4BKTC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
137
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 137
sequence length 140
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bktC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bktC01
4B95C 1LQBC 3ZUNC 3ZTDC 3ZTCC 4WQOA 4W9GC 1VCBC 1LM8V 4BKTC 4W9FC 4BKSC 4AJYV 4W9IC 4W9LC 4W9EC 5LLIC 3ZRFC 4W9HC 4W9CC 4AWJC 4B9KC 4W9KC 4W9DC 4W9JC 3ZRCC
chains in the Genus database with same CATH superfamily
4P2RB 1RJYB 3WNJA 1WWCA 2IVFC 3BP4B 5C0JB 3BKJH 4QY8A 2EC8A 3A4EA 1IJ9A 2AEQH 5IW3A 1RUML 4ONFL 2OTUB 3V0WL 4JRWA 1Z7JA 2APFA 3F2LA 4WIQA 4JHWH 3LS5H 4CJ0A 1NAKL 4FNPA 4R0LC 3S3PA 1J8SA 4LASH 1W0VB 3CXHK 5ICYB 2JXMA 4G5ZL 4FHKA 4LARH 1JRHL 4LU5L 1T89C 4WVRA 4FABL 3L9YA 4B9ZA 3QUMH 4HJJH 5HI4D 3QIUD 5IVOA 4OV6F 1QTYT 4MMZB 4QTIL 1SLVA 1EIBA 4FP8H 4CN1A 3VQ1C 5EFIB 5HHOD 2V7NB 1GGCL 1BVKB 2NNRA 1JPTH 4G59C 1TVHB 3AG1B 4PJIB 5DQDH 5D5MF 3MYJB 4K2UH 1K5WA 4HFUH 4XVTL 2PP7A 1T0NA 5B3JE 4R8WH 5CCKH 2FWOA 4E5XA 4Y4KC 1LO3L 4R4FH 5EZJB 3SCMB 5F9WC 3KLLA 4DN4L 5LQBL 5EOCH 3L1OH 4G7RB 4PTTB 2J73A 5DVNA 1WFUA 5FV2A 2WXJA 4HUVB 1HHGA 3QJFA 2H9GA 2XWBA 3BP6B 4DAGH 1JPSL 4HIXL 3DHJA 3EGXB 4FG0A 1DUZA 4KHTH 4O02H 5EEXA 1RIVH 3KLAA 2WZ6A 2EVHA 3QQ3B 4WUKH 3TCTA 3QNYB 2KS0A 4I3RL 4YPGB 4L8CA 1FRGL 1IILE 2EDTA 3QEHB 1EXUA 2IALA 4UQBA 1OGAB 1ZTXH 2P5EE 3Q6FA 2GW5A 4ZZFA 4Q89A 5HI5D 1MLCA 1GIGL 1UWFA 1E27A 2ESVA 5D1XB 2NY4B 2GHWB 4EKJA 4LAJH 1C12A 3GMRB 5DA4A 3MODL 3R0NA 5KSUB 5I5RA 2PMZA 2ZKXA 5ESAB 4JRXD 3QDGD 2EVGA 5IBLD 4N9GB 3CFIC 3DGGA 2ODIA 4KDTC 2X4SB 2A77H 3NG5A 3ROOA 4J12A 1I9RL 4HAFA 4OGQC 1N5AA 3T6WA 5H4YA 1M2VA 3Q06A 3P4OB 4GLRI 1DJWA 1P6WA 4NN6C 4OB5L 1RZFL 1SLWA 2R23A 3U6XS 1WAAE 4MLSA 1Q0XH 2HPTA 4NZRH 2BLFA 4HWEH 3D1MC 4POUB 3CLEL 4MQ7B 1KLUA 4IDLA 3RVUC 1ZV9A 1YECL 3Q8FA 3A0OA 3ARDD 1V3LA 4PJXF 2CZNA 2HRPH 4Y5YA 4KJWD 3QNFA 4O5LL 1TQBB 2EXYC 4PJGB 3KG5A 1MZYA 4K55A 1M71A 4LBEA 4F8OA 4QRFA 1A7PL 4H1LA 1OF2B 1VESA 2O26U 2XWJA 4P5KB 5JIDA 1PAZA 4NJAH 1IKFL 1T21A 3TH3T 2X4UB 4HXBL 5L0QC 4ZBJA 2HG5A 4OUUA 4EDWH 5E4OA 1IZKA 2DF3A 3OBAA 4JKWA 4LEEA 3GBLA 1UWXK 4HS8H 2X9ZA 3GI9H 1KDJA 4AQ1A 3BZ4A 3FU5A 3OAWA 5GS1A 1X7QB 1HSBB 1HHKA 5L7XH 3GJEB 2V3EA 1MAKA 4YHOL 5D1ZB 2ZX6A 3LQZA 3Q3GB 4W6WB 5DMGC 4NQCD 3T77B 3S37X 1BPVA 2OL3L 4F33B 4XNYH 5H94B 5IB3A 3TVMD 3SBPA 1FYTD 1I7RA 1EEZA 1UD3A 4L1BA 3T4AA 3ZVVA 4CGTA 1ZY9A 4QT5A 3HE6D 3GRWL 3UAJD 5E6ZA 3O3UN 1UGNA 3OAYH 3CZNA 4XBPB 32C2B 4LGPB 1C16B 3NP4A 1CG9A 2YRZA 4IHOB 3FBQA 3HA0A 4NGHH 1AAJA 4YO0B 1EX0A 1JBJA 3CMOL 3MV9D 1YHPA 3FFOA 3MV7D 4WHYH 1BPLB 4ZO7A 1EEYA 3ARGD 3B2PA 3O4OB 3QHFL 4AQZA 5J3HC 4QWWC 3KPNA 4YQXL 4GKSA 1WBYA 1GYVA 2MIZA 2VKWA 1YEJH 2D4FA 1VIWA 3VXPB 3BWZA 3ARSA 2QGCA 3UO8B 4IRSA 4ZJ9A 2FH8A 4S0SD 5I8KL 5PCYA 5JW4M 4E9SA 2EDBA 5KBMA 3F83A 2YFNA 2Q7YA 3V2AR 3VXQA 1MAJA 1UD4A 3HMXA 4WK4B 3OJMB 1P4LA 5C0IB 4OZIF 1OEZW 1UXSA 3X3FL 4KKZA 2R0WH 25C8L 3GLEA 2XSKA 2HFTA 4YXKH 3ARBC 3LHAA 2GPZA 1XF4A 3QJRB 4LXFA 2WLLB 2WWOA 3H6AA 5GZNC 1TETH 3FO1A 4LLQA 1QFPA 4O4YH 4W4NA 5E6IC 5FYLE 2BW5A 1FNAA 3ECBB 1L0XA 2L7QA 3FQWA 3QWOB 4L3ED 3SQBB 1T20A 4UQDA 3F64A 2K3TA 3MRDB 3RWHB 2VN7A 2HP4A 1KGYE 3QJSB 1OAJA 2KHAA 4KO6A 3S96B 2G9HA 2NTFB 5CLXA 3KH4A 5GHWH 5IT2L 5EF3A 3CZUB 1U8PB 5J1SC 1SDDA 4LK4A 1AGDA 1OCWH 1OSYA 1FFRA 1W0WB 3EOTL 4GSRA 2H1LM 2PP8A 2A4ZA 1UCBH 2Q76A 1XZ0B 3UCRA 5FO8B 2VR8A 1WAAF 3G04A 3UX9B 2OS7A 1B0RB 5CNHA 2MEJB 4X5PA 3GDCA 1DHKA 3RZCC 4XGZB 3DETD 4ABVA 4H4NA 2FJFB 4NO5B 3VG9B 3FRPA 3FCTA 1QFWM 3VI3B 2BIQA 4L3CA 4CAGA 5FF6A 2NY3B 4PJCA 4TULL 3FFDB 2X3BA 4Z7VA 3GSWA 2I5YL 1AS7A 1KGCE 3FCBA 1Q9LA 4XHJC 3CIAA 5D1ZI 3FTGB 1MHHB 1LQBC 2W80C 2WANA 1JVKA 2NNXA 4QRAA 1PEWA 1KIPA 1KCUL 1PLGH 3J07A 3UP6A 5KVFE 5TTRA 3S3CB 4QRSA 4TVPE 3F84A 3ZQWA 1FZKB 2ZE0A 4AQAA 4RISH 1O7DC 2F54A 2WC7A 4KVNL 1K85A 4GFTB 4NSKB 3O3EB 2VDOB 4R0LA 1K2DA 2VLLA 3H56A 3R1GL 3R8BB 3X1BA 4ZFGL 2C5DC 2JJVA 1CI3M 2D7PA 1M3JA 2FK9A 3ILPB 2CCLA 4JZNB 1SUHA 3BWUC 4JB9H 4E41E 3WD5H 2E3VA 2PXYA 1ZGLB 5C70A 4XNMA 5CEXA 4OKVA 3ULVH 1TSHA 1AYRA 2AERT 3OPZL 3NACH 5HDBB 3QG6B 5GJTH 1FLRL 2FL5A 2K7PA 4XN4A 1IUZA 1GY1A 5EN3A 3SODB 4OCRH 2BS71 5TDNB 3X3GL 1ND0B 4IQHA 1KN2H 4UDTB 4KO5A 2A6DA 1FYTB 2XZQL 3OGCB 4NBYB 1JHTA 1G9MC 2B9AA 4OLWL 3HE6B 1YZZA 5BZXA 2G4EA 5E6SB 1JPGB 5HYJD 5GGRA 2IG2L 3MFFA 4PB9H 4PJHE 5J9PB 4XCCH 2V37A 1AI1H 5DHVB 5C0CD 1T7WA 4LB8A 3L6FA 2NYYC 1IGCL 4ODXA 3JTTB 3MRPB 4FLOA 5DRXB 1O7SA 2VRKA 1YJDL 5JPNA 1SM3H 1PQZB 3VFTB 1D9KA 3MV7B 1MH5B 3EJTA 2BX5A 4Y2DB 3ARGB 4CBZA 1REIA 4LHUG 3ORJA 5DUJA 4IW4C 1N6QL 3FQNB 1NUDA 2OP4H 1FA4A 1SJHA 2FSEB 4L29A 2VLKA 2J88L 3HMWL 1T1WA 4RMUA 2F8IA 3VWKB 2YUVA 4G8FB 3LZFL 1RZJC 3WEMA 3WJJA 5E8DH 5F9JA 2F6AA 2W95A 4KTDH 4P2OC 4P3WA 4RFEB 4OZGA 3APCA 1IC1A 4DQAA 1WYJA 1XR9B 4HISA 4NRXA 5HHME 3L3IB 2OM5A 4K23H 1J1OH 2GIMA 5IMLA 1KPRB 2D7QA 1BXXA 4OCMC 3QCVL 5CXPA 2DIEA 2ZXAA 4YSOA 1NMBL 3WSQL 5E56A 1I1YB 3EGSA 1G7PB 1XGUA 4RRPM 2Q7NA 5LAXB 1EFXA 2LHAA 1HKLH 1Y6NR 5AVUB 2C7UA 5F7AA 2KQNA 5IGXH 1I3GL 2E0PA 1OP5H 5CP7A 3QUMB 5FUZH 2R0KH 1YEDA 3MRQB 5D1QE 1GYCA 4Z7AA 1KTJA 3OLIA 5L8KB 3BX7C 4X4XA 4BCXA 1M3IA 4PG9A 3VXMD 5DFVD 3ZDYF 4BH7B 4GIOA 4X5WA 3DX9B 1KYUA 4F8PA 1T2XA 1QP1A 5I1HL 4M6OL 4HW6A 3MGTB 3E3QE 2L7UA 2Z8RA 4Z7UE 4R96A 2CJTA 2PYEE 2PW1B 4X6DE 2ZOLA 3DMMA 4FTVA 5K9QI 4TRPH 3T6XA 1SJEA 3MRNA 3VW3H 1LO5A 2IDSA 3MGAA 3MTRA 4PS7A 1AGEA 2Q8AH 1OL0A 4D0DA 5D9SB 1R47A 3U9WA 2Z31D 3LXUX 4AGMA 1E9PA 2XQBL 4JFEE 5FKAA 2KPWA 5B7FA 2VXTL 5HBBA 2C3XA 1DQDL 4ENED 1EDYA 1HSAA 4M3KB 3RJOA 5JIQA 1UZ6F 1L0QA 4XOAA 2OYLA 1MUJA 3S2AA 3ELAT 2DJ4A 2HJFB 4NKDA 3NUKA 4NIKB 5DQJA 3WCYA 5DRZB 2R15A 3ZT6A 5DMYA 3TO2A 5IWLC 1T6VN 2XIIA 5D4JA 2H8PA 3FT2A 3FNKA 4UI2A 3ZE2E 3X2QB 1KJ2H 3A4DA 3F7LA 3K6FA 2XZZA 3X11A 1H8NA 3SDYH 2VDLH 3GSVB 5E2JA 1FFQA 4FX5A 1P1ZA 5GRJH 2CALA 4JY4A 2Z7ZA 3K8MA 1PZ5A 2Y07H 2YMXH 2ITDA 1QW8A 4PJHF 5IQLA 3H2QA 1TQSA 2QTVA 5DDHB 1OZTG 4MJHA 3PCYA 5IHZA 2VL5A 3N85L 1CIUA 1U42A 3QS2A 1INEH 4KY2A 4ELKA 1DYZA 4O9HL 1TJGL 5E2WH 4LASL 2Z4TA 5HJGA 5CEYB 5T1KA 1A7QH 1OO2A 3D4GA 1OTSD 4G9FB 4LARL 1R5IA 5EIIG 4YS4A 1DTUA 3P0YL 1KYOJ 5D96B 3QXDA 4YDKL 1U8MB 5HYJB 2N4IA 3AAZA 3KHOA 2AITA 1MCJA 3E8UL 2D3VA 4KNUA 2EKSB 2H26A 2R0ZL 2CWRA 5EWIL 3HS8A 3N40P 2Q8BL 1GPOH 3LIZH 1WTGT 4MA7L 3VTAA 4K2UL 4KRMB 4B96A 2H0EA 2VKXA 3TTSA 3MLPA 2Q86A 4PJ9D 4R8WL 3FU3A 1IKOP 1LO4H 2CQVA 1MFAH 1GC1H 4G6AC 3VFRB 3SDXA 1OALA 3C2SA 2NNAA 1N64L 4HLZH 3J2PA 5EOCL 4NQDD 2CR0A 3L1OL 4PJDF 3ZTCC 2QL1A 5I1AA 3RZCA 3FT3A 1RSYA 5K59F 2LU3A 1ES0B 4CDHA 1V8HA 4DAGL 1E5UI 4WUUD 5J1AA 5I24A 3U7WL 1T5XB 3H8NA 5KJRL 3RFZA 1CD0A 2FJGB 3CVIH 1CD1A 1WDAA 2K4AA 5KS9E 2EUZA 5ES4B 5E2VL 5JR1H 2ZXEB 5SWSD 3TZVA 2J5LC 3QB7C 1E4JA 1DQML 3DSNA 5E7BA 1QPPA 4ZX3A 1HZHL 1WTLA 3AGWA 4I0KA 3D9AH 3ARXA 3HIZA 2CU9A 4GJTB 2HRGA 4GBXB 3U48A 2BHYA 2L8AA 2WQAA 1M1SA 3DRTA 3HAEG 2C3GA 4Q9QH 2LABA 4PTUA 4U3SA 3VD0A 1KEML 5CZKA 2XT1B 4Q4IA 1TVDA 3WIFA 4QJ3B 1L4IA 5HI3C 3KYAA 1A6WH 2GK0A 1NGWB 1DN0B 2VDMH 4GI6A 4P3DB 5EU6D 2J7LA 2X4OA 2AP2A 5EO0B 2Y3AA 2Z65C 4CSSA 1ZGLP 3VQMA 1X5YA 2YQ2A 4OFPA 3IDNA 3P0VH 3ZHFA 1NTDA 1Q8MA 1S7QA 4QHMB 2XWZA 3TV8A 3CN0A 3WS3B 4MMXC 2BM3A 2PTVA 1QR1A 1KJ3L 3C5ZC 5TE6L 1FVCA 4H20H 2MNWA 5FDWB 43C9A 4WW1A 1AXTL 1DL7H 3ZE2F 3U4BL 2RR3A 3ZKMC 4QNPE 5DK0B 1VKXA 4LDCA 1NOLA 3M6DA 3ELQA 3V7MA 4HH9A 3MBWB 3MCKB 2ENQA 4CC0A 4OD1L 2AQTA 4HWZA 3EFFB 4TSCL 3ZPDA 3BD4A 4W6YB 5C09B 4G42B 4HJEA 2GABA 2BZCA 2V2XB 3L48A 4G8GE 1H15B 2ATPA 2P45B 2MOQA 3P02A 4RFNB 1QUPA 4M7ZC 1KG0B 1HKFA 2FBOJ 2K6YA 4H26B 3DRQB 4D94A 4RESB 4CU8A 3C08L 3ILQD 3KD4A 2X5PA 4Q9RL 4XXDA 1QEWB 3I9IA 2Q5BA 2VXQA 4O2CA 1YSOA 3G5VB 3R7QA 1G9NC 3TYFA 2JQZA 3IDMB 1Q1PA 1WD9A 3BVNB 3CXDL 3SE8L 4LESA 1TOXA 1KOAA 2BIPA 1M9WA 1PBYA 1ETJA 4X0KA 2UZIL 4L0PB 3TN0D 4F57H 4OLXL 5AB9A 5F1OB 1UEYA 4LT7A 5DVMA 5IUSA 3Q5OA 5DUPH 2CO7A 4X42A 1DQVA 4B27A 3NQIA 5A6MA 1QX1A 4OF6A 3VA6A 5LLIC 4JCWA 1URLA 1EHXA 4IRZH 2OCCB 3JVGA 3JWDH 4PN6A 5AVVB 3GGWB 1UJ3A 2JI1A 2AK4A 1EERB 5GS0L 1PZSA 2O61B 1YEJL 4ZDHB 2WJ5A 4LCCB 3EBGA 5BV7H 4LCWB 4X2UA 1DBBL 2W88A 4HZAA 2AQ1A 5HI4C 1DVQA 2V7HB 3ULUH 3NSXA 4JRLA 3SKNB 5T3XL 3UG3A 3B43A 2BOBB 4QLRA 3ETSA 1I75A 5DVPA 5AOKA 4JO4L 5DJ8B 3KCPA 1NEZG 6FABL 3VM7A 1XCWA 2V9UA 4ODVL 2DQUL 4NENA 5KS9F 3B83A 3HE7B 3ESUF 1R3LB 5BUPA 4J5VA 2ZXQA 3K80A 3O8XC 4IBYA 4O4YL 2VLRB 4FNSA 1NBZB 2OYPA 2Z93A 4EUPH 1KTRL 3O2VH 2XV0A 2QVKA 3H85A 2IWFA 1FORL 3MUUA 4JDEB 4NQED 1D5BB 4L1DA 4XPHH 3D25A 5B39B 2PCPB 1M05A 1Q9OA 4M7JL 4MZIA 5A1AA 2VT0A 2VUYA 1BZDA 2FX8H 2IDTA 4AUUA 3MUGB 2ZXWB 1S4IA 4KTYA 4YSSA 5A3ID 1BAWA 4L1LA 1JWUA 1UCBL 4JHZA 3NZHH 4UNUA 5HI5C 1IO4C 4NO0D 3LZLA 1YMMB 2BSSA 2N01B 3OTTA 3UPRA 2N7AA 1WA2X 4ADJA 2W1NA 4WFFD 3GEFA 5E9DA 2BJML 3VA2C 1MCRA 1XAUA 3REWA 3KPRB 2P52A 1DO5A 3Q5YA 4I85A 2BVEA 2UZXB 4WSKA 1E5YA 4X4ZA 3IMBA 2ZWSA 2NCEA 3CVHL 5IBLC 3UBXG 4A2LA 4EI5A 5DQ9A 1HX0A 2XTLA 4JFFB 2YXWA 3AS2A 1A3ZA 1XHHA 1LM8V 1L9OA 1QFUH 1YYMH 2EDJA 2WW8A 4YSCA 4FXLA 4L3FA 3NN8B 4LRIC 5HHPA 5EEYA 2NY1D 3EF4A 2VDRB 3T6VA 1PLCA 3RFRA 1QI5A 3ZNGA 4WV1C 2VAAA 3ZT5A 4YSPA 4KMQA 1TZGL 1KNOA 2K1MA 3Q2NA 3SDXF 1PLGL 4KRPB 5FKPA 2DQEH 5AD0B 4JFUA 4PV9A 3DX1A 2NUTA 1JF1B 5EZLB 1UWEL 1Q9KA 4RGND 4KJWC 1BGXH 1ZRUA 1Z6JT 3TXAA 2D31B 1D2OA 1ORQB 4OCSL 1I85C 4N8VG 4P46D 3IN2A 1U8OA 1KBGL 1XIWB 4KVCH 4OCXH 4APQB 2YFOA 3WTVA 1XSKA 4K8RH 2R4RH 1KGJA 4HUWA 3U4EA 1Y1UA 4WU5A 1A1NA 4WSGA 4DP7X 3T0ED 4GQ9H 1QWNA 4I9WE 3SJVA 3SKMB 1T3FA 1SYSB 1YEHL 2GSIB 4L8DB 4Y5XB 5F21B 2YQGA 2QZQA 5E99L 1KLGB 1H8OA 5CF3A 1U8IA 3R8QA 3RUGF 3SDDA 4ODWB 3ULVL 2VH5L 5EMYA 2CDFA 4NDMA 3V4VH 4JPVL 1KF9B 4D8OA 4CNIA 4CJ1A 3SYOA 4P2QD 1TMCB 3SYAA 4N85A 4PS4H 1F4XL 2WLNA 2YKLL 1S9WA 1AZVA 2OULB 3QQ4A 3QJUB 4H8WH 4GG6B 2HKHH 5D2NB 2IMMA 2Z64C 3CFEB 2FRGP 1PG7X 1QSED 2CLZA 4PH8A 3UAJC 5I0DA 3AWFA 2H3NA 1X5AA 4KFZC 1WZ1L 2CCWA 5AOLA 4U6XA 1HWWA 4G5AA 5EO9A 3O0RH 3H3BC 4URTB 1HEJC 1OAZL 4FN0A 3B8YA 3WFBH 2YGVA 3DPBA 3KS0J 1SM3L 2WTPA 3OKEA 4MDIA 3TIEA 1UM4H 1RK7A 4QXWA 5GSRA 3FTXA 1DN2A 3ILEA 4XP4H 5EF1A 3MU3A 5DURB 1OSZB 3VGAB 1KJ2B 3THML 1QQDA 1P7QB 1YMHA 5KSVB 4MQSB 1TTRA 1F11A 4OIIL 2BVPB 3IPBA 4F7MA 2EO9A 4DSYA 3S4SG 2F9BT 1UXWA 3F7VB 4UQIM 4BFFA 2IC2A 2J1KA 4E9TA 2DYRB 4XOEA 3QE5A 2EVIA 2JB5L 4WLCA 4Z5RA 4CSZA 4L4VE 4QXTA 5DD6B 3KBEA 3RIKA 5LBSL 1J1OL 1BDYA 4PGBB 3W9DB 3SPHA 1LEGB 5LHDA 2J21A 2P4AB 5JLZA 3DVNB 4Y16A 1F3JA 1ZWIB 2B5IB 2G4GA 2Y7QA 2JIXA 4U1GB 2CJUH 2XG5B 1BQ5A 2ARJQ 3P3TA 4YDLB 2WAHA 3BZFA 4K3JH 3G6JF 5TQ2L 2DWEA 3EJQA 1IFHH 3GMLA 1MCSA 4S0TD 3PRZA 5FUZL 2R0KL 2XG4B 1E7UA 1TNNA 4IGBC 4MXVF 4GUQA 3KPQA 2GJJA 5E03A 1T0MA 3DI2B 2OI9C 2R8SL 2I07B 3GMMB 1QZNA 2R7EB 2GIXA 4B9KC 4P2RE 1CFBA 1NCAH 3V0VB 2A73A 2MTAA 4Q0XL 4JO2H 1FGNL 4J3OH 1OKEA 1F8TL 1ODUA 4PSPA 3ZX1A 4UTBA 4B97A 4BWWA 3D85D 1SZNA 2BWIA 3IE9A 1ZXKA 3QH3A 4NO2A 3DJ9A 3E2HB 1YDPB 2I9LA 2LV4A 3W39A 1TQUA 3HR5A 4EDXB 4GUOA 1ZE3H 4MRCA 3ZQ9A 5I19H 3GDBA 1HQRB 1A4KB 4WU7A 1FFOA 1R3JB 3QA3A 2VDNL 2XJKA 3LPWA 2IDQA 4K0OA 3V6ZB 4UM8B 3W0WA 4AYBA 5HY9A 5H8DA 1MW2A 3IFLL 2JTDA 3WKQA 1PLAA 1TENA 4OLZL 3MRKB 1EPFA 5K9OB 3C87A 4MB5A 4OT1L 4PJIE 2FT8A 1G7IA 2HJKB 4L1HA 4X80H 1UKQA 3HZYA 1VPOH 5F96H 4EVNA 3LKQA 3CFDB 5G5DA 5JA8B 1BZEA 3J7HA 2Q6WB 3TONA 1YEGH 1FL3B 3AMKA 1D5IH 2MNUA 4RGNB 1BHGA 1ADQL 1FVDA 3CVBA 4TL4A 4X5XB 4P46B 5AOJA 5TGBA 2FGZA 4D0CB 3AW5A 4HUMB 3UTQA 2DL2A 5F3BB 1L9MA 4YOKA 3BQUD 3SDYL 4F15B 3FUIA 1JPEA 4ZODA 1J48A 5KVGH 1RZ8A 1OGAE 2PR4L 3F05A 4O51B 2FGWL 2Y07L 4KI5E 3I3BA 5JORB 1N8ZA 3RKDC 1GJIA 2NXZD 2XVKA 4LSDA 3U46A 2ZWYA 4Y4HA 2CHNA 2XNAA 4KXDA 5D1XE 5FM8A 4PRAB 1INEL 3BUBA 5HGGS 3B9KC 1B4JH 1I4FA 1A7QL 1RHFA 4FGMA 5HHQA 3OXRB 1GL4B 4A7GA 1ED3B 5I0WA 5FLVA 1DVFD 1A7OH 3K8KA 4GIAA 5CIPB 4LDOB 4OGXH 5KYWA 3DBSA 1BMZA 5F7HA 2OMYB 3V5HA 4ZI8A 4WWKD 1X3DA 1GGYA 2DQFA 1GRWA 3WS6C 2VN6A 1TIUA 2X89D 5HGDB 1TMQA 4I0PC 4LQ1A 5AB0A 4H0IA 4WW2A 4K5LA 3RU8L 4N3UA 4RETB 4O58H 5GRYA 2HRHA 3H53A 1MAML 3GMOA 1MFAL 4PRBB 3RRQA 3NSCA 1A6UH 3JUZA 2GTZA 3DO3A 2ED8A 4WWOA 5IKCB 5F1KC 1NIBA 4PJGE 3T1FB 3KBFA 3QUHA 1NC4D 3VFVA 4FYTA 2DYPD 3QQ9C 3QVAA 1L7TH 1Z9PA 5CD5D 4QHLA 3F7KA 4PRDA 4NX0A 1OZUA 4LRNH 1QSFD 4PG2A 3B34A 2OMUB 3OSVA 3O4LD 4KZEL 3MBEB 5ANMB 1CGXA 3I9PA 4U1HA 1EV2E 4F37K 1I7ZB 1PD0A 1W72L 4M4RB 5C2UB 1KB5L 3MLTA 1TLMA 3LXCA 1RVFL 3TBCA 5C8JA 4E9XA 3FCUB 1KN4H 1OAKH 4ELMB 5JNYA 2D7TL 4TPRH 2VWEE 2E7BA 5KSBB 2F7OA 5ESVB 5JW5B 2OTWB 3L3KA 5TE4H 1YNTA 1TEGA 4EOWH 2VDML 1WCBA 4P23C 1H3PL 4ZXBD 2J8UA 3AT9A 4GY4A 3HI6H 4AT6B 5TFSL 4CC4C 5T3ZE 2W60B 3UZVA 3FQTA 4KROB 4LSTH 3ALWA 1FDLL 3PL6D 3GHPA 3NIDF 4FMFA 4QRRD 2IPKA 3EYQD 4K3DL 3KMDA 3TEUA 1TVBB 4U1IB 2V0AA 3HMXH 3EDKA 3I6LD 2HN7A 4JUSA 4PW3A 1M42A 2X44D 2VJ8A 3AXLB 1TT6A 1BG9A 4RGOL 4ERSH 2YKKA 1CLYL 4HK0B 4YHZL 1GHFL 2AQRA 3K2UH 4Z0XA 1N0XH 2YPLB 4KK9C 4PRID 1E40A 2CBTA 2DJMA 3VQLA 4ENEC 1X4XA 3HZKA 2I9TA 1KPUA 3EW3B 4NO3A 4PJAF 1KJVA 5GIRA 2BFVH 1FLTX 4PJ8C 3EO9H 4CILA 2G5BB 4B9PA 3NIFB 4K07A 2E47A 2F2HA 5IMMB 2E8YA 4YDVB 3RA7L 2WUCH 3UBGA 4KK8C 1ETB1 3F7YB 3UTZB 4DN3H 3K5RA 2RCSH 1U2CA 1IBFA 2MFNA 3DUUB 3Q1SL 4YSQA 5KVDL 1WIUA 5IG7A 2JELL 3ZE0F 5I1DA 2ZUQC 3VNYA 4DZ8A 5IW6A 4QF1A 5ICXA 3ZRFC 5EEZA 1OCZB 1HZLA 4EZMA 1YQ2A 2LAAA 1D7DA 1SF3A 4M43L 2YSTA 3QG7L 1PIGA 1WFNA 2EDEA 3R06A 2PO6D 2J6EA 3N91A 4HIEB 5BCAA 3U9UB 4MX7B 2ISDA 4PGJA 4F5CE 1NCWH 1QD0A 4I77L 4N0FA 4I88A 3VXTB 1OPGH 1YNLH 1KBVA 1F18A 1DVFB 4N6QA 3P73A 3VI3E 2JJTA 3MREA 3VXUB 5FYKU 1IEAB 4NYLA 3ZKXB 3ULUL 4IGBA 2CBMA 4LPWA 1XCTA 4NFCA 4DZBB 2HYMA 2B2XL 4MCNA 4Y1TA 5DZ9A 5D7KE 2QR0B 3PV6A 4LE8A 2FH6A 2I26N 1U8JA 4IIQC 1J5HA 3D39B 3QUKA 3CMGA 5GRUL 3AG4B 1FNGA 1Z9SB 3WDJA 1GZPB 1DANU 1J8HD 3OWRA 4K94H 3INUH 3EHBB 4ZUSA 3VG0H 4PUBH 4QDGA 4UM9A 2C4XA 5AG8A 1WS7A 5ANHA 3VWJB 2FEJA 4KV5E 5DZLA 5LUMA 1NC4B 3QR2A 1KV7A 4GPVA 3QNZB 1Z0MA 3U36B 5C0AD 2MCMA 3WHE0 5T5NF 2VDPH 2ZPKH 4XPHL 3KW8A 2CDEA 4OCYH 1E9OB 5IK3B 5DJ0B 5IMOA 3TA3B 3LN9A 3C75A 1M56B 1O9WA 3C60A 4GT0A 3CWGA 1NBYA 4EEEA 1VFOA 1VACB 3ZRCC 4G6MH 1L6XA 1YAZA 4PJ6A 5IEHB 2Z6FA 3RWCA 3V52H 4TYUA 3BC9A 5FGCB 4XBMA 4Y4FA 1OB1A 3F12A 3HFFA 2XQ0A 4R84A 4F27A 1AMYA 2PPDA 4NLAA 1GAFH 1RZQA 4P5TD 4YHIB 3T65A 3V6FB 1TKWA 1ZV5A 3PWLA 4H25B 2NY2C 4JVPA 1FYTE 4M7LL 3LEXB 3PS6A 1AO7D 2AK1H 1IEBA 4FJ6A 1HS6A 2YD2A 1UEMA 3OPUA 3QAZC 5DRNA 1T66C 1ZHKB 3ZHKA 1G7HB 1WA1X 1NQBA 4MMYB 3CPUA 4JKNA 4EMZA 4BQBA 5D6DA 3PL6B 4I3SH 5F3HA 4Q2ZB 1JFQL 2VC2B 4PRHA 5IHLB 4P57B 4PEEA 2F58H 4JHBA 2NQCA 2WUBH 2OW7A 4Z7WF 3DK0A 4QY8B 5CO1A 5HYEA 3KYMA 4AE1A 5DJYA 3SE6A 2BSRA 3GSNA 5HHNB 2KUTA 1DJGA 5AVSB 2AJYH 5FW8A 4LEXH 4Y5VC 4QXGH 4H7VA 3WYRA 4Q8BA 4WO4C 4GQ9L 1GCYA 4DKDC 2JXMB 5GGTA 2BNRD 4WY7L 1A3LH 2Z92A 4XI5C 4JY6B 1W6WA 3D09A 3MUZ1 4U1NB 1SDAB 3QISA 3MNWA 4YHKL 5D7EA 3BD5A 1EJOL 2KI6A 2QADB 3A23A 4K73A 4PJBA 3V4VL 3U2SA 4DKEL 1OF0A 4JDTH 1C5CH 5EBWB 3CX5J 3QUXA 4HG4K 3F7PC 3ILQC 4OY9A 1T0NB 1IQWL 3SQOL 3Q7JA 5JQ6L 4E5XB 1OT1A 1QG3A 3C6LD 4NOFA 5FYJL 4QHNB 1EGJA 3GK8L 5F7WC 4CSTA 3L2MA 4H88L 5D1QC 4ZYKB 5I1JL 1F97A 4DP1X 3VFPA 1BVLA 3QJFB 4I8DA 1XH0A 1MXDA 2HJLA 4CW1A 2J4WH 3TN0C 2D03H 3QJHB 4NP4H 3T0DA 4DPRA 2IQAA 4NAQA 3V7AE 1R17A 2V5YA 5BVPL 1M6OA 2PO6B 4MQXC 4W9IC 3BP7B 4OJFH 1UM4L 4U6HA 5D93C 2ZX9A 2IALB 5DYOA 2YGNA 2ED9A 4TSBH 4UV4H 4EIBA 1P9MC 3QUYC 4BFNA 1RJLA 3MLRL 4JPKL 2ESVB 4JRYD 4N8PA 4PWGA 1N3NA 1JPST 2EZ0D 3CN3A 3LZRA 3PHOB 2RAMA 3GUTB 3VYOA 1E4WH 2F74A 4Z0BH 1ZTXE 3HB3B 4R2GC 3BKML 4A7UA 2XKSA 4WWNA 5AW5B 4B3EA 4B41A 1AH1A 3ROOB 4AEHH 4LBAA 1N5AB 4L3AA 4ADIA 5GGUB 3TBVB 1M2VB 2OYMA 2I27N 1IAOA 3CXHJ 2CJUL 3VRIB 3TO4D 3M1BB 4Y9FA 2YOAA 3FCGA 2ZNXA 2R23B 2K4WA 1QBAA 1QLEL 3BPNC 4QJ5B 3JWOC 4YEFA 1KLUB 1U3ZA 1QNZL 1PNDA 4D3CH 5IROA 2DKSA 3UMNA 4JMNA 5HPMB 2NY0D 2YD4A 2WZ5A 3RIFK 1FH5H 2ENYA 4FXKB 3X13A 4BFBD 2A0LD 2VMEA 3ATDA 4S2SA 1M71B 4LBEB 3OL2A 1S9VA 3PWVA 2IH1A 1NCAL 3CK0L 3LPFA 4ZX6A 4H1LB 1SXAA 5DLML 1UOLA 4FHBD 4YFLF 1GYWA 5A3IC 3RIAK 2L3BA 2DMHA 2RQEA 1NKOA 3S3SA 1T21B 2E9JA 5LGYA 4AM0Q 1ZLSL 2HG5B 4P59L 2XXGA 3NJLA 1IFGA 3KHQA 4PS3A 3GTVA 1PS3A 4UOW0 4G9FE 4ZFOB 3W9EA 2ATKA 2A6JA 2J3SA 3D4CA 4M1DL 2XRAH 1KCSL 3CSGA 2WHVA 1HHKB 3BN9C 4RA3A 2E5EA 3LPPA 5DLLA 5EBMA 3WIIH 1WC7A 4XNXL 2H6OA 2NCMA 4M3JA 3CC1A 4JDVA 2YD7A 4TUKL 1VFBA 2WCGA 2YEZA 3V5KA 5K9QG 3DTUB 2PUQT 4UCFA 4QT5B 5CBEA 1MKFA 5F9AC 3JTSA 2ZCLH 1PZBA 1VENA 3LQAC 5T8IA 1H6EA 4IKIA 3FN0L 3CUPA 4UANA 1D5IL 1NCJA 2WBJA 2EIZA 5CWSB 5AVTB 5I1CL 2DY2A 5AAWC 2QQNL 1T1ZA 5DUMH 3ZHDA 5F6IB 1VGKA 4PGCA 4I1NB 4N26A 3ATFA 4U1MA 1MXGA 1IGMH 1G4MA 1PEZA 3F3HA 1EEYB 2BPBA 3VXRD 3B37A 1N5YH 1U21A 3WKYA 1WBYB 2E8ZA 4R7XA 4UV7H 2V8LA 1QATA 2HLAA 3O6MH 3BZEB 3QIBA 4F2EA 4NXSA 2CUHA 3UP1A 4CMMB 2A74A 4IRSB 4KUCD 5LBGA 1ACYH 5FHBL 4DVRH 2EDOA 3QI9A 2DBLL 3HS9A 3VXQB 2Q7YB 2YPKA 5HDQL 3BHBB 1P4LB 1UWGL 2DZEA 3GI8L 2ZNWA 2H2SC 1S9YB 1UXSB 5GGSA 1YYLL 1RLBA 3KPMA 1J05A 1A7OL 1IGTB 5ADOH 4FFYL 4LLQB 5DMIL 1RZKC 4I5BA 4WHTB 3UYRL 1GGBL 2N59A 4GO8A 4HFWA 2O72A 5DFTA 3L3HB 2XZCH 2ZCHH 3FQWB 1F6AB 2XVGA 1T20B 4GSQA 1IJNA 4BFOA 4E41A 1UGKA 1UWXH 4NZUH 4PLJD 5B1JA 1BM7A 2H7WA 1Y18B 4XPBH 1KIQB 3PFQA 2VR7A 2FIKA 3CE1A 2G9HB 5TDPA 1KPVB 3TURA 1SDDB 1USQA 1AGDB 4NN7C 3ENEA 2ZKMX 1V7NL 3FMGH 3A6BL 3C5SB 3PXJA 5FYKH 1Y07A 4MKTA 3QZWA 1LP9A 4KKCD 1FHGA 3HG1B 3G04B 3IFOA 4A66A 1MIMH 4BUGA 1IC7L 1NGXB 2C7FA 1OW0C 1HHHA 2AJSL 4LRNL 4N2KA 3X17A 1OSPL 3RVVD 5KVEH 3TPUA 4JM4L 1WAEA 1ZMYA 5CJBA 3KPLB 3MR9A 4UDUA 5C09E 2VXQH 3SGEH 2VYRE 5KOMC 4HSCX 2VZ3A 4PJCB 3EJUA 2H0FA 2OTPA 4A39A 1L9NA 1JYVA 2IJ0C 2ZKHL 5TH2B 3TO4B 5ID0B 1Q9LB 4G11A 4TPRL 2IDCA 3FHEA 1G7JA 1NA8A 4RX4A 1OXYA 5AYUL 1XMWA 5BXFB 3O3AA 3A67L 5DK2B 1N7ML 3ZMNA 3GS7A 3HC0B 3QNXB 3L3JA 5MEND 4Z7OF 1J0YA 4HZLB 2VSCA 1OCCB 3FUJA 1NWOA 2WZPD 3NFPA 4MWFA 1AQDA 2G5RA 5DVOA 1K2DB 1V27A 2VLLB 4NS0A 3HI6L 5DJ6A 2EABA 4XPFH 1E4KA 1Z3GL 2OX5B 5FEBA 5LB1A 1BEXA 5MI0B 1F58L 3MRFB 2NY6C 5KOVC 2GJ6D 2PXYB 2H3XC 1D7CA 1IGIH 2XVLA 2ADIB 1BBDL 4D8PB 3GMPA 4DQOL 4XNMB 5E2UL 1UH4A 5CD3B 5FFGA 3GBNH 4OFQA 4FFZA 1IRAY 2NOYA 4TMPA 3ZDXB 2VDPB 4LCWE 3V6OA 2FLRT 4N2LA 4HA1A 3QZPA 1KENH 1XT5A 2VGLM 1B9ZA 3QRBA 5E8OA 4KHXH 2FL5B 4DVBB 3BWAA 3MUY1 4U7MA 5EC2A 3TJHD 1N0XL 5B1BB 4ZMAT 2AJZA 4RGMB 5IFAL 2A6DB 2R83A 2NW3A 2AV7A 2FJSA 2WMPA 3LD8C 1JHTB 1CCZA 3CHOA 3IVKA 5F93C 3CZKA 3FB8A 1BD2A 3VSUA 1KZYA 3MFFB 3V9FA 1FNEB 3CIQA 2AGJH 3CFNA 4JFPA 2LLLA 1XGZA 2JCCE 2WAQA 3L6FB 2VLRE 3GXDA 3LX9A 3Q8BA 4HBCH 4Z7UA 4ODXB 5E00B 1C9SA 5CZXC 4FNUA 2WUCL 3U0WH 4X6DA 4J8RB 5T1DL 3LVTA 1PKQA 2EVJA 2QGBA 4Z3IA 4FLSA 1D9KB 2BXZA 1T22B 1W9XA 2WOYA 2Q7AA 2BDNL 3QFDA 4KU1A 3I02A 4NUMA 1CE6A 1BVZA 3RGVC 3VD7A 3BQUC 5ILTL 1RZIA 4RIRA 1S3RA 1ZJAA 2I69A 2AQQA 2AXFA 3SE4C 4X4MA 4Z77A 1RULL 3QPXL 5F9JB 4ISVB 4Q9CA 1YMME 5KBKA 1CGWA 3PNWB 2OMZA 2IFFH 3TESA 4S0HA 2VMJA 1AZRA 2FBRA 2QDWA 3KPRE 1DDHB 3L54A 4ILDA 1EZVX 3H9SD 1NWPA 1U2YA 3KL0A 1J10A 1CBVH 2IO5A 4MB1A 1CICA 2C9SA 3EGSB 4JFFE 3X1EA 2GSMB 4A68A 1L9QA 3UBHA 4K7PY 1IAIH 1EFXB 1RH8A 2EDDA 2EUWA 4XBGB 5CP7B 4AL8H 3CTTA 5FO7A 1YEDB 3HN3A 4M5SA 4QOKB 4U2ZA 3U6XA 1FQ9C 2GFBB 2SEBA 2E7LA 4MSWB 2W5PA 5TK4A 2F0CA 4B3VA 3LHPL 2OMXA 3GKZA 4V2BA 4X5WB 3O2DA 2WWMC 4MA1B 4PIBA 4U2YA 5ISZB 1WWBX 4J6RL 5DJCA 1MY5A 5BJTA 1A66A 3B2UD 3CQPA 3HC4H 1MI5D 1NAMA 3S34L 3RTQA 2ZOLB 4WHYG 4FTVB 3VH8B 1TCMA 2EC9U 4YSUA 5JHDD 3WFDH 1MW3A 5D8JL 5F7EL 3MRNB 4JFZL 1FIEA 2W91A 1WFIA 2H45A 3ZE1B 4YHML 3ZKSD 5H37A 4OZFA 5C9JB 3V52L 1BG1A 1E9PB 3AT8A 5F1IB 5FKAB 4HBQA 5DT1L 4BK5C 2HT3C 2WXMA 4EXPX 3L3GB 4LL1A 1PKOA 3B7TA 5GS0D 2G3MA 4D9RE 1DQQA 3EDEA 5SX5K 3FU8A 3U30B 1MWAA 4KOBA 4NP9A 3US9A 3N41F 4NKDB 1A3QA 1KCBA 5DQJB 2IGFH 1HVXA 1MCBA 1TPXB 3GPSA 1NBQA 1QUNB 4PP2A 4X5LA 1YQVH 5D2NE 4F2FA 2R0LL 3MXWL 3REVA 2P43B 1ZEAH 3NCFB 4JQXA 5EU4A 5T3XD 3SPVA 3FT2B 1LXMA 1N18A 5D55A 2VLME 3I6KA 3MXVL 4MVBD 3K71A 2G2NA 4JANB 4XNAA 1BWWA 4UOZA 4JR9H 4X9IA 3T09A 2J8HA 3D0LB 4ZG1A 3WLWC 1JUFB 5E51A 2WLHA 3ULVF 4W9DC 1EFQA 2ODHA 2OSWA 3POCA 5A2CA 2PWGA 4YBQD 4XNUH 4MAYC 3LSOA 5E7FA 3GSOA 2V9QA 2JCCF 4QTHA 4F93B 3SQRA 5IHZB 3QUGA 4LSVH 3B7SA 3PPSA 4CL7A 2C1PA 1JNJA 3ARED 4TQEL 5CZRA 3WU1A 3KW7A 3PAZA 5T1KB 3ZMEA 2DLFH 3IGUA 4KUZH 4TOYH 4GW4A 2CO2A 4NUQA 4Y88A 2FJUB 2Z4QB 5GJSL 4IBLT 5D4HA 2VRQA 1LILA 4CVUA 4N8UA 2YPVA 2H26B 1U0QA 3RVXC 1T03L 1MQ8A 4YXLH 4JDTL 2Q86B 4TSAL 3RL2B 2YK1H 5D6CA 4HT1H 3FO9A 4NKOA 4UT6A 1ROWA 5HDOA 4UTBH 3U1SL 4B5ZA 4P4KA 1RURH 1NICA 4ZFZB 1QSZA 5BVJB 4FNQA 5C7XH 5FYJU 2ZX7A 1WT5C 1QRKA 2VERN 3IM1A 2XA3A 1YEEL 5J1AB 2VE6A 2KDGA 4JPWL 2A1WH 2AJUH 2HT2C 2FIRT 5D70H 1UOWA 4FCAA 3RFZB 2VERA 3HG3A 3RNKA 5A16B 2X28A 1MEXL 2JK5A 3GXNA 4NUPA 1QTPA 2VN5A 3I2CH 3IBEA 2R2CA 4PRNB 3DSNB 3PDGA 1VCBC 5JHLL 2ZJSL 4YHLH 1RIHH 1WRFA 2VL4A 3S4SA 2H32B 5DVLA 1VCAA 3GJFA 4TN9A 4X7SH 4X6FA 1S78D 5E0FA 5GQBA 1NGZA 3DC0A 4I2XE 1ML0A 4PTUB 4U3SB 3VFSA 5KYYB 4J2XA 3WIFB 4DTGH 1QA9A 4AEHL 2NT0A 3BVVA 4A67A 3BPLC 4F7PA 3ZK0A 4WI6A 3CFMA 1OAQL 1R46A 2K70A 4IDJH 4JFQA 3SD5A 3RWIA 3ULVD 2FR4A 3SCMC 5E4EB 3TWYA 2OQJA 3MCG1 2X4OB 4TM9A 1XB6A 4RGNE 5BS0A 2CKBB 3GINA 3GHEH 1M1XA 1KJMA 3DX8A 1D6EB 1GZQA 1CXIA 3VRJB 3HI5H 3LH9A 3DV4A 3PAYA 1L9PA 2V2WA 1S7QB 1MVFA 1W91A 2EICA 1A47A 3NDZE 1TQVA 3TU6A 4AQEA 5H2BA 3EDDA 1QR1B 5AAMA 1FVCB 43C9B 4X7FC 1F41A 4PRPD 1JMZA 2XTJD 3T6QC 3C12A 1YEKL 3AG3B 1HHIB 5A2FA 5F2FA 1A7RL 1CVSC 5LJYH 4TS6A 1GZHA 5BOPA 3O0LA 5D1XC 4LOVA 2NY4C 3IGAB 3QFJD 5CUSL 5J0BA 4KRLB 3LAFA 3FRUA 1KIUA 3F00A 2DJUA 4MNQD 4BWUA 2YRBA 2C9RA 5IW1A 4KMTH 4ZUUB 2APTA 4FG6D 1NGYA 4U6TA 2WQXA 3WEXA 3HUJB 2LW3A 2GHZA 5I17A 2P44B 1R3IH 2COQA 4XXDB 3K6SA 1U3HC 5HP5A 2DM3A 2IAMA 1G6RA 1WO2A 3TYFB 3RDTA 3VACA 5E5UB 5JZ7D 4F20A 3HZVA 3HFMH 3ZIMA 1X9RA 2A6KB 4ZMTA 1TYEB 1U8HA 5CAYB 4GSDH 3FU0A 5HTSA 4QMEA 4NWTL 4G8IA 4IRJA 3HRZB 1IGYA 4UYQA 2JWYA 1TQBC 3UPAA 4HKJA 3KCWA 4Q56A 3NCMA 4YHNA 1TZHB 3MRHB 4HMCA 5EZIH 3FN9A 4HOZA 2GSGA 3KPSD 5I18H 3STBA 1UJ3B 3TV3H 2VQUA 1CGSL 3MOBL 2AZUA 5I6XB 2VZ1A 3TPKA 5ANME 1FUNA 1A21A 1ROCA 1E4XH 3LMJH 3O6KH 5CP3A 1A9BB 3KEDA 3MLXH 4NFBA 5I75C 2FNWA 4ELME 4I89A 3KCPB 1AFVH 5D1ZC 1IQDA 2JJUA 4NENB 1I8UA 4PM1A 1Q94A 5KSBE 3CVHB 5ICZB 5AALA 1LDPH 3KM2A 3DSFL 4A2HA 3GPEA 2AV1A 2OJEB 4ZMPA 4FFWD 4ZQKA 1TZIB 1GKOA 1XGTA 2K78A 5DZAA 5IQOA 3CH1B 2HAZA 2Z93B 5J6SA 2P80A 1H6FA 1KXTA 2X9XA 3DX4A 3TWCL 4AVIA 5JUEL 4OF7A 4XPBL 4K9EH 3VCLA 1OCRB 1Q9OB 4BFEA 1EO8L 4Z78B 2YSSA 4GAAA 4W70A 1G9ML 1KXQE 3UGEA 4KXAA 2DMKA 1BFTA 5AQ0A 3GT6A 2UXGA 2NT1A 3FMGL 3O4OC 2IEPA 1LEKA 2OV0A 3SKUD 3QORD 4GW1A 2BSSB 5E2TH 1QLFA 1MRCH 3ZKNC 4FQHA 2EZ0C 2QSTA 5DXWA 4D0BA 3LKPA 3NCBB 1JGLH 5CR1A 2XN0A 2YPLE 4Y9GA 3MRJA 4EI5B 4OGAD 2FX7L 5IVZA 1OAUH 2YIHA 1RUAH 3LN4A 4GNKB 4B9CA 3L4XA 1RZJL 3VVWA 2R1XB 1I8AA 3NIFE 1CBJA 2VXSL 5F0PB 2Y1YA 1NFDA 4G71B 4QHUA 2B15A 4L1TA 1MDAA 2VAAB 5FWQA 5HHXH 2DOCA 1SUJA 4ZTOL 2EDFA 3NEOA 1B4RA 2F53D 3RVTC 2J6EH 3LRLA 4HLZG 4PV9B 2NUTB 4JREB 3RY6C 2NY0C 1PZAA 1Q9KB 4FQIL 2XFXB 3HTLX 1X4ZA 2B1AH 1JCVA 2IFGA 2YD9A 3CZFA 3VFOA 2F5BL 1I8IB 2MQ0A 1IT9H 1SVCP 5C6WH 1SLUA 3IXTB 3HOGA 2ZG1A 3FC8A 3FSZA 2EIJB 1MPAL 3OKLA 1BZ8A 4HUWB 5EHFA 2OMTB 3SBWC 4U6VH 4WU5B 1WUZA 1A1NB 4CMHB 3QXAA 4OTXL 3SJVB 1T3FB 4PCKA 3FZUC 1IGIL 3LH2H 2MSPA 3A24A 2EDXA 4JCMA 4JE0A 2EADA 4AC4A 3ARFA 1JI2A 1PZ3A 5BMFL 2VM3A 3VXUE 1UB5B 2IH3B 1EWHA 3BD3A 3HNVL 4CNIB 3OB0K 1BZ9A 2ITEA 2NY3C 4YGAB 4P9HH 3MLUH 2P24A 3VFNA 1GGIH 1P4BH 4OVUA 5AZEL 3DTXA 4PAZA 3BDYH 1T7YA 4LNRA 2EUXA 4LPYA 3D39E 2ZSVA 5D4QA 3X1GA 1RJYA 4F9PA 2CLZB 3ECWA 3WOVA 4A38A 3EJYC 5D7IE 1UFGA 5IB4B 2AEPH 2XI9A 4HMDA 4XC3L 5C0JA 5ECJE 2AGJL 4U6XB 5B8CB 3BWSA 4WI2A 3L7EB 4HBCL 1IL1A 1SEQH 1PJWA 3N42F 1AHWB 1ACCA 1BLIA 1ZSDA 3D08A 4L48A 4NC1C 4BFIA 4JK0D 2OCFD 1JJUA 1SBSH 3TIEB 3WGVB 3WIHA 1CTOA 3FOMA 2FWLB 1B0GB 1SY6L 4DP6X 3VSQA 5ICYA 4G6JL 1AGBB 2CLVB 3DV6A 1L9RA 4W9EC 3LZPA 4FS0A 4N90D 4WI4A 5C7ZA 4TNFA 4W9ZA 3IMRA 4XTRC 3ULUF 1DJZA 1OARL 2CNYA 3BN3B 2FB4H 4MMZA 5GISH 5EFIA 5I1EL 2YC1B 1XGRB 5FGCE 1BVKA 4OLYH 1TVHA 4PJIA 3GZQA 3ZDZB 3MYJA 2C3WA 2O5XL 4X6CF 5HD8D 1YN6A 2UX7A 1VEPA 5AVQB 4DPCX 3IDIB 4GINA 5CN3A 1WEJH 5JLZB 5DYFA 4Y16B 5KBPA 1F3JB 1I9JL 4PTTA 1CZ8H 1MCWM 4HUVA 3PWPB 5KYXB 1P5VA 3N06B 1WVZA 4DGYL 1KFAH 4B9FA 3EGXA 4JZOA 2CIIB 4BCZA 3BZFB 2B4CH 2DWEB 3P3UA 3GMLB 4RNRA 1JCKA 1VHPA 3PQYD 2IDUA 3QQ3A 3EFDH 1V10A 3QNYA 4YVNA 3O6FD 3GS4A 3TF4A 3QEHA 1T0MB 2A6IB 4J4PC 3MYZA 2HH0L 4S1DD 1CVRA 4PJEA 1IAII 1N0LB 4MRBA 3QWQB 5D1XA 5I0VA 3F04A 4K5PA 4Z3HA 1LYQA 3ATBA 2FEEI 3NIFF 2X4QB 2RGSA 3BSZL 1UXLA 3HC4L 2F5AH 4NO2B 3QH3B 3VWKC 4AMKL 3PGFL 1JI1A 3O9WC 5I9QB 1YNKH 3EH1A 3L45A 2HMID 4N9GA 4K7PL 4R5TA 3RILA 3W39B 2X4SA 5SX4I 4S1SH 3HNSL 1JGIA 2PTTA 4NHUA 1LTXA 1FFOB 4WU7B 4XMUA 4YGVB 1KTDB 1HL8A 1EGJH 3PJLA 1JGEB 1R24B 2FHCA 3U1PA 2GQHA 2NR6D 1MCNA 4POYA 4X7DC 4MQ7A 3CSBA 4XH2B 2BMKB 1SNRA 3MACL 5KSAA 4EVNB 1BLNA 1R5WB 4JFHE 3SOBL 1CJYA 2F53B 1UZ8B 1OP9A 4PJGA 1H3TA 3ULUD 4MJ6B 3FFCD 4EUPG 3NAAH 3LRSB 4TUUA 4P5KA 4EN3A 1BM3H 4JG1L 4XNQB 1SHSA 5TGBB 3WNIA 2X4UA 4GRLD 2A9NL 2MQCA 3EYUH 2GBAA 4RWHA 1E30A 3KZ8A 4KPHL 1NC2A 1EAPA 2ARJA 2ED6A 5D7IF 4TLTA 4XNUL 3OJVC 3GJEA 2H2PC 4TQIA 2ESVE 2XNAB 4FQJH 5DK3A 1UASA 4M5YH 2P5WD 1QFOA 3T77A 1NH6A 4F33A 1X9UA 1NGQH 5H94A 5KVGE 1MFUA 2H6PB 1PZ2A 3TJHC 3WMQA 4HJ0C 3WFEL 4ONHB 1W72B 4NNYB 1FIGH 1E7VA 1KB5B 2FYYB 5KYWB 32C2A 3WNNA 3ZTNH 4GQPH 3BAJA 4WTQA 3MLSL 5I5MA 4X4YA 1UHVA 2DQFB 3DBXA 2VXVL 5IMKB 4IMKC 2W59A 4YXLL 1BZQK 2AZAA 3S3JA 4OZHA 3LKSA 4HT1L 5FV1L 2DTMH 4XPGH 3GMOB 8CGTA 3R18A 1I8MB 2N7SA 1NLBH 2DQDL 4M93B 4AMWA 2DI9A 4DGVL 5C7XL 2QTEA 3UTSD 4N5EC 2ZD0A 1SMAA 5AOIA 1AE6H 2UXVA 4DEUA 3QIUA 4JHVA 5JDSA 1U9KA 3MX0B 5C6TH 4MFHA 2XKUA 3SDAD 3VXPA 4M62L 2GJZB 4Q6IA 4QHLB 4YH6A 5HHOA 4PRDB 5D70L 3MROB 1JK9B 1NSNL 3OAUL 3RWFB 1G9NL 3CSTA 5C0IA 4HYTB 3SDCB 3Q9PA 5GZOA 3CFKB 2X38A 3DHUA 4G7YH 2G0KA 2VW6A 4BM7A 3MLTB 3O6LL 4KKRA 4PBWD 3DWTA 4L9LC 1IGFL 1CDYA 1ILSA 4IM8A 2XWEA 4BA8A 1FL5B 2ENJA 4OSUH 3Q44A 5JNYB 3LRMA 3QWOA 3SQBA 3P4MA 3O3BB 3MRDA 4DPAX 1QYGH 1ZIBA 3RWHA 1QBBA 4E2OA 4PVBA 1GVIA 2O5YH 3QJXA 2IQ9L 3FO0L 3KPPA 5E8NA 3WHE1 3FUHA 1IC5H 3B8SA 1X5JA 3MOAH 2AJ3A 2OXGA 1YNTB 5AYQA 4LLAA 3M8OL 1WCBB 4J3OF 2BHUA 1VERA 4QRUB 1W0WA 2J8UB 2D0HA 4TLKA 5FO8A 4ZX5A 5DGQA 3L5XH 3M7OA 1B0RA 5EORL 2GKIA 3GHEL 4U31A 5AZ2L 1P5UB 1ERNA 3FQTB 4AW7A 3NTCH 4ZMYA 2HTLD 4XGZA 1FZMA 1RP8A 5FCSH 1SYVB 2A7BA 2F7QA 4NO5A 5D72H 5I1GH 4JRXA 3QDGA 4IOIA 3LXBA 1KV3A 1S46A 3VI3A 4ZOCA 5ETUA 1BAFL 3GM8A 4G80B 3FFDA 1DQJA 4TVPH 1V55B 4E9QA 1Y1DA 2LQRA 3INOA 4MBRA 4LCIH 4AVKA 3FTGA 1MHHA 5IP4A 1ZHBA 1OLZA 4GBXC 4B7IA 2AXGB 3ARDA 4NO3B 1OVZA 3NA9H 2DIJA 1QBLH 3Q0HA 3ATEA 5E1GA 5GIRB 4Q52A 2Y7MA 1A7NL 3EBAA 1VA9A 4PJ5D 3MMEB 4IBWA 4NSKA 3O3EA 3I3EA 3QEQD 4DFHA 1FFNA 3BI9X 4KK6C 2EACA 3ILPA 4JZNA 1E0OB 5F71A 2BOCA 3RBSA 2BVQB 5T33L 3FU7A 4P05A 5D5MA 5C0EB 4WI8A 4P8QA 4U49A 1DBML 4PVLA 3IB4A 5IG7B 1MHPL 2IPUK 5IW6B 2JV6A 4GSDL 4DZ8B 2APVA 2C9PA 4QF1B 2E4FA 4B9YA 4UU9A 1N26A 3HJ0A 3K0YA 3L7FA 4FE9A 4Z3FA 3B7YA 1IM9D 4YX2H 1KXVA 5EDXA 1CR9L 3LEYL 4YBQC 1NIFA 3CDFA 3SE3A 3FHQA 3HVDA 1XF5B 3HG1E 3QG6A 1KMGA 4BFJA 5DHEA 4NQCA 2O1AA 3WY4A 4PYGA 5TDNA 4N0FB 2W8CA 3K3QA 1ID5I 4GKZB 1X9QA 1NCNA 4N9OB 3TVMA 1FYTA 1PF3A 2VW4A 3UGUA 1NANH 1J7VR 3NFNA 2BC4A 3HE6A 3CC5B 4E5XG 3LMJL 1E4XL 4J3OD 3D07A 3BLPX 1JAEA 1L5GB 5DHVA 4PJCE 3MRMB 1GY2A 2VMCA 4Z7VE 3HVNA 1XCTB 2CA3A 4RFNC 4X7TA 3CFUA 3VGDA 3HN8A 5DRXA 1MJ7H 2QEJA 4BK8A 1AFVL 2NZIA 3IJ9A 1RFDH 3TT1L 1FP5A 4LVNB 3PV6B 1PQZA 3A22A 1U8JB 2OR9H 3MV7A 5FO9A 3QUKB 3VFTA 2PYFB 1MH5A 4HIJA 4Y2DA 1EAQA 3ARGA 1FNGB 3IGKA 4A7SA 2CK2A 5LGJB 1K4CA 4H44C 4G8EA 4F8TA 4DW2H 2FSEA 1CDIA 5FW6A 3VWKA 1HTYA 2CGRH 4UM9B 5FB8A 4MD0B 4G8FA 4NZTH 1S5IH 1U3JA 4QRTA 4LSPH 4QIRA 1FSKB 1HH9A 5EA0L 4Z23A 1IU1A 4FFZH 3N44F 4RFEA 5IB5B 5JO5B 3VAEA 3RYMA 3QP3A 4M9OA 1ZT7A 3RGHA 1XR9A 4ES8A 2CDEB 2VUOA 1QHQA 2WVTA 4Y1AB 1KPRA 4HCFA 5IMOB 1YLBB 4WCYH 4NWUH 3LN5B 2J1XA 5I1KH 2I85A 2ZG3A 3SY0A 3QZMA 3W11C 3FUKA 1I1YA 1XTLA 3QO0A 3RWCB 4DNLA 3QUZD 4GXVL 1B2WL 3ZDXE 3ZSTA 2UV3A 3F12B 1MRCL 4LCCC 4UMGA 3SPIA 1MREH 1JGLL 2XN9D 3MRQA 1I9EA 2DLIA 5AW1B 1ZA3B 2FECL 3S0PA 3KLHD 2KYIA 4BSVA 2G60H 2LU4A 2Y0SA 4BH7A 4F8NA 1IEBB 3DX9A 3KYNB 4Z7QF 3TBYB 2Y1AA 3HE7C 3ULVC 4EE2A 1J12A 1LWJA 1P7BA 2YS4A 3FH7A 1ZSHA 3QIWC 4FFTA 1F90L 4H1LG 4JO1H 3UTTB 3U4AA 4LEOA 4PLKD 1SHWA 4EQ2A 1HE8A 3KDPB 4KX8A 2QSQA 4M7LT 1X7TA 4E9VA 2EDHA 3EH2A 4C4KT 4YDMA 1YY9D 3HC3H 2WNKA 1GJUA 2BFGA 3H42L 4UOW1 3WTXA 2FATL 3KYMB 2VLKE 3B2DC 2BSRB 3GSNB 1QO3B 4MDJA 2QKIC 3JWOH 3D06A 3IYLW 2GY7B 2XTJC 1KYAA 4M29A 2P9RA 2RJMA 1BIIA 4PWEA 1JNNL 4JY5H 5T1LB 2Z92B 3KEHA 4D9LH 2X9YA 1LO0L 4WFEE 2HJFA 4ODTH 5E08L 3MNWB 2VDKL 5DRZA 5C2BH 1BYOA 2FE0A 5FCUL 1RI8A 1MHEB 3FQUA 4PJFB 1T1YA 2HX7A 1IC4L 3O2DH 5CHNA 3BEVA 3NZ8A 4YZWA 1RKRA 4JZJC 3SIKA 1P4BL 2JKNA 4U1LA 1V5JA 3T8XB 3EH3B 4QOKE 1BYPA 1MCHA 2P48B 5LAPA 1NAMH 2N56A 3ARWA 4FNLH 3BIBX 3II3A 1BVLB 2XWDA 4AUYA 4KRPC 3G6DH 5KG9A 4HEPA 4H8QA 4XBEL 4Z7VF 5DDHA 4ZS7H 4J28A 5H37H 5ISZE 4OZFH 3BCDA 1M6OB 5TPWH 4OM0L 4FZEL 3K6IA 2X10A 4U6HB 2ICEB 5CEYA 1XIWC 4Y2OB 3WGUB 1BREA 4FTVE 5DYOB 4APQC 4QPEA 3NP3A 3IF1B 2EIBA 4XMLH 4MGXA 3ZE1E 3UXFA 4HWNA 4AZUA 1UACH 1U8MA 1RY7B 4Y5XC 1N3NB 4OJCA 2YXFA 4P5RA 5GISL 4WQOA 1MWAH 4LVOB 5HDRA 2EKSA 1KEGL 2JH2A 2VIRB 4NEHB 3OMZA 4JCLA 8PAZA 5JPMC 1X4YA 3ZSSA 3SBQA 1YEIL 3HNTL 4H8UA 3JYBA 3VUAA 3ROLB 5EF2A 1U8NA 4BELD 4OCWH 2Y6SD 4E9RA 3PY9A 4WFHD 2J44A 1K5NB 1CZ8L 1ES0A 3BKYH 1A9VA 5D2NC 1YRKA 5IJKC 2CO3A 3IDYC 4G3YH 2GT9A 1PZUB 1T5XA 5HGHB 1MW1A 3STZB 4J23A 1EO5A 2FJGA 5BO1H 1TO4A 3Q6GL 2NXYB 3IGFA 4AQOA 1UTDA 3WY3A 1DLFH 1HYSC 3X13B 4ZNCD 4S2SB 4HG4J 2H3KA 4RAUB 2JKTM 4LHJB 3EZJB 1PIFA 5HDWA 1DBKL 3U82B 5KEZA 3KJ6H 4MS8D 1Q72H 2P8LA 3CFCL 5IOPB 1HJBC 3TEWA 3BUIA 4O2EB 2Y3NA 2F5AL 2ADFH 4DUVA 4XP9L 4YUEH 1UUSA 2VR5A 2LR4A 2YPVH 2ZSWA 1BXUA 3D18B 4RLDA 5FA3A 2XN9B 5DTFB 2CGZA 3NPSB 3N55A 3ZBMA 1JGDA 2QHLA 4G6FB 2ATKB 4ZTPL 2A6JB 2KLSA 5CFAA 4YBLB 4JO3H 4UT6H 4OGAC 3F58L 1NKGA 1EGJL 3BT2H 1I8LC 5D7JD 3FQ4A 4NKIL 3FHAA 4P3DA 2C3VB 2TSAA 3UIYA 5EO0A 4I48B 1FNLA 3SGJC 2B5IC 4JDVB 2YAFA 4NPYA 3L3OA 4BA0A 4U1GC 1I1AB 4BZ2A 2O4EA 4OZGF 1T80A 4YDLC 1J0IA 1E28A 3QHTC 2R69L 5L88L 3JTSB 4QHMA 5B38B 2D3JA 5IB1A 3UTPE 1AQKH 2FD6H 3WS3A 4NC2B 2CPUA 3CUPB 2APSA 5FDWA 1VGKB 4CA4A 2Z31A 4MXQD 4KJPD 3N43B 3ZN6A 1A6PA 2F54D 4JFVA 1BM3L 4MCMA 4NUGL 4LLWA 1IVTA 3HN5A 4HETA 1CF1A 2J1ZA 3GJFH 1W80A 1JHLH 3AY4A 1XGYL 5T5FA 3GMNB 3VMPA 3EFFA 3P11H 5DS2A 4ZAKB 1GC1C 2XXFA 4G42A 1GSKA 4AEIL 4NJ9H 15C8L 2V2XA 3GXMA 4WI3A 5J4MA 2HLAB 1CUOA 1G5AA 1KG0A 2BOLA 3QBTB 3QIBB 1LNUA 4LSRL 2D7OA 3IDXL 5LDSA 3DRQA 2ZUVA 3UZEA 3BUTA 4M5YL 5DWPA 2YD6A 4PPTA 2YPKB 4Y4KD 1QEWA 1HCFX 4RAVB 2P8PB 2ZKYA 3AXIA 5LKNA 2I60L 1NPJA 3IDMA 5GGSB 2AQNA 3WJMB 1J05B 1FIGL 5INDB 2R2HB 3NJGA 3ZE1F 2IAND 3QGVA 4PMEA 3WI9A 1QSVA 1WP6A 2BHFA 4EI6B 4HFWB 4R3SA 3KYOB 4OQTA 2X4NA 1OE2A 1T7XA 4IEFB 3UDWC 3PLYA 2E75C 3Q2LA 1WBXA 4LSQL 4MJID 3F7QA 1MNNA 2QLVB 4XPGL 1R33A 2IPTL 3L9BA 5TDPB 2JKLA 1BXAA 2O61A 3ISRA 1N2RB 1NEPA 2RBLA 4ZDHA 3DUHA 3JV6B 2HLEB 3AQXA 4X9HA 1J87A 3MNVA 1JZIA 5C6TL 3U7YH 1DBAH 4JFWA 3QZWB 1LP9B 4F58L 3IFOB 3WXVL 3N2JA 2WXOA 3HZMA 5F8QC 5FYLL 4M6NL 5DJ8A 1RPUA 3EOBA 4DEWA 4G6KL 5CSBA 4GRMB 4N0UB 1LWHA 4PJ9A 4GFXA 3HE7A 4XN5A 4AK1A 4F91B 1R3LA 1S8DA 4E36A 3BQVA 5FYKE 4ZMVA 1OM3L 1G6RH 3UJJL 5E1IA 3DGDA 2VLRA 4K3EH 4LMQI 4QRPD 3BVDB 3KNBA 4DK3A 1CDCA 1EK3A 5KVEE 5T3XE 3HUJE 5CM1A 1G7JB 1KLFA 1ADWA 2WCPA 4JM2B 2EXYD 5B39A 3RPKA 4RMTA 1VRSA 4ANUA 3MOAL 4FKHA 1MIEL 1QASA 2X1WL 2KL6A 2EEXA 3AY2A 5CJOH 3C2AH 4GXUN 1UH3A 2BWDA 3MCLL 1YMMA 3MLZH 5CP3H 3NTCL 3ARRA 2D73A 2XETA 1COBA 4JKPH 4C47A 3KPRA 5D7SH 2WKOA 3DMMD 1X5HA 4XN1A 4XODA 4KAQH 2AK4E 4JFFA 2H0PA 5EUOA 3QC5X 3W2DH 5KVFL 3PDOA 4JFDD 5TE7H 1RLWA 2VZSA 3IDJB 1A8ZA 3MBEC 5C08B 4BK4A 5C0BB 1AOZA 5D7JB 2D2CC 1CF8L 3SYCA 5E8OB 4CU7A 3BO8B 3ZTDC 3BWAB 4TUJB 5EZOL 2AJZB 2Q2EB 3HC2A 4U7SA 1EVUA 3CG8A 2NW3B 3VFGL 3JWDC 2WMPB 1LEIA 5AD0A 5AEAA 1IFRA 2YUXA 3DUSA 3VE0A 1L7IH 1JF1A 3FB8B 1BD2B 5EZLA 5BV7C 4F3FA 1ORQA 2QQKH 2XQYK 3RURA 2F8VA 2XIBA 2X42A 3FONA 3KWWB 3QZOA 3QYCA 4HJGB 1PKQB 3S2CA 5J3HD 4QWWD 4KKAC 3ARVA 4KNTA 3X12A 5J11B 3OG4B 4OM1H 1CE6B 2LAGB 4GRWF 3SKMA 2GSIA 1IIKA 2ZUXA 5AVXB 1M53A 4KROC 5FM4A 5D2LF 1BQSA 1TZOA 1AZZC 1U8CA 2YO3A 5SV3A 1F3DJ 4ODWA 4M1GH 4RFOL 1NLDL 3WEBA 2YUWA 4HX1B 2H4EA 1QACA 2X3CA 2Y36L 3EYSL 2QHRH 1F3DH 2W81C 4XXWC 4U33A 1YPZB 2I24N 2VZTA 1E6OL 3HRPA 2FQGA 3JT0A 3EO0A 3ARBD 5DO8A 5F9WB 2ZZUT 4N20A 4LPVA 4WEBL 5GZND 5IHUH 4GG6A 5EOQH 2OR7A 3NSFA 4MAUH 5CJQL 1CICB 3KJ4B 5ALBL 3FT4B 1CXEA 3LZQA 3KLSA 4N2IA 2WLMA 5ENWB 1JWMA 3NABH 2UVFA 4OLEA 5L4MA 1JXJA 4PBXA 4C56D 2N0MA 1RFDL 2B1HL 5CBAA 2JCWA 1B9KA 4H0GA 1NANI 5F1SA 1E5CA 2SEBB 2C8NA 2NLJB 1A4CA 1U4FA 4HKZB 2FT7A 3OLEA 4N8CH 1DBJH 4CN6A 4DW2L 1P7QA 1RUKL 2PP9A 5KSVA 2CIKB 3T4YB 5M7QA 2X2UA 2QPDB 4GLRH 3Q01A 2XPZA 4LSPL 3RZCD 2BVPA 3MJ9H 1AXSB 3H9ZA 2DD8L 3QJOA 5FLUA 3U0TA 4XNDA 3QZLA 1RHHB 1JPFA 1QRNB 2E4TA 1UJTA 4HD5A 1CL7L 1JGUL 4WCYL 3SJVE 2LLNA 5AL8A 3A3YB 3GTNA 4QYAA 3DK2A 3T2NL 3VD9A 4OZFB 1ZWIA 3V4UL 4Q4EA 3GHBL 2XG5A 4XHJD 1CFQA 2WV3A 2X1PA 1F0LA 3C5JB 1NM9A 2XWXA 4K8RC 5HHVH 5D7LD 2DWYA 2XG4A 1R5VB 3ZKXC 3GIVA 1CE1L 1M7UA 4YE4L 1ZANL 4XVSH 2EILB 4NQEA 4NNPH 1HILB 4OGYL 3DXAD 1MWAB 4HJUA 4LP5A 3T3PB 4F7CA 3LNDA 4MAZA 4UT9L 2I07A 4XRCB 3GMMA 3WIHH 4PP2B 3LS4H 3VI4A 4HPYH 2ZOTA 3RX8A 5DRWB 3REVB 3IJ8A 3NPZB 1UT9A 4L8BB 3K71B 5JHAA 3I6KB 3B1TA 4LSSH 1MELA 3IU4H 4YZFE 4UB0H 4NO0A 5L0QB 1AHMA 2WVVB 3VWJC 3I50H 1YDPA 2GJRA 4KJQC 1C1EH 3GKWH 3KWXA 4H8WC 1BXVA 4P07A 2QV2A 1HQRA 5IJDC 3HC3L 3DVFA 4JFYB 1DVSA 5CJXA 3LSOB 3V6ZA 3GSOB 5DD3H 3Q13A 2ZYSA 4JFDB 3FBKA 4QTHB 3MBXL 4EBQH 1V7MH 1JZ5A 1AJ7L 3JWOL 4MZRA 4H8PA 1UATA 2WYIA 5IF0B 4TVSa 3QCTH 4TLSA 3UO1H 1XH2A 3ZDZE 3EG9A 3KPTA 4O2FA 5I6NA 3BSHA 1Z66A 2W0PA 3JTBA 2DQGL 4D9LL 1T5WA 3CLFL 1A6ZA 2ADJB 3TJEH 3ETBF 2NYYD 5C2BL 3VQ2C 5JXEC 1BJ1J 3PWPE 5ESQB 2HFGH 4L4TD 4P46A 1H6TA 2WTRA 4J3WA 4D0CA 4AKOA 5D6CB 1BJ1H 3FO9B 2G2RB 2UUDH 5FA4B 5L8JB 5CN2A 4Z7NB 2NQ3A 4P4KB 5DD5H 4ZNEE 3T0EA 1NAML 4NNXB 2JTYA 2ZCZA 3A21A 4FNLL 2TRHA 4PB0L 2OKMA 2RIKA 5JORA 5L9DL 2VE6B 4P2OD 4OKDA 3UEZA 1DCEA 4PRAA 2A4CA 4BSWA 2W94A 5TPWL 4JEGB 1ZVSA 5SX5H 4WHDA 4P2QA 3NJHA 5HVGB 3HBPA 2XXCB 1ED3A 3LQAL 4YSAA 5I1IH 5CZVH 2ZWNA 5CIPA 1NMCC 5E6IB 4Y8AA 1JDDA 1QSEA 2OMYA 2FQFA 3QPKA 4RSYA 1T2JA 4J3OC 2NNFA 3NEEA 1YEFL 1M57B 2W0LA 4HLEA 1R3HB 1MCOH 2ZXDA 1DQIA 1H3WM 1ZLVK 2QADC 1DEDA 4C56B 1OP4A 1SEBB 1D3CA 4PRBA 3BGAA 1QA9B 1ZE3C 4OCWL 1QPXA 4F7PB 5TDOB 5IKCA 2FR4B 2DQTH 1MG3C 5JOFB 2OQJB 3FT1A 4YFEA 2IH8A 5BS0B 1AIFB 2ICES 3WEAA 4AGPA 1DSFL 5JW4N 1GZQB 5DWUH 3N0PB 5AYTA 3TT3H 3BRDA 2Y5QA 5HVHB 1XF2B 1F4WH 2EYSB 4LZKA 3TBWB 4Z18A 2CBPA 4HJSA 3L4CA 4HPOH 4U0RC 5ANMA 4NT6A 2G9KA 2Y24A 2B0SH 4KMLB 3T3MB 4QI3A 4V1DD 5H2BB 1RZKL 4QHPA 1ZDSA 1KELL 1XBRA 4LLUA 1INQB 5CEZL 1OGPA 1RUPH 3I6SA 5FUOH 3MA9L 2APXA 5E9DD 5KSBA 1K6QH 3ML8A 2WOBA 2OTWA 4C55A 2C26A 2G5UA 2WBXA 2NSMA 3DXAB 4H2AA 1EZUA 1VAHA 4JO3L 3IMTA 5BOZG 1JWSA 2YZ8A 1NGYB 3KM1A 2CMRH 3WEXB 1TFHA 5TF1L 3D0VB 2WM0A 3Q43A 3KVDD 2W60A 3K6SB 4AK2A 4BDVB 2F7PA 3PV7A 3D85A 2WTOA 3ZDZF 3NA4A 3PHAA 2OFQA 4GKNB 1TVBA 1INDH 1U8HB 5DD1L 2FD6L 3D4ZA 4KQ4H 1DR9A 4MQTB 4AYFA 2JLPA 1XF3B 1JTPA 5FUCE 2HZHA 1G9HA 3AXLA 3S3DB 4Y5YC 4LEBA 3IJYB 3MJ7B 4U4BA 3L08A 4DIXA 4HK0A 2V33A 1XL6A 4YHNB 1RMFH 2ITCA 1HINL 1AIZA 3CHPA 1BECA 2CUMA 2R9HD 1IC0A 2CH8A 2YPLA 3NSDA 4JQIL 4N0YH 2VSMB 3P11L 1DO6A 3DHPA 7FABH 1TITA 1AS8A 5E70A 2IBBA 2ZOOA 1X7SA 3B6SA 3L1EA 4F9LA 5F7NC 2V5MA 2MPAL 4XPTH 1LK2B 3TCXA 1AC6A 4AQ1C 3EADA 3QQDA 4FYSA 4YDVA 5GS1C 5DFAA 1CMOA 3F7YA 2BP5M 3NYKA 1QWHA 1SF5A 1J86A 4G6AD 2K9UA 2VZOA 1JHKL 4LGSB 3DJTA 4QKTA 3VGGA 1BA9A 1Q94B 3DUUA 4XCNB 5K69A 2WO4A 3L13A 2CHXA 1VF5C 4ZQKB 5CGBA 3T4AC 3ZGHA 2VDQB 4XX5A 2OMWA 3CZSA 4EXKA 5L4FA 4TQ8A 3L5WB 1NCBH 5MP6H 2J8UE 1FL6B 4HIEA 5FC9A 1MF2L 2ZUUA 4CSPA 3U9UA 1HIML 2EXSA 3JZ7A 4FQXB 3CHRA 4MX7A 3WFCH 5C07B 3S36L 5ABZA 2C9VA 2GC4C 2BWQA 4LLYB 1PGRB 5EU7E 1VGEL 3PYCA 3V4PL 2F19L 3VXTA 1U8LB 1MFDH 4W9KC 5F7DB 5KVDE 4U6YB 2BCKA 3VD3A 2BNUB 1UM6H 1DVFA 1U2HA 2A9ML 3RQ3A 3VXUA 4XP5H 3MLYH 4GW1B 2Y23A 4A7TA 3ABLB 3BPOB 3GSUB 1DJYA 3FUFA 4EJ1C 4FQHB 4YPJA 3PAUA 4DZBA 1MRFH 1PX4A 1RU9H 4UINH 2X89A 4UUJB 2DQHL 4W93A 3SO5A 3VRLF 3GLDA 3LKPB 5L4IA 4IRSC 1ZLUK 1LDSA 2X4RA 1MQKL 2IBGA 2XKNA 5HI3D 1NGPH 5HJ3A 3RKPA 5IVXA 5IVZB 1Z9SA 5B1AB 1FNFA 1GZPA 3LN4B 5I0XA 4M56A 1AQHA 3NCWA 4JVUA 1A14H 1USZA 4HCRA 4RBPH 1R9FA 1CFTA 1MFEL 1RZ7H 2JIXD 2KZKA 2QGDA 1NC4A 3HPLB 2DYPA 3GBEA 3R4RA 5DS8B 5E0QA 2XICA 1JXKA 2LVEA 1MCEA 1U93A 4JPSA 3ZKQD 1IKNA 4XAKE 1E9OA 5I15H 2WXQA 1QSFA 5DJ0A 1E5ZA 4FXGA 3TA3A 5B1KA 1FO0L 2VITB 1S9XB 3S8FB 3C5ZD 3TX4A 4A7GF 4APXB 1B3IA 1P2CA 4B5EA 1P4UA 1VACA 3D69B 3ZKMD 4OJDH 2CRIA 5IEHA 4UQ9A 1MSPA 1C5BL 5DEJA 3GB7B 3KYKH 5CGMA 1M7XA 4JL2A 3OKLB 5D71H 2AAAA 4JAMA 2KZ1B 4EI0A 4XMKL 5DHVH 2FNBA 5A2JH 4WW2F 2O5ZL 4YHIA 2WBKA 1PY9A 4RRPA 4JM0A 4H25A 4OF0A 1AXIB 1TJIH 3FN3A 3I9AA 4PS8A 1BZOA 5HPOA 1TTFA 4WK2B 4YK4C 2EXTA 4DUXA 4YDIH 4Z95H 1QBMH 4L5FE 4ZXBA 3ZR5A 3W0WD 1G7HA 2ZWKA 1CLZL 2CO6A 5KN5A 1D7FA 5GS2H 4F7KA 2P24B 1WGOA 3VFNB 3UJTL 1WUNT 5JA9A 4QRRA 3PL6A 4M6MH 2J43A 3MQIA 1J1XH 2AEOA 2VO5A 4P57A 4AENA 4EPSA 5FHAL 2QSCH 2X4PB 1SFHA 3OX8A 5E6YA 3H3PL 4LPXA 3KDMA 2EDNA 2QQKL 4NZJA 1IL1B 3CSFA 3RJQB 2UWEB 3AQDA 1HK6A 1ZSDB 4UQAA 5HHNA 4MXQC 4BFIB 4AEEA 1NDGB 4KJPC 5IQ7H 4P9ML 2QQLH 2YWYA 3FOMB 1TTUA 4N25A 5FO2A 3AWEA 4K7FA 5EB9A 2JNZA 1PG7H 4V11A 3DV6B 1RIUH 4Y1AE 4WJKB 3AMLA 4JY6A 4LNVA 4U1NA 5MI0C 4K94C 4H0HB 5DO2C 3L4ZA 1YNTF 3DIFB 1HEZB 4GW5B 2PXYC 5IIEA 3BVWA 4MD5B 5EBWA 4W9GC 4PWKA 1B6UA 1A02N 1BWMA 2IOMA 1U8QA 4G7QB 4HKXA 1CK0H 1OY3B 1P7KA 1YN6B 4QHNA 4U1KA 3IKCA 2MCPL 5IHUL 7PCYA 4ABUA 4JGUA 3AUWB 3O8XD 4ZYKA 2QMKA 1CD9B 4Z8FH 1V3KA 4RGMC 4B7LA 3NT0A 2XWTB 1P5VB 2AABH 5SV4A 3M17A 3NABL 3I9GL 1EJ8A 1S7RA 3QJHA 4JZOB 3VTTA 3VXSB 3QWNA 4RNRB 2HKFH 3MI6A 1RUQL 1UOVA 2PO6A 4AGLA 3BP7A 5IM7A 4U1JB 5K9JH 4ELDA 3IT8D 1VZHA 2BH0A 4XN9A 3UTTE 3WIAA 2YAOA 3QDJB 2ENSA 3DIDA 5FYJE 2J5LB 4PRHE 4ZOBA 5F9OH 5JPNC 3PP4H 4N8CL 1DBJL 4PJEB 3WN6A 1D9KC 5E1QA 1B3JA 3OB0H 4WKZA 2KZBA 3U6RB 1QWUA 2C9XA 4LSUH 3UACA 3MJ9L 3LNFA 3PHOA 3VNZA 5BRZD 3GUTA 4KKNA 2JJWA 3WEOA 2B9BA 4OFKA 4HC1A 5L2KD 3WJJC 5A6LA 4JQVA 2ZICA 3DI3B 2VQ4A 3TYGH 2PTTB 4NHUB 3QO1B 1LO2H 3DJZA 4FADA 5GGUA 3TBVA 5C0RH 4AQ8A 1F02I 2QVTA 2OW6A 1J8HA 4GAJH 4HHAA 3M1BA 3TBTA 3VRIA 4JGHA 1F2XK 1MNUH 3NH7H 4YAQA 4PJBE 4PJFE 2OL3A 1KCWA 2DL9A 5KZCB 4QHKJ 2XBDA 4KNSA 5C0AA 5KSAB 3CVDA 5CLZA 1BLNB 4NNPL 5FFOA 5HPMA 4A6YL 4H8VA 3GRWA 4Y9CA 3LIUA 2UZPA 5ITBL 3WIHL 4FXKA 1DVZA 4HPYL 1FAKT 1AR1B 2WBWB 3IPFA 4AKPA 1HXKA 2HTKC 3MGOB 3NIGF 2DQIL 1H5BA 2ZOWA 3D5OF 1MJJA 2Z8VC 3MV8D 4W68A 4EN3B 1NUNB 3IU4L 2GCYA 3F5WA 4Q58C 4HULB 4MA1C 3A6CL 2DQCH 4KXZH 3NJVA 2X2YA 3BH8A 3CLWA 1C1EL 4ESKA 5FXCH 2ZWZA 2XC8A 1NC2B 3VTMA 1EAPB 1KACB 4ZFOA 4M7ZB 3DMMC 2ARJB 1FVEB 1UA7A 2X1XR 3QRFM 4ZQTA 5DD3L 4KKLC 2X0VA 4X7EC 4Y19D 4FZ8L 4JN1H 1KCRL 2RB8A 4N2EA 1JGVH 4RMQA 3OXSB 5A43C 4LPTA 3K1KC 3HG5A 3RJDA 3UTOA 5HSFA 2H5UA 3F01A 4XB7A 4M61A 1LL1A 3GNMH 4ZO9A 4ANWA 1T0PB 4ZUVB 3DJSA 3TJEL 1KDIA 1G94A 4MNGA 2E7DA 2FO1A 4UILL 1TLKA 2OSLA 2EE0A 5C0FA 3RI5F 4KK5C 5CWSA 4X4YB 3U30C 3B5TA 3DBXB 3LDBB 1OSEA 5AW3B 4AJ0A 1TPXC 3AUVA 5ELIA 2XPYA 1Z5LB 3S5ZA 4OZHB 3LKSB 2EJ1A 5B3JF 1UA6L 4BKLB 1KYFA 5SWZD 3P9MB 4FQ2L 2X41A 4R97C 1HDMB 1KCVH 2R27A 3ZGIA 3BZEA 3QIUB 5JDSB 1ILUA 2AJXL 4CMMA 1HE7A 4GH7B 4JLRB 4Q6IB 5TQ0L 4ICXA 5HHOB 3P4NB 2OK0L 2ITFA 1S5HA 3PNRB 5KBLA 3BHBA 1OAYL 1UKSA 4NI6A 1S9YA 4A63A 3FAWA 4AZ8B 3LTVA 4FLQA 3C6LA 1FH2A 1IGTA 2HXAA 2W9EH 2BXYA 3O8XB 1A4JA 2FHBA 4GAGL 4TNVF 4ZTEA 4BZ2H 3K0WA 4WHTA 4YL9A 4YWGL 1IARB 3BFQG 5DI8B 3B56A 4H5SB 5G4MA 3L3HA 4G43B 2K45A 1RSFA 3J8F7 3P4MB 1F6AA 1N70A 4IGBD 3NFSL 3EFOA 5I76A 1OE1A 1XB3A 4LLMB 1Y18A 1X5KA 1AP2B 1KIQA 3KPPB 3QULA 5E8NB 1LQSR 3UL4A 3KVPA 4OLUH 1J18A 3BE1H 4I18A 1KPVA 2AJ3B 2OXGB 1GOFA 1UYWH 1KBKA 2N0KA 4AMXA 5T5FH 2EIKB 1WCQA 3C5SA 3DOHA 1QKZL 1WZKA 4GMTH 3HG1A 2NYKA 5LCVL 2AJVL 2AQSA 3NGBB 4PJBF 4JBSA 1NGXA 3N9GL 1CGTA 1ZPUA 2XPGA 3MKKA 5DWUL 1FZMB 3D34A 4WK0B