4BKTC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
137
Chain Sequence
VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 34
structure length 137
sequence length 140
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bktC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bktC01
4AWJC 4WQOA 3ZUNC 4BKTC 1VCBC 4W9JC 4W9IC 4BKSC 4W9LC 4W9HC 3ZTDC 4W9CC 3ZRCC 4AJYV 1LQBC 3ZTCC 4B95C 4W9FC 3ZRFC 4B9KC 1LM8V 4W9EC 4W9DC 4W9GC 4W9KC 5LLIC
chains in the Genus database with same CATH superfamily
5IB5A 3HN5A 2K70A 5CFHA 4X6DF 1TF4A 3O3EB 3HG1D 1WIUA 1BZ7B 2ICWI 1RUQL 5DJ0A 1K72A 2XVLA 5T1MA 2FEDD 1P4BL 3ARRA 2C1PB 5H94B 2Z8RA 3WCYA 2IV8A 3C5ZC 2NT1A 2WP3T 5D71L 3V0VB 3VD5A 4HS8H 4NLHA 3CE1A 4FQQA 1QD0A 2JJUA 2VDNH 3RWIA 1A25A 3ATEA 3OWEA 3QZWA 1R5WB 2X88A 3NZUA 1FHNA 4Y5YA 4H8PA 4BELD 4HG4K 1A6WH 1V05A 3GMLA 3PIQA 2M8XA 1JV5B 3WFCH 3RHWK 4HPOL 3ENEA 1RZ8A 2WXIA 2DQCH 4JZJA 4JPWH 4O02L 3UG4A 2EZ0D 2IGTA 1CD1A 4AQAA 3U30C 4LRIA 4FTVB 1MQ8A 4AG4L 4YSSA 2GK2A 3GSQB 3HKFA 1R3JB 1ECZA 2NXZD 2MQ3A 3P4OB 3BUIA 3D3VB 3WXWL 3SPCA 4ODUB 3VU1A 5F2FA 4MSWA 2FX8H 3K2IA 3DX8A 3Q0HA 1VGEL 1XD0A 2V9TA 4ZO8A 2HTKC 1BJ8A 2BCMA 5D1XA 3RPIB 5IW6B 4N0FA 1B90A 1F3JB 1QX1A 4IOFC 1Q9LA 2FGZA 3V4PL 1ZGLB 1NC2A 2CGYA 4PJFA 2WZ6A 4FABL 2C3WA 3PXJA 4WHYG 3UTQA 4NGHL 3X3FH 1K3ZA 3SKNA 1N8ZB 4HWZA 5MENE 2HYMA 1TQUA 4WW2A 3O11B 1RK1B 3U9PL 3HUJF 2VMFA 3EYQD 4XVSL 1DN0B 3L4WA 2BXYA 3WKYA 2E4FA 3D2TA 2YPLA 4WW2C 1NCCH 1NAKL 1OE2A 1T7YA 3DECA 5EZJB 3TV3L 4YXLL 3NAAL 4MDIB 4PV9A 5IV2A 3EUUA 4BKSC 5E1IA 3X14A 2WSKA 5IUCA 4EDXB 1ACXA 2WXOA 1IAII 1JGDA 2PCXA 4A1RA 1MI5E 4I7ZC 1U8JB 2XPZA 5K39B 5BPPA 5KYXA 3RY6C 1F4YL 3GJEA 5EN3A 4ZMAT 5ID1A 2HVKB 4YMPA 1O7VA 2FECL 2ADJA 4NUPA 4W4OC 2XWJA 5EEWA 1AJ7H 3OSKA 3TPKA 2HN7B 2ZKMX 2A9AA 5SWSA 3CZNA 5C07E 2FSDA 5GRUL 4TNGA 4HGMA 4MYWB 4BV1A 2VL4A 1X5AA 2VYRE 5GPRA 3GTTA 4HJGB 2MPAL 3UZEA 1OHZA 4OJEH 1WEJH 4H20H 4L1HA 1GHFH 3NESA 5KYUB 2AJZB 4BFJA 1RUAH 1T2JA 4FQQB 1D5MA 1N67A 1FAIL 43CAB 4ADJA 3U7YL 4PD4K 2MCPH 5BZWA 3IMTA 3NFNB 3MLXH 1U4EA 1YMHA 3JV4B 3ZE1E 4ZW3A 1R3KB 2GW5A 2HT3D 2YUVA 3QUHA 1GVIA 4CC0A 3M86A 5F1OB 1I7UA 4PGJA 1PZDA 1NMBL 2OX5A 4ZNCD 2P8MB 2VN7A 4C56A 1ZGLA 1T0NA 1YPZF 2J6EL 2ZYIA 4IDLA 4YHIB 3WD5L 1N5YH 4LT7A 4O02A 5SV4A 2G3MA 3OX8A 1FNAA 1EMTH 1SJEA 1BM3L 4FZ8L 1KPVB 4G71B 5EFIA 5ALCL 1A6VH 2A6JB 2GCYB 3DI2B 1G7QA 2XN9A 5GSRB 4PS3A 1KCBA 4B6ZA 3OKKA 2B77A 3BP7B 1DUYA 3T1FB 5KAQG 3P3RA 4QEGA 3UTTE 4X6CB 1Y0LB 4ZTOH 3QZPA 1OCWH 4A2EA 4NNXB 4NZUL 4NYLA 5F3FA 5DZOA 3S2CA 2I5YH 3CD4A 4UZSA 1IQWH 5DRXA 2A1WL 1M6OA 2EDKA 4I0CC 3U9UB 4WEMB 1VCAA 1GOGA 3MRJB 4I9WE 1IAIH 3NEOA 1ZLDA 5DI8B 3HMXL 2B2XH 4P2RA 4S1DD 3V0FA 4IGBB 2F74B 1OQOA 2ZSVA 4JFWA 2NY0C 2BNUB 4PJAF 4FQXB 2N01B 1S2EA 4R83A 4J28A 5DUBA 5GRJL 3RJQB 4LZKA 1AG0A 1FUNA 3F7PC 4HCFA 3CZUB 2FWOB 2K8QA 3GBNH 4Z7UB 1ZLUH 4EDWL 4PRHE 1T20A 2VC2B 2YPKA 5CAYB 1BF5A 1MVUA 3BP5B 4M4RB 1LO3L 2P47B 2R2HB 2UWEE 3HC0A 4XCNB 2C4XA 2JF1A 4I48A 2Q86B 3VYPA 1ZTMA 4PVLA 2CIIB 4XN7A 1BHGA 3MDJA 5C6TH 3DURA 3VA6A 3X13A 2DQIL 5KVGE 3SIKA 2WLJA 4LOFA 3UBFA 1CG9A 3U4AA 1EWHA 1J8HE 4MASA 5E5MB 3FF8A 1RJZB 4OLVH 1MLBA 2ED9A 1I9IH 4DP9X 2EE6A 2IMMA 3MRMB 5DD0L 5GGUB 4JG0L 1DFBL 3BWAA 3CDZA 4I9WD 3GS0A 4HPYL 2GJJA 1FGNL 1A64A 3UH8A 4QIRA 1J5IA 1DE4B 1ZIAA 1DBBH 1ZGLM 1FG2A 1A7QL 1ZPUA 5KN5A 1FO0B 3HEIB 4NXKA 1OT1A 4ACTA 4AW4A 1CFNB 1QYGL 2K6ZA 4M5TA 1BXAA 2X3AA 3Q1EA 3ABGA 2XTJD 1LL1A 4HFWB 5IEHB 3PQYD 1TSRA 3T0XA 4DKTA 1AI1L 1J8HD 4LF3A 5JXAH 1S7UB 1KIRA 4J2XA 1ZKAA 1C1EL 3PDDA 4FABH 2EO9A 2HJFA 2X42A 3ETTA 3H42H 3QZMA 3X3FL 2VR4A 4R90H 3SDCB 5C08D 1NDMB 2MOGA 3KNBA 4F9PC 5AOMA 4ZAKA 4TQIA 3RUGA 1GZPB 1KV3A 2ZOLB 5I5RA 1K85A 1H9DA 1Y6NR 3APCA 3VG0L 1HINH 2KDGA 1NCCL 4KKRA 4NZTH 3ZL4L 5KBKA 2O5XH 5AYTA 1DO6A 2PP9A 5AAWA 1R47A 1I85A 3ME0A 5JYMA 1KB3A 3HVDA 1V7ML 2EVGA 3KR3L 3MRMA 1D7FA 1RJLB 1VZIA 2MJWA 3H54A 4HCRH 4PGEA 5A6MA 5KSVB 5CGYC 2RIKA 3DIVA 1E6OL 1HZHL 3QIUA 4NFDA 1WWWX 2V5MA 4PJ9A 3B7RL 1H0DA 4HOZA 4Z1PA 2ZAGA 3C6LA 1XR9B 2IGFL 3IETB 4GRMA 4JMNA 2FEDC 2AK4E 3PY9A 4CVZA 1CG9B 3NJFA 1VEMA 2ESVB 3ZDXE 2P5EE 4NZRH 1Z9SA 1M9WA 4OD2B 4GIAA 4LVOB 2DJ4A 4JFXA 2XQYA 4M7JH 5MEPB 4RFNC 3UIZA 4DCQB 4ZMZA 4FJYA 1Y6MR 3WDJA 4NSKA 1KJ2H 1NUGA 3VGAC 1AGBB 5CFAA 3LN5A 1T20B 2BLFA 2VGLM 2YPKB 4HIEA 1FBIL 3FRPB 4NJ9H 1YVLA 2GAZA 3MLUL 2WWMC 5I6OA 1USZA 4RGNB 2YWZA 2VRQA 4QTIH 4IJ3B 5CGMA 5I0VA 3MUUA 3US1A 1UD2A 4PW4A 4TQEH 3OWRA 3WUWA 3DYMA 1QSFA 2FJHB 2WWKO 4UQBA 1ETB1 3BUTA 1MHHA 2TRYA 4TOYH 3VGBA 1BD2E 1CGSL 1HNFA 4GQQA 3AS3A 3PL6A 3VFMB 2F19L 5C07D 2NTFB 4AQEB 5JTWA 3KPSE 4OGAD 2QDVA 4BEIA 1J87A 4OQTL 2L4OA 4X8GA 4G8GB 4F57H 1V10A 5EUKA 4A6YH 3L4UA 4NAQA 5AFAA 2XI9A 4MA3B 2CE6A 1G9ML 2EUVA 3QS2A 5J0BA 4YAQA 4KTEH 2CRZA 3UFIA 4YBLB 1MREL 4MZ3A 5C07B 3T0AA 1L0QA 1JZ8A 2K1MA 1FIGH 2A9DA 4GLRI 4TSBH 3VXMA 4E9RA 3PWPA 1NC4A 5FYKU 4JPQA 3EADA 4ILDA 1P5VB 3WBDA 4PREB 1XH3A 2VXQH 3RVWC 1FYTA 5J57B 4GKLA 4EVNA 3UJIH 4NDMA 4ODWB 3AWEA 3MUHL 2R2EA 3E8UH 2WZPD 5K69A 1WBXA 5CO1A 5CD3A 2R15A 5DVKA 1HN1A 1OALA 1BFOA 1ZTXL 2OJZL 3MRBA 1TQCB 1WZ1L 3U1SH 2QQNL 1V3JA 3EYVA 4M6OL 3FUIA 3KH4A 3MA9H 3MRGA 4PVNA 5DZLA 4ERSL 2WVTA 1Q0YH 2VLRA 3RE0A 4KH9A 4OCLC 1GPOH 1P9MA 1Q9WB 3ARVA 3B9KB 2E7HA 3RL1B 3QIUC 3DO7A 1XF2A 3ARXA 4PP2B 4ZQKB 5B38A 3WS6C 2YQ2A 5IQLA 1AP2B 4FQCL 1IC0A 5TF1L 1FGVH 5E5RB 3L9RB 2H0FA 3NPSB 3D9AL 1LDPL 4PGZA 4PRAA 3RWIB 2XUWA 3RVVD 5ADOL 3TL5A 5BVPL 2R29A 3F58L 3VWKD 5DT1H 15C8H 5AW5B 3DDGA 3D87B 3LNFA 4EKXA 4OCRL 1UWXH 4FAAB 1SMAA 4P2YA 3P2TA 3LIUA 2PO6B 3FUKA 4YEEA 4KKLC 1XH1A 2GUOA 1S7TA 1F0LA 1NTDA 1SPDA 3NJHA 2BC4B 3HAEH 3BSGA 1CLOL 2N0KA 1A4JA 4PPTA 3V0HA 2A73B 3O2WL 4KK9C 1MFCL 3U46B 2ZUSA 4OLWL 1EJ8A 5F1IA 3PGCA 4TTGA 1JGUL 4F7EA 4Z78A 3ULUL 2GTZB 3EJPA 2J88H 2HFEB 4Z8FH 1DBBL 4JFHD 2YUZA 3NJXA 4YSRA 4OUUB 3OZKA 2WCPA 3FOLB 1SN5A 3PHQA 3S8WA 1A7BA 2MMXA 1QYGH 4N2CA 4PGDA 2XN9D 4CJ0A 2R56H 4AH2A 4NZDA 4JN2A 3MVSA 4JFEB 3CX5J 1DVZA 3ZUCA 3CFKB 1OCCB 2PWDA 4R2GB 4NQXB 1MCFA 3IAGC 1PCSA 4OF8A 2ITFA 1NSNL 2J2ZB 3T1FA 2VERA 3ULVD 2Y07H 1IKFH 5FB8B 3P9LA 1R5IB 3MR9B 1BQ5A 1RUKH 2IAMA 2R4RL 2YSTA 1T1ZB 2XZAL 3DUUB 3CIAA 3RJDA 3V6FB 1XR8A 4TUOB 5CMAA 3D0VB 4JG5A 2WZAA 3L3DA 2P5WE 1J86A 1KNOA 4OIIL 3HZMA 5CU5A 1Z3GH 4RAVB 3GMMB 4RWHA 1F2XK 3MJ8A 1WF5A 4PJBA 3UTZA 4Q7DA 5HGAA 3B8YA 5BV7B 5MEOA 4MCYB 5C0NC 1O5DT 1KGCE 4XMLH 2NY3C 5FYJU 3RWGB 1P5UA 2NUPB 3LS4H 3ZT5A 1ULVA 4BJLA 3WY2A 1BD2B 2E5EA 1AXTH 3KHQA 4KI1A 1R34A 2WBWB 4GW5A 5DVOA 4ADIA 5IFHL 3CC5B 3RAJL 3AMKA 4LPCA 1V8HA 4XP1H 4F7MA 2VXUH 3LZFH 1YEIH 1BZOA 4P06A 2CWRA 3SJVB 2OR9H 1BG1A 2W8CA 2WKOA 5C0IB 2CPUA 1IGIL 1IUZA 1CU4L 2X9WA 2YAEA 4UNVA 4P2RE 1UB5A 3CZJA 4S1SL 2OULB 4P4KC 5DK2B 3DGGB 3PHOB 2VLKE 1XL6A 3MLUH 3MACL 1AR1C 4Q2ZA 4G8AC 1QBBA 1CLZL 3B2MA 1NCAL 4JHZA 4KO6A 1LK2A 5F1NB 2FHCA 3CDYA 4JG9A 3UBXB 1T22A 3QDGB 5T3XE 4KHXH 2DV6A 5EDXA 5A2KH 3RX8A 2XTLA 5J7CC 4L8CA 1KXQE 3EJZC 3NABH 3AREA 3FU0A 1MQKL 4JRYD 1NAMA 4Z7WA 4PRBB 5B8CB 1RUQH 2WXPA 1F4XL 3IDXH 4UV7H 5E00A 5IMLA 5C0JB 2J7LA 3O45B 1O6SA 4PBWD 3QJZA 4LPYA 5GGVY 4JQVC 5D1XD 1VEPA 3QB7C 5GGVH 3EDEA 4L8CB 4K94L 5TPWH 1UATA 5GS1C 4ONFH 2I27N 4KROC 3GIVA 4JRYB 1UA6H 5BQDA 5D1QC 4KK6C 5HHMB 3W11D 2FLMA 5I19L 1BZEA 2X4NA 4GG6E 1ZLWH 2AVGA 2YD8A 3CK0L 4JG1H 3SZKC 1E8WA 4MCYA 1ITCA 1EHLH 2D4FA 1E50A 3OM3B 2X87A 3JWNG 4B5EA 1MIEL 3QXAA 5D55A 3WIHH 2WUCL 5LN8A 2ZXCA 4Z7QF 4ERSH 4APQB 4LIQE 3RX7A 1ND0B 4FA8A 4ATWA 5J4MA 4PY7A 1JWMA 1KFAH 4LSVH 5I0YA 1AKJD 2VW7A 5I6PA 3TBTB 3ZDZE 4A39A 5I75C 1HL9A 4G1EA 3ARQA 1SY6A 4D9QE 2VDPL 1RHFA 5DSCA 1BXUA 2C4FU 1FNGB 1RIUH 3BP4A 2ZNWA 3ZQWA 4LKCB 4TVUA 2J6WA 1CGVA 1LO5B 4Z76B 4AM0B 4E9LA 1TQSA 5T33H 3Q3GB 5H37G 4U1NA 4P9HH 4U1SA 3HG1A 4WU7B 3WLWD 1MDTA 2DLTA 4M8QB 1REIA 1TMQA 4DKAA 3UAJD 1AZNA 5C9KA 1QUNA 4QT5B 3N0AA 1CXEA 1T0MA 1QASA 4HALA 4P46B 2W0FA 2ZP0T 4Z3TA 2K0RA 3H6AA 4R7NA 2AV7B 5HDBE 3QEGH 4LEXL 3MNVB 4HP5A 2HWZL 4H8WL 4PRHB 5EU4B 5C0ND 1COBA 4D9QD 4YXHH 1JYWA 3MJ6A 4YE0A 3OHMB 2HSIA 1C5DA 4HU2A 3JVFC 4NQCA 4U3HA 1CFSB 2HKHH 3VD7A 3HE7D 1C12A 1GS7A 4NKQB 5AWNH 3TN0B 3CFTA 1IGJB 3T08A 3VXUB 3QCUH 3ZYZA 2BIIA 5JOFA 2VLKA 1B6DA 5I24A 1M1XA 4C8XA 5E9AA 4F27A 2A83A 1W72A 4QXGL 3BUQA 4MXWH 5ISZE 3NN8A 4XO4A 3KCPB 1RLBA 4XGZB 2XXMB 2CKBA 4FXKA 4Y5VC 3BH8A 3C5SB 3K2MC 4MJID 2WIIA 2I69A 2VQTA 1Z9PA 2K7QA 1LO5A 1TITA 2G60H 2FNBA 1HSAA 4JEGB 4ORZC 3TN0A 1KXQA 4DAGL 4F2FA 1NCWH 4ZMQA 1M2OA 5I71B 2Y07L 3RFRA 2PWHA 5JHBA 1LEKB 2ZWKA 3QYCA 4IS6B 3I50H 2CNYA 3MHZA 2WMPB 1Y07A 5MEND 1DUZA 2GTWB 4N22A 5DJ2B 1NC2B 3QNXA 4G9DB 5HGAB 2MCPL 3HLAA 4JM2B 2IQ9H 4IBTA 4HWNA 4P46A 3NIDE 3LKOA 1KNOB 3VA2C 3BEWB 1PZAA 3O6LH 2VLJD 1S3KH 3CGTA 3FH5A 1JWUB 4I0KA 4DP5X 1P4LB 4L4TE 3DX2A 2ZXEB 3AB0C 3I9AA 1E40A 2AXHA 4PHXA 5CLTA 5FGBA 4D8OA 3WD5H 2FTAA 5JW4N 4F7CB 1L0YA 4PJ5B 3PXHA 4QR7A 4JN1L 3BVUA 5C6WH 3VXUA 4GBXA 1I7ZA 1QW8A 3MRQB 2KLSA 3W0WD 3T8XA 1TEFA 1LO0H 3FNKA 1ACYH 2NY5H 3N1MC 4FG4A 3B4NA 2VLJB 4EE2A 2E59A 4FTVA 4WW1B 4TNWK 1I8KA 4XCYA 4M3KB 4OAWA 3ARFC 3IM1A 5T5NG 1Q9KA 1DR9A 2BSSB 4XNZB 3SGJC 3UEZA 1KACB 3RA7H 2O5ZH 1ILUA 4KKCC 1BFOB 2FQDA 2PO6A 3F84A 4AGQA 5FCUH 4Q89A 5HHPB 3J8F7 2YQGA 4AX3A 1QSFB 2FJHA 4HG4J 1MWAA 2ICWJ 4DP8X 2NPLX 4QPEA 4UAHA 4KDTA 4JJ5B 1JZGA 5GRZA 5IVXB 3C60D 1SNRA 4JRXE 4WCYL 3MRLB 4XNUH 1H5BA 3VMOA 1NPNA 5ICXB 3MJ9A 4LPWA 4WI7A 4EIZC 1Z0NA 4OZGB 1IM3D 3EOBA 2NX5D 5I0XA 1YQVH 4ABUA 1SYVB 5BOJA 2FBRA 4ZPVB 4P59L 1KFGA 5JPNB 3Q5YA 4P2AA 3ZK0A 2ZKXA 1JVKA 2P52A 3FHAA 3O3EA 5CJ5A 3ARBD 4MJ6A 1YY9D 2EH8L 3IDXL 2WYTA 3RL2A 5GGRA 3BVNA 4GBXC 5CP7B 4N24A 4F58L 4XCCL 3F7QA 1RZIB 2H6UA 3MV7B 5D6DA 4PWHA 3NIDB 2BNRB 1HKFA 4UQCA 3VI4F 1QI4A 1UFUA 2UV3A 4NZ8A 1MY5A 1KCRH 1UKSA 1P6AB 4H0IA 2XTSA 3AUWB 1A7OL 3LXBA 5IW1A 3L3HA 2ZIDA 5J1AA 1UA6L 2VMEA 2I07A 4RWYH 1TVBB 5B1KA 5IFAL 3OGCB 4P46C 4KUCF 3NMEA 5I76A 3JV0A 1IJ9A 3MBXL 2FBJH 3RU8L 5JLZB 1YUHA 2V7HB 4MA7L 2QJDA 3X1FA 1MIEH 4V11A 1Q9WA 3AM8A 3B9KA 5AW2B 5B1AB 5T5FL 1XGPB 1DQDL 2WUCH 5DD0H 5L4MA 1T2XA 2EYSB 1KSRA 1RSFA 2LU4A 3HPLA 4H88H 5JW4R 4WEEA 3ZHLA 4LVNB 5HHOB 2XWEA 2N1KA 1HEZA 2CCVA 2JB6B 4QO1B 4J8RB 4LSVL 2X3CA 1I3RB 5D1XE 2DQEH 4PJXE 4P5TB 4HOXA 1AS6A 4JREB 3F83A 2Z1KA 2VDQL 3LX9A 2OMBA 1KXVC 3SYPA 3QQ9D 4NQDD 4Y16C 3GMPB 2VJXA 5J1SC 2ZF8A 2ZXWB 5LVEA 3KWXA 1OL0A 4G9FB 4ISVB 1AR1B 3AY4A 4Y16A 2DY2A 5D6CB 4Y7MA 4NQTA 5AD0B 2ZCHL 3N44F 1ZSDA 4XP4L 4NQVA 3SDXF 1N4XL 1FL6A 4TNEA 1PZUB 1I9RL 1TLKA 2CM6A 3AFLA 3QPXL 3K7UA 4ICWA 2JKTM 3QIBD 4AEHH 5I6KA 1Y6KR 3W1ZA 5FC9A 4L3EA 3MUJA 5G4MA 4P3WA 4Z7AA 5L2KE 3IVKA 1MHPH 3B9AA 1OAXL 3RP1A 1NFDE 2R51A 1R5WA 2AKRA 2OZ4H 4GLRH 5H35A 3HE6C 3GHBH 1BMWA 3D85B 2H2PD 3QT2A 4YC2B 1KG0B 2GTZA 2JKRM 4PJEB 1S7XA 1XGUA 4H8WH 1BAWA 1E27B 4X83A 4DP6X 4ZUVB 4XVTL 2CALA 3DBXA 3ESUF 3ESNA 5K9OB 2LAGB 3GI8L 4DVRL 2IXQA 4QXVA 3SE8L 3IJEA 4NN5C 3X1NA 2EACA 2LVEA 3PWNB 3ARGD 1WGOA 2I24N 3NT0A 4HIIA 2EDHA 3TCXA 1MJUL 4QMEA 3TEZA 3TJEH 2PYEA 3CZLA 1G1CA 1BCIA 5HBBA 2FJFA 4KTDL 4LHQB 5JLZA 1A14L 1T7XA 1XSOA 3BZEB 3RY6A 4PRHD 3IYLW 5EHFA 3TU6A 1OAQH 4KDVA 1J1XL 4M3HA 3BJLA 1CBJA 1N5AB 2DJSA 3G04A 4WEUD 4JDTH 4UU9A 1HCVA 1MG3C 3WDIA 4YS4A 3PJSA 4B9JA 1IFGA 3RURA 5FO9B 1U2CA 3ARDD 3SJVD 5EBMB 1MLCA 3TNNB 4NP4H 1YJDC 2H1PL 4EIUA 3O4LB 4PBXA 4XPBL 3CVHA 1FFOB 1X5IA 2VJ8A 1FZKA 3SEPA 5C8JA 1EFQA 5F93C 2Y2WA 5GZND 5ACLA 5C09B 3OGOE 4PJAA 4NM8H 4JN1H 2CM5A 1ITBB 3QJHA 3I9IA 4I3SH 1GYCA 3COOA 3P3TA 1C5CL 1GGBH 3MGAA 5HHXL 3SKUD 1RJZA 2D03L 1ZVSB 3B6SA 5G5DB 1OGAE 1AC6A 1ZCRA 2OSLB 2YBRB 4NN7B 3UJTH 3ULUE 5CINH 5FM8A 4OB5L 3NBNA 4MJ2A 1KGIA 3SBQA 1HILB 2XVBA 2XJKA 4ELDA 3WUWG 4N9OB 2A74A 1S7WA 2HX9A 3GB7B 4U0RB 1QRKA 5ITFA 3TP4A 3MRIA 4RMUA 1TKWA 1RSYA 1SYVA 5JPNA 1DVSA 1JXFA 4J3SA 2X2JA 4XWOD 3FDWA 2VABB 1BFVL 2XKNB 1DL7L 3MYJA 4U6HB 1IFRA 2R83A 4MBRA 1D7CA 2OS7A 4HWBH 4AM0Q 3CX2A 2HLEB 4HEPG 4TVPE 3FQXB 1IU1A 1E65A 1K5NB 1WCQA 3BKJH 3LJ3A 3WUWB 1CICA 4BSWB 4K9EL 3RWJB 1MCKA 4XODA 5F71A 3AU0A 5E99L 4GAJL 1LDPH 5BVPH 5ADOH 1BQUA 4KRPB 3F58H 1JZDC 1CTNA 4I48B 2Z9TA 5D1QD 3W11C 3MNZB 4X6FA 3VWJD 4QCIA 1RZKH 1JF1A 4HUUA 3IJEB 3MCLH 3O4OB 4RIRA 2P8PB 2ZE0A 2NDGA 1OSPH 4GSUA 3BH4A 2RGSA 2RJMA 3VVWA 4M56A 1EXUA 1LM8V 3U4EB 1JGVH 4P3DA 1OLLA 1OZTG 3X14B 2BVOA 4GMTH 3MCG1 2DQUH 4AMKL 1SXCA 3C8DA 4JFEE 5D70L 5HHOA 1QFWM 2AP2A 2XPYA 3ZKXB 1IGFH 2VSDA 3N44B 4QKTA 4KH2A 5DMIL 1RIHL 3FF7A 1NGXB 3QORC 5IM7B 1F90H 5HVWA 4KVNH 3MRGB 1D5RA 5EU3A 3EYVB 4XC3L 1QR1B 3SE6A 3OG6B 3RPBA 3GJFB 2UY6B 2X5PA 5D6CA 4GO9A 3EG9B 2NY6D 1ET7A 3BXNA 5DGRA 4O00A 1PDKB 4KPHH 4QOKE 3TTYA 3ZXAC 3JXAA 1J1OL 3WLWC 3SKMB 3EYUH 2OM5A 3ZSSA 5CKAA 5FKAA 2BH0A 4UNTA 4AIXA 3QCTH 5K9QI 1HWGB 1E4KC 4TPRL 1HJBC 2A5UA 2XA8H 5F7WC 4BUQA 1E2WA 2NY6B 5JQ6L 2R4RH 1KTDA 4PV1C 4TV3A 4AJWA 3KWWA 2VWEC 4AENA 2QV4A 2VERN 5AQ0A 4YSQA 4KAQL 2JKSA 5EBLB 5T1KD 4GSXA 1C5DB 4NQCB 1QAWA 4LLWA 5FFGA 4JR9H 2OMTA 2CJSA 4Z5RA 5F9WC 1SFDA 4RA0C 2MQCA 3GMOA 2CMRH 3UDWA 4D94A 3A5VA 5DEJA 3QCVH 4CVWA 3CDGB 2X4QA 5CZVL 5LCVA 2FX9L 1A1OA 4G59C 4PJ9B 1BVKA 3QWRA 3BN9C 4PG9A 3RAJH 1MFNA 3N9GH 4H8HA 3ZKNC 4XP1L 4UAOB 2O5YH 3SE9L 5J3HD 1CJYA 4GB9A 3DROB 3QARA 5KSBE 5CCKH 4E42B 1RD6A 2NW2B 4KWUA 4YDZA 1IGML 4KI5C 3EJJX 4YHLH 3RDTB 3MRDB 2MSPA 1N3NA 4C83B 1WFOA 2WXRA 5JHLA 3IAQA 2HTKD 3MACH 1OP5K 3R06B 4DP1X 4PJDE 1E9QB 3F8UB 4KFZC 5JUEL 5EORH 1IILE 1T7VA 3TBVB 3U2JA 2QGBA 3A4DA 3KYKH 1G7HB 2FGWH 2ZKHL 2DLIA 3BD5A 2W9DH 2HH0L 8PAZA 2ZF9A 4LQ1A 3CZSA 4RMVA 4YXKH 2R27A 3HNTL 3Q3GA 5CLWA 4PJ6A 1IGYA 3U36A 2C7UA 3FCUB 1NFAA 4JZNA 5HHNA 3IDIA 1AOZA 3AG3B 3BWUC 3P3UA 4P99A 4A7SA 2AANA 3ET9F 5KANI 5HVHC 4YHKH 4U6VL 3OXSA 1BAGA 3A4FA 5B21A 4WW1A 3O3AA 4J4PA 4I3SL 5CBAA 2A3TA 4GXUN 2GG1A 2WZ5A 3EFFA 1ZS8A 3EAKA 2QR0A 2FSEA 4OGYH 2WUBL 1Q0XH 3IDIB 1U58A 2ZWSA 3MRCB 3OAYK 2EICA 3CZFA 5GXBB 3AS1A 1S7VA 1KF9B 3JVGC 3HRPA 3QXTA 4C55A 4DN3H 2F53E 3R18A 3VXSA 5E4AA 4F7PB 1O7DE 3SJVA 4XXDB 3VNZA 3BDYH 1IC5H 4W6YB 4MXVE 1JBJA 3FPYA 4U6YA 4QHKI 4ABQA 2V5TA 1FNHA 4NO0D 3CSPA 1BXVA 3PV6A 2AQNA 2WBJC 1FN4A 1M1SA 4IBQA 1ED3B 4E0RB 1BF2A 1NM4A 1E6JH 4PY8I 4AQAB 1ACCA 3BWAB 4LMQE 1MUJA 5INCB 1KFAL 4U7SA 2P45B 3KWWB 1DE4A 3DROA 2V7NB 2CA4A 3N42F 3FB8A 4Z0XB 3HNSL 4HUWB 3LPWA 4PTTB 1HE7A 3KD4A 4H25A 2BHZA 5KSUA 3V55A 2WN3A 3RX5A 4F2EA 5JHDA 4JFQB 5BQ7B 1IEBB 2CCWA 4LDLB 1R75A 2AGJH 2UWEA 4TNVF 1MCJA 5E99H 4F5CE 2VL5A 1VA9A 1MF2L 1TVHB 2NY7L 3X11B 1E3FA 1MEXL 5J1AB 5I82A 3CSTA 1KPUB 4PJEF 5B1JC 3CZKA 2UZPA 1ZHLB 4YNYA 1QLEB 2V7NA 2CU9A 4P9HL 3BKCH 3MO1A 4ZUSA 1SYSA 2KT6A 4H25B 3P77B 2AJUH 3WY3A 4DPCX 4XMZA 1AAJA 1P7BA 1FVCB 4AGPA 2H9GA 3MV9A 2F54E 3DNKA 3NTCH 3QWOA 4Z3JA 3FO2A 1VFOA 2DM2A 4FQHA 1NCJA 3EO1A 4DGIL 1L9SA 4NJAH 2R2HA 3APMA 4XCNA 4XE0A 5B22A 4A04A 2Y7QA 3ATBA 3NOIA 2BSRA 2IXQB 3QEGL 4LEXH 4QHNA 4XAKD 2Y24A 1E9PA 4QUOA 1QSEB 3H2QA 2H3KA 3L3GB 4HIJA 5TE4L 2JJWA 5BUPA 5TK2A 2QKSA 4XPAL 2ZOTA 2W9EL 2F0CA 2G9HB 4K5PA 4KX8A 2NYZA 3FHEA 1CXLA 3V5HB 2ZG3A 3RG1C 3KGTA 1DVUA 4ADGA 4IOSD 5LG1A 1VHPA 1THCA 2PXYA 4D3CL 3L5HA 4P07A 3PQYB 3X12B 2RACA 3QULA 3N5AA 1OM9A 3T65B 2FBOJ 5FA4A 1HZKA 4RGMB 1KTDB 5FKPB 4X6DA 4R7DA 5A1AA 4X4MA 4DAGH 3KM2A 4IJTA 3PAYA 3KJ6L 3HZYA 4P3CL 3EYFB 1SHMA 2X1QA 3JWOC 2D7MA 3QO1A 4PRID 4JLRB 2Q3AA 3B7SA 4JFHE 3SDAB 5JPMB 2WQ8A 2QQLH 3BGFB 1CGTA 3V5KA 3BMVA 1SF3A 1TZ8A 1A4KB 1CL7L 2C9QA 5ESVB 1NEZG 1LQSR 1YEFH 3S37L 4ZX3A 3V9EA 4PMEA 3T0EC 6CGTA 5SX5K 3T4YA 5IVXE 2QDWA 5EU7C 5FR3A 4Q4EA 2CQVA 4N4YB 3K6SA 4G8GD 2X0WA 3LZPA 3WE1A 5LXGL 3SE9H 4BFKA 4JGMA 3MNWB 4TNVK 4EUPB 5C3LD 3OLGA 1FLRL 2HUEA 1HCZA 3FSVA 3FU9A 3MROA 1QA9A 3B3BA 2BNQB 3L3GA 4HIJB 4CBPA 2VXSL 3VW3H 2H2SC 2VQ1B 4XMPH 5FCSH 4G7QB 2BVQA 5L8KB 4FQ1H 1KGWA 2APFA 1F13A 5E0FA 4ZTPH 3FAWA 3BVXA 1JGIA 2F1BA 5KVFE 5DUPH 4KJYB 3O2DL 1YEKH 5GIRB 3O8XC 5HPMB 1FVCA 1GJIA 1FORL 5ESVA 1RZ7H 1A65A 3K6DA 4GAFB 3IDMB 4IBVA 5I1LB 3MOBL 5CBEA 2DM4A 1Z32X 5AAMA 3MBWA 5HVGB 3BKYL 1JPFA 2CO2A 3IGUA 2XBDA 3A3YB 3HZYB 4GBXD 4N5UA 3MODL 5JIIA 4LVEA 2AAAA 3KPPA 3ULVC 3I74A 2CA3A 4L3FA 2R1WA 1W0WA 3GF8A 3PWPE 1KCRL 4HMEA 4DESA 5H8DA 1C8PA 1JPGA 2DIAA 4BH7B 5JIPA 4NQQA 4WW2B 4C58B 3RWCB 2ZG2A 4RWYL 3F7YA 4DN3L 2WXGA 3V52L 2A9NL 2B1OA 3KPSA 1JJUA 2VLJA 4OM1L 2XCMC 4YDLC 4YFLF 5F9OL 3OPUA 3QVAA 5IBUG 5JMRA 2YA2A 3JTBA 4CA4A 4EIBA 1KT2B 4PCKA 1EVUA 3BCDA 2O61B 2EH7L 2JK5B 3SSGA 4JHVA 3CQFA 2AMGA 3C5ZB 5EB9A 4XWOC 4WI9A 1F41A 2KHAA 3PWUA 2Q8BH 3X1EA 4DQOL 1H0DB 1OSZB 5HGBB 3TLRA 2E6JA 4NNYA 3NJKA 4XPGH 2F8VA 4JANA 2AJXH 4V1DE 5C2UB 1CLVA 3QG7H 4K9JA 4GPVA 2QZQA 4LEBA 2DQEL 4IGBD 1SY6L 1AZRA 3CG8A 3NSYA 4MA1C 2F08A 3CFKA 3D5OF 2Y36H 1WH0A 5DD5H 3ZZ1A 4CNIB 2J1ZA 3IMUA 1R3HB 4MZ2A 2VLKD 3WJJC 4URTB 1FH2A 3CH1B 2FD6L 4NQDB 5IHUH 4HEME 2JQAA 5I5MA 1FDLL 2G2NA 3ZOAA 4MJ4A 4UQ2B 5EU6B 3MXWH 3OC8A 3KDMA 1OARL 3I6SA 1AO7A 3C2SA 5D7KD 3B9KC 4NNPL 3GKWL 4K3HA 3AGVA 5E4OA 5IFJA 3QDAA 2V4LA 4X99B 1RU9L 1IEAA 4G72B 2BIHA 3LRKA 4LU5L 5KBMA 2YSSA 4EQ2A 3V6BR 2FHBA 4FA6A 1N6UA 1S7SB 5BJTB 1R6VA 1RHHB 2DKSA 4LHUA 4I3RH 1HHGB 1EHNA 3HTLX 3WIIL 3ZKJA 3MRPB 4RDQG 4JBSA 3L08A 4I8DA 4KK5D 5C86A 4Q8BA 4RX4D 4W4NA 5DJ0B 2AHIA 1DJGA 4PB9H 1FAKT 1M2VA 3LS5H 3QUYA 4OCYL 4IKLA 3IU4L 3RVUC 1KEGL 2HKFH 1E5CA 2V5YA 4OLYL 3TO4B 3ALXA 1CDYA 5I15H 3MNDA 3WJLA 3TJEL 2X6BA 4KTDH 3QDME 3B2VH 5L2KB 1OGSA 3M1OA 1YNTA 3L9BA 4A2HA 1LP9F 5IB3B 1NCDH 1E30A 1UJTA 2JKNA 3DOHA 3KYOA 4KRNA 4PTUA 4QHKJ 5HI3D 5LWYH 3L1OH 5ENWA 1KJ3L 4NB7A 3OJ2C 2CIIA 2QSCH 4MQXD 3KDPB 4N0UE 5EOQL 3IS1X 3PWLB 5JHLH 1U8HA 2J5WA 3RL1A 5FGRA 4H40A 5IG7B 3UAAA 5C0RL 3ARUA 3FCTA 1V7NH 1FE8L 2BPBA 3BFOA 5KS9F 3LNDA 4FRWA 3IJHB 3MRRA 4L3CB 1KBGL 1NUNB 3APDA 4MB5A 4NP4L 1KIPB 5ETUA 3ARDC 5CN1A 1SUJA 3EHBC 3I9GH 4NO2B 1JOIA 3UTSE 3W37A 4Q9RH 3MV8A 2PYED 4WFFE 2WWOA 4HAFA 3P9LB 1CBVH 3JWDL 2G5BA 1ADQA 5FHBH 3ARGA 4Z7QB 5KYYA 3DUUA 4NM8L 4QRRB 5E9NA 2CDFA 2H3NA 3U1QA 4FZEL 1A3LH 2EDMA 5C09D 2EDRA 1T03L 4QJ5B 5AVYB 2DWDA 1DZ0A 4YBHA 4CL7A 3U7WH 4WK0B 1KB5H 1A1MA 3G6JF 5L88H 1TU2B 1RMFL 4JO3L 1NUDA 3GIVB 4JRYA 4S1RL 4ZW5A 1RJYB 3IDYC 3I6GB 1ONQA 3LEYH 3PYCA 1NGZB 2HG5B 3BP7A 1U2YA 3C6LB 4HJ1A 3ZE1B 3N1QC 3DOIA 1FO0L 3S2AA 1OT4A 1AE6L 2D7NA 4LL4A 2P28B 4WIQA 4QRTA 4RCAA 3BZFB 1U8QB 4ZTPL 1I4FB 4GKSA 3A21A 4N2MA 1XZWA 2K3TA 4YLCA 4LNVA 1AVAA 3NEEA 2VDRH 1CDCA 5HHOD 1N0XL 2BMKB 3II3A 4U1HB 1FL6B 1RPUA 1H6UA 1JI1A 4AYMC 2Y2YA 3PGFH 1WUZA 2J44A 4U1JA 4E41B 2XWJB 1CDIA 3ZHKA 2WW8A 3S3CB 1A6AA 2WJ5A 3RTQA 1G9MC 3IFLH 1S9XB 5J11B 3WXVL 2TSBA 3OD3A 1GYAA 2PPCA 4M00A 1NBVL 1F45A 2P9RA 3BPCA 3F00A 1J88A 3L9RA 2AK4D 2DOCA 3MKGA 1JNLH 3G6JE 1DSFH 1KLFA 3D39B 4WKZB 3BUYA 1TJGL 2X4SA 3MBEA 3BFWA 1J0HA 2BO0A 2G0KA 3GXDA 1LK3L 4DKFH 5AENA 2IDSA 3D69B 4XB7A 1R3LA 1F02I 2WLYA 4K3DL 4TL4A 2ZPKH 1TO4A 3DHPA 2XWTB 3S36X 1TTRA 1FFNA 1K8IA 3A6CH 3ESOA 1SEBA 2A74B 1WE5A 4KO7A 4NUMA 1DSYA 5KVDL 1F86A 3O0LA 1HDMB 2DM3A 4YX2H 1S9VB 1LO2H 4NBXB 3PUUA 3OB8A 4XGZA 1QNZH 2BWDA 2FYYA 3BSHA 2G3ZA 5DQDH 1BYNA 6TAAA 2XHNA 3O2VL 4V1DD 5EBWB 3TBWB 2ZZUT 2APXA 5EEZA 1FZJA 5D96C 4XPHH 3IPBA 5JA8B 3E2HC 1GMEA 5I1EL 1LP9E 3PFUA 1YJDL 3CFDA 3IN2A 1IM3A 4KV5F 1J8HB 1D5ZA 4L8BB 1MLCB 3TNNA 4E9QA 3WKPA 5CP7A 3P9MA 1BQRA 3E3QC 3OL2A 4AEEA 1MFUA 2NX5E 1UASA 5JQ6H 4HULB 4Y4HB 5GZNA 3QAQA 5J11C 2G30A 5KOMC 3QC6X 2WC7A 4HQQH 3SCMC 2VXTH 2QKIA 4JKPL 4HJGA 3ZTNH 4W9KC 3QG6B 1PFOA 3LQZA 4JZJC 4B0MB 2Y2TA 1SDDB 4EZLA 3K6SB 2NXZC 5FOJA 3Q05A 2ITCB 2WOBA 1T1YB 3BVTA 1BF8A 2F5AH 3AWFA 4UM9D 4XCYB 3DHJA 3FO9B 1KBKA 1AXSB 1HHKB 5EO9A 1G7MB 3UZVA 5FYJH 4DKDC 2QPEB 2WVVB 1JZHA 1NGPL 3H9HA 4W9CC 2VDNL 3MNVA 3GSXB 4PJXF 4PRHA 3ZRSA 4S1QL 2Y1VA 4N25A 1ASPA 5DLLA 2VUYA 3H7LA 2Q3XA 5BNXD 2IQAB 4PV9B 4LLMA 2V9UA 3O6MH 1RZJL 1OKEA 2VLRD 3SDYL 2DQCL 5EA0L 4GRWE 2VMJA 5MENB 1ZANL 4HZ1A 1WA0X 3LN4B 5ETUB 3FTVA 4FI6A 4M8VA 5HDOA 5JUEH 3MJ9L 5C0AD 2IDTA 3KYKL 4DO5A 3N1PC 3VI3B 1QW9A 3UYRH 1H9VA 1L7TH 4L4TB 1G4MA 2KI6A 2YD1A 5E5UB 4ZW6A 4HJEA 4JFPB 3PWPD 3QQDB 3AW5A 4KJWD 4HK3J 2CBQA 5B4MD 1ZV2A 1DEEA 3K5SA 2YGQA 3ILDA 2B9BA 5F7DB 4L3ED 3MLZL 2KLTA 5BZDB 2CXGA 2JCCB 4G82A 2FR4A 3CFIC 4JM4L 1ODUA 1F58H 4ALAC 5IBUB 1C16A 5A3IC 4NIYE 1P5UC 2A9CA 3HE7A 2P5WD 2FQEA 5DMGC 5E00B 3V4PH 3IAPA 1IAIM 2LLLA 2CK2A 3MLPA 5DD1L 1E4WH 3KYNA 1A9BA 2FT7A 3RWFA 1VFAA 4PWJA 4QXWA 4UT9L 1RZPA 2NXZB 3ROOB 4RFEB 4CN4A 3ETBJ 2IBZX 5C07A 3K6OA 4DP4X 2CBMA 2DZEA 3QYMA 2F53B 4QRFA 2EYSA 2XPGA 1IC5L 2DTSA 1QSFD 4R5XA 2V7HA 3Q1SH 1CFSA 5KUMA 5PAZA 5TQ2L 3VXUE 4HK0A 4HH9A 3MLSL 1G7PA 3BYYA 1PZSA 2IPUK 4A7GA 3QUMA 4WO4B 4Y2OA 5A2JH 2MOVA 1BIIA 1HHGA 2Z3FA 4JZOB 1U8CA 2E86A 1JF6A 1N5AA 1SFHA 2Y5TA 4YUEH 3B9KD 4FADA 1C08A 2DIBA 3N91A 2LU7A 5FA3B 2BP5M 2VTFA 1MCWW 4KO5A 4ELMF 2JLLA 3G5YA 3MOAH 3PGFL 1R5VB 3HB3C 1XGTA 1AO7E 4EI6A 2OXGA 3NVQA 5IKCA 4FNPA 5FGCB 3GLEA 3KXFB 5FM5M 4M03A 3L9EA 3IFLL 2CR6A 4OT1L 4TNWF 1MDAA 2W91A 4I87A 5CEZL 2NY7H 2D4DA 1CYWA 5A7EA 3DI3B 2VZOA 4X5XB 1GCYA 4NSKB 4YHML 1CVRA 1G6VK 2C9WA 2EDFA 5A6IA 1NICA 3EJYD 3GK8L 1I1AA 4GW4A 2VR3A 4GNKB 1H8LA 1EPFA 3DRTB 4ZBJA 3T9WA 1TJGH 4M1GL 5K59E 2PW2B 4OSUH 4XN5A 3W82A 5DUBB 4HUXA 3E1ZA 1RUMH 3GSNL 5IT2L 1Z5LA 3BZ5A 3L3DB 4ZUVA 1A1OB 2D3JA 1RK0B 1S7VB 3Q6GH 4PG9B 1IBDA 1N7ML 1T21B 4F7PA 5I8KL 4AGOA 4W93A 1C16B 1BIIB 2ENSA 4KZDH 3U46A 4JHAH 4L18A 4LQFH 2QHRH 3NACL 4N0YH 5DQ9B 3EJQA 4C57C 5FO8B 1XAUA 5FO2A 5IJVA 1R9FA 2L7UA 3S88L 3SGKC 1MAML 3LIZA 3BCFA 5FUCC 5FYLL 3ETBF 3VNYA 3O2VH 4G6MH 1TZHB 4ZMPA 4J3OF 5KYNA 3REWA 1BOGA 2AJVL 5IMLB 2Z8VC 3ZDYF 3FCSB 4Y1SA 1K5NA 5C7ZA 2JQZA 4PRDA 2DEYX 4RMRA 2AJYL 4AEIH 5I0DA 4I4WA 1WIPA 5HDBF 1CC3A 3KBHE 3LVTA 4G8IA 2DWYA 2ZX5A 5AL0A 3EGXA 1AQ8A 3O41A 1JF1B 1FO0A 3HMXH 4ICXA 4IS6A 2ZQKA 3CPUA 1PS3A 4YDVA 5J06A 2LW3A 3DO7B 5FECB 1P7QB 3P4LA 3PV7A 2H47C 5E8EA 3VSQA 1CL7H 2OI9B 3ZTNL 5IB2B 3RWEA 2K6YA 4MAUL 2OZNA 4P46D 1GSKA 3KPLB 4MLSA 1AGDB 4X5WB 1W2KT 4WI4A 4LNRB 3WFCL 2F5AL 2YBRA 1XT5A 1YN7B 4JQIA 3QUXA 4QY8B 1UJ3C 4URKA 1AYOA 3WE6A 1UWFA 2DWXA 3CQQA 4BE6A 2BP8A 4JQIH 4O02H 3BRDA 1WVZA 4RFOH 2PF6A 4LLYB 5BRZA 3MFFA 5HJGA 4PS8A 4C47A 3TN0D 4GKZB 3W39A 1CI3M 3TT3L 3PFQA 2Y7NA 3MJWA 2UZIH 4RGOH 4IU2A 5KZCD 5FF6B 1ZS2A 3QPKA 3LKRA 1YMMB 2WAQA 1MRCH 3NJIA 3L3OC 4OKDA 1UZ8A 2VAJA 2MOQA 2YN3A 3ZYIA 3MLWL 1PEZA 5SWZB 5FFOA 4L4VD 3NJJA 3BAYA 4HMDA 2CHDA 2HJLB 2NR6C 2ENQA 4MJIB 3Q8FA 4AYGA 4ZNEE 1AHWB 4OLVL 3US9A 4U2ZA 5I9QC 1VGEH 4JCMA 2OMVA 5LAPA 1IAOB 3R7QA 1MNNA 1G6RB 3MJ9H 2UVEA 2PYEE 1PX8A 4JG0H 2ODHA 5EV7A 2GABA 3OKDA 1K2DB 2F15A 1FGNH 3GWJA 3QUKB 4OF7A 4N68A 4AC4A 3HHMA 4FTDA 2UY7A 4R96A 5D6DC 2R23A 3QZLA 1WT5C 3ERXA 3U9PH 3QFJA 1JXDA 3UAJA 4NLAA 4HIEB 2EDXA 4GRWH 4JN2B 4TLUA 4UTAH 5FV1L 2PUQT 2UXGA 2KZWA 2H32B 1LVEA 5EBMA 1BVNP 1O7SA 1TZIA 3D48R 4J6RL 4JFOB 3FU7A 4IIZA 2GITB 3J07A 4HWEL 4MHHI 4YE4H 4C56D 1R3LB 1RURL 1I85C 1L9RA 1YY8A 3GHEL 3FT2A 3ROLB 4CSTA 3BH8B 4UZGA 1UKTA 2YKLH 5TDOB 2NZ9D 2IEPA 1S78C 4N8VA 4PJEA 1S9WB 4L4VA 5FYJE 1MHCB 2OJEA 2ZSWB 4XXDA 1B0IA 2ARJA 2KPWA 4P49A 5IB1A 3BWZA 2KZ1B 3DO3A 2Q87A 3H2WA 4U3XA 3HJ0A 3HZVB 1AJ7L 4XTRC 4GRLA 5E2VH 1EGJA 4WTZA 3QNXB 4G9DA 2AQSA 4AL8H 2OCFD 4QRBA 1E9OB 1DDHA 1QSZA 3P30H 1DLFL 3HMXA 5JNYB 4FEMA 3MA7A 3UBXI 1WFTA 5JOPE 1II4E 4LSQL 3R19A 3P11L 4PJCB 5I1JL 1HXMA 1LO4H 1SY6H 4OZ4B 3V0DA 3PWLA 3WG7B 1BQSA 4TRPH 4YO0B 1RFDH 4P4RA 2R7EA 4KROD 2CLVA 1OWRM 4PJDB 5IJCC 4L9LC 1DBKL 1IGYB 4HH8A 3U36B 3MU3A 5CD5C 5GJTH 4LLQA 2A4EA 3QNZA 4NM4L 2Q8AH 2BZ7A 3W2DL 3QFGA 3CVDA 9CGTA 4R4NC 4HUXB 1DP0A 3FQ1A 1X44A 5E08H 5D7JD 4CRPA 4Z7VF 2OJ1A 4G6KH 5IBTL 5EN2A 3RNKB 2R9HC 1P84J 4M1GH 3DRTA 5CSZB 1YSOA 3QXVA 3DYPA 4ZUTB 3VQLA 1KV7A 1ZDQA 2KH2B 2QADD 32C2A 3FO2B 5BZXA 3UZQA 4E9YA 1AMYA 5CJQH 5TD4A 3F7VB 4M43L 4KFMA 1N7MH 1V27A 3EW3B 1U8JA 4KKPA 3VI4B 5E6IB 5IVZA 3RNKA 1W0VB 4BYHA 1DQQB 1O9VA 4PJHB 3VFNA 5L4JA 1F4AA 5AUMA 2ATPA 1JUFB 4X5QA 3BWUF 1CO1A 3PF2A 4RZKA 5G5DA 1H19A 1BOGB 1H15B 2FIKB 2ZYSA 3DETC 2D3LA 4Q6IC 3P69A 4PRDB 4O51B 2YGVA 5F7DA 1ODAA 4P4RB 3M07A 5FM5O 4M93B 2FQGA 4BFNA 1TTAA 5DFVC 1U3YA 4GUQA 1WICA 4ATTA 1FF5A 2HLFC 1IARB 1FH5L 1A6WL 1Q90A 4CNIA 2AJYH 2BFGA 2DWSA 4B27A 5GRJH 2DTMH 3ROOA 1XMWA 5CSGA 1ZHBB 2WXNA 4GG6A 2B5IB 4NHUA 4AG4H 7FABH 1EEUA 2Q2EB 2HRLA 3DV6A 3UBHA 4RNRA 4UOZA 1H3GA 2K3HA 2XLLA 4WNJA 4BWUA 3NFPB 1G7HA 1LXMA 3V6ZB 1AQHA 3QNFA 2QHLA 2AEPL 1KYOJ 5FK9A 4GS7B 4ETQA 5AL8A 2PWFA 4DFHA 1XO8A 2Z0UA 4JDZB 3OKNB 4FNQA 5F6IC 3NRFA 2KL6A 2IAMD 2JWYA 4PJ9D 1P2CA 3QIUD 1M05A 4FYTA 4WWPA 1L0XA 4OZIE 3QEUA 3ZDYE 2WLZA 5I8CA 15C8L 3L6FB 1I9IL 3U7WL 4M1DL 1U3NA 2FX7L 4NFCA 4WHTB 5CZRA 4LCIH 5F9DC 4AUYA 8FABB 4YHNA 3QDMD 5AG8A 5DHVB 2P8LA 1TVBA 3I2CH 3PAUA 1CLOH 1YG9A 3L3OA 1HAUA 3QJXA 1DQQA 4Y7OC 5FDWB 4ZFFA 4PJDA 1WAAA 2MRYA 1QFPA 1HK6A 2BDNH 1NLDH 3OAUL 1PCXA 3BUPA 4BGDA 4AXWB 3JQOB 5I30L 1OK8A 1KC5L 4H0HB 1S9KC 1JXGA 2ICWA 3TA3D 1R3HA 4E42A 1J8HA 1GOHA 1NLBH 1SDAB 4MNHB 3V0EA 5EDSA 1JYNA 5I2IA 1AZUA 4C4UA 3FFDA 5IR1A 3WTSA 4OKVB 4KC3B 4D0CA 4XNBA 1JZJA 3GMPA 1PLAA 1JWSA 1ZHKB 1CDBA 5D1QB 1CR9H 5GRUH 1XGYH 4M6NH 5JQIB 1NIAA 4XOCA 2XG4A 1N2RA 3IJSA 1BLIA 2ERJB 4ZQKA 4L8DB 3DSFH 3T0WA 4W9IC 5T3ZD 3AXLB 2EDNA 4YBQC 1IM9D 3APNA 5CGTA 3U83A 2YKLL 3H3BC 3QA3A 1RUAL 1T6WA 1FL5A 3DXAB 3LRHA 4NT6B 3P4NA 1TTBA 4JGUA 4DETA 4ZMYA 1HX0A 3TX4A 3TBYB 3TCLB 1U95B 4MGXA 4O58H 3WMQA 2LQRA 3WNNA 1NGQH 2YXWA 3MRHA 4KUZL 2X4PA 4MVBC 4BFIA 2NQCA 2PNDA 2EC8A 1P4IH 1OF0A 5GS2H 4R0LC 3CHOA 3DYOA 4L05A 5DO2D 4YX2L 3QEHA 1TZHA 4XBGB 1RZJC 1HVXA 3H8NA 3U2SA 2EYRA 3V7AG 1I1YB 4LKXB 4QI3A 5J9PA 1BZ9A 5DZNA 1PJ9A 2VXUL 4KNUA 4TQEL 2PXYB 5C7XH 5GJTL 2OK0L 3VXMD 3KGSA 1OCRB 5I1EH 1X4YA 3BD4A 2Y0SA 3CV5A 1RCYA 2DEXX 3D1MC 4Z7WF 2CHZA 3G04B 2DIJA 3ELQA 1J5OL 3O2DA 1WG3A 1HHHA 2ODIA 1TZGH 2Y69B 2CPCA 1CT8B 4G70B 2VDLH 2XWRA 3BPCB 5DI8A 1EEZA 4ANXA 3FUEA 5JORB 2GAZB 1KIUA 3HZKB 1NWOA 5IF0A 2BNUA 5D5MA 2XRAL 4X5WA 2CDGB 4KRMB 3VX1A 4Z6AT 1RK1A 3PL6D 3GXTA 3T4YB 1D6VL 4JDVB 2NQDA 1KGCD 1JAEA 1JPTL 1IVTA 4NOFA 4XBEL 2WYZA 4XR8C 4WV1A 3H56A 3GBNL 2DL9A 3QWOB 2B14A 3QDMA 1DJWA 4A6YA 1Y0LA 4HPOH 4N0CD 3IDYB 1IVLA 2GQHA 4TLTA 4EIGB 4L0ZA 1J8RA 2GY5A 4N2GA 2C9VA 2EXYD 1D9KD 3EOAA 1ZTXH 4EUPH 3WLBA 5I1DB 4HCGA 1KOAA 3KLHC 4JZOA 3K3QA 2GJ6A 4RGND 1GYUA 3HHRB 3N50A 4F93B 1P6WA 5LNEA 4X80L 1X5JA 3CK0H 4JG1L 4XH2B 1AR2A 1QR1A 1T0PB 4UTBH 3C6LD 3NH7H 4E0RA 1FNLA 1L3NA 3MBED 3GTNA 4Y2DA 2CDEB 1OV8A 1B9ZA 4HA1A 5IZ7A 5LNGA 3BOVA 4FHKA 1MUJB 4R5TA 5INCA 4GI9A 5ES4B 3ASOB 1KJ2A 4HZAA 2WSPA 4LOEA 3QULB 1JCKA 2Q7YB 3K2KA 1RK7A 5F7EL 2AEPH 5FYKE 4PLKC 1I3VA 4KRPC 5E1GA 2BS9A 2OTUA 4JY5H 3KYMA 5GGSA 4J4PC 2VO5A 4PLJC 1FZOA 3QRLA 4R3SA 3HI6H 4H8VA 3RVXC 3V4VL 1HI6B 1FVEB 1U8OB 2IV9A 3GXMA 1Z6JT 4JVWA 5DHEA 2VSCA 3Q8CA 3VO0A 3NCMA 3QUYB 5E9DB 1W80A 3S0PA 3EH1A 1QQDA 3D8MA 3ZZQA 1VIWA 2AS5M 3M17B 2E9BA 3L3IB 1NPJA 2H3XC 4UOJA 2OYKA 4XP5L 2Q3ZA 3TVMB 1E3ZA 4WJKB 3GDCA 2RCSH 4YQXL 4JFXB 5MEPA 5E24E 3D34A 3BUDA 3IE4A 4RSVA 1UD5A 4D0BB 3H9SD 1OP4A 4MDJB 3GJEB 3VG0H 4AE1A 1NIEA 4FYRA 3L3JB 3WHXB 3CSYA 1S8DB 3VXPA 2MQ0A 4LLMB 5CKGA 1S7XB 3MLSH 4K5NA 2R56L 4WI6A 1YO4A 3L3HB 1F3DJ 1E4XL 2VLME 3IFOB 4IBSA 4PCYA 4S0TD 1SDYA 4NN7C 3FCSA 4PWFA 3SPJA 3JT2A 3Q8AA 3U4BH 3ZDZB 3HC2A 4HCRA 3LRSA 1HCFX 4BDVA 3RDTA 1P1VA 1R33A 2RTTA 2KZBA 4TUKH 1BVLA 1JCVA 1JGLL 4ODHL 4P2OA 5ALBL 4G6JH 1YPZB 4WNSA 5F8RC 5E8PB 1SEQH 5SX5H 1ZEAH 5F97E 2PPAA 4ZX5A 3VFPA 4MMXB 1PG7W 2UX7A 3PHQB 1HI6A 1U8OA 4RISL 5D5ME 4N0FB 1MCSA 4F1ZA 4HKXB 3KW7A 3MLYL 3QFDB 1HXYB 2B5IC 2HTLD 3UG3A 2D2CC 3NJNA 2GC4C 4UF7C 2VISA 2VAAB 3GEFA 1MHCA 5I1IL 1WBYB 2PTUA 3FN3A 3LQMA 1Y7VA 4I1NB 3HE7B 1Z2KA 4X9IA 5I6LA 5EO0A 1P69B 3X1BA 2CLZB 3T77B 4P2RB 3UERA 1EUTA 1ZHBA 1BGXL 4PJ8D 4FZ8H 4ZD3L 2YKKA 1GC1C 3AVEA 3LZFL 3M7FB 3UACA 3A24A 3U6RA 3WNPA 3S4SG 1U8NA 2AJSL 3FTGB 4YDNA 1DUYB 4JHAL 2A0LD 2OL3L 3FT4B 3QDJE 4LSSH 2Y1YA 2DJMA 3TYGH 1MJ7L 2X12A 2JE8A 4FQXC 3LPOA 3D0AA 4JKKA 2I5YL 2C7UB 4CU8A 2HA1A 5IB3A 2NNAA 2V9QA 4HZLB 1V5JA 5I8EA 2K6WA 1JPST 4G6ML 4RX4A 3BSZH 2FHFA 4JE0A 3TBWA 2GEQA 1BQHG 1PU0A 2X6CA 3ZPDA 1IAIL 1TOXA 3BAXA 3QFJD 4M4PA 1MOEA 4HUCA 3SQBA 4N5EC 4LHUD 4FG0A 4U7MA 3ZE0B 3SDAC 2ZG1A 3NABL 4KJQD 3GMRA 5JIHA 1QHPA 4FA7B 1NANH 4JUSA 4MAYB 5EC2B 2FEJA 4L1BA 2BP0B 2GK0A 2DLEA 1NL0H 4A2LA 1TZGL 1D5MB 3AU1A 5DK2A 1A21A 5FHAL 3AY4C 5DCCA 3CN3A 4TQ8A 5BZWB 2Z93A 4FCHA 1MI5D 1NCIA 4FQIH 2GSMB 3R8QA 2R8SL 3TBSB 4AYFA 3LEXA 2JH2A 3HAEG 4NHCH 3V4LA 2YMXL 3X3GH 1JPTH 1L5GB 3KWUA 3QJFA 3DO4A 3D4CA 3SO5A 2EH8H 4F7EB 4B9CA 1I82A 3SPVA 3L9YA 1A66A 5A2LH 3B43A 3GMOB 1M9SA 7PAZA 4JFUA 4JFZL 5FGSA 1WWAX 4NXSA 4PRPA 2KBGA 3CDCA 1XTLA 4EI0A 3TJHC 4YDKL 4X6FB 5KYXB 2IDFA 3S5ZA 4KNSA 3QUXD 4GKOA 3WMSA 2FWOA 1L7IH 1MRCL 3PGDA 1P53A 4N0UA 1CZ8L 1RL1A 2NY2B 3DV4B 1BPLB 1HL4A 2B1HH 3FTSA 2B8OT 5FUZH 1I4FA 4MA7H 1A7QH 2CSPA 4RNRB 3NH7L 3QUZB 4DO4A 4WUUB 3AGWA 4JX0A 2WTRB 5FO7B 5T5FA 3D0LB 3CXHJ 1NWPA 1T1ZA 2DYPA 1HH6B 2P46B 4IDJL 9PCYA 4LSTH 5BO4A 1WC7A 4XXCA 1IAKA 3M45A 3QNYB 3MV8E 4XC1L 3AB0B 2W07B 3PREA 1KCUH 2B4CH 1BXXA 4MQTB 3U0TA 3UC0H 5KVFL 5JIMA 3NRPA 4JFSA 3DUSB 1QLEL 5DUJA 4J6IA 4XNYH 3DIDA 4Y4KD 3TEUA 1IGTA 3OZ9L 4K07A 2B0SH 3OJMB 2ESVA 3VCLB 3ZHDA 3D6GA 5HY9B 2NRDA 3QRFM 1BAFL 3TO2B 4IQHA 2VLRE 2O5XL 3MBEB 4KNQA 4HUVA 4MVBD 1F11B 2N7SA 5DMYA 2HWZH 4YXHL 2WINB 1JPFB 4YSDA 3KR3H 3DX9B 1I1FB 3LB6D 5HHME 3UIYA 5I6XB 4BCZA 2WSDA 2V37A 1IEHA 3OMIB 3GHEH 4UQEA 3VCLA 3RL2B 3ULSB 1QP1A 4N0UB 4G8FA 1RQ5A 4XPFH 2JJSC 1CD8A 4WK4B 4PIBA 3LRGA 4NC1E 1I1RA 2RALA 1A3QA 2JVUA 3CHXA 4C4BA 4ZMWA 1MSPA 5HYSA 4JKNA 3TWCL 1YECL 3VTMA 1KIUB 3HZKA 1NDMA 3KNBB 4L8SC 4L5FH 4NEHB 4G8GA 4FDWA 1QRNA 1SRDA 5L7XL 4MQXC 1NCTA 1G5GA 2G9HA 1JHKH 2MTPA 4QHPA 2VKWA 1JWSB 1QBMH 3H53A 3MLVH 3PG2A 1MJUH 1Q72H 2HRHA 3BISA 5E1QA 5HD8C 2HXAA 2YAOA 1IGJA 1OAYH 2YGNA 1FQ9C 4BZ2H 3RB7A 4WHCA 2WN2A 4KROB 2L0DA 3RZCB 1N64L 4PJIF 1QHQA 2IG2L 1T1WB 4CGTA 2EE2A 2F19H 4S1SH 2X6VA 4M62H 5DGQA 3LPFA 5EF2A 3RWDA 2ETWA 2BMKA 4HT1H 4U1HA 5IOKA 4MS6A 4JDZA 1WBXB 2OMWB 4UBDD 2XQ0A 1M7IB 3PAVA 4E68A 35C8H 3ATFA 4YNYB 1L6PA 1ASOA 5DC4B 5JPMA 4FNSA 2FJGB 1NOFA 4BSWA 1A4BA 1OE3A 5FWQA 3V5KB 2XZQL 1B4LA 4BH8A 3RZCD 4QRPA 1LO0L 4PH8A 5IMMA 1CYXA 1SLXA 1IKNC 4N8VB 1IEAB 5T8IA 5F7LB 2H1PH 5HHQA 1NBQA 4OJAA 5F7UA 1H3PL 1NMAL 1JD9A 1MQKH 1TETH 3RWHB 1QG3A 5DZVA 4Z0BH 1ZA6A 2E9GA 3OKLB 3VFRB 4AVIA 4K3GA 2XN1A 3BZDA 1HOEA 4H0GA 2OQJA 2HJKA 1SLWA 3BN3B 2F8IA 2P5WA 1GZPA 1FIEA 3HKZA 5F7FA 3HLKA 1IAKB 4AGNA 4AXWA 4PJGE 5IROC 1SN0A 5F9WB 3ARPA 4UM9B 3SD2A 1KWKA 3W0WE 4KX9A 3VGHA 3QW9A 1JYVA 5BVJB 1CE1H 5DYOB 3OKDB 3QIWA 4ESKA 5F88B 3B83A 4LBAA 3AM8C 4HFWA 3GBMH 3BKML 5EF3A 4IGBA 5PCYA 3SQOL 2MTAA 4GI8A 5F0JB 1XX9C 1G6RL 2YPVL 1M7IA 4JGNA 3VXSE 3NFSL 4F58H 5AOJA 4Q0XL 4BRJA 4HW6A 1ZT4A 3S8FB 2CJUL 2QVMA 1RXLA 1X7TA 5DT1L 4FQIL 4K7FA 2LU5A 4PWIA 4QYOA 2H32A 2BRQA 4R7NB 4Y4KC 2XWBB 1JK8B 2F8OA 1WGVA 4N2BA 3BKJL 2L7EA 4RZCA 3JUZA 4PB0L 5F9JB 4W9DC 3E8VA 5HXMA 2VDPH 1M71A 3HBPA 4I77L 4KGLA 2VDKB 2DWEA 2VL5B 4OFYD 4ZMTA 1XF5A 1JRHH 4XMUA 1LNUA 2YEZB 3VYOA 2GT9A 2ATPB 2QSQA 1CL7I 4Z76A 3LB6C 3C09C 2FX7H 4LBEA 5D1ZB 2EEFA 4HGWA 4WJ5A 3RB5A 1YNKH 4GP4B 4UM9A 3S98A 1FZKB 5C8JB 1F8TL 1M2VB 3CH1A 3VJ6B 3VSVA 3CFNA 4ALAH 4KY1L 1B4JL 3MA7B 1B0GB 3G08A 4KGJA 4NNXA 3VDBA 3TZVB 1VGKA 2VDQH 4AMKH 2OTWA 5J6SA 4JM2C 3MROB 5B3NA 1KGJA 2CLZA 1JDDA 3FQNA 5DD6A 3H2PA 2PETA 1B3IA 2EAEA 4GT0A 5AAWC 1YNTB 4LSTL 2P24B 1ZVYA 1ICTA 4YVNA 4OU3A 1QFWH 3E7JA 3CTTA 3NSXA 3WKML 2FJGA 1BMZA 1PZCA 4BKLA 4FQLH 4MXQD 3KMDA 1QLEH 3FUFA 2F18A 2BNRD 1A22B 2FB4L 3VYNA 1U91B 1IGTB 3EJTA 1MHPL 4WRLA 2IWGA 5DHYA 2V2XA 5TDNA 4AKPA 4Q6IA 1NIFA 1E67A 3V8CA 1CR9L 3FH8A 3FQRB 3VM7A 1DVFC 4A2FA 3IRZA 3L3IA 5EC1B 4K7PY 1AYRA 3QS3A 1MZZA 1Z3GL 3Q6FB 4UT7L 2A38A 3GMQA 1NCWL 3R1GL 3FQUA 3CLWA 4TPRH 2BSBA 3II1A 2NX5B 3I50L 5DJDB 1AQDB 4UILH 5IWLA 1T21A 5GRXG 3QUYC 2HAZA 5IIEB 1NUFA 1SJVA 3HBQA 1GA2A 1MNUL 5D7SL 1AANA 4JR9L 1BEXA 2J2ZA 4W9GC 3PQYE 3OX8B 4NKOB 2OR9L 2NY2C 1BQHB 3BQUB 3EOTH 5BS0E 4WY7H 1X7QA 4Y5VA 2WHVA 4PRIA 2PCYA 1P7HL 1VENA 2ADJB 2FO4A 3QWRD 3HCVB 3QZOA 2ED6A 2R0WH 1E28B 1EVTC 4KJWC 2F58H 2ZCLL 2YD6A 3O4OC 2ZUXA 3NCCB 4U1IB 1IMHC 25C8L 3T3PE 3UBXG 1OAYL 4BUHA 3KLAB 5KSBB 4X0KA 4P23D 4IW4C 1EEYA 5J6GA 2PXYD 4KTGA 2NYYC 2CO4A 3Q2CA 3PGCB 1M7XA 4X4YB 3GGWA 1EBAA 3G6DH 4GW5B 4WNQA 2BCKA 2ZOOA 2WKGA 4FYSA 2YA1A 5ID0A 4K5MA 4BZ1H 1ID5I 3U7AA 2IMNA 5ISZB 4JL2A 1D5BB 2P1YA 5ACZA 5BOZG 1L9MA 2VDLL 2QPFA 1CMOA 2QVTA 3W9DA 2GUOB 5IGXL 1YA5A 4AVHA 1WZMA 3GMMA 3OKOA 2L3BA 3QQ4A 3IMRA 3SBPA 3HC3H 5KW9L 3ZRFC 5IB4B 1KTJA 4NQCE 1DQMH 4NUGL 4NQEB 3IF1A 3NJLA 4XBEH 2IOIA 4GG8A 4QLRA 4HWBA 1XD1A 4IIQC 1T89C 4EBQL 1KY7A 3RY4A 2YPLB 3N1FC 4MMZB 4XCCH 2QGDA 2VM4A 4OZGF 5HHPA 1I3UA 3VE0B 1EHLL 3VTTA 1UCBL 5C09A 4AM0A 3P3SA 5HDLA 2Y06L 4L23A 1JK9B 1PNDA 2ICEC 1YHPA 3IBOA 4RFNB 1W6LA 3U9WA 4LVOC 5KBLA 1QEWB 3LQAC 1X9LA 3LNIA 5DLMH 1URZA 5JW5A 3RIAK 1HJCA 5B8CC 3DK2A 3FU6A 5JHDD 3NIFF 2D31A 1E4JA 1HH6A 1Y18B 3Q2NA 2ICES 3GLDA 3REVB 1JPEA 2R2BB 5IHWA 3Q2LA 4UTBL 1EJ6A 1GH7A 1YNLL 1F42A 2VDML 4XN4A 4LCUB 3BUYB 4UI2A 1JNNH 3TBTA 3QJTB 4S0SD 2GBUA 3FBQA 2Q7NA 3WL9A 2CJUH 4RDQF 4HWUA 5D1QA 5GGQL 3TA3B 3QEQE 4NO0A 5F7EH 2X7LB 3DLQR 3GDBA 4RMQA 3F6IA 3S97C 1MW1A 4TTDD 1CFTB 2A6IB 5IEHA 5TK4A 5JOFB 1J1PH 3LH9A 5B1BB 4FFVC 2AQRA 3UZEC 5A7BA 3STLA 2XBZA 3GIZL 3QA3B 2B59A 5GS0H 3ARFD 1V55B 2Y25A 4JFPA 1GL4B 2H32H 3SDCC 3QUXC 1ML0A 2IH8A 4GMTL 1BQHA 2X6MA 4PJ7F 1J9CT 1KB5A 2MIZA 1RLWA 4MWFB 3VJ6A 5IUSA 1LEIB 3TURA 4H1LB 4XP4H 1RERA 3O3BB 1IGFL 2YS4A 1DVFB 3P1VA 4WSGA 3HMWL 5HHNB 5CLXA 3L16A 2P8LB 4AEHL 3QUYD 5ECGA 5HGHB 1F90L 5DJZA 1EAQA 3QIUB 3RI5K 4BFFA 3QCUL 4TUUA 4ZI8A 3ZKND 4B50A 3S36L 4JB9H 3STZA 1OHQA 1RJYA 4NZJA 4NPKA 2DPKA 3NRQA 4UT9A 3CVHH 2OTWB 3EYSL 4L0YA 3RIFK 3NPZB 2E7LC 2I9LB 4FF9A 1MHEB 1LEGA 4YFDB 3ARBC 3C6SB 4R5VA 1JZ5A 2NXYB 5LB1A 3GI8H 1J1OH 1QFWL 2DH3A 2QTEA 4YFEA 4HOMA 5I66B 4IOIB 2W1NA 1CFTA 2A6IA 5IHZB 1A47A 3QXWA 3I85A 1ZE3H 2C1OA 1I8AA 4GKNA 2XA8L 2WD0A 5E2TL 5GGTH 2XZCH 5FYJD 1LQBC 1C08B 1ZHKA 3RY5A 2PPFA 1UOKA 5IB4A 2IQ9L 2AKRB 1U0QA 4JFFD 3EYQC 3FFCD 4U6TA 4Z3GA 4ZYKA 1Y1UA 4G1MA 1FWXA 2EDDA 1FFPA 2CHNA 3UTPE 2VQ4A 4KVPA 4AZUA 3ECBB 1BWMA 3DIFB 2GUYA 2DQDH 3GSWA 4O2CB 3ZHNA 3IRPX 5INDA 4JHWL 1QQDB 2EVHA 3GJFK 2NSQA 5E9DA 3PJSB 3V0WL 2MNJB 2O1AA 3FQ2A 1MCDA 1HOCB 1I8IA 1T80A 1KLGA 2UUDH 3NA9L 4DHLA 4BFGA 3SOTA 4K5LA 3FN0H 2V3EA 1TR7A 5AVUB 3WEBA 1F2QA 1KN2L 3LN4A 2VZUA 3QHTC 4LFHD 2R1XB 5LG6A 2W65A 4DQAA 2VDNB 4PW3A 3DMMC 1Z9MA 3S37H 1S8DA 1UGKA 1IBBA 2XETA 1IGMH 4JDEB 4GS7C 4CKVX 1LJMA 3HG5A 4U1NB 5E6ZA 5B3JE 4NCC2 4YHLL 2R0WL 3UTSD 3NGBB 5CJBA 5FCUL 3W5MA 1IQDA 5I17A 3ZZSA 4HK0B 3IN0A 5AYUL 2NDFA 4OD1L 1EAPA 4H5SA 3FSAA 3ZQ9A 4YSPA 3CBRA 4XWGH 2NY4C 3CDZB 3S3BB 3WTTA 3IXTA 3WN5B 2UYLA 4Q2ZB 2VH5H 2FE0A 4M7KL 1DZBA 1DQTA 1WT5A 4X5LA 4L8SB 5AVXB 4WENB 4NQUA 3CCHB 4WQOA 2H2PC 2XX1A 3KYNB 3U82B 1WDAA 2JJTC 2N7BA 1YAZA 4QRPB 5GGSB 4A2MA 1LWJA 1EZSA 1UVQA 2PW1A 4YZFE 5C1MB 3M46A 1FCCA 3P0YH 2COVD 3SDDA 1CWVA 3DWTA 1FORH 4G8EB 1VFUA 1VLXA 2GFBB 4LIQH 4NHCL 3OR7A 1UT1A 1MFMA 4Q74A 5AVZB 2XV6B 4NQDA 1S7TB 3EOYG 4ZO6A 3ABKB 5E8OA 4B9GA 1WBZB 3N40P 2J72A 1YYML 3NCYS 3OV6A 3CBJB 3PP3K 1OGTB 2K4AA 4FKEA 5HGDB 2P5PA 1FC2D 3MBXH 3NSDA 3H3PL 3TN0C 3VRLE 2IAAC 5C6PB 1PIGA 1AQKH 1KCVL 1CDHA 3MNMA 3LKQA 4N2AA 4QKXB 2V3FA 3NA4A 4XBPA 3VWJA 3O3DB 2PLTA 4BK5A 4IOFD 4AQZA 4YDKH 1Q38A 5T5FH 3QAZC 3QIWB 5DR5L 1HS6A 2DI7A 3JWOL 5IB1B 5DLML 2Z7WA 4IBLT 2J4WL 1KCSH 4WGWB 2A9NH 5F9OH 5D4HA 3HPLB 1CZ8H 1WHPA 3THMH 1T66D 2WYIA 3H9ZA 1F56A 2D31B 3IPEA 3PJLA 4J8RA 2LLNA 4JMXA 5HYFA 2LFGA 4GMSH 2DQUL 1YNLH 2W88A 2VLRB 1CE6B 2DAVA 4LAQH 5D70H 2OYPA 1XXFC 4PP2A 1TU2A 2X09A 1WTGT 2OXHA 2FZ3A 1O6TA 1MF2H 4KBPA 2W92A 1OWWA 1NEZA 2AJXL 3WELA 1F3RB 4PGDB 1QHOA 4B9ZA 2ZP8A 2P5EA 3VUAA 4XBMA 4I18B 1EEZB 2HUHA 2D0GA 3QPXH 4GO8A 1MWAH 1K4CA 1XF5B 3VFVA 4LCWB 3WN6A 3ECUA 4AQ1A 2Y36L 4ODVL 4CMMA 4ABWA 4R9HA 4YSCA 5EG6C 4UTCA 1XGRA 1AZBA 2OZ4L 2ZWYA 3O6KH 3T6ZA 1D5IH 2BNRA 2GHWB 4J3XA 4MJ5B 2N7AA 3G5XA 2X4UA 1Z5HA 4W70A 1MG2C 3GINA 3ZN6A 1H3WM 3QDMB 1OARH 2F68X 2VR6A 1PZ3A 3G08B 5CIPH 3BP5A 3T6VA 1BFSA 3GKWH 4XNXL 5C70A 1UENA 3IDJB 4XNZC 4ZG1A 4FN0A 5IM7A 4PUBH 4UU9B 5EUOA 4BD4A 3GGWB 2P49B 4PJHF 4XPFL 5IVOA 3QHFH 4WEBH 4DO6A 1ZSHA 2PO6D 4GXVH 4P5SA 3L1GA 4Z7VA 5HYIA 1FJ1B 4UDUB 3Q2VA 4D3CH 3UADA 3KJ4C 5EO1A 3BSZA 2KERA 4G7RB 4FTVD 3LZQA 1A7NL 4AZ8A 4OLXH 1M1XB 4CILA 4KMLB 5EUOB 3HS0C 2R0LL 4N0CC 5LGHL 2HX7A 1HHJA 4B96A 5LBSH 1AGBA 1CGUA 2HJLA 1QSFE 3KL0A 4NYLB 5T1LA 1IKNA 3N9GL 3B7UX 2XZCL 1AD0B 2WLNA 4I2XB 3ULVL 3CX5K 4G8EA 4R4ND 4FXLA 2KUTA 4MB1A 3WKNA 5EU6E 3DPDA 2B15A 3KPNA 3OLEA 1A02N 1IE5A 1A6UH 3POCA 1RZGA 4AMWA 2EEBA 4Y5YC 3D52A 3RWJA 4QRTB 4DFIA 2I9TA 4NQDE 1DLHB 4ZMVA 1NEUA 1JRHI 1O9ZA 1YEFL 4Q52A 4HUVB 2DQMA 1XHHA 1NIDA 3DXAD 2P5EB 1ZVHA 2Y7LA 1XCQB 4W6XB 1T7ZA 3CVBA 1JWUA 3V0WH 3EJRA 3L5WB 4BINA 1U33A 5G4OA 3F65A 3H9SE 4MJIA 4NOBA 2GSIB 1R3KA 4YXKL 5DMKB 1KXVA 3U6RB 1TETL 4ISVA 3VXSD 3NPSC 5KVEE 1ZT1B 1YEJH 3FQYA 2ICCA 2VC2L 2MNWA 1ZSDB 1S46A 4Z0BL 2VO8A 4DT2A 4M3JA 2AV1B 1UCTA 1WUNT 3ABMB 3N85H 3QIBA 2BVPA 3L4VA 4F3FB 3QUZA 1NPUA 2AABH 4WHYH 1OCOB 4J4PD 3BI9X 1KB5L 4KOBA 4NQCD 4PCTA 4TNFA 3WIHA 1L9PA 4Y16D 3DJTA 4F8TA 1U3JA 3IDUA 2BIMA 1MWOA 2EADA 2MNUA 3N43B 4L2LA 3A67H 5C0FB 5CU9A 3VD0A 3IXTB 2X28A 2IBZY 3GBML 4ANWA 1CD9B 5F1NA 2G5UA 3CFCL 3RZCA 3V0JA 2I7OA 3SDDB 3T04D 4AIZB 2H9GB 3MV9B 3S3PA 4X98A 2VQ1A 5TE7L 4G8IB 2DD8H 4M02A 2X2UA 2GEEA 2LT9A 3PXLA 4Y5YB 5DYFA 1X9UA 3MGTB 4FNLH 3W9EB 4GI6A 2VCOA 3EO9L 5DVMA 1KBWA 5I6MA 2PR4H 2NYKA 4N9GB 5ITBL 2XN2A 3OB0K 3LD8B 4AJVA 1AKJA 3NSJA 3RDJA 1JRHL 4QRUB 4HXAL 3WXVH 1UQSA 2XTJC 2YZ1A 4C4KT 1JDCA 3ARGC 1JS4A 2H0EA 4DUWA 2Y23A 4QXUL 3UTTD 2Q8BL 5CEZE 4BK5C 1KENL 1QFHA 2XKSA 2WXKA 3IFPA 4XPGL 5DMIH 4E36A 3BPNB 4PJ5D 4Y4FC 5C0FA 3EFOB 2DBJA 1E8ZA 3CBKB 4R26L 4G7VL 5D72H 3HA0A 5TJWK 1YRKA 1AOHA 2QEJA 4AT6B 4HJSA 1N8OE 4POZC 4MMZC 1S4IA 2B20A 4CN6A 5D1ZI 5DYOA 4M7LT 4NO5B 1KLGB 4AY0A 2JK5A 4E9SA 1ZHNB 2V8LA 4TULH 3VB8A 5CGYD 2JELL 5J6HA 5ANHA 3WFHB 4XX1E 3K71B 1LO2L 3QCTL 4PMFA 2X10A 1FG2B 4UT6H 4NNPH 1BVLB 4HUMB 1N9PA 4XB8A 2BOBA 3IDGA 4QRRD 4ZYKB 2P48B 3BDXA 1BEYL 4G1MB 4OZHF 1IBGL 4XPHL 3LKPA 4JM2F 2Y6SD 3WIIH 4X5RA 5J13C 5DRWB 5J56B 5SWZE 5A2FA 5EOTB 2VR7A 3F05A 4I2XE 4AC2A 4PCSA 1R3IL 4X42A 4B97A 3HLAB 1SHWA 4JM2A 2R69L 3IB4A 3N55A 4PB9L 1RJCA 1AIZA 1TQWA 2BRRH 1SZNA 1MCCA 1YAIA 5E56A 2DYPD 1SBSH 4NRYA 3ZMNA 1ILSA 1RIVH 3ZTEA 2P8MA 1G0DA 2EUXA 3C6SA 3ZMEA 2BC4A 1OSYA 3D4YA 2YD5A 3DX0A 4HF5L 2NY4D 2BVQB 1JK9A 4C4KO 1QEXA 4XAWH 2K9FB 2ZUTA 4XI5C 4K9EC 2OW7A 1KWGA 3LVEA 2JSFA 2R0LH 5EEUA 1VPOL 4XCFL 3GLAA 5HDRA 3ASNB 2ATKA 2H4EA 4AV4A 4GG6F 3WLBB 5I1DA 2H26B 5EWIL 1SVZA 2JXMB 3KCPA 5DC0A 5FYJL 1OPOA 3IDMA 3L5XH 5JIKA 3V4VA 1EXHA 4F20A 1NGPH 1R17A 4HJIA 5HDWA 4MXVF 3DOSA 4GIPD 3GI9H 1O6VA 3CN0A 3OLDA 3N6YA 5H37A 4IIQA 1GGIL 1CICD 4ORGB 5IQOA 1JZ2A 4JPSA 4MCMA 3CQPA 3Q43A 1ZRUA 1CCZA 3L7EB 1PZ2A 4KTYA 3GNMH 3NEXA 1CB4A 3D33A 4A55A 3ESMA 4PJHE 1HSBB 3PUCA 5EOCJ 1KTCA 5KJRL 4YSAA 3I6LD 3FH7A 4FQ1L 2RR3A 2R1YB 1IM9B 4HUKB 2AQTA 3O2DH 2AEWA 1R5IA 2IDUA 1IFHL 1HXYA 1A6PA 5GS3A 4PVBA 4HETA 3IXAA 5A2IH 3DVFA 1UWEH 1QACA 4NGHH 4F8OA 3PHAA 3MV7A 2GKIA 1HSBA 3MLTA 3P40A 2Q9OA 4M29A 4OLEA 4YHIA 2C9UA 2P7TB 2YGPA 2J3SA 2Z8SA 2X89A 3HAEB 3IMSA 1AZZC 1M53A 4BSVA 3SKNB 2XFXB 3TV3H 1G4RA 4Y89A 1W0WB 1PD6A 5C92A 1M42A 3J7HA 3QHZL 5KSAA 2X05A 4KY2A 3FU3A 4YHZH 5F1KC 4N20A 3KPQB 1UXLA 1GGTA 3MLTB 4MD5A 3VXPB 1FNEB 4JJ5A 5IVXA 5H4YA 3DV4A 2HFEA 3MFGB 4JGHA 3VGFA 2AJ3B 1QI5A 2J1YA 3DJ9A 1QOKA 3J27A 3TH2T 5GS0D 5KBDA 4BFRA 3ZW3A 1T4KB 1H8NA 3ARDA 1U21A 4XHJC 3ULUC 4PJ8A 2HN7A 1E9QA 1B6UA 4KK8C 1MCHA 3MRCA 3NCBB 1SHSA 4FFYA 1XTMA 4OCSH 2ZYRA 5TE7H 1MEXH 4EJ1C 4MNHA 4F15C 4OBRA 5EC1A 3SE4A 2W95A 4X6EA 2A6DB 1SOXA 2EIDA 3VWKA 2C3HA 1X5KA 3VG9C 4GW1B 5ISZA 4D7BA 1DQIA 2E9WA 3BKCL 3M1BB 4F9PA 2R4SL 3MOAL 3UP6A 2FK9A 2PR4L 2Z64C 2ENPA 3MO1B 2I25N 2GPZA 2B1AL 2OYLA 1D7DA 1XV8A 1N6VA 2Y22A 5L4IA 5DRNA 3RVTC 4Z7WB 5B8CA 5CF3A 2NLJB 2XY2A 5E1AB 2EIEA 2X4QB 2ROXA 3BAEH 4K71C 4PJFE 5KSAB 4G7YH 4GSRA 4OLUL 3GK8H 2BSDA 4HUWA 4X7SH 2ZD0A 4EO5A 4L29B 4WU5A 1X4ZA 4NT6A 4PRIB 4MD0B 2JI1A 1T89A 1B0GA 4NFBA 1KYDA 4K71B 2E7MA 2ROYA 4N1CA 3ARED 1KLUB 4UDTA 1NC4D 2NW2A 4G5ZL 4BK8A 1EFXD 4Q9QL 1IC4H 3TH3T 2ZCKH 4KZEH 2WLIB 1PQZA 5HPOA 4GH7B 3LTVA 5HHVL 5L2JA 4KU1A 3D2UA 3ZT6A 5FAAA 3ZKMD 1J5HA 3MRRB 4FTVE 1M7UA 3OG4B