 1UHVA 1Q1JH 4LFHG 3POHA 4U49A 5IESH 3AUWB 1T89C 4R5TA 4X5XA 5IW3A 2IAMA 1GGCH 4OJEH 4WRLA 5MEQB 1UUNA 1VEPA 5GISH 3K4AA 3ZHLA 3ZDZB 2NY0D 1E9PA 5KBPA 3KR3L 2K70A 2QV4A 4G8AC 4HP5A 3T8MA 3L95B 4Z3JA 5J13C 1EEQA 4DF9A 4YBQD 1DQLH 1G1CA 4XR8C 1G6RA 2HXAA 3TT3H 3DIFA 3BEVB 4G11A 4ZJ9A 2OW7A 3ZTJH 2Q86B 5JDJA 1UEYA 4CDHA 2UWEA 4LB8A 3IJ7A 2H5UA 3CSFA 4NN5C 4JFTA 4F1SA 4Q2ZB 4LMQI 1X7SA 1XCXA 4OGZA 4WK0B 5C2BL 4XNYL 2L0DA 3P9MB 4L2YA 4PHXA 3WNPA 4B5EA 5L8KB 1MWOA 5TPWH 4L4TD 5TE7L 3NGBB 1QHPA 5C0DA 4DP4X 3B2VH 8FABB 1C5CH 1OSZB 3EOAA 3AC0A 2HVJB 4ONFH 2A6KB 4LCUB 3S36H 1G6VK 4RMUA 3FUHA 3HKFA 1AGBA 1YNKH 4M5TA 4X8GA 1V7ML 5C3TA 1ETJA 1UCBL 5BS0B 5IJCC 3HC2A 1JDAA 3SO3C 4W9KC 4A2MA 3MLSL 1TZAA 4U6TA 3HZMB 4OZ4B 4KTYA 2IXQB 2FGWH 5MEPB 4NQXB 3RZCC 5MERA 1KEGH 3NABL 1OE3A 3GNML 4ZUTB 4LEOB 1MUJA 3W1ZA 4DOHB 2W88A 4OT1H 1IM9D 3CUPA 5HHVL 1WHOA 1RD6A 2DEXX 3V4PL 3QIWB 3QXAA 1IAKB 2MKLC 1T20B 3L5XL 1BBDH 1JRHL 1Z32X 3MGOB 5DQJB 4BFIB 2F19H 2XY1A 1VADA 2BFVL 2KMWA 4NOBA 3GSXB 4PB9H 3W5NA 3VW3L 5IF0B 2EH7H 1HE7A 5C7ZA 2A74B 1CYGA 4NO5B 3D6GA 4P5TC 2QKIC 2YIHA 3B9KD 4N0UB 3UTSA 3WDHA 4F2MA 3G04A 2ZUVA 2DLGA 5MEOA 5CZKA 3IDJA 1S7XA 4N6QA 5A2FA 5EBWB 4L3FA 3SE8H 2E75C 1NUDA 1JN6B 4X42A 3BXNB 4EUPG 1CXEA 3O0LA 2DI7A 4PEEA 3HKZA 3ZRSA 4LASL 3L1FA 4JKMA 2WPGA 4KHTH 1DBAL 4P9ML 1FL5B 1QEWB 1EUUA 2MQ3A 1G9MH 3O3DB 3I3BA 4JFEE 4MNHB 4YFLI 2DWTA 1P4LB 2R56L 4HKZB 1JERA 2MJWA 3E6HA 1QLRA 2XZQL 2VW6A 5F3HB 3CLFL 4WUKH 3VE0A 4MQXD 1WA2X 5D7IA 1JPTH 2WKOA 2CO4A 4QRRB 5JW3H 3VXSD 5I1LB 5IJBC 1RIHL 1HWHB 1MNUL 1PZCA 3BO8B 2F54B 4DKTA 4FQLH 3DX6B 4B53A 4B9CA 2Y2YA 2IQAA 1D6EA 4WGVB 5IK3B 1R5VA 1HS6A 2DYPA 4PS4L 3L2MA 2YPKB 4LHUG 4BM7A 5C3IA 2NT1A 5HD8C 4R4FH 5T5NF 4PWHA 1JZ6A 2QADD 3S37X 4UZGA 5FGCE 2AQQA 1CTOA 4ZQKA 2ZKYA 3W9DA 1OTUD 3PGDA 5EO1A 1CFQA 3DSFH 3ZHKA 5T33L 5IB5A 3ASWA 2BVOB 3T3ME 2VDRL 4ZMAT 4TNEA 3WFHA 3F85A 1CK0H 1HWGB 2VXTH 4GFXA 4Y9BA 2PKDA 5A2LH 4Q9QH 1NCCL 3CFDA 1RIUH 1U21A 5I1HH 1GZPA 1CIDA 4JY6B 3BIKA 1R47A 3EFFA 4BSWA 3KPOA 3PJLA 4J1UB 3SKMB 1CLOL 2QBWA 3QWOB 1E4JA 3DECA 5F9AC 4IBYA 1SEBA 3KM2A 4L2LA 4ONGL 2XHNA 2BZ7A 3FH8A 3BAJA 3TN0B 2HB0A 3VXNA 5KTEH 2ISDA 1XGYL 3NPSB 1Q0XH 1JWMA 3PV6B 3D25B 5LO7A 2ZCLH 4NJAH 4X4YB 4AIXA 1HOCB 5LN8A 4MB4A 4Y2NA 3L54A 4NXSA 5KS9A 2OTWA 3N41F 4DUVA 3D0LA 2YJQA 3O9WA 2BNRE 1JGVH 1L0PA 3K71A 4W81A 3ZHNA 3G6AA 1PX3A 4AC4A 4R9HA 3EJRA 4PJDE 1J1PH 5EHFA 2OL3A 1WJ3A 3QG7H 3HPJB 3JWOL 5F96L 1NCBH 3JV6B 4HIIA 4ZAKD 4PV9A 1F2XK 4Y89A 4OZFA 4BFOA 1I1AA 5B38G 3B7RL 3RPIA 2X6CA 3L5JA 4ABQA 5KSBE 1IGIH 2KI6A 4WW1A 3MLVH 2DICA 4IDJH 4EOWH 2A4CA 3SJVE 3T3PB 4BYHA 4G7YH 1N6VA 3QXWA 4KOCA 4WI3A 3S5LA 1XSIA 4R90L 3FCTB 3O2DA 4ALAC 5HYSG 1MLCB 1HU8A 2WYZA 4QHKJ 1NAML 1CG9B 4LARL 5FOJA 4GUPB 1V7NH 2Q10A 4J5VA 1EJ8A 1FFPB 2PWHA 4FFZL 4O58L 4OB5L 3Q8BA 3SKUD 2XPGB 1BVNP 3FT2B 2NTFB 4UB0L 1KN4L 1I1YA 2FECI 5E1QA 5DEGB 3QAQA 1TR7A 1UD8A 1WZ1H 4BH7B 2D31A 2ESVA 2X2UA 3GXIA 2V4LA 2XACC 3I2CL 3ETBJ 5E8OB 5E2UL 5KWYC 3MV7A 4AGNA 2WTPA 3QDGD 1QW8A 4FQXA 5GGSY 1AXIB 5AVTB 1CR9L 1KLUB 2FYYB 2LAGB 3OWRA 3PQYB 1OCZB 8PAZA 2VMJA 4KO7A 1QPXA 4OI7A 4OM1H 3SE4C 1G1KA 5SWZE 4ZK8A 4TVUA 2EO9A 3RWGA 4FZEL 4I1PA 1YQVH 3V5KB 3IPBA 2CUAA 5T1MA 1TU2A 2WQUA 3C6LA 3CFQA 2L7EA 4HGWA 4JO1L 4P4KD 3RX7A 3BRGC 4MMZA 2C7FA 4JZNA 2Y22A 3WKML 3SO3B 2VDMB 3V0EA 5IVZA 3RIAK 1IBDA 1TZHA 3WKYA 1T1WA 3KVPA 5TE6L 3RZCB 3RHWK 1P9MC 1LK2A 3HVNA 1YMHA 2B59B 2H0JA 12E8H 2NPLX 3LPWA 1FDLL 3V6ZB 2B3IA 2ARWA 4XTRD 4AQAA 3CVHL 3O81A 4JG1H 1PBYA 5E6IC 4Q7DA 3UBXG 3REWB 3CZFB 3F64A 3TZVC 3L5HA 5FYJE 4DP1X 5HJDA 5HYFA 1VJSA 1RPKA 3B56A 1BMWA 4XNBA 3SPCA 1M05B 3AT0A 1FH2A 3H6JA 1DR9A 4TNVK 2YMOA 5ABDE 5I75B 2J1ZA 2MHAA 4P5TB 4J6IA 2NRDA 3QO1A 4MCZA 3CX5K 1D6VL 1ET5A 1SHSA 2CWRA 1W72H 5J12C 5D5ME 3PGCA 1O6TA 4KUCD 4AJWA 2AEPL 1ILUA 3CDZB 4XPTL 2VLLA 3ECQA 3WTVA 3BEWB 1AY1H 3V6FA 1INEL 1IEHA 1B88A 1MHEA 4PGBA 2JB5H 1IL1B 2AJ3B 4Q0XH 4WTWA 3IE9A 5DTFB 3RIFF 4C56B 5TF1L 4Z7NB 4PGZA 5AZ2H 1DEEB 1ADWA 1R4XA 2V2XA 2XWRA 1A4AA 3Q8CA 4MAYA 4XXCC 3SGEH 1H3UA 3PDOB 2OTUB 2X42A 5DC0A 4YL9A 4ZSOA 5I66B 5DK3A 1YYMH 1XEDA 3CFJB 4N28A 3LRKA 5DJ0B 1RUKH 2DV6A 4JR9L 5EO9A 4NERA 1DQQA 5JLZB 5KSBA 4YBLC 1ED3A 1DQMH 3QT2A 5F6HI 1H3GA 1GOHA 5DJDA 4JO4L 5FA3A 1TJHH 1QR1B 1R6VA 3CVDA 4H1LG 5CBAA 3UEZA 2DMBA 4JO8A 4UOJA 3GS7A 2Z4QA 2VDNH 1MWAB 4O9HH 3VGFA 3FQ2A 3MRGA 1F41A 5DZJA 2PMZA 5IROD 2YFNA 2VDPL 2MH4A 1A7QL 1AZCA 4WLCA 1TQSA 3BZFB 4HIEB 2VE6B 1LEKB 1X9LA 3QPKA 3DXAE 1NICA 3QCTL 1NANI 2WLHA 3QUZC 4YSDA 5K5YA 2DQEL 2J8UF 4P99A 5HYJA 4PJCA 4P3CH 4UU9A 2F68X 3PHQA 4OF0A 1OB1B 3LVEA 4BH8A 5TD4A 2CA3A 1FIGH 2X4UB 1G7JB 5HPMA 1S5IL 3N43B 3DRTA 5G5DB 3MJ9A 4HISA 4WVRA 2PXYC 2R1WA 3QDJB 4Y1SA 5F7WC 1E3FA 5IMKB 3NZUA 4QRAA 3QUYA 3GJEB 4HEME 2VN5A 1RZJL 3GRWL 2FD6L 3K2UH 5EA0L 3M1BA 2BVQA 4JDVA 4K94C 5TDNA 1SLWA 2E4TA 3MBEA 3OKMA 2DWYA 3AUVA 4AG4H 3MJ7B 5CCGE 1DANT 4BXSV 2X70A 3NA4A 4WO4A 1Y1UA 3NEXA 5J6HB 1YEKL 3QR0A 2W94A 1I9IH 3PCYA 4N2HA 2CO2A 2JF1A 1AIFB 2IC2A 3VNZA 3OKOA 3UJIH 5LWYH 2F7RA 4NGHH 5ID1A 3DUUB 1FZKA 1TQBB 4MJ6B 4X5LA 5C0RH 4NO0B 1Y18B 3VH8G 2BO0A 1CF8L 3IBEA 2HA1A 1KDIA 3VFGL 5FM5O 4A66A 2XX1A 4JKLA 3ZTJG 4BINA 5FO8A 2E9IA 2DKSA 3V9CA 3ZDZF 1EO8L 3C5JB 3KEDA 4PJBA 5FGBA 3VACA 4AVKA 5E2TH 1HFUA 5HYSA 1ZDQA 1AHKA 2XFXB 1KCWA 1ASOA 1R75A 4FGMA 3ML8A 3TH3T 3SD2A 3HCVA 3VAEA 4AMKL 2H32A 5IOPA 3H9SA 2JCCE 3NIDB 5IQ7L 2F7IA 4KK9D 3H1ZA 1XB3A 1LO3H 2ZYIA 5JIDA 5EORH 4YOKA 3TONA 4M3HA 1PYWB 2ZP8A 3QFJA 2YARA 4QHLB 4JFED 4A7TA 3D12B 1J5DA 4EDWL 3SDXF 4RLDA 4FMKA 4YUEL 4XPAH 1I85A 1LL1A 1DVZA 3MMEB 3PWLA 3U0TB 1XZWA 2A6IB 4P46C 4XPFH 1R3IL 1KN2H 3CFCL 3R19A 2LAAA 2MNWA 2ZX6A 3MV9E 2HJFA 4RIRB 5B8CA 5EF2A 4MA7L 3HVDA 2NT0A 3VWJC 3IFNL 1J8HA 2VLKE 3U9WA 1XAUA 5AG9A 3UJJL 5I2IA 3RA7H 5FLVA 4ODUB 2CO7B 3ABGA 4OVVA 3RBGA 4IBQA 5LGYA 5ALCH 1I7TB 2OP4H 2QEJA 1JNLL 2V17L 2NY3C 4P2OD 5KVDL 2P8PA 4DUWA 1CL7H 3HBQA 1K72A 2XOTA 4JGHA 1FRGL 4K3HA 5ADOL 1QABA 3IVKA 5I71B 2QTVA 3OZ9H 3FN0H 3B8YA 3BSHA 3BHBB 3HI5L 3UGEA 3G6JA 3QZWB 4Y2DC 3KAAA 2A5UA 3PIQA 2J4WH 1DANU 3VFOB 2NLJA 1S9VB 2W59A 1OSYA 3DHUA 4TUKL 3JV0A 1QSFE 1HXMB 2XN2A 2LU7A 5I6KA 2DLEA 1GGYA 1TETL 2FJUB 2VGLM 3TEYA 3MRMB 1AP2A 4KU1A 2M2DA 1U2CA 5E6IB 3NSYA 4K7FA 1P5VA 3IDIA 3FUIA 4WI9A 1RZIA 3C9NA 3LKRB 3UYOD 1KGCE 2Y1AA 2C8NA 4LRNH 3PHOA 2YGVA 2FQDA 2IANE 1OM3L 3RE0A 4W4OA 4BKLA 2VZOA 1OCRB 4OGQC 1TZIB 3VFPA 4PVLA 4UAOC 1WS8A 2Z8SA 4N24A 5J12B 1HK6A 3KNBB 5IIEB 3FB5B 1T4WA 3I6SA 5IB1A 5FOBB 3L81A 4CN1A 1WFUA 4XNMB 2R15A 1QNIA 3UBGA 3ESVF 2WOBA 4NBXB 1E3XA 1ITCA 5FO7A 2CBOA 1FZJA 2E5EA 5EUOB 4HUKB 1TVDA 2EDEA 3SJVD 3J27A 4RBPH 4JQIL 4XBEH 3CDYA 4K3DL 3CLEH 4MMXC 4WI5A 2CJ3A 5JZ7D 4X6BA 1UACH 1X5IA 2PPAA 1D9KC 3HE6A 4YFLF 2ICWI 2XTJE 3KDMA 4AH2A 2ZCKH 3OKEA 5DJ6A 1T5WB 3IKCB 4I4WA 4IBTA 4DCQA 2BH0A 4YHIB 5KOVC 4YBLB 4ZS6D 1N2RB 4FXGC 2BSTB 4PRIA 2FVNA 2LV4A 4H1LA 3RGBA 2V3EA 3MXVL 1PKQE 5GGRA 2ZSWA 3EO1B 1TYJA 2E7BA 2BWDA 5EO0B 4EI5C 2FSEB 1VFAA 4Z7IA 5BNXD 1R3HB 1T1XA 2WJ5A 3KVQA 2B39A 4R3SA 2H4EA 3OKDB 3BWAB 4M9OA 1J05B 2EXWC 2NX5B 2Z31A 1PG7X 4N9OB 5LQBH 3QUZB 2E76C 2FECL 3B9AA 3ISYA 1BZ9A 4LOEA 1WWBX 4CMMA 3KPRA 1VACB 1EHAA 4KJWD 4ONHA 5SWZD 5GRVL 4U1JB 4GH7B 2XNAB 1W0YT 1CMOA 3W9EB 1YZZA 4U6HB 5SX4I 3MRBA 2MCMA 3ZTNL 5FYLL 1BQHB 3IGFA 4GMSL 1OXYA 2JJTC 4HUVA 1INQA 1PX4A 1MDAA 4G43B 2PXYB 3D4ZA 1MRDL 2IG2H 3DI3B 2QVIA 2YQ3A 3EYVB 3FUDA 4QXTB 4DKAA 3IWVA 3TC9A 4GUCA 1JMZA 3GLZA 5F72S 1SY6A 2C9VA 3IU3B 4IRJA 2VDML 2NY0C 3VJ6A 2NYYC 3GZQA 4R2GD 4PREA 4U1KB 2XTLA 4DFHA 2F8XC 2UXFA 5IQ9A 4PJFE 3KYNB 4M4RA 3C5ZD 5FYJD 2DMGA 1QTSA 2JELH 1I82A 3FO1B 4L8DB 3UDWA 2HJLA 1RK1B 3T6QC 3EBHA 5BV7C 1F6FB 1ZJBA 4LVEA 5HJBA 3SKOA 5EIVA 5DURD 4DPBX 4ZXBD 1H6EA 3UG4A 2UZIL 2AEOA 2G3ZA 2QV2A 3OLDA 1AI1L 5DD6A 4IIQC 2Y2TA 3T3PF 2JV6A 1DE4A 2C9WA 4JQXC 4YIQA 5H2BB 5DWUH 3VFVA 1DVQA 3GUFA 4FJZA 4DVRL 1E5YA 5DT1L 4LL1A 2O6DA 1H6FA 1ECZA 2R0KH 3BIBX 3QEGL 1OP3H 3QHZL 1HE8A 3OGOE 4GNKB 5C0AB 3TBWB 4DSYA 3CPUA 4CGTA 2BCMA 2BIQA 1VEOA 4Z0BL 5ESQB 2VC2H 4G9FB 2R2BA 3NJXA 3Q6FA 5B4MD 5B1AB 1PQZA 3EDJA 4JRYE 5AWNH 4J6RL 4HFUH 4NQUA 5T5FH 3P77B 2F0CA 3WL9A 2PW1A 5D70H 1OTTD 2BNUB 2VDQB 4KX8A 4XPHL 3HG4A 3N85L 4PLNC 4PJ5A 2DQCL 4X6DE 3FT3B 1OGPA 1VENA 4XN5A 1IGJB 4HIHA 4LSTH 2SEBB 1HINH 1HKLL 3FQXA 4JY5H 3VYOA 3BYYA 4FQQB 4P46B 3HNSH 3F7VB 3RWEB 4Z23A 1KELH 4MJHA 3Q48A 1MFNA 2AABL 4IMKC 3VWJB 1TJIL 4I8DA 2CGZA 4GKOA 1JTOA 4J3UA 3V8OA 5HPOA 2B1AL 3C08H 4XVTH 2XVLA 4NNPH 3D0VB 5FM4A 2X88A 4P2CG 4PV8B 5EOQH 6FABH 3T0EA 2EVJA 4EJ1C 5LKNA 5IHBA 2EUVA 1MWAL 3DXAD 2NY3B 1EHNA 5HI3D 4ZMLA 3BWZA 4JFQA 35C8L 1YEHL 4P23A 4FFWC 4KI5C 4I48A 3GBDA 1N4XH 4APXA 1JYVA 3PUCA 3B9KC 2FATH 1EFXA 2I25N 4AZ8B 2G5BA 1AGFB 1PD1A 2DLTA 2Y06H 4Y2DB 4G5ZL 3ULVH 2VISB 2XJKA 2GSIA 3BWUC 3DYOA 5CHNB 4HCFA 3ZIMA 2YD9A 3C60D 5FUOL 3GXPA 4URTB 1AFVH 3SQRA 3VXQB 1X5YA 4XNUL 4GP4B 1RZ8B 4OV6F 5I30L 4J8QA 4JGJA 1DUYB 2E59A 1U8PA 5FECA 3UG5A 4OZIE 3PAZA 5D4JA 1TFPA 5C08B 4PJ9D 1QRNA 5D1XC 3IF1B 2VXQL 5E8DL 1XF2B 3ZSTA 4MQXC 4UT9H 1UOWA 5CBEA 3VSUA 3AT9A 3DTXA 4PWJA 4Y4HA 1XIWC 3II3A 5FO9A 4UAOB 1RULL 2ZX8A 3MRPA 2C9QA 1EXUB 2ENYA 3RX5A 1E4KC 4NPJA 3VXRA 2B5IC 1HEJC 5AVWB 3S36X 3TCLA 5DRNA 3GMRA 3JWNG 4MAUL 3U2IA 5K59E 1QLEB 2OZ4L 2WGNB 4HC1H 4XAKE 5M94B 1MFCL 1TKWA 3LQAC 5IBUG 2QADC 5F8RC 5B7FA 4W9EC 1OTUC 2K7QA 1UM5L 4QIRA 4PJIA 4S1DC 5GSRA 1DBKL 3RWCB 1BQKA 2WJ7A 1W15A 4KJQD 1CTNA 4ABVA 2UWEE 5AKVA 1D9KB 4XXWA 4KHXH 4V1DB 4F7CB 2AXGA 1WTLA 4ALAL 4G8EB 1HHGA 5FKPA 4AC2A 4UOW0 4KDVA 1F3DH 3P3UA 1TTAA 4O51B 2QQLH 1RMFL 4N90E 4FQCH 3ZT5A 4RBPK 3S2AA 3FSOA 1NMCB 3KXFE 4EI5B 1MCPL 5IJKC 3MV9D 1ZDSA 6PCYA 3ARDD 3VCLA 2X38A 3EYUH 5E4OA 3RP1A 1W80A 2ZE0A 4GKZB 2VLKD 2XZAL 1F4WL 4ODHH 4ZUSB 3BQVA 2K8QA 2AVFA 4IMLB 3SE3C 5D7SH 4JE0A 1WLHA 2NR6D 3VQ2C 3NEOA 3N43F 5AQ0A 1PS3A 4TM9A 5E99L 5EMYA 2OFQA 4U2ZA 2AHIA 5CJBA 4N2MA 1DBJL 2B2XL 2IDTA 4LSRH 3MLWH 3VXUB 1B4JL 1ET7A 1FYTB 1JZEA 1OK0A 1WWAX 3ECVA 4XT1C 4FQ1H 3CZKA 1E4XI 3LZLA 4MDRA 1E40A 1RZFL 3IRCA 5EBLA 8CGTA 4XNZC 2IADA 2TSAA 3LYRA 4O02A 5JHLA 4LK4A 4L29A 3JZ7A 3LKOB 4HCGA 4F9LA 3K6FA 4B41A 2W9EH 5DJXA 5ILTH 3QIUC 2VQ1B 2YRLA 3PXHA 1OAQL 2V9TA 5DUBA 3EHBD 5FGSA 1QSFD 1CFTB 4PCSA 3FRUA 1I3RA 2WK2A 4H8PA 4LSSL 4I3SL 4DEWA 3KJ6L 2NY0B 2FWOB 3EF7A 1V27A 3GSRB 4NZTL 4BJLA 5DHEA 1YPZB 4QCIA 3II1A 2EVFA 4ZRGA 1KGCD 2EECA 3FB6B 2N0MA 2JKSA 3LZPA 3NCYP 3UTSE 5CEYA 3EFOA 3GWJA 4F2ME 1DEDA 5K9OA 5BV7B 2ATAA 2RAMA 2IAND 1PY0A 2NNAA 4KVCL 2IIJA 3GBNH 2FLMA 1FNSL 1YJDC 4OD2B 5DEFA 5HDOA 4Z6AT 5C0CA 4IIQB 5IB4A 4AEEA 2QPFA 5HHOA 4NFCA 1E6JL 4FQJL 1JPSH 5AVXB 1GR7A 5BVPL 3FFDB 3TIDB 3NCBB 4U0QB 4GW4A 4UF7C 4LEXH 5L0QC 3HLAB 3QEQA 3QBTB 5GS1C 2CRYA 3APMA 3C8DA 1P69B 4I0CC 4AY0A 4Z7VB 3HI1A 3BQUD 1ZTXH 1UXWB 3CU1A 3S7GA 3WHXB 1YVLA 1B9ZA 2YK1L 2X44D 4CKQA 1UKQA 1AQDB 2AITA 1L9TA 2XTJD 4P4KC 3N1PC 3VI3B 1F4YL 5CCJA 1U8KA 2A6JA 1AD0A 4PJXA 2G2RB 2W60A 1NEZA 2P8LB 1KJ3H 3NAAL 2OXGB 2R27A 5IW6A 3GK8L 5JUEH 3CVIH 3KCPA 2VMFA 3CQPA 4AQEA 5JIQA 1CFMA 1LP9F 3DK2A 5D6CA 5J6GA 4PJEB 4UM8B 2WKGA 5AVQB 1IM9B 4XTRC 5D1ZD 3WN5C 1ACXA 4NRZA 3WHE0 5HYQA 5E6SB 3ROLA 3DJSA 4HPOL 2W38A 1D5MA 4TSCL 3PJNA 4N0YH 5EZPA 5C0EB 3LB6C 1LO2L 5HDQL 4TV3A 4ZTOH 3O2VH 3P4MB 4Y7MA 2Z8VC 5GS2H 4R7DA 3LPGA 4WSGA 3UZEA 2XKUA 1H19A 3PAVA 2MRYA 4KVPA 1WEJL 5AOKA 3GUTB 1MFMA 4JO5A 1Z9PA 1JPGB 4G9DA 3B9KB 1HDMB 1LO0H 4OIBA 4P2QE 4PJAE 4BE5A 4NKIL 3CPLA 1W72A 1W8OA 3F7PC 4D3CL 1TNNA 3HC4L 1N8OE 2WVVA 5FDWA 4K3EL 2YBGA 2WYIA 3AM8A 5DHVA 1PD0A 3P11H 1MSPA 2DBLH 4LP8A 4D8PA 1KB9K 4QY8A 4WI8A 5AYQA 1JWUA 15C8L 4K71C 1A3RH 2D03L 3AU1A 5I0YA 1OANA 2EYSB 2V3FA 1OPOA 1A4CA 3PS6A 4QWWD 1BQLH 1MOEA 3IMUA 3HG1B 4ODVH 5D1XB 2GSGA 4B9ZA 1S5HA 4X4MA 4K94L 1IM3B 3JVFC 2F9BT 1N3NB 1UQSB 1KT2B 1UYWL 1U8MB 3LN5A 3QJQB 1ZE3H 3VD9A 1M7DB 5IHZA 1FL3A 5L2KA 1OGAA 1XIWB 2AK4A 4AX3A 4ENED 5I1AA 4PBDA 5D7LA 1RUMH 2G9HA 3G7TA 4HF5H 3EBGA 3I3DA 2B5IB 4JFZH 4KY2A 4AIOA 5F0JB 1A7PL 1CS6A 2R69H 2VABA 5GJTH 4Y4FC 3N2JA 5F2FA 5IROC 5HGHB 2X40A 2J88H 1YEWA 2HYMA 4M7JH 4FFTA 2QADB 5FA4A 1O7DE 3VXPA 1I3GH 5IVXE 4JREC 1ZGLM 2PCFB 1U91A 5ICZA 3L7EB 4G8FA 5C0FA 1ACCA 2LGNA 5C07E 5ITFA 5I8EB 3L4VA 1CGSL 3T6WA 4G6ML 1ILSA 4JG5A 5FKAA 4ZFZB 3CCHA 5TFSH 3QPXH 1UFUA 4AGMA 2ESVE 1FV1A 3O45B 4MTMA 1JFQL 3NJNA 3ARWA 1PL3A 2YSSB 3ESNA 3EAKA 2Z92B 1AQKL 4GUQA 5EOTB 1DJWA 1L7IL 2CGRH 3GZPA 2IPUK 1ZLVH 3CIAA 2K9FB 2VDQL 1P84K 2JK5A 4YHPA 4QAWA 4AW7A 5DRWB 1U42A 4YVNA 1Z9SB 3O8XD 1I7ZB 4WI0B 1KTKE 4N2DA 1L5GB 4ORZC 4RFEA 3RWFA 2QHRH 3G6DH 5C09A 4RDQG 3L5IA 4ZX5A 3U30C 1QR4A 1BVKB 1F90L 1XF1A 2J5LC 3GPSA 3P02A 1HZHH 4X6CA 1CU4L 1MFEL 4UUJB 1F97A 1EH9A 1F42A 4LCCA 5EC1B 3H8NA 3SDAA 2XG4B 2VJ0A 4D9QE 2V0AA 2FX7L 4M7LT 4HV8A 2EDHA 3SDDA 4PGDB 4RQQA 1KWGA 4MX7B 3EOBA 2Q8AH 1ZT7A 4HEPG 2IALA 2NZ9D 3NCFB 2FL5A 3V95A 5IEKB 4XNZB 3T08A 3VXTB 4BKSC 4OZHA 4ZO7A 3EF4A 4M29A 4P05A 4F37K 3NJFA 3QIUB 4FI8A 3QNXA 2CR3A 4X0NA 4G80A 2IFGA 1SVZA 3NP3A 5IHUL 4MXQC 3ARBB 4MDIA 1JWSA 2EH8L 1P7HL 2OJEB 3L3DA 1M2VB 4QRPB 3WDIA 2EYTA 1TF4A 3VFTA 5TE4H 5DQ9A 3L9BA 3DYMA 4QRQB 4XP6H 3TBSA 4FTDA 4TXVB 5GSVA 3T1FB 4ZX4A 3HR5A 4FQIH 1J5OH 1GZQA 3HJ0A 3CVCA 4Z7QB 4UOQA 1J5CA 1JGIA 2IBBA 2NY4C 2OSWA 3BH9B 5LB1A 2YC1B 2VZSA 5KVFL 5EFIB 4HOXA 3H7BB 1NCAH 5D2LF 3B6SA 2XXGA 1WCBB 3REVA 2FNBA 4HZAA 1WAEA 3IDXH 1G7LB 4GIOA 4RGMC 2WLYA 3MA9H 4G8GA 5I76A 1TJGL 4L8SB 4F92B 3ARYA 2BJMH 3O2WL 5L0QB 5ENWB 4ZSOE 4UM9A 3QDGB 4ZT1A 1Q9KB 2EXSA 3K72A 5K69A 3ARFC 4XAKD 5EEVA 3EJJX 1ZLEA 5KAQG 5A3ID 1WZMA 2PWFA 1IQWL 3FONA 3SDXA 1ES0B 1Z3GH 4TRPH 5IFHL 1A4JA 2DZEA 3FTGB 4I87A 2IVFC 2ZOLB 1QQDA 3SBQA 1QLEL 2HT3D 4FYTA 4JHVA 5HJGA 1HEZA 1FBIL 4KKZA 5DO8A 3T09A 2Z65C 3O4LA 4F57L 4JPWH 2VIRB 2O5ZH 3F62A 4BZYA 4J28A 3CJJA 1I7UA 1K6QH 3NOIA 5KG9B 3U82B 3T4AA 1OP9A 2WBKA 3ABMB 3GD1C 1UM6L 1BQ5A 3JTTA 4KNUA 4N90D 4OLYL 5KBMA 3KXFD 1UKSA 4MD4B 4G5AA 1HCFX 4LLUA 3WN5B 1AGDA 1YYLH 4PRNB 1NM9A 1KIRA 5EIQA 2BSSA 3MRNA 5HYJE 1HEHC 4D9LL 1U95B 3QJFA 5A16A 1NL0L 3AQDA 5LNGA 1BAWA 1HL9A 1WH0A 2XN9B 5GZND 1Q72L 3ZTEA 3B37A 1JV5A 1WA0X 2CH8A 4JKKA 2GEEA 2D7MA 3ZQWA 4FXKA 4WJ5A 2FSDA 3VI4A 4DZ8A 3MLYH 5I1DA 3FH5A 2XX0A 5KVEE 3OX8A 2VCOA 4JFFA 1DCEA 2H6UA 1GW6A 4X6EB 5BQ7B 1WRFA 4R6UA 2G75B 2XWZA 4H0HB 1F0LA 5D96C 4X80H 1NGPH 1OAYH 1FUNA 3TIEB 1CQYA 3D51A 3K5RA 3QUMA 1HH6A 4RMWA 3VFWA 5E00B 3H9ZA 5G4MA 3N1GC 4E0RB 1L0YA 1JXGA 3BSZA 2ZONA 3K5SA 4K71B 4U6XB 3Q01A 5JZ7C 3V5DA 1J87A 3AT8A 3BN9D 1K8DA 1JVOA 2CRZA 5A1AA 4Y9CA 1CXHA 2IPUG 3PP4L 4ZOBA 2NNFA 3IWUA 4LU5L 1N0XL 4PW3A 2QVTA 4X99A 5I6OA 2ID5A 3QXDB 5ADPH 4ZS6C 3UTSD 3BMVA 4XOCA 4TOYH 4FADA 1MLBA 1ZD6A 2C7UA 4DH2A 3QA3A 1JZFA 2CHZA 2Z93B 4B3VA 3CFUA 2BINA 5C0BE 3RX8A 2L3BA 5EB9A 2W0KA 4XOAA 4N85A 1GYWA 3H9SE 1WFIA 3QDMA 3DETC 1CCZA 5GRYA 5BV7L 1E8XA 5GS0H 1A7RL 2AV1A 4ZW3A 1D5ZB 5L8LB 3IETB 5B1KA 1MPAH 1HSBB 4Y4FB 1T3FA 3H0TA 4OIIH 1XH3A 3WO4C 2W95A 3QFJE 3UTOA 2NSXA 3VRLE 2H0FA 4JREB 4S11A 3DUSB 1OD7A 4JM4H 4HIXH 2WLKA 4G72B 4HKXB 2CIIB 4K8RD 4J3OD 4X7EC 4PLOB 1OEZW 2C3XA 3R0MA 1WD9A 4WEBH 1BW8A 3UTTA 2EUWA 4OLUL 5PAZA 1U3HB 5IQLA 4BDVB 2N7BA 3UC0H 1GGTA 1J8HE 5BO1L 5C8JA 5EU6B 2EDMA 2JKLA 1N0LB 3D06A 4M1DH 3WJLA 5E9AA 2V7HB 4MQSB 2CJTA 5C6WH 2EDKA 2ED8A 4PLJD 3GIZL 4EI6B 1E5BA 3VFRB 4WJKB 1WBZB 3S6CA 4R2GC 3PU7A 3U36A 3Q13A 4ADGA 3NJVA 2GYSA 4GKNA 4DEPC 3GI8L 4BSWB 3U30B 1VLXA 2J5LB 1NUFA 4XWGH 3C5ZC 3U0WL 3APNA 4EXKA 4G6KL 5DFAA 2Z35B 2ZUYA 3ZDYE 2JJSA 2X28A 4HEPA 2ORBH 5L6YL 2HLFD 1ZLVK 4HJGB 2I07B 1ACZA 3B2PA 1T5XA 1IC5H 3QNZB 4ODTH 4ZXBC 4YSUA 3X14B 2XWBB 1ESOA 3F65A 4P2QD 1MI5B 1XMEB 4XO9A 4NUJA 1IZJA 2EINB 2YAOA 2G2NA 4BV1A 3QCVH 2M26A 4WV1A 1KPRB 1G7PA 4CVXB 4ZTPH 5IGXL 3VXOA 3DTDA 1VFOA 1YPZF 2RH0A 3V0WH 1U41A 2KL6A 4KPHH 4WK2B 5EN2A 3WFZA 2F53A 3QDAA 5FYKH 3MFFA 4LF3A 5B4MC 1A1OA 1GL4B 3APDA 1QTPA 1EK3A 1T7WA 4WTZA 5HGAA 1MHHA 4DN3L 4E9VA 5CU5A 1TQCC 1A7NL 1IKNA 3OMAB 4OFVA 4PTTB 3P9LA 4JFEB 1OTTC 3CSPA 1M1XB 4X7SH 1Q94B 5T5FA 3RGVD 5ID0B 5K1NA 1EHLH 4LFHD 1CF1A 5DEZA 2NY4B 2XT1B 5I18L 2J6EL 4AE0A 1I1AD 4G6AC 4KKCD 5EIIB 2PCPB 4ZFGH 5AYUL 2IH3A 1A02N 4LOUD 3F6JA 4ZNCD 1RPUA 2I7SA 1EJOH 3QAZC 4KY1L 3EH4B 4XN4A 3ULSA 1WO2A 2Y3AA 4E9XA 1MCHA 1QI5A 1OL0A 4NO2A 4Z7VF 4G7VL 1J12A 5JW4M 4XX5A 4ZX6A 4S2SA 2FT6A 5GGSA 4Z7UA 1NCJA 2FIKA 3ARFB 2GABA 4J3TA 2Y7SA 3MAWA 1LDPL 3VI3F 3STZB 3U7YH 4JVWA 4HLEA 1C5DA 2P80A 5HXMA 3NIFE 2NY5H 2BOBA 3AY4C 3IMRA 2ZKXA 5JHAA 1HTYA 3KYOA 1Q9WB 5TE7H 5C07D 4HAGA 2E4FA 5HHXH 3LQAL 3WIHH 3OR6B 1PGRB 2XIIA 2ESVD 3DOHA 3IJHA 4PJ7A 3MRCA 3TXAA 4Y16D 1DQTA 3IAPA 3VTMA 1XR8A 3C60C 1F6AB 1MJUL 3FRPG 5CEXA 1V7MH 3MV7D 3FO0L 1T1YA 7FABL 1U8NB 2WBJC 4FQXD 4NNYA 2VM4A 5FR3A 3N9GL 5I1EH 3EUUA 4DP8X 2EDXA 5BUAA 1QHOA 5IWLA 3M7OA 2LOEA 3U0PA 3KYMB 5J9PA 4IRSA 4DGUA 3C2SA 3IPEA 5D2NE 5KJRL 4KI5F 2WVUA 4PJ9C 3QC5X 3GNMH 3U2SA 2JKJA 3OMIB 5HHNA 3M7FB 4UINL 4WWID 4AEHH 2XIBA 2QSQA 4D9QD 5EU5A 1HNYA 3BWUF 3TJHD 3L1OL 1X5JA 4ODWA 4DKFL 1JRHH 2IPKA 2GVYA 2V2WA 1ID5I 3VW3H 2A6DB 5EC2B 4NUPA 1UXSA 5HJ3A 4H40A 5F7YC 1ZVSB 1SDDA 4N5UA 2W9LA 4CJ1A 4PG2C 4ERSH 3GO1L 2JQAA 5I0WA 1NC2D 3GLDA 2IH1A 3ZQ9A 4GRWB 4M7LL 3GBML 1O6SA 1VB9A 4HC1A 4M43L 5KW9L 5MENB 4KQ4H 1IGYB 3GJFH 2QSVA 4KJQC 3AXIA 3FMGL 4GXUN 2BDNL 3QNYA 3UMNA 2EKSA 3OG6B 3OXSB 4KO6A 4OQTA 1AR1B 2ATPB 4B9PA 4U3SB 4XP1L 4E5XB 3OJ2C 4LLMA 5DWPA 4WHYH 4FNSA 4OIFA 5F1NA 1FYHB 1JZJA 5ANMA 1BAFL 1I8KB 4UIKH 1J9CT 2WZ0A 5GGUB 4BFBD 2DWEA 2AJXL 2PN5A 3GTTA 1XF4B 1IEAB 1XO8A 1JXDA 3MZGB 2PCXA 1MCWW 4JS7A 4X5WA 5CR1A 3QQ4B 4YE4L 3ARDC 3ZE1F 4XGZA 4AUJA 1N7MH 4MAYD 1K8IA 5HHQA 3QUHA 5MP6H 4EIBA 4JM2A 5I6NA 4RZCA 1YJDL 3L3OC 3ALXA 5AD0B 1MIEL 3GEWB 2CLZA 3WO4B 1U93B 3EH5B 2YUXA 2NR6C 4KKNA 1SDYA 3CE1A 4UQ2B 2X0WA 4PCYA 3HE7C 1NTDA 1FNFA 1M6OB 1PAZA 4KXDA 1J11A 2VAAA 1UATA 4ZUVA 3NZ8B 1BLNA 3GXNA 1JNHA 2J8HA 3IJSA 5FM8A 3OR7B 3KBEA 1JI1A 1QO3A 4NQCE 5LAPA 1UZ6F 5EU7E 3BVNA 1RH8A 4ISVB 1JZGA 3QQDB 4NWUH 1S8DA 1B0GB 4L3CA 3A3YB 2VDRH 3DKHA 4TKWA 2AQPA 3K6OA 1ZTMA 1VCBC 1T22B 1UWYA 1E27B 1YEJH 2YAFA 2AVGA 4PGCB 4F91B 1FC2D 1BGXL 2J72A 1D5XA 1R5WA 3DDFA 4R2GB 4R5XA 4HUUB 1L3WA 4DEPB 1CWVA 2HTKD 4QHNA 2AK1L 4XCNB 3C5ZB 1MHCB 2CM5A 5HYJD 4A7UA 1JNNL 2FO4B 3RL2A 3GXDA 4UTAH 1LVEA 4EKJA 4OGXL 4IHOA 3B3IB 2B4CH 3OSKA 4NM4L 4U3XA 1CD8A 4I77H 3QZPA 5E5LA 5GGTH 5DURB 4OCNC 3B4NA 2VN7A 1YECL 1A4KB 5D5MB 4KQ3H 2V37A 4NUGL 1A5FL 1V3MA 3OHXC 4X0KB 3WJJC 5FF6A 2KH2B 3MBED 2CLVB 3ATDA 4GBXC 3LDBC 1VPOL 3G3LA 4M48L 3FHEA 3BE1L 4GSDL 1ZRUA 1QRNE 4PRHA 2J20A 4QRUA 4ZFOL 1LO5B 1ETA1 4X7TB 3WBDA 4Z7QF 3ECBB 3BQUC 3UIZA 1P6FA 1II4E 3NCJH 5JQIB 3A4EA 2NXYD 2HKFH 4YR6A 1PKOA 2JNZA 4JAMB 4B9YA 4QXUL 2DIEA 1BECA 3VTTA 1F3JB 4F80A 1BIIA 4KV5E 1PNCA 2NY2D 4B7IA 4PD4J 3EJQA 1TTCA 4E42A 5AUMA 1NAMH 3V0AC 3VXRE 2DH2A 5C2UB 5EZOL 4P0DA 4MA3B 3DX8A 2CO6A 1MEXL 3WEBA 3LSOB 1QEXA 2EQDA 4FFZH 4F33A 5FCUL 1GS6X 4WIQA 5C0BD 3E3QE 5D1ZC 4OB5H 4KGLA 4XB7A 3H9SD 1JAEA 4XZUB 2ILLA 1IAIM 5JPNC 4JHAH 3IFOB 4RRPA 3DPBA 4LCVA 3MV8A 3BI9X 4PJIE 4UB0H 5EEUA 4ICXA 4DPRA 3WNOA 2ZKMX 3E1ZA 1A14L 3RWJA 3QFJD 3HHSB 1GCFA 4XN1A 3I2CH 3DXAB 2R1YA 5E2UH 1M7UA 1XSJA 3KS0J 4Z8FL 1F3RB 3ESOA 1A1NA 1EEZB 3PFQA 5AW6B 1AZVA 1H6TA 2X2JA 4K23L 1XGPB 4DIXA 2YWYA 5FYJU 1LP9A 1CR9H 5TK2A 5D7JC 5I15L 5DHMC 3FQWA 1IU1A 2XA8H 2RR3A 4ELMF 3CDCA 5HHPB 1TEYA 5EUKA 1QVOB 4F3FB 3LHPL 4GUOA 1J8HD 1THCA 2PYEE 3FQTA 1CDUA 5DZNA 2O5YL 1R1CA 4JO1H 2UZXA 4YO0A 3BSGA 1E50A 2WBJB 2G2PA 1G7MA 2BMKA 4JDEA 5AOMA 4L37A 2CBQA 2V8LA 3Q5OA 2OMVA 4GXUM 4Y2OA 4DPAX 1J8SA 4RMRA 3FT4A 4QWWC 1F18A 3EJCA 3S88H 1KLGA 3UIYA 4PJ9B 1Y1DA 4XO4A 4DO5A 3VFUA 1SN0A 4QRBA 3DGGA 4ZDHB 3WTWA 3QR2A 2O61B 1GGBH 2E8ZA 2YEQA 3TV8A 4KUCF 2HN7A 3Q3GA 1NBYB 4EBQL 3JUZA 5IREA 2GT9A 5ACZA 2FEEL 4ETQA 4YHYC 3D18A 4OUUB 4K5MA 1MCKA 4ZYKB 4NCC1 4OF8A 3BZEB 3TZVA 4ENEC 2RALA 1URIA 4NQDA 1XTMA 2D3JA 4DGWC 2GUOA 5JXAL 2L8AA 4AK2A 4CVZA 2NY1D 3VWKA 1D6VH 2R69A 1NCHA 2MPAL 4LHJB 1OAJA 2AXFA 2PPEA 2CHXA 5JORB 5LDSA 3MREA 4LRIC 2RFXB 2VR7A 5GRXG 3GSNB 4U7KA 1MW3A 2CDFA 4B7LA 2WNXA 4DNLA 2OMYB 5TF1H 5KYYA 1M2OA 2ITCA 3AG3B 4LO9A 1VA9A 5C0CE 1BZEA 1NGZA 1WBYB 2X5PA 2ZKHL 2E9GA 5HHOE 3OD3A 1OAKL 1FNEA 2I69A 5L4IA 4U1NA 3EGDB 3KPSB 5T1LD 3R7RA 3NN8A 5DHDA 2C1OA 5HY9A 1H5BA 4YHNA 3DOSB 1D5BA 1BZ8A 3NSJA 4GPVA 3ABKB 2JLPA 4PJGE 3MV9B 2H45A 3QEQE 3OJVC 3NCYS 1SJMA 4F58H 3O8XC 1VFMA 1USZA 2VR9A 2DQDL 2VLKB 4PRDA 1IC4L 4ZFFA 3LKQA 5IB3B 2Z0UA 3QFDB 2EE3A 2JJVA 2ICWA 3HB3D 4JO4H 1HILA 5HDBE 1FL6B 3V4VH 3HE6D 4WU7B 5B21A 4PTUB 4RMSA 5J1AA 1SJXA 3IMVA 3GXMA 4Q58C 3TWCL 4PJXE 3HE7B 3VMPA 4JANB 3V6OA 1U8QA 4BQ6A 5I23A 1FNLA 2R1XA 4R83A 4XNAA 2X2YA 2BX5A 3B7UX 4GI6A 1I9RL 2WXGA 2NZ9C 4NKMA 4P2AA 1T7VA 3QQNA 5JHDA 4D8OA 3DIVA 5E4EC 5DSCB 1LO4L 4KNSA 3G5ZB 4JZJA 1QSFB 2XU9A 2XVKA 4HK0B 3MROB 3GMQB 5TGBB 2H8PB 4JG0L 3T0WA 4WNSA 4H8VA 2Z31D 3IXTA 2WKLA 4OJCA 1E5ZA 2XQBL 3DVNB 2BVPB 4X98A 1OHQA 2Q87A 3GRWH 5FO2A 1TZOA 1UWEL 1PZSA 4FLOA 3EH3B 4CW1B 3ZE0E 1Q8MA 1SFHA 4QRTA 4WK4B 2GK0A 4Z3EA 2H0PA 1J5HA 1ZEAL 4DT2A 5C0GA 5IFAL 3CSBA 2AEQL 3UTZA 3RVWD 1KTJA 4R26L 1YEKH 3AGVA 5D4QA 4QLRA 2IAMC 3CN1A 3FSZA 1UA3A 4EKXA 3MJGX 4IRJD 1DBMH 3GS0A 4KKBD 2FQEA 5K9QI 4P48A 2C4FT 4GBXB 3WFDL 1U58A 3LDBB 3RPBA 3JTSA 2W0FB 3W0WB 1P5UA 3KWWA 5I26A 1IBGL 3L7FA 3ZMRA 3BQUB 3FCSA 1S9YB 3RL1B 4C57C 3MRRB 4RVBA 2NUPB 3PWVA 5BZWA 2HT3C 5D2LA 4ZOCA 1OGAE 2LE9A 1AH1A 3DVFA 4RFOL 2AK4E 3PWPA 4LKCB 1MJJB 4CKVX 2OA9A 1DJSA 4V33A 5D1ZI 4BBWA 3NK4A 2X41A 3U9PL 1N64H 1PKQB 1R3LB 1UENA 5CP3H 3N5AA 2IH8A 5D1QE 4EDWH 4L8CB 1OTSD 4HJEA 3SQOL 2YPVL 5D1ZB 5FB8B 2Y2WA 2B9AA 3PFUA 4GT0A 5I6PA 2DL9A 3CK0L 4MAZA 5KYXA 1NPNA 4NJ9H 4GLRI 3TCTA 4LPXA 3WOVA 3AJ7A 2YGQA 4UIMA 3QUKB 1FCGA 3CFCH 1KGWA 4I2XE 2R8SL 4MA7H 1K2DA 2ZOKA 4HAFA 1T04B 1ICTA 3BCFA 4OLZL 3UJJH 3KZ8A 1AO7E 1PLAA 4U33A 2XTSA 5FW6A 1QI4A 1CO1A 1OZUA 1JF1B 3KGTA 5ECGA 2EDLA 1FFOA 1A3LL 1QFUL 2IOMA 2QPSA 3MR9A 1BOGA 5D7JB 4X4XB 4KMLB 2BPBA 1S9WA 4PR5B 4PWEA 3CXDH 3RDTA 3TBBA 5E7FA 5C09E 1FRGH 3N42B 2VITB 3EYOA 4X6CE 1LE9B 5AAPA 1FFNB 3HI5H 4L3EE 4JL1A 3LIZL 1TVBB 1EZUA 2PTUA 4HUMB 1YEEL 4PB0H 3HS0B 3NDZE 5FEBA 2GBTA 1HI6B 4P23D 1NKRA 4PJDF 1RHHA 3PNRB 1XVSA 2WB7A 1N59B 2X09A 2YXVA 1IC7L 4NPYA 1EFXD 4ZOAA 3P30L 2X1WL 2A9CA 3LRSA 3DV4B 3DDGA 3NMEA 4K2UH 5B39G 4YHYB 2C4FU 2J43A 3K8LA 4FFVC 1IIIA 4O5LL 3QISA 3JV5A 3HZVB 4XO5A 3SOTA 2XFGB 5J3HD 4IBVA 3MRDA 4FI6A 2ATKB 4WHYG 3DO7B 4BELD 5CZVL 4QOKA 1R46A 4OSUL 1OM3H 2BP5M 4CBPA 4AK1A 1SDAB 5TQ0L 1RXLA 4UZUA 4N9GA 5CKGA 4WY7L 2DLFL 2X3CA 2H26B 1QRND 1CE6A 3K6SB 2FT8A 1AMXA 4MZ3A 4ZO6A 5HGBB 4PP2A 2CCWA 3KEHA 4U1LA 2VL5A 4P4RA 3S3DB 3X12B 4OD1H 2QT6A 2WLJA 1PZ2A 4K8RC 2VSKB 3SKJL 2J25A 3SCMB 3LKSA 2XPYA 3AS2A 2Q6WB 2RCSL 1A9BB 1BG9A 4JQIH 1EJ6A 3V0GA 2Y7QB 4FTVB 2H7WA 4X6DB 2IGTA 4WGWB 2XWJB 1DQJB 3VXRD 4WHTB 1RPQA 4MMXA 2ADFH 1VGEH 4YZFE 1J88A 4KTEH 3ZKQD 4XMLH 5BO4A 4WKZA 3O6KL 4YHML 1KTDB 2X4TB 3O8XB 5E5MA 3STLB 4XB3A 1GJUA 1EGJL 1BSIA 3PHSA 2IGLA 4NENA 5E8EB 3RFZA 3QXUA 1L9SA 3E9UA 4RAUA 1UM4H 3MRFB 5DR5H 5GGVL 3CFEA 1PFCA 3FPXA 3ML9A 1WC7A 1WIPA 3KHQA 5E94A 4O00A 4QTHA 1VZGA 3KWVA 4WTQA 3C2AL 5AVVB 4BFNA 3QCUL 1F02I 2K4WA 3BAEH 2YAQA 3UTQB 1F4HA 2X4OA 4PQXA 2C1PA 1SJHA 2AJSL 5TDOB 3I6KA 4X4ZA 3M45A 3CBKB 3OF6A 5TTRA 3PE9A 1WQVT 3FDWA 5TDPA 4N6RB 3UYPB 4LCYB 2OAAA 3SY0B 5I16B 4LSUH 4MS8D 1E9OB 2V3DA 3PL6A 5E4EB 1NOFA 3EOTL 3NESA 4KAQL 1GOGA 3VVWA 3Q1SL 5C0ND 1U2HA 2ADJB 3ZTNH 3VD4A 5FYLH 2VDKB 4KFZC 9PCYA 3FN3A 4J3WA 4XPBL 1OT1A 4HJ1A 5F70A 1QBLL 2JJTA 3SE6A 3ZY7A 1KC5H 2QGCA 3VI4E 4LVHC 5D8JL 1ZV9A 4RZKA 5JOFB 4PN6A 1OLLA 3P3SA 4MJIA 2MQCA 3RGVC 1RZGB 4NZDA 1XGRA 2VDMH 5D5MF 3HRPA 3L9EA 4Q6IA 1I1AC 4KKCC 4WDIB 3ULVE 1TG8A 3IS0X 1L9MA 5EWIL 4LIQL 1PZ5A 1Z5HA 4FYSA 3CFBA 4GINA 4LOUC 4X5XB 2IAMB 1ETZB 3IJ9A 3BGMA 4L1DA 3FAXA 4A7QA 5KYUA 1E9PB 1GZHA 1G4RA 3GSUA 4JNXA 4AEIL 4LHQB 3PAYA 3EYQD 1FORH 5GHWL 2XBDA 3PABA 1O7DC 2QVMA 1SJVA 1G6RB 4BWWA 3WEAA 3BLKA 3MFGB 4P04A 4GO8A 1PZ3A 3QHZH 3V0HA 2UWEB 4L4TA 5DS2A 3WY1A 1T21A 3L6FA 3TBCA 3CZLA 1FNGA 4L1BA 3SSGA 2GW5A 5C0CD 3FT9A 3WIHA 3LEVL 4GIPD 4Y16C 5HHOD 4LESA 4MCYA 2AP2A 2EO7A 3QDME 3L4CA 3GKZA 4J6RH 1KCRL 3ZPDA 4JE4B 1IAII 2L04A 4C54A 3UJTH 3AY2A 3RWIA 3BJ91 4HH8A 2DQTL 4FFYL 4FQXC 4XPHH 4A2HA 4HPYL 1Z9MA 2DQCH 3QEQD 1E9QA 3MXWH 4BZ1H 1OIOA 3NFSL 4ZMXA 1HKLH 5C0DB 2FJFA 5J56B 2X6MA 3EOAB 4OCRL 4JB9H 4LSVH 3GHEL 1DLHA 5H8DA 1AGBB 4W9JC 1VAHA 3LQMA 3C6LC 4I0PA 4A63A 2N7AA 4FLRA 4YMPA 4G3YL 4MMZC 4NWTH 5I24A 1PCXA 3RVTD 2Z7ZA 3D3VE 2DI8A 2VDLL 2KT6A 3WE6A 4FNTA 5F1OB 1P2CA 5AW0B 3RX9A 5I8CA 5MERB 4UQEA 5E56A 3V79C 4UDTA 3K6IA 1MWAH 2UUDH 3R18A 1MUJB 3CUPB 4BZ2L 4BFJA 35C8H 2CDGA 3JZYA 2ZPKL 2ZTBA 3QXAB 4HS8H 3FQUA 2W92A 5JMOC 1NLDH 5L4FA 2CO1A 1IQDA 3I74A 3ARRA 1LNUA 1VADB 3B1TA 4BK5A 2YD2A 2A2QT 1TT6A 5FUOH 5IEHB 2XZZA 3GJFA 3HNTL 4UILL 1H3PL 2IPTH 4XNUH 2WXLA 1C9SA 2ENPA 3TBTA 3WS6C 4KGJA 4XZ4A 4B3EA 4TQ8A 3UTSB 4YS4A 3NJJA 4F2MB 3HNVL 3G04B 1AKJD 5MEOB 3IDJB 1N5AA 1S7XB 3TH4T 3H3PH 3WGVB 3BFQG 1BX2A 5E8DH 5BUPA 4JGNA 2XXCB 5I19H 1P7BA 2C3HA 2VR8A 5TJWK 4MXVE 1JXJA 1EAPA 1YEFH 5LBSH 4MAYC 2AEWA 3F7YA 1JGDA 2Q7AA 4QRFA 2ZJSL 4XN9A 1P4IH 4PJHA 1RULH 3VXSA 2HJKA 3CZSA 1YN7A 4Z7AA 4MQ7A 1E4KA 3MCYA 3E6HB 1QLRB 4OLVH 3VE0B 1GXEA 1KPUB 5D7IB 4MAUH 1U4FA 3TT1L 1MFCH 1OGAD 4NQEA 4YC2B 5EPMB 4PVNA 5AKSA 2AK4D 1XZ0A 3SE9H 1KEML 1NGQH 4HUCA 3V0JA 3O6LL 1I1RA 3ZL2A 1D6EB 2WXQA 1R5VB 2DYPB 4W9LC 4Z7UE 5D1QD 2GTQA 3TA4D 4N2BA 3QNFA 3DSNA 4FULA 2X0VA 4ELKA 3W9DB 2BXZA 3PGDB 5EO1B 4YLCA 2HTKC 4WF7A 4KXZH 4HX1A 4NKQB 1QZNA 1H8SA 4IU3A 3WFHB 1GY1A 4XMUA 1V3KA 2FQGA 1W6WA 2X0UA 4UTAA 2WLLA 1AO7D 3CFDB 3TO4A 2JE8A 1X6NA 1GZPB 1TLMA 2H6PA 3BIKB 3DROA 5GRZA 3EFFB 2B7DT 2WP3O 1CD9B 1TTFA 3KPOB 2BXYA 2VL4A 3QUYC 2APXA 3NVQA 4HZ1A 5INDA 1KYAA 5GGTA 3ZOAA 2EDOA 1SEBB 2HG0A 3GGWA 3OAZH 3SE3A 3VXNB 3D50A 5E99H 1DZBA 2YGPA 1MY5A 1JWMB 3MBEC 3OLIA 1DBJH 1AIZA 2OMZA 5T1DL 3OQ3B 5C09D 4WO4C 3CLWA 4RDBA 3S34L 4M7ZB 1H8NA 2WBXA 2OTWB 3U1SL 5KS9B 5D93C 2ADIA 1FH5L 4NI3A 4L3ED 5JIMA 4ZAKA 1JTTA 1T66D 1HXYA 3D0LB 3O9WB 2AGJL 3K71B 4MXWL 1SF5A 4JFYA 3SDAD 3GT6A 3TV3L 2NXYC 4W9GC 1OAQH 3G6AB 4OJFH 4LVHB 4EI0A 2VT0A 3SDDD 4I3SH 1V55B 3DVIA 2P8MA 2NY2C 2VSDA 3KJ6H 4Q89A 4HIIB 2G0LA 4PV9B 5GRVK 2ZNXA 2DLIA 4OZFB 1CQKA 2E27L 1I1AB 3I84A 3RPIB 2RA1A 4WW1B 4UQIM 1HQRA 4GKSA 4M62H 3D39A 4K7PL 1RJYA 4HULB 2BSED 2VO8A 3S5LB 1QASA 4P2RA 3ZYZA 4GAFB 4YHOL 2WXJA 4HIPA 3EJPA 4WO0A 1YC7A 1FNSH 1GKOA 1QP1A 3QE5A 1GHFH 4Y5YA 5DDHA 3O6FD 4HS6B 1E6JH 1GOFA 4FQJH 3L1GA 2QSCL 1ACYH 5CIPB 3BP7A 3Q2VA 5I1CH 1I85C 2JKNA 3IDYC 3VGBA 2APFA 2VLRB 1A9EA 3DOIA 3FH7A 4JY4A 5K1JA 1I1YB 5AB1A 1TVHA 1X5HA 1XSKA 2XG5A 2HKAA 2D31B 5GS1A 5D55A 1WIUA 3PUUA 2VNCA 2X4RA 1OSEA 1ERNA 4Y5XB 3Q6GH 2YK1H 2AQTA 3UABA 4FHKA 2Z91A 4IBUA 3MV7B 1F4YH 2Y07H 4TL4A 4UM9D 4Y1AA 4FQXB 4P4KA 4IKNA 4J2XA 5D6DA 3R8QA 3FT1A 3IFLL 4A2LA 3AWGA 3W39A 3K2IA 3NAAH 3NRFA 4X9IA 5I73C 1FE8L 1A6UL 3QJOA 3SDCD 3N40F 2F08A 5LLIC 3OL2A 1X7QA 3RWGB 2ALWA 3T6VA 2GAZA 1OWRM 4XHQA 1UT9A 5T1MB 4BA0A 2DMCA 3C6LB 4HGWB 1SF3A 2O5NA 3O41A 4MMZB 3O4LD 4JZNB 2BIOA 4HPOH 1AD9B 4ELMA 3L4TA 5IVZB 3FHQA 4OKVA 1TZHB 2CXGA 3MLRL 4G1MA 4U0RC 1T1WB 4HXBL 1Z2KA 1LK2B 4JPQA 1MFBH 4LNRA 3NJLA 3JVGA 3A24A 2B3RA 3IKKA 4AQAB 4N1HB 1LEIA 1WEJH 2VUYA 3ARGB 4Q52A 1AS7A 2NY1C 1U4EA 3BFWA 2H3NA 2R29H 4N3TA 5FXCH 4XNQA 4PJFF 1VGKA 1W8NA 2WAQA 4HGKC 4YAQA 1F8TH 3QYNA 4MNGE 2HH0L 1SPDA 2AW2A 3HC4H 5LGHH 5AKRA 3VFMA 4F93B 1CFBA 1UD3A 3DURA 3T2NH 4GG6E 4NC1E 4XVSL 2C3GA 4JKNA 2MHAB 1ZSDA 3NQIA 2UUDK 5BRZA 4JO3L 3QO1B 4MCZB 2VDKL 3GHBH 3ZDXB 1NGWA 5C6TH 3UADA 4UOW1 3PGCB 3HG5A 4N86A 5DJCA 4UV4L 1HAUA 2CKNA 1ADQL 3RFRA 3ARED 3F58L 2VLLB 1G7HA 4MZ2A 5DI8A 5H4ZA 3TNMA 2X4SA 2WXHA 3V6FB 1C12A 1MHEB 1KCUL 2CJUH 4PGBB 5GRJL 4G42A 4DGVL 1EV2E 4ZMYA 4KKAD 5DVLA 3HOGA 4LPTA 1F86A 2EVHA 2IWGA 2V2XB 4MAYB 1R33A 3KS0H 1YNLH 3HB3C 1I31A 3BP4A 4ZSOB 4GAYA 1ZTXE 4EMZA 1D2OA 1AMYA 2W0LA 3HE6C 1GIGL 1G5GA 4X7DC 3CHRA 3PRZA 4J23A 2J56A 4ANVA 3FU9A 4IBZA 3V4VA 4L1LA 3SB3A 5EO9B 4GW5A 4X6DF 3ZZLA 3UTTB 5KJ4A 1ED3B 3B7TA 3I6GA 4FLHA 4JHUA 3STBA 4AXWA 2YD8A 4XAWH 2AKRA 5FA3B 5DJDB 3Q8FA 1J1OL 1G6RL 4QGYA 3RTQA 1KIQA 4P59H 2Z4QB 1F1GA 2MMXA 3QDMD 4L8BA 3D2UD 5BJTA 3MV8E 3MSPA 4AENA 4E9WA 1CGSH 2I9LA 4GW1A 4G6MH 1BM7A 1CE1H 1Z66A 3ILPA 3QHFL 1QRKA 3WLBA 1JFQH 4OM0H 2Z31C 4YNYA 3LKPB 1S3RA 3GSWA 2BP0A 1SM3L 5F44A 1XD1A 2I60H 3WNJA 4PJCB 5AOIA 5HYJB 3TYGL 4UU9B 4LBEA 3BH4A 4ZS7H 4F7EA 4B0MB 4BH8B 3DNKA 4KUZH 5HPMB 4AM0Q 1CLZH 1V54B 3UTTD 3FQ4A 3DRTB 4ZMPA 3D3VD 2R1WB 4OLXL 1MFEH 4LQ1A 4XP5L 3QUYB 3FO2A 3WMPA 2IO5A 5EDSA 3M17A 3DMMA 4IRJC 3M1BB 2BVQB 2FX7H 4JDVB 5TDNB 3SGKC 1CVSC 1NCDH 4KH9A 4CRPA 2R59A 5I1GH 2IDUA 2X70B 4WO4B 4Z3TA 2EIDA 5DQJA 5L9DL 4QJ4B 1FO0L 5D93B 1V3JA 4W6YB 3IPFA 1MCSA 3L3GA 4ZX3A 1MRCL 4HJTA 3OKOB 4NP4L 4XCEB 3UDWC 5ID1B 3EBAA 1FZKB 2R2HA 1A3ZA 1X44A 2XZCL 4GEIA 3OAZK 1ZIBA 3JSSA 2HCZX 3EADA 1ROWA 3CX5J 1A6WL 1VKXA 4NQDE 2P5WA 3LN4B 5FO8B 4R7VA 1N26A 2RHEA 4PJBB 4MQTB 2OJZH 5HYSB 2ALAA 1X9QA 5K59F 5L88L 1OTSC 1CBJA 1WISA 3WHE1 2H32B 5IOPB 3H9SB 1KG0A 3P0YH 4GS7C 1KGYE 4Z7OE 2OMNA 1ZAGA 3QULA 4ZG1A 1KGIA 4N0FB 3BUTA 2UWEF 3O3DA 1UEMA 3QFJB 1BM3L 1Z1WA 3FFCE 4PIRF 4MA1C 3TS8A 2XN1A 5IMMB 1BXXA 2YN3A 5CMAA 3DBSA 3KWUA 4OI8A 2X6AA 5CUSH 3IDYB 3PWLB 2IBZY 3VVVA 3VD2A 4JRLA 1S6NA 5KSUA 1IQWH 3NBNA 3C6SA 3IXAA 2HJFB 5B8CB 1S2EA 4NN7C 2IOIA 4HALA 4YX2L 5EU7C 4P2OA 1PLBA 1J8HB 1GC1H 2P49B 4FAAB 4K8RL 3JT0A 5I2IB 1QLEH 2G3MA 3NP4A 5I5JA 1J8RA 1SEQH 4TNFA 4LSQH 1C1EH 4K5OA 3UBHA 1CPUA 3CWGA 2ZP9A 1E4HA 4OGYL 4WUUE 1FIEA 5I73B 4AM0A 4U3HA 4HK3N 3V6OE 2J2ZA 4GSQA 4P23C 5TF0A 3T0AA 2YBRA 2GC7C 2VXVH 4BCXA 3IAGC 1PIGA 3IVKB 2XQYA 2AQ1A 5AVRB 4GRLA 1JZ7A 1CJYA 3BKJH 3UBXI 4F8LA 3ZDYB 3G6JB 1KZQA 3O3AA 1IAIH 3PIQB 4EIUA 2QQKL 1NFDE 1CGWA 2YD7A 2NLJB 5FHAL 2FRGP 4U0RB 3ULVD 1EZLA 3BAWA 2FX9H 4S1QL 2HTLD 2BNRA 2YD1A 3O0RH 1AP2B 4NLAA 4AE1A 4IBSA 2NY1B 2P5EB 2Y25A 3QQXA 4K7FB 1P5VB 3EDDA 3IDIB 4IRSD 4PJDA 1RZIB 3C9NB 4MWFA 5C1MB 1B0RA 3HHMA 3H6AA 3OGCA 3O3BA 2JCWA 2FBJL 3II2A 4M4PA 3UBFA 5F3BB 1U92A 5KUMA 1G1YA 2P43B 3PHOB 4BWUA 3BZDA 3LEYH 1GS8A 1HIML 1NC4A 3TFBA 1IBBA 1IBFA 3D5OF 3NYKA 2PR9A 2HRHA 3AXLA 3I9GL 3U25A 4BKLB 1I4FA 1K3IA 4NQQA 3VFPB 1L4IA 3TA3A 4RGNC 3M07A 1E67A 3S4SG 3OKLA 2H3XC 5IB1B 2OLDA 5F9DC 3RUGA 3V0FA 4GO9A 1J10A 1JMXA 2OL3L 1ZK9A 5E9DE 3PP4H 2JJUA 5FO7B 1N0XH 2HSIA 3E3QC 2J73A 5FK9B 4PD4K 3BFOA 1GY2A 2JXMA 3UACA 3P40A 4J7RA 4Q4IA 4X6BB 5DVOA 2ZWZA 4PGEA 4J3OF 2WKOF 2XA3A 3HE6B 2NYKA 4XXWC 3KDMB 4MB3A 4AH2B 4BXVA 3PWPE 4X9YA 1T6BX 2ICEA 3OKEB 5DJ6B 3O2DL 5PCYA 5BV7H 4I4WB 4TSBL 1A7RH 4DCQB 4KVNL 2D0HA 4PRIB 5C70A 4H1LB 2GBVA 3GXFA 3Q5YA 5GGRB 2ZSWB 4R7NA 4RSYA 5HDRA 2CO3A 3D4GA 4D2NA 4R4BA 1VFAB 2AJZA 1UH4A 3ARZA 4MS8C 1EXHA 1T1XB 3AITA 1XX9C 3D4CA 1YCSA 4IW4C 1LILA 4TULL 1IGFH 1ZGLA 2GJRA 3K8MA 5E4IA 3KPQA 4RA0C 5SWZA 3ZHDA 5C0NC 3CN4A 3SYCA 1IJ9A 3MX0A 4MMYA 1GTNA 2WQWA 1TMCB 2YRZA 2Z31B 3IDGA 2YD0A 5L7XL 4CMMB 4P06A 4D0DA 3KPRB 5F88A 1U8OA 4ONHB 1USQA 3GIZH 1JCVA 5E23A 3MRBB 3N91A 4IYKA 4PJAF 2XWXA 3ZL4H 4HUVB 4GSRA 4ZNEA 3RNKA 1INQB 1PLGL 4F9LC 3U0WH 2WIIA 5EBGA 4YDKL 4AVIA 1UG9A 3NJKA 2F8IA 3NSDA 3QZWG 3VMOA 4A7VA 4V11A 5KS9F 1F6LL 2QQNH 1AQMA 4FG6D 5L6YH 1DN0A 3MRIA 4IRJB 4ENZA 2EDBA 4XCCL 3VJ6B 2FHFA 3DBXA 2D9CA 3KLDA 3BP5A 4PREB 3DJTA 3MLZH 5G2NA 2BFGA 3GIVA 3V4UL 3WV0A 4JJHA 4GAAA 5IQ9B 3HC3H 4ZXBA 4M4RB 4WWOA 2OMTA 2AQSA 1MCRA 3KH3A 3BAXA 4IGBB 3P4NA 3EH2A 3WKPA 1W0WB 3JYBA 3EH1A 2HJLB 2R0WL 2O1AA 3KLSA 4QPEA 4MRBA 4IRZL 3SKOB 1SMAA 2JLLA 5EOCL 3OXRA 32C2A 3DUHA 5DD6B 3OAUL 5JNYB 2MQ0A 4YIQB 1DE4B 2RQ8A 4JFDE 4QOKE 5AW1B 4N8VA 3TJEL 1YA5A 1A7NH 2VTFA 4KOBA 4U3CA 3M8OL 4M6ML 1RURH 1LEGA 2AJ3A 2B16A 3WFCH 4DJMA 2DWDA 3TNNA 1UZ8A 3L3KA 2R2BB 5IVXF 5CFAA 5IJVA 2ZIDA 5I18H 3QDHA 4OCYH 3Q6FB 4U6VH 5DCCA 1PQZB 2X12A 4RWYH 3PGFL 1RJZA 2OCCB 4XCFL 3CFJA 2PW1B 5AALA 3RG1C 4ONOA 4C4KO 4G7VH 4PJ5B 5FHBH 3NH7L 3RVTC 4OU3A 1BWWA 4HIHB 3FQXB 1MAJA 1NMBH 1R19A 3KW8A 3BRFA 1IFGA 4OTXL 1QBML 3MLXH 1Y6MR 2DOCA 1JUFA 1NAKH 2JKTM 4NN7B 2RQEA 5A6LA 3VDCA 4S10A 4YHKH 3WIIL 5IHWA 1RAMA 1MVUA 1F45A 2HAZA 3AY4A 3MV8D 2O4EA 1LD9B 3OKNB 1UXMA 4AGQA 1CGUA 4LAQH 1H6UA 2VQ4A 2EIKB 2IWEA 3KBPA 1YDPA 3PP3H 2VE6A 3T0EB 3GB7A 1JVLA 1YNTA 3UZEC 1R24A 2JTYA 4BD4A 1G9NH 4JFQB 1SN5A 4P23B 3C60A 4D0CA 4K3JH 2OZNA 3FO0H 3K7UA 4I48B 1M4KA 5GS2D 1E8YA 1KBGH 4IS6A 4APXB 1CFVL 2ZD0A 1OB1A 5E7BA 1OAUL 1Q9LA 4JFOB 3WDJA 4APQD 2Z9TA 2G5BB 2GJZA 1XF3A 1RVFH 1E6OL 1T83A 2E47A 2PPDA 3MUHL 2GSIB 3HI6L 4BQ9A 1MHPH 5IMKA 4DEUA 5JW5A 4I0KA 1AZBA 2OSYA 4FQ2H 4MHHG 1BQHG 2YAPA 2HUHA 3B83A 5T3XL 3AM8C 1OY3B 2H0EA 3QS3A 2A9BA 1P7QD 4XCYA 1EMTH 3L1OH 1HSAA 1U8PB 4E9LA 5FYKE 1GAFL 1WTGT 4GFTB 1ZMYA 4ICWA 4M00A 4QLWA 4H88L 5KVEL 1G7QA 5LBSA 4NLHA 4XC3L 1MJ8L 3EO9L 4QXGL 3QG6A 1QRNB 4WZ9A 5J6HA 3T0DA 4MJIE 4MS6A 4I18A 1JYNA 1AC6A 3S3SA 5J1TC 4PUBL 3FU5A 5E8NA 3EXLA 4XO8A 5KSAD 4DUXA 4IBWA 3S4SA 3CDGA 1KCSL 5CBEB 3DTXB 3ZXAC 4Y4HB 4PG2A 4RGNB 5FO9B 2I5YL 5KW9H 3MRPB 3QRGH 2JCCA 2BVEA 4E9QA 4NQDD 2QZ5A 3VXRB 2ARJQ 5E1HB 2BNQE 3FMGH 3TCLB 1AYOA 2CNYA 5DRNB 3GMRB 3LD8B 4O2CA 3VWKD 5D1QC 3LJ3A 3FTZA 1TKWB 4GRMA 1MDTA 1S7RA 5I82A 1BAFH 4NZUH 2CG9X 5GSRB 4PJIB 5CXPA 2OW6A 5JQ6L 5GRWA 4N8CL 1TZ8A 3RURA 1THAA 1ZVNA 3MKGA 2AXGB 2CD0A 3ARDA 3K0YA 3QIBA 5IVNA 1HHGB 1X5LA 1HH9A 5FKPB 4W93A 4WSKA 2VWEC 2A6IA 3DRQB 4PM1A 1MIEH 1PF3A 1NPUA 1UWFA 3L3OA 1JCKA 3I9IA 1UH3A 1YC8A 2IMNA 2NR6A 3HTLX 4HUXA 5E08H 1I7RA 2NNXA 3B7YA 3VCLB 2DQUL 4CMHC 4CSTA 2CBPA 1NCTA 5JW4Q 4ODUA 4PJCF 4JHBA 1ZLSH 4NKDA 2OYKA 1T66C 4LCCC 4OD3L 1BYOA 4WUUD 4F8PA 4K9EC 4ZMNA 4FZ8L 4ZPVA 3SDAC 5DF0A 4KRPC 3G5YA 1BZ7A 1EHKB 5IV2A 4WFHE 3E8UL 1DUZA 1G0XA 2DEWX 4LZKA 3SDDC 3VX0A 2JI2A 4JO2L 4AQOA 4PRPE 4I5BA 1C08A 1BGXH 3LZFL 3WFEH 3WYRA 1MCBA 4LP4A 4S1RH 3QZWA 4JRXE 1I9EA 2IADB 5EBLB 1ASQA 5D72H 4O02B 4L29B 1CGXA 3VFOA 3OC5A 4ATWA 5DJXB 1DLFL 4FP8H 1F4AA 2ITFA 1V5JA 1CDIA 2G4EA 2Y9RT 3KL0A 5DUBB 1HHIA 3N41B 4OGXH 4M1CD 2GTZA 1I3RB 3FRUB 1K5WA 3AQZA 3QUXA 4UV7H 2WLNA 4DGIH 1ECYA 2IANA 4BRVA 2EUZA 3UP6A 4QCIB 1B3IA 1YECH 2WZAA 5CILL 2RJMA 5KSVA 3MUUA 4CAGA 1A5FH 1D5IH 3VB8A 1P1ZA 1O9WA 5CEYB 3EFOB 5K9OB 2ARJA 2APTA 3RI5K 3EJUA 4PJBF 2DD8L 4JZOA 2NNAB 3WXVH 3A6BL 1JF5A 1AQ8A 4RMVA 5DEFB 5C0CB 5IB4B 1FSKB 4UNVA 4A67A 1OT2A 1QYGH 3ENEA 3LQZA 4NZJA 5CJOH 2OSXA 1I53A 4HETA 4H0LC 4ABUA 4GW4B 4LPVA 4XNXL 5E9DD 5EUOA 1T0MA 1I9JL 1ULVA 4Z7WA 3KDPB 5I0DA 3VRLF 5EZOH 5TQ2L 4N68A 1MEXH 2WXIA 3H2QA 2LLNA 3HI1B 2W8CA 1JYXA 3PHAA 4YXLH 2DQJL 5FFGA 3P3TA 2JQZA 1JHLL 2FGZA 4NQEE 3MODL 3PWPD 3IKCA 2QELA 2A6JB 1AD0B 1CICD 4PJXB 2N01B 1NEZB 5J7CC 1BP3B 5JPNA 1UWGL 4UBDD 5IW6B 1D5RA 3FOMA 3KCPB 2IQ9H 1GH7A 2FX8L 3T4AC 2XUWA 2EEAA 2HKHL 3KG5A 4FA6A 2WV3A 5BZZA 4AQEB 1QLFA 1A2YA 5D6CB 1MW0A 5J6GB 2PWEA 4M61A 4PU2A 1XEUA 4A6YL 4NRZB 3VG0L 5HYQB 3KLHD 2DBJA 3ROLB 3QEHA 1DFBL 3KGUA 1D5MB 2DJSA 1QPPA 4UT6H 5DLML 4JDTH 2R29A 2W1NA 5FC9A 1FZMA 5B1BB 1WUNT 3MOAL 1E43A 1O7SA 3ZDYF 3G6JF 4R7DB 2BSRA 5TK4A 3I3EA 1D7FA 1VACA 1MCFA 1CXKA 1KYDA 2PWDA 1OSPH 4NN6B 2CK0L 4G9DB 4P8QA 4U6HA 3HPLA 2YPLE 5AVUB 3MNMA 1BQHA 2V7NA 4NM8L 5LAXA 1KXHA 3CPLB 1W72B 4XVOA 1A6ZA 1A47A 1OB0A 1P7KA 2WVVB 3RDTD 3OKKA 3PP3K 3SGJA 1ZANH 3QI9B 5AZUA 3SKNA 4PJFA 1R34A 5DHVB 5CEZH 3SGDH 5BRQA 4D8PB 3EGSA 4QY8B 1BFVL 4EBQH 4KKAC 1JWUB 2R23A 3RVXD 3GQFA 1CZ8L 3AU1B 4YZWA 3ULUL 2K45A 3LVTA 4PY8I 2QSTA 4NQTA 1JHTB 1XHHA 4NQVA 3HAEA 5IESL 2XWCA 2V2TA 2CBMA 2GSGB 5GQBA 1S5HB 1SY6L 1KCKA 2O26U 1UVQA 4Z76A 5JXAH 1XBDA 2C34A 3DHMA 2W91A 3DARA 3LN5B 1PDKA 4X9HA 5GISL 4B5ZA 5IHZB 1WYJA 3V5HA 1FL3B 5L2KB 5SX5K 1OGAB 5KANG 1A65A 2AK4B 3D39E 5I1AB 1ZLDA 1UD2A 4KRNA 4LGRB 2H41A 2G9HB 3CXHK 5D7LB 2O6PA 5E70A 4P2RE 1D7BA 4JFDD 4QOKD 3TT3L 1CDHA 1TPXC 2VABB 4QKTA 4JRYA 3CZEA 5CSBA 5GS0D 2AMUA 4C83B 3K80A 1TTRA 5FA4B 3WUWG 3VXPB 5AW7B 3WFBH 1U91B 2VB5A 3MTXA 3NIFF 2AZAA 5ICZB 1Z0NA 4G8FB 3N3EA 4HH9A 4PCTA 4QXVA 5C0FB 4CUCA 5DD1H