4BKTC

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
137
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 137
sequence length 140
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4bktC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4bktC01
4W9JC 4W9IC 3ZRCC 4B95C 3ZUNC 1LM8V 1VCBC 3ZTDC 4B9KC 4W9HC 4W9CC 4AWJC 4W9EC 4W9FC 4BKTC 1LQBC 4W9DC 4W9GC 4AJYV 3ZRFC 5LLIC 3ZTCC 4WQOA 4W9LC 4BKSC 4W9KC
chains in the Genus database with same CATH superfamily
2QVMA 2R1WA 4LLMA 4G6JL 3HNSH 1BBJA 2AF2A 4GSDL 3RL1B 4IOSA 2R27A 4H5SA 3G6DH 1D6EA 4HEPA 2VZUA 1UA3A 1FYHB 1RULH 4KO5A 3QXUA 2FBOJ 4NM8H 4OQTA 1SYVB 4E5XG 4NNPH 5FW6A 4UQ2A 3SQOH 4B27A 5G2NA 1WUNT 4KDVA 1S7TA 3IPEA 3PGCA 1JGIA 2RACA 1NJ9B 4UBDD 1KCLA 2J5WA 1WG3A 1T5XA 6FABH 2WUBL 3R4RA 4RAVB 1B3IA 1INQB 5E5MB 2R2HB 2RAMA 5CEXB 1WCBB 4X4YB 4FERA 3NEXA 3RGBA 5ACLA 1WS8A 2BLFA 4ZTPL 1XGZA 3QO1A 3BDYL 5FCSH 3D18B 1PY4A 1ZDSA 4FMFA 4YWGL 1R3HA 4RFNC 2CKBA 3ZHFA 1KZQA 5EUKA 1SFDA 1KBKA 4QNPF 4OZIF 2Q3XA 2YQ3A 5D6DA 4RIRB 1BSIA 4BEIA 3D7PA 4GW4A 3MHZA 3JV6A 4N22A 3S2CA 2ICWI 2WAQA 3C5ZC 3EJYD 3ZKMC 4EDXA 1UTDA 4FKEA 2G4GA 3CBRA 4XPHH 1FVDB 3U83A 2A7BA 4GIAA 4GIPD 4BCXA 1I9RL 4JFQA 3WKQA 1SYSA 2ZX5A 1JVKA 3DX1A 3HMWL 5K9KA 1P5VB 1I7RB 5F0LB 3EBIA 1Q0YL 4HMDA 3EYQD 1HK6A 1S9YB 4JZJA 3VWJA 5A3IC 1NEUA 4CW1A 3KDMB 1CLYH 5L2KE 1U33A 1TTFA 3EFDH 5HGAB 1XSOA 2IH1B 5I6XC 4P4KC 2YWYA 1Y07A 3SCMD 2F8VA 5GZOA 2CWRA 2DWTA 5ENWB 1RZ8A 4NQVB 2EDTA 1FG2B 1HH9A 5FM5M 5AVVB 2CDEA 3CHOA 4YFLI 5JQHC 1MW0A 3UBXG 4MRCA 3HCVA 1CT8A 1KIQA 3C8KA 1C9SA 4GP8B 3TP4A 1HAWA 3RPIA 1YNKL 5EEXA 1NC4B 3PPSA 4YDJB 3FN3A 1IUZA 1DBJH 1X5HA 4F1SA 4L9LC 2IV8A 2VW7A 5IBTH 3FFOA 1KIRA 5FGRA 1MFDH 3BWAA 4PGBA 5DRNA 3VFTA 3BRGC 2K70A 4X6BB 4UU9A 2R4SL 2P8LA 2NNAB 5H2BA 3TC9A 3ZE0E 4K9JA 4YBHA 3LPFA 4F8PA 4MB1A 1FIEA 1NLBH 2MNWA 2WP3T 5D7KE 4XMKH 5DVOA 3WJMA 3G5XA 5F97E 3S4SA 4YSAA 3EYUH 5TF1L 3FT4B 1GYCA 4J3UA 4B5ZA 5HHNB 2QFRA 2D73A 4H0HB 1NAMH 4OIAA 2BY2A 4RETB 3W0WE 3O3EA 2QTEA 4XNMB 1G5AA 2P5WE 3HHRB 4GH7B 1L3NA 3P4MB 4URKA 2ATKB 2ZOKA 2ZX6A 3HG1B 2L4OA 1TVBB 3V5KB 1CXLA 5AEAA 1DSYA 4KH2A 1D5BB 3HMXL 1JZFA 2AGJH 3UO1H 3L5IA 3S96B 2E75C 1JGEA 1PF3A 4KMLB 2EABA 4YGAB 3GIZL 5A2IH 4OUUB 4UT6A 3DIDA 4OW6A 3JVFC 1IAOB 3KPTA 4M7ZC 1U92B 2NY4C 1UT2A 2WJ5A 5CMAB 2Z7ZA 3LPPA 1TKWB 5EULV 2XVBA 4FXKC 3KPRE 1E3ZA 1J5IA 3QQ9C 3I6KA 4HUXA 4WY7H 1BLNA 2ED9A 5C0AA 2AP2A 4BFFA 1QRNA 2BP0B 3VXUE 2APBA 1JJUA 1MREL 2BY1A 3PV6A 4RA0C 3RHWF 5HJ3A 1U8NA 1SQ2N 1XB8A 3E9TA 5E6YA 2OMWB 2AERT 3NIDB 1VGKB 2K3TA 3RDTB 2V6HA 4JB9L 1LHZA 4JHBA 3QORA 1IKNA 1SY6A 1L0PA 1AAJA 3OAWA 4HZLB 1ZT4A 4G8IA 3TVMB 4PHZA 3UO8B 1SXNA 1MJJA 3SPVB 4PUBL 5HDQL 5F6HJ 1G94A 4XPGL 1IBHA 1NBZB 3FQUA 3TBSA 3U79A 4LCIH 4X2UA 5E8DL 5K1NA 1BVZA 2CIIB 5I75C 3R06B 1ZVYA 1GKEA 5IHUH 2UV3A 3O2VH 1IE5A 4H88H 4YXHH 1HL4A 3CSYA 3X11A 4TUOB 5DO2D 1QX1A 2R9HC 4N2CA 1FN4B 1KPUA 3RTQC 4HUNB 2IGLA 2XY1A 1X4ZA 4QAMB 4XN9A 3T6ZA 4B96A 5EF0A 4PJFB 1MCSA 3TURA 2OJZL 2D7TH 4EI5B 4D8PA 1TO4A 4Z7IA 1P5UB 1QSFB 4I1RA 1L0YA 3SQOL 4EIGB 3AS1A 4WWOA 3ZE2B 5JLZB 2H45A 5EOTA 4D9RE 4Q2ZA 5FO9B 4UNUA 5DJAB 2ZKYA 3S36H 4LVEA 5GS0D 3U4AA 4YSPA 2DD8H 4LPVA 2MWCA 4OKVA 3KH4A 3H3KA 4DP2X 3SDDB 2VABB 4LDEB 3EYSH 3HPLB 3L3HB 4NRZB 5CWSA 2VE6A 1KN2H 3WO3B 3SDCC 4WDIA 1F4AA 5D7IE 3U82B 1VFAB 4QRQA 4U33A 3TNNA 1HHKB 3BFOA 3CHQA 4N2KA 4KPHH 2B2XH 4FFYA 4EKXA 1AQHA 4JDZB 3CHXA 1JN6A 1PAMA 1SEQH 3T8MA 2X6MA 4NQCA 2XFXB 3BGMA 3GM8A 4JVUA 3Q5YA 3MFGB 1OL0A 3LZFH 4KTYA 3CFUA 3H9ZA 3TA3A 1QFWL 3AZUA 1OIOA 3MXWH 4BCYA 2Y5TB 2NDFA 1XL4A 4QOKD 2A9NH 2OZ4L 3QHZH 4MASA 5DK2B 3FOLB 1YMMB 4DQAA 5E2TH 1UM6L 2BWDA 3GSOB 2DMCA 3IJ9A 2X2UA 3T8VA 1KEGL 5KWYC 1MFAH 4ECNA 5AZ2L 3V7MA 5CCHE 3K5RA 1A0QH 1F3DH 2AK1L 4KXCA 2X09A 3NTCL 2JJSC 4NSKB 1MCJA 5DHXB 1UOKA 2FX9H 5PAZA 1E67A 2IADB 2NDGA 2RCSH 1NGXB 4ENEC 3LIZA 4R26H 1FV1B 2J71A 3B83A 5HD8D 4NBXB 2AK4B 1R5VB 1SOKA 4GRLA 3QDGD 2VLRA 1EDQA 1BAGA 1OAKH 2RHEA 2Y7MA 1T22A 4GG8B 1RK7A 3MRCB 5EBLB 4WUUB 3LNFA 4NC0B 4AC4A 1CE1H 4G11A 2F53D 4BKSC 2PCYA 4I0PA 3WEMA 1B4LA 4F27A 2C7UA 4WSGA 2BZ7A 1L9OA 4U1HB 1RZPA 4IHOA 1I4FB 1FWXA 1NBYA 2OJEA 3AQXA 3KWWA 5SWSE 3ZMNA 3D48R 2EEFA 4KMTL 1F6FB 1TCMA 1E5AA 1AXSA 1FGVL 1M9SA 1UKQA 2IH3B 3TWCL 1IKFH 3W5MA 4IRJA 4UV7H 3SE4C 4P2RB 5HHOB 5DI8A 4DEPB 4LF3B 1O7VA 5EZOL 4PBXA 5J56B 4UTAA 5FDWB 1DQML 4A67A 1E8ZA 1RQ5A 3EYUL 4NQDE 1JPEA 2F1AA 1CD1B 3OR6A 1FDLH 1IBDA 5FUZL 4F3FB 1FBIH 4QLRA 1SUHA 3LPWA 5I1JH 5E1AB 1QPXA 3PWPA 2YMOA 5D93B 4P9HH 4RDQF 1FO0A 1IAKA 2BH0A 5KYUA 4HVBA 1OF2B 5MI0C 1HQRA 4V1DA 1K5NB 4LKCA 1QPKA 3RVTD 2IH8A 3TBYB 3RVWD 3BO8A 1YEDB 3I9GH 2COQA 4PTUB 4ZAKB 4AC2A 1G7MB 1E5YA 2AGJL 3QDJD 1AGFA 1OK8A 4A6YA 1GAFL 4OV5A 4S1RH 4U6XB 5B39G 4IQHA 3KPPB 3GSQA 3CVCA 3FQNB 4ZXBA 4TLUA 3QEQE 1M4KA 1CL7I 3S35L 2ZWZA 3CZFB 4WI2A 4M1CD 4G8EB 2WZ0A 2LLLA 1WZ1H 4M4RB 4WY7L 3LB6C 3MODH 3QH3A 1ET7A 4IRZL 4LSPH 2GT9B 1S7WB 1KBBA 3T0AA 1TPXB 1MPAH 2A74B 4F8TA 4F9PC 3T2NH 2X4PA 4PJCA 1BD2A 5KBDA 1CLVA 1T80A 1P4LA 1TITA 1U95B 4DAGH 2DMKA 2JJTA 4JFTA 5E0QA 3VH8A 4HWEH 4JFXA 1TZHB 1P53A 5EC2A 5ERWB 4HCIA 3BPCA 3MRRA 4P2QB 2PCXA 4B97A 3BGFC 4MZ3A 3LZOA 3IFPA 5IHLB 3H9SD 3I85A 1BFOB 2KLRA 2X70A 3M8OL 2F5BH 1R3LA 4HQQL 3SDXE 3RVUD 1Z1WA 1JZ4A 2FK9A 1JYVA 3RWFA 4LP5A 1PX8A 5FYJD 5DC9B 2AQ3A 5IHUL 2OXGB 4D9QE 3CX5K 1OT1A 4LFHD 3OB0K 5DTFB 4GIOA 4HIJB 2J8UE 3E8VA 4IK6A 1YDPB 3QIWC 4X7FC 1UH3A 1PKQB 2A1WH 3ARFC 1SJHA 3RWEA 4PJ8A 1J5CA 5JA9A 1B88A 5AKRA 4UANA 3HN5A 3N40F 2R0ZL 4NHCH 4WO0A 3AG1B 3NFNA 4JO3H 1HX0A 1I31A 3AS0A 4JR9H 4E41B 4YVUA 2ENPA 5DGRA 4I2XA 1DQQB 5EEVA 2ICEB 3CVDA 4JDVA 4OTXH 3QWRD 3UX9B 4E2OA 4NB7A 2QVKA 1MCIA 1AJ7L 4Y4HA 5E99H 3AM8A 3EYSL 4E9RA 3AJ7A 4KJQD 3VXTB 1WA2X 2CLVA 5LAPA 4OF6A 2MKLC 3ISRA 2PW1A 1ZPLA 5G5DA 3L3OB 4WU5A 5L8LB 4KPHL 1GMEA 4TL4A 5DJ2A 1KGWA 2CCWA 5ANME 1HAUA 3FS9A 3DI2B 1SEQL 1RU9L 2F74B 1VLXA 4XO5A 4ONHB 3RL2A 3BVNA 1L6XA 2PWGA 1Z3RA 4WKXA 2DYRB 2LU4A 25C8L 4ZTEA 5T1LA 2FL5B 2C3HA 4TNGA 2C26A 5EORH 3MV8B 3VXNA 4APQA 1UKTA 4FNRA 5KSAC 5EN3A 4KTDH 1G9ML 1I9JH 5DQ9B 3JTTA 1MHEA 2WQSA 3WIHH 3C6LC 2CDFB 3BKMH 1L6PA 2OMNA 1A0QL 1O7SA 3UGUA 7CGTA 3IETA 4PJAB 3NDYE 1PX3A 2IO5A 3L81A 5CJBA 3VWKC 2XWZA 3LKQB 3SJVA 2UZIH 2P80D 2AITA 2Z31C 3EH4B 1PZSA 5AOZA 2DH3A 4XWGH 3SBWA 3FT2B 3QNXB 5CLYA 4X7DC 4I85A 5EU6D 2RCSL 4NWTL 5I18L 1MVUB 2BHUA 3PHSA 3ENEA 3Q8EA 4R2GB 4U05A 3MRMA 4NT6A 4X4MA 5KOVC 5E51A 4HPHA 1JWSA 5A2AA 3OKOB 1U8QA 4KZCA 2VXSH 3B2XA 4KMQA 4Y5YB 3H6JA 3BX7C 1NCUA 1P84K 2OP4H 2CLZB 4AX3A 3BLBA 2ARJB 1IRAY 4LSSL 1GRWA 1NCCH 2FYYA 4KNSA 2VB5A 4WRLA 4DN3H 4YQXL 5KSBE 1E43A 1XCXA 3NQIA 2WTOA 5I1IL 1H5BC 3KWXA 2BFVH 2A3TA 5IF0A 2OM5A 4PSPA 4F33A 2JF1A 5ELIA 3CUPB 1F90H 4TS6A 4N9OB 2BK8A 3MBWA 4PPTA 2EVHA 1JXDA 5AW7B 5CFHA 1QUNA 3BJLA 4L23A 2EP6A 2LAAA 3R4DA 4J8RB 2IQAB 3L3KB 5C0BE 2EINB 3WIFA 2OW6A 4KGLA 4NLHA 1GL4B 3KPSA 1XF3A 3B9KA 1A9BA 1COBA 3HBZA 3UTQB 5KS9A 1G7JB 2X6UA 2CPUA 4ZDHA 4CUCA 2R15A 5JUEH 3BAWA 1CL7H 3VXMD 3T77A 4G9DB 4MB3A 3JWOC 4HKJA 4HX1B 4P9HL 1MQ8A 2AJSL 4AI7A 1V3LA 4MJIB 5KVEE 5F7DB 1KTJA 1P6WA 2YPLB 5AB2A 1WCQA 3I9GL 4XP4L 4HSAC 4HCGA 3P3RA 1XX9C 5AUMA 2VM9A 4F58L 1NIAA 3ZKND 4Z76B 1UCBH 4F20A 1YEHL 5EU5A 2WO3B 3V95A 1BZDA 5DYFA 2IPKA 2VLRD 5CZVL 3KE0A 4UTCA 2O6PA 4LSQL 4PB0H 4R3SB 4YNYB 2XV3A 4A2HA 4Y1AA 1XGUA 5BVPH 2ZOWA 1CFSB 1UGKA 3QYCA 1E9PA 3WNIA 1J8KA 3OLGA 4H0IA 3FB8A 4UAHA 4Z3IA 4F2ME 2GEEA 3L08A 3QCVH 1A02N 1BF8A 2Y72A 3MODL 2X12A 3WFHA 3EZJB 4J1UA 4AZ8A 4HFWA 5ICYB 3T2NL 1NCAH 1ZV9A 5ITFB 3DBXA 4EI0A 43CAB 2Y24A 1WFIA 3I84A 3TF7C 2NQCA 2F19H 3HRPA 1QMUA 4IRJD 3DURA 3GPEA 5EO0B 5T33L 2G3NA 4BM7A 4GAJH 4LLDA 3F12B 4B9JA 4JE4B 2C34A 4LBAA 2JQMA 5C1MB 4K9EC 5IW1B 4N26A 5MENE 2IC2A 3SE3A 4IRSB 3W2DL 2UY7B 35C8H 3CDZB 4UQBA 4CADB 5FGSA 4JKPH 3TO4B 5D7IF 3L5WA 2WGNB 3G5YB 4HPYH 3Q48A 4H26A 4DZBA 5D1ZC 2C8NA 5GRUH 4OT1L 3NJMA 3AC0A 2GBVA 1ZA6A 2BNQE 3OBAA 5JDJA 1A4JA 3C09C 1HKLH 3MV11 4OGAC 4F7TA 2G3XA 1FFOA 2NY0D 5F1NB 1ZT7B 2F58H 5HGBA 2AJUH 4BSWB 3PAUA 3GSRB 2A6KA 2P3YA 1KC5H 3B9VA 3TFKD 4NO0D 5I1HL 3SPHA 1H8SA 3WE6B 3VFNB 3GMNA 4LHUA 3MRGA 1JG9A 5E1QA 4UMSA 4CBPA 1JZ2A 3GMQB 3V6OE 1YEEL 3K2UH 1S9WB 1YLBB 4OTXL 3MFFB 3FO0H 1USZA 2PTTA 4NFCA 4P05A 3FB6B 1UM4H 4X5XA 5IG7A 2JNZA 2NUPB 3QAZB 3VYPA 2Q8AL 4UILH 2GJPA 4CU7A 3F00A 4GBXB 3QJHB 1C08B 1DR9A 4ZUSB 3PGDB 5FGBA 4XP1L 4I1PA 1NCHA 1E4KA 3HNTL 4LRNH 5TDOB 2LLNA 2H6UA 4AGPA 2M1KA 4LHJB 2B59B 5HHVL 3QYNA 4J6RL 3C8DA 5EEZA 1JFQL 4WW2A 5EIVA 4P2OA 2MPAL 1I85A 4XPFH 5TE7L 1D9KC 3UAJA 2J8OA 4X6DA 1FNEB 4AQEB 1IC5L 1RJLA 5LG6A 1IGJA 5EORL 3WFBL 4PP1C 3UXFA 1M7IA 4IKKA 4UT9H 1QNZH 4ZMAT 4NGHH 4MD4A 1JGLL 5TH2A 3BKML 1CLCA 5E95B 1AGDB 3V6OC 4RMVA 1XT5A 1A7PL 4HH8A 1KXVA 4KI5E 3V0IA 5C3IA 5B1KA 1CGSH 3RKDC 2QGCA 3CVIH 3VXRA 5IBLC 4UTBH 4IMLA 2PW2B 5ISZD 2NY3B 3V4UH 5JXAH 4F7CB 1YNTA 1HYSD 5E8EB 5AW2B 1H3XA 1YN6A 1HHGA 4DGYL 2HJKB 4YHPB 1UUSA 1E2ZA 1OM3L 4MBOA 2F7QA 4NZJA 2GUOA 2WO4A 3FO1A 4PVNA 3EYVB 2VZVA 5DC4B 4N2EA 4KGJA 4OY9A 2W0LA 2Q1EA 4WV1A 4BHUI 1NCCL 1BAFH 4Z7VA 1KLGB 1AVAA 3AADB 2IOMA 2DLEA 3HZYA 1H6UA 5FOBA 2C7FA 2EUZA 1J88A 4X4XB 4MNQA 1T1ZA 5F93C 3APNA 3ULUC 1F90L 1TQBB 5C0DB 4KXZI 4YDIL 2Z1PA 3OL2A 4TOYH 3GSUB 3O6LH 3PYCA 5DEZA 1HL5A 1M1XB 5GHWH 2E8ZA 1J0HA 3HE7D 1C12B 4KI5C 4JFVA 2BX5A 1JYWA 4NRYA 2R8SH 2R56H 4UV4L 4X0KB 4QRPE 2WJ7A 1EDHA 3BAEH 4ODUA 5B4MD 1JNNL 1U8HA 2PCPA 5CILH 1RHHB 4OZFB 1CL7L 2BY3A 2J1ZA 2AVFA 5EIIG 5L7XL 5T1MA 3SYOA 4K3EL 4HAGA 1E5CA 4PJHA 4UCFA 3H3BC 3O6FC 1RZKH 1U6AH 4AVKA 4AUJA 5DSCB 4FXKB 3SJVD 1GZPA 3WS3B 4AW7A 3ROLA 1PW3A 3AY2A 4W9GC 3CDFA 1SMOA 4PBDA 1CDHA 3F8UB 3SDXF 5LDUA 4Q52A 5LBSL 3H85A 2P5EB 1P1ZB 4HLJA 3L9YA 1H3TA 2RH0A 1IBFA 1EFQA 2OSWA 4QHKI 5BVPL 3S8FB 2XI9A 3Q2LA 4BFRA 1TZAA 4NRXB 1BM3H 4HC1A 3VFOA 1AHWB 1J5DA 1UJ3C 1JNHA 4G8GD 2I9TA 2BW5A 2XC8A 3AXLA 4BSVA 12E8L 1UA6H 2WLHA 4UUJA 3II1A 4JRYA 3T04D 3TO2B 1AGBB 4K8RH 4N0FA 4PRHB 2WP3O 4DP5X 1GS8A 2XN2A 3MCG1 5DQDH 4E9SA 3ATAA 3TA4D 4FQ1L 3HKZA 4GAJL 3U1QA 1D5IL 1SGKA 3NZHH 2KQMA 5F7NC 2OSLB 1ZPUA 5CIPB 3LRKA 3U46A 2VR6A 2PYFB 3B9KD 5LGYA 5EBMA 1DLHB 3INOA 5HY9B 4RSVA 4QUOA 35C8L 3IAGC 3BCDA 4MQXC 4OFQA 3VXUB 1JTTA 4X8CA 5DF0A 1WICA 2GIYA 2CR3A 3QUYC 4FG4A 4KRNA 4N85A 2A4CA 3KG5A 4X5PA 3RURA 1Q72H 4MQ7B 4N8CH 5BQ7A 4MNHA 5I15L 3O2WL 1ZLWH 3KYNB 1MLCA 1MIEH 1WLHA 4KTEL 4RISL 1FNLA 4M7LL 3DMMC 4XVSH 2BW4A 3O3DA 1HKLL 4H4NA 1W0YT 1RJZB 1XZ0A 5KW9L 2CLRB 1E4XL 4Y5VB 5C70A 1LM8V 2F58L 2AJUL 3INUL 3L95A 1OGSA 3NSFA 3VFSB 1K8DB 3I02A 3VA6A 5I8EA 1DUZB 5SX4I 3OKEA 5E5LA 2ZWYA 4Y1AD 3SDCB 1TO5A 5ESQB 5AW5B 1MSPA 4L3EA 5EBWB 3IRPX 4TVPD 2ODHA 4YDVB 5BMFH 3BPNB 3U36A 3AU0A 4AL8L 4J3OH 3JT2A 3BAKA 4RRPA 4JAMA 2OMXA 4NUGH 4J3SA 3ET9F 2EVGA 4HGWA 5JIHA 1IZKA 1G0XA 1NPJA 1X9RA 4A68A 5C09B 5F7KC 2Y06H 3RIKA 1XQ4A 1Q9OA 2AC0A 2CK0H 1OSEA 1RVFH 2W0PA 4G42A 4NJAL 3BISA 4OFVA 3N06B 4MHHI 4Z0XB 3BWSA 1QEWB 3ARDB 1OANA 1B0GA 1I7UA 2CGRH 5TD4A 2IPTH 2XN1A 1F6LL 3NACL 1PEWA 4LRNL 4QTHB 1HXYA 1KENH 4TSCL 5FDYA 3SHSA 3U7YH 2FEJA 3I6LE 4GJTB 2WYZA 2J57A 2NX5A 5ALBL 4XRCA 5G55A 5C0EB 1ODAA 1AXIB 5C08A 4JN2A 2XA8H 1LK3H 3BKYH 4M93C 3VTAA 4JM2A 1NDMB 4G6FB 1CYXA 3EAKA 1ZLUH 1R24A 4XPFL 1QHQA 2EXWD 1GGCH 5KSBF 3CHPA 4AM0Q 5D96C 1I7TA 4Y19A 3LY6A 4WAFA 1LWRA 2H47C 4HS6B 4RNRA 3NJXA 4BFBD 4IJTA 3Q2WA 3CH1A 3MRIA 3BH9B 3FW6A 4M43H 1KCWA 1LEGB 1TJGL 3KYKH 1DFBL 5D7LB 2ITDA 3F2LA 2HA1A 4N5EC 5HDBB 5C0NC 2OPCA 4LSUL 3P3UA 2GJ6A 5B7EA 4AEIH 2A6DA 4LHUD 2Z93A 4OM1H 4XCCL 2HT3C 4JZJC 5BS0D 1KJVB 5EDXA 5I8CA 5D1XD 1UD2A 2Y7SA 3IJ8A 4FC3E 4KXZH 2GITA 3RGVD 3BXNA 3IDIA 5DMKA 3P3SA 2Z0BA 1Q4NX 5LXVA 2NY7L 2ENSA 5F3HA 4DFHA 5GZOC 4GPVA 1KJ2B 3HBQA 4GP5B 1WEJH 2CGYA 3MRPB 3D8MA 4JHZA 3QDMA 1JF6A 4EUPB 4FLRA 4W81A 2YARA 3B8YA 3WTYA 2ITCA 3B9DA 3L7FA 4Q9QH 3DBSA 4FQJH 1PZ5B 1IM3A 3PG2A 3ZOAA 1FFNA 1DVQA 4R4FL 4M6OH 3K91A 2BXZA 5A2JH 3QEUB 5T3XL 5BRZB 3ZSTA 4CN6A 1M7DB 1L7IH 5IM7B 3N9GL 1Y7VA 2QKIC 5MI0B 3GHEH 4YL4A 1KGYE 3TM6A 2L0DA 4OI7A 2R2EB 1OGAE 2B20A 2MQ3A 5FO8A 4IIQB 4BXVA 1IV8A 2NY5H 3DOSA 4U1NB 3HHMA 4ELKA 4N0YH 4NM4H 1DL7L 3KR3L 4MSWA 5EIQA 5C0AE 4XPBL 2I9LA 2ZJSH 4YSDA 4E9QA 3U2SB 5DRZA 5KYXA 4ERSH 4BK4A 1EUUA 1F00I 3BDBA 4PP2A 1SN0A 4YHKH 1FAIH 4ABVA 1HJCA 2QLVB 2QPUA 4W9JC 4EQ2A 4ZS7L 3W9DB 3DRTA 3WD5L 4NDMB 4S2SB 5B1CA 2YKLL 2QJDA 3HZKB 2ZF9A 3AUVA 3AUWB 3L4TA 5FB8B 3N55A 4XNAA 1G6RB 2ENQA 3ZO0A 1CXFA 3QNFA 2VR5A 4M8UA 4PJIA 3BGAA 1BM3L 2H32A 1CFVL 3L48A 3WDIA 1MCOH 3FL7A 3FRUA 4QGYA 4E0RB 2I26N 1LLAA 4ODHL 1FFPB 2Q76B 4MNQD 4ZTOH 4HPOH 4FE9A 1I1CA 2PYEB 3IBEA 5GJTL 3TASA 5IEHB 1AOZA 3D05A 3H1ZA 1KBVA 4RGOH 3QFJD 4ANUA 5HDWA 1N7MH 2VW6A 4ODSL 2FAUA 3MLZH 4XMPH 4FXTA 3TTYA 1Q0EA 4PN6A 3TN0B 4DK3A 2WMPB 1MAML 4OJDH 3IT8D 3QIWB 5SX4H 1F4YH 2AEQH 4FZ8H 5SWZB 5IB4B 4FTDA 4UM8A 4K3DL 4MMXA 5IVZB 2MMXA 5JOPE 4GO6B 4QI3A 2XKNB 3T65B 4OB5H 4W6XB 1IKNC 2WPGA 3UAAA 5H37A 4LCYB 1PZCA 4L9DA 3MLTA 2ZAGA 5JXEA 1Z7JA 4XCYA 3WKPA 2NY6C 2QDWA 3UBXB 4J23A 2WW8A 3K8MA 2A2QT 4GKSA 4WFGD 3ETSA 5DWUH 2J1KA 3JVGC 3HS9A 1ACCA 1BOYA 2E7DA 4PEEA 4UDTA 4EE2A 4BBWA 1RURH 2XQBH 3ULSA 3M1CA 2B4CH 3QB7C 4JHWL 4DUWA 2DQCH 1A14H 4AQ1C 2P8MB 2DBJA 2VLME 4DQOL 5BCAA 3MNDA 1E28B 2QADC 3HZMA 2J1WA 2RQ8A 4P57A 5FKAB 4P23B 3BRFA 4F7MB 5FECB 4EN3C 3SZ6A 1QUPA 4R4BB 3FUJA 4NC1E 1RKRA 4LVOC 5CGYC 2L04A 1VZIA 3OKLA 1EAPB 4NUGL 4ZG1A 2XG5A 5IEKB 4JRYD 4KI5F 5IT2H 2C3VB 3L4ZA 1ZAGA 4L8BA 2DLTA 1F6AA 2YZ8A 3LKOA 4LLYA 1BPVA 5LN4A 2B3IA 2TSAA 1CB4A 3BVDB 2VN4A 4FQQB 4PRPE 1NCDH 1A1MB 2BPBA 2VDPB 4KKPA 2PO6A 1IGTA 1RUQL 3VI4B 4GY4A 5T5FH 5MEQA 5DJCB 5CD3A 1TEFA 3U7YL 4GAYA 4N24A 2BNUA 1OTSC 2XUWA 2G75A 5FM8A 2XA8L 1LK3L 4N4YB 2CE6A 4FFZH 1TJXA 4UINL 2Z31B 5IY5B 1VFOA 3V52L 1HXKA 3VNYA 3QNYA 4JVWA 4RBPH 1OW0C 4YO0B 4FQ2L 5FYLH 1LE5A 1H0DA 1I8IA 4GW1B 3T2LA 3V5HA 1LD9A 2ZSVA 3NRFA 1UATA 1PG7H 1DUYA 3KYKL 4QHUA 4X6CE 4NC1C 3VFMA 1BXAA 3NFSH 1E42A 4XHJD 4A04A 5CF3A 5JW5B 1P84J 2RMNA 3LKRB 3E6FA 4JM4H 3NPZB 3P73A 4OM1L 2O5YL 4H1LG 1N8ZB 2Z35A 5E2JA 1H5BB 3GMMB 5HI4C 3RB7A 1SDDB 2FJHB 2ADJA 4QIRA 4YSRA 1G5GA 5BVJA 5KANI 5BJTA 3DA0A 2FD6H 3SO3C 5EOCJ 1L5GA 5C07B 1PQZB 3FTGA 1A1NB 1R5IA 1XTLA 9PCYA 3GS0A 1VKXA 1WIUA 3PWPE 1DVFA 1DDHB 1Q94A 4PWHA 3HMXA 3MLYH 4JFPA 3HAEB 3DVIA 1ID5I 1KFAH 3GKWL 4FQJL 2VM4A 5D71H 4GW5B 4V1DE 4AIZB 4DEWA 1E4JA 1XR9B 1RHFA 1USQA 1S2EA 1CUOA 2J6WA 2M2DA 2X1PA 2XA3A 3K2KA 1CGUA 4NX0A 3O4LA 7PAZA 4I0PC 4CA4A 3EOAB 1L7IL 3HNVL 3KAAA 2A73B 4MRBA 2FNBA 5MEPA 3GUTB 4F9LA 3ILQC 4MQTB 4M5TA 2J6EH 5DO8A 5HDRA 1HINL 3C9NB 5J6HA 4M7LT 2XN9B 2DEXX 1U91B 3V4PL 4XP5H 1A4AA 2V8MA 5CEZL 4PV9B 1QO3A 4WI8A 1T1XB 3RG1C 3UTSD 3TIEA 1EH9A 1BXXA 3D4GA 2OMZA 4KFZC 3HE6C 4L1BA 5I5JA 3NP3A 1BD2E 1UWFA 5CINH 3WENA 4OLYL 1AR1C 3MNZA 4Y7MA 5LCVH 5C6TL 1YPZB 2YC1A 3O9WC 4U2YA 1HWGB 3EJTA 2H3XC 3UG3A 3IMWA 3WGUB 4A7SA 3PABA 5GIRA 1FZKB 2D2CC 3X3GL 3UPCA 5ID1A 2PTUA 5B38B 1KGJA 2OMYB 4Y89A 4BH8B 5IVXB 1D5XB 5EFIA 1V7MH 5D2NB 5AAWA 3LNHA 3HKFA 3NQKA 2X0UA 3QDMD 2FH6A 4B60A 2O5NA 3RZCC 1B0RB 2BMKB 2W92A 5K1VA 2O6CA 4R2GD 2OL3L 4OZFH 3D2TA 4HUMB 3A22A 1HOCA 2P7TB 5FO2A 3RNQB 4KQ0A 3RKPA 3T3PB 3V9CA 2F6AA 4F5CE 1MCRA 1GJIA 1E5ZA 2NR6C 1EMTL 1PCSA 3FYEB 5D8JL 4CKQA 5F1SA 5D2LA 3BUTA 1N7ML 5I1EL 5CN3A 4ABUA 2DN7A 4H25A 3Q6GL 2C4FT 3MLZL 4XMPL 3RB5A 3S37H 3BP4B 4QRSA 4PW9A 3D08A 1FG9C 4TUJA 1OTUC 4WWID 4JQXA 1HEZA 3IJ7A 3UGEA 1FVCA 4LEBA 5HHME 3UYRH 1T04A 3LYRA 2WOYA 5KN5B 4RQQA 4H8QA 1JGDB 4JY5H 3P4NB 2NXZD 5BV7L 5JOEA 2DLFH 3IJYB 3V6FB 2KZKA 4DCQA 2HSIA 3V4VH 2GY7B 2ED8A 2XXGA 1JF1B 4S1QH 3LZNA 4LMQE 4R4NC 2WVVA 5EF1A 1ODUA 3MRLB 3QZMA 3TYFA 2W9DL 3FSOA 3NSYA 4CVXB 5JPNB 4JPIB 4TUKH 5AL0A 3GGWB 2BC4B 2RBLA 4XC1H 2WBJC 3SYQA 4AYFB 5J9PA 2B3RA 2ZPKH 4XE0A 3BZEA 1S7RB 3L5HA 3DX7B 2ZUQC 3LEXB 2DQCL 1MQKL 1A14L 4JFEB 4MJID 5I9QC 1V5JA 2E6QA 4FXLA 4AYMC 4BWTA 1LVEA 4PJ8C 3AG4B 3P77A 4N0UA 4KQ4H 1RUAL 4N2LA 5IT2L 4EIBA 4JO8A 3ECBB 5AW6B 3TS8A 4KOCA 1OCWH 1VENA 4JHAL 5JORB 1LMIA 3D07A 3WEXA 2WBKA 2WZ6A 4LEOA 3MRJB 5J1AA 1EZLA 4CC4C 1H8OA 4DJMA 5T5FL 2PPFA 2IWFA 1FE8L 3Q01A 2AXGB 4JFOA 3U4EB 1XCQA 1A6AB 2HVJA 3ZTJG 5K59E 1AG6A 2Q5BA 1AKJA 5TK4A 4B95C 3NCXA 4FFZL 2DMGA 1J12A 3UAEA 3ZHDA 2F54A 3C5XA 2FIRT 2XLLA 4PD4J 3BAYA 1JZDC 4R5XA 1CD9B 1N70A 3DXAA 4ODVH 3IDXH 3O3BB 3UADA 4OZHA 1KMGA 5CGTA 2BZDA 4FNLH 1CK0L 3UBXI 5IK3A 4XOAA 5MP6H 3FF7A 2WKOA 1PG7L 4ZOBA 1OQXA 4NO2A 4GB9A 5ESAA 1OPGL 2PWHA 2VL4A 3L1GA 4XXWC 1KXQA 3L9BA 3MXVL 3BH4A 3LKNA 4KKQA 4NZRH 4M4PA 4RMUA 4APQC 3GB7B 3LXUX 4UQ3B 1CS6A 2X2IA 2HVBA 4BELD 1JS4A 3MROB 2YGNA 3LRSA 4HH9B 4PJEE 5HYFA 3UMNA 3T1FA 1BQHA 3L4XA 4TYUA 1RZGA 1I8UA 4QYOA 2H6OA 4JY4A 1E5BA 1OB1B 1NAMA 3HC4L 4KK6C 2YRZA 4Z7UA 1MKFA 1R17A 3FQXB 2IWKA 4AGNA 3PL6C 2VAAB 1BX2B 4HEME 5DRWA 2NYYC 4M9OA 1B9ZA 3I6GB 2W60B 1XGTA 3AWFA 2RFXB 1ZRUA 1KCRH 5FV1L 1QHOA 1KLUB 1QQDA 3MBEC 1ORQB 1KFAL 2FWUA 1BQUA 1MXDA 1OM9A 3DSNB 3OKNA 4IJ3B 4HHAA 4ZW7A 3BH8B 1JXFA 4Z8FH 1KZYA 5ECGA 4W4OA 1T66C 1O7DE 2IQ9L 3UP6A 1WH0A 3O6FB 3RAJH 1KEML 2R39A 3US1A 4G8FB 2AJYL 5D7JA 3QUZB 2DQJH 1XF2A 3UTZB 4OZ4A 4HKXA 3ZW3A 1P6AB 2BP8B 2J6EL 5J8OA 4GQRA 1JVOA 5A7EA 2XJLA 2AQ2A 1FIGL 3GBNH 1JHKL 1C16A 5E2VL 3OD3A 4DPAX 1KJ2H 1U2HA 1CLZL 3DIFA 4KAQL 1XGPB 4OCLC 4EUPH 5BXFB 1ECZA 2ZCKH 4LGSB 2ZWKA 4PJ9A 4M3KB 5CSZA 2BRRH 3ARBA 1BBDH 1NEZA 3FYIB 3PU7A 1BZ7A 1QA9B 2OMTB 5LCVL 2FEDD 2ESVB 1SJVA 1JCVA 3MJ7B 2XVKA 3I9PA 5E56A 4ELMA 3T8XA 1L9NA 4AVIA 1MEXH 4HWUA 1NIEA 1TTRA 3WO4B 4HHWA 1N64H 4J3XA 2YD7A 3L3DB 4QYAA 5EO1A 4GKOA 1O7DC 1J9QA 1SXSA 5LXGL 2P8PB 5E00A 3B3IA 1DVFD 4DVBA 4NUPA 5K39B 4H2CA 4ZUVA 2XNAB 2DH2A 2BM3A 2WNWA 3QJXA 4Q8BA 4QT5B 5TGBA 3BHBB 3FUHA 3WHXB 2WCPA 2KDYA 5I0XA 3IGFA 5CM1A 5IR1B 1BEXA 1GCYA 2XTJE 4HK3N 3O4LD 3TT1H 1X4XA 1TZGH 1ZSDB 4MS8C 5F70A 4NEHB 3V9FA 4YBLB 1CDYA 3HOGA 5EZLA 2GHZA 1DQIA 1ZMYA 1UQSB 3F7RA 4PJ7A 5F7UA 2Y0SA 1JFHA 2FCBA 3B7SA 2LTQC 4Z9KB 3UTTB 3UYRL 3OAUH 5T3ZH 3U0TB 2QGDA 2GJRA 3BUQA 5C3LD 1G6RH 1RIVL 4FYTA 3BPLC 3S0PA 3X1EA 4YEEA 1LNUA 2C1OA 4YDKL 4NHUA 1AY1H 2OCJA 2B39A 3V4VL 3VGAB 4LGPB 3RQ3A 3SE3C 5F1IA 1SM3L 3QQ3B 4I18C 4NQEE 3US0A 3KH3A 4L1HA 4JBSA 1N18A 5DD6B 4MJ5A 3DVNA 4TMPA 1AO7B 1FNSH 3SDAB 3Q0HA 2IGFL 2DMHA 4IBLT 1U3HB 1CVSC 1V55B 4ZS6D 5FF6A 1DBAL 1CICC 2G30A 4L2YA 1G87A 1T4KB 3E1ZA 2APXA 3NESA 2HFGH 3QCTH 4HZ1A 4JMNA 4J3VA 5F7YC 1UZ8B 3M1BA 4ABQA 4PH8A 1VEOA 3GSNB 4D9LH 1J0KA 3SGEI 2WWNA 4IBQA 3THMH 3ZZQA 5JHMA 4Y4FA 5AW0B 2FT6A 4X6CF 4DETA 3LKPA 4GOSA 1SEBA 2VC2L 3U30C 2XV0A 3KM2A 3LDBC 1T4WA 5DHVB 3SKJL 4OGZA 1BVLA 2YD8A 2PF6A 3MUUA 1KJ3H 1XF4A 1OCWL 1T0NB 4NNYA 4CNIB 5IV2A 5D1ZI 2YQGA 5D96B 3MRDB 4K7PL 1E7UA 1F86A 1BEYH 3KXFB 1V3MA 1FZJB 4IDLA 5IB3A 3VXRE 4U3HA 1MFUA 3LEVH 3TCXA 1MRFH 5JQIB 1G9NC 3TONA 3FMGH 5I76A 5IFHH 4JPWH 5AL8A 4C56B 2YSTA 1EZUA 4I4WA 1X5AA 3X14B 5FGBC 3MV9A 3GRWH 2JB5H 1B4JH 1G43A 4GQ9H 3DV6A 2E47A 3CN1A 2QDVA 1VAHA 1U3JA 1OQOA 4RESB 3P1VA 2XXFA 2ZUUA 5KUKA 4ODVL 3IDXL 4Y7OC 1LO3H 1MFNA 2R51A 3PWNB 3QIBC 2X5PA 3P9LB 4N2GA 4FQXB 4XI5D 2X4UB 4GUOA 3FONB 4J4PC 4U1MB 1IQWL 3W37A 4G6AD 1LP9E 1OALA 3CBKB 3UAJC 3L1OH 4WWKA 2VDPH 4QHLB 4RSYA 2PLTA 4C55A 1J87A 3ZKSD 2YAOA 1KACB 2GG1A 1XV8A 2FIKA 1ZHBB 2ATAA 2YAFA 2ED6A 3AGVA 1YHPA 3P4LA 4G7VL 1A6VL 1G7HA 3BQUB 4LXFA 4DOHB 5EC1B 4YZFE 2WSKA 2QZ5A 3ZHNA 1XB3A 2UZXB 3VG0H 4CMMB 1BYPA 2C3XA 2QQLH 5HGHA 1MW2A 3W9EB 3AREA 1P69B 4PJCF 1YQVH 3REWA 2QKIB 1A9EB 4IOFC 4LARH 5IQLA 5TJWK 5IMOA 2X2HA 2DWYA 4WFFE 2V2WB 5GGUA 3F65A 2EDJA 1KCRL 3HRZA 2G9KA 2IMNA 5JPMC 4P07A 1MDTA 2JKXA 4XXCC 3QIUA 2PXYC 2VQ4A 1A6WL 4MBRA 2I7SA 4LAQL 1Y18B 3TNMA 1U41A 2CDGA 4ZW5A 4WV1C 4KNUA 2NLJA 1R19A 4BD4A 4TQEH 5DJYA 3ABKB 2MCPH 2GBUA 3WV0A 5I66B 4KKLC 1QTPA 1IAMA 3DXAD 5DHDA 1HCYA 4ZOAA 2JKLA 1S5IL 1FNGB 2GC7C 3GBNL 4QRRE 3SGJC 4UNVA 1CURA 43C9B 4X4KA 3HN3A 1K8IB 3NCJL 4ACTA 3KLHC 5DDHA 2ZXDA 32C2B 3EOYG 4Y2NA 3FSVA 4G6FD 3ZDWA 4ANXA 1T0MB 3K6SA 3AROA 3FTYA 4F57H 1U30A 3Q5OA 3HAEH 1FORL 2EEAA 4X9HA 4XXDB 1GSMA 5D7EA 3GJFK 4M5ZH 5IMKA 2DQTH 2W07A 3F64A 4NOBA 2FRGP 3JWOH 1ASQA 1WBZB 2A6JA 2J55A 4OM0H 4UQ9A 3ARPA 4WEBH 5D7LD 2Q10A 3ZYJA 4P0DA 3ESOA 4JVPA 1OGAB 3RVXD 3WXVL 5I2IA 2GYSA 4UM9B 1KTDB 2OQJB 1N64L 2C9RA 5KSUA 3NA4A 1XF1A 4K23H 1HHIB 4HJJH 4JRXB 2CO7B 4XBPA 4JW3A 1NFIB 4XAKD 1ZE3H 4JHUA 3FT1A 1W16A 1IKOP 3EFFA 3FU6A 1KPVA 3W39B 5FS5A 2IXQA 4EF3A 3DK2A 3DROA 1N59A 5CJOL 1DANU 4Y16A 1QTYT 4O9HL 1X5ZA 1W6LA 1PTZA 4CL7A 5KZCB 2VLKA 1KCUL 5TQ2H 3TT1L 4KHXH 4PG9B 4QHMA 1TZGL 4BZ1H 4ES8A 4JNXA 4BWWA 4DKFL 1INDH 1JZHA 4TRPL 2NY2B 1MI5A 4Y88A 3EJZD 5A2KH 2EZ0C 4TTGA 5DA4A 2AEOA 3OG4B 3T08A 3MV7D 5C0RH 5KYYB 4FQCL 4N86A 4AM0A 1BMZA 1JMXA 1OT2A 1D6VL 1UA7A 4LLWB 4WGWB 1OGTB 3S97C 3SGEH 3RL1A 4JFFB 4WK4B 1T5KA 4IGBB 1YEFL 5GRYA 3PP3H 4FQHA 3ZUCA 3MREB 4PJ9D 3NSJA 1CYWA 3T4AB 1SYVA 3ARBD 4EN3B 3KHOA 3RPKA 3FUKA 2PWFA 3F7LA 1TJHL 4LVOB 1WBYB 3PQYB 4N2DA 5K59F 2YK1H 1GHFH 2NXYB 4DFIA 5J6GB 1NJ9A 1F42A 4YS4A 4RAVA 3QCTL 2NX5E 2G60L 3IXTA 1INQA 1KTCA 1W72L 3HIZA 2R2HA 4PY8J 3SBPA 5CEXA 1BPLB 3QFGA 5HJDA 1ZXKA 3K4AA 3GMLA 3WIHA 4C4UA 1IFGA 5K9JH 4IBSA 1AZBA 3D18A 5CJQH 3UGXA 5DUMH 4J6IA 2ENYA 5TQ0L 4PI2A 2VDKB 5GGTL 2YXFA 5EIIB 1BP3B 3QSKB 1T83C 4QY8B 1Q38A 2WLMA 3GD1C 1FVDA 4ZJ9A 4N68A 1M56B 1SHSA 2FSEB 2PYED 3RNKB 4HOXA 1E6OL 3FMGL 4P5MB 4UAOB 1CFQB 5IFHL 2Q20A 4W9EC 3C2SA 4D0BB 5LAXA 1I7RA 2KI6A 4NO5B 1MZYA 4MA7L 3FTZA 1F4XL 2DQFB 1S9YA 4FQIL 4BCZA 2ZYHA 4QJ5B 4HEPG 5K9QG 3KDMA 2FB4L 3CSGA 5D7SL 4UIMB 5J1TC 3F7QA 2WKGA 1DP0A 2IH1A 5EPMB 3QZWB 3NPSC 4FLQA 1I1AC 3CZJA 4RZKA 3JZYA 5ENWA 3ROOA 3WIIL 5KVMC 4NQVA 3OXSB 3T0WA 2JKSA 3HI1B 4GAGL 1FG2A 5DVNA 1IQDB 3JV5A 1JOIA 4WEMB 5I16B 4D7PA 3R0NA 2D8KA 3EH2A 1BJ1J 1ONQB 5F96H 1W9XA 5LG1A 4M6NL 3FU8A 5KG9A 3P0GB 3VG0L 5F7BA 1NSNH 4HOZA 2X4QB 4ONGH 3AWGA 2QQLL 1MRDL 4YZWA 1A64A 1NC4A 4LSDA 4YDJA 4DP0X 2HFFA 4LARL 2IBBA 3K2IA 4P23D 2AV1B 1TJIL 3RA7H 2PWEA 2X44D 1JPTH 3FSWA 4X6BA 1IT9L 2ZXWB 3LVTA 3V79C 1PY0A 2VSMB 4LRIA 1OF0A 5GZND 1S9XA 3OB0H 5D72H 3D06A 3BP6A 3QI9C 1NCGA 4U6TA 1AGEA 3D33A 3FT4A 1GGYA 1L9TA 1MUJB 1WFJA 1YY8B 1J8HB 4FA7B 4TQEL 4YVNA 4JN1H 3PDDA 1QVOB 3O9WB 3CCHB 4AJVA 4CJ1A 3ULUH 1RZJC 4DVRH 3L3GB 4XNMA 4KKNA 4PRDA 5D1QB 3P4MA 4H8PA 2ATKA 2D7PA 3HG1A 3B2VL 1RMFH 1TVBA 3KVPA 3V5KA 3CBJB 4MJHA 2ZT9C 4EMZA 2IAMC 5DLMH 3QISA 3MR9B 4TTDD 4E9VA 3C60B 3QEHB 2COVD 2VZSA 4FYRA 4MXWL 4W1TA 5F6IC 3RZCB 3S96A 3JTSA 1F5WA 2P48B 2CRYA 5HXMA 1MJ7L 4M5ZL 2BSED 1IAOA 2DQTL 1S9VA 3JWOL 4G72B 1RY7B 5CMAA 5JZ7D 1DVXA 4IEFB 1BVOA 3MYJB 1OWWA 3S88H 1E40A 3R1GH 2WM0A 3Q13A 2OLDA 1ZVHA 2WLIB 3HG0A 1X3DA 1E50A 4HJJL 3FXIC 4LPXA 2OYPA 2HVKB 4HP5A 1HVXA 2B0SL 3NUKA 4G80A 2GIMA 1VGKA 4X80L 3FKUS 3RDTA 2FQGA 3FB5B 3EOBB 3BP7B 2WB1A 3QIUD 3FQRB 4FHJA 2X4SA 5IOKA 2TAAA 4TLKA 4YFEA 3UACA 2M8XA 4HZLA 2NNXA 4KWUA 4XB3A 3QGVA 3TVMA 3ZRFC 2VCOA 3ZTCC 3O8XB 5LGHH 4BZ1L 3SPVA 1VA9A 3S4SG 4ODWA 1HIMH 4PRID 4WW2F 3MKKA 5I0VA 4UIKL 5GS3A 1NCJA 4X6DF 1ANUA 1H3UA 1EEYB 1NUFA 2ENJA 3OXRB 4NYLB 2AKRB 4X9IA 1ZHNA 3R06A 1UD8A 4Y4KA 4R7LA 5DS1A 3RWJB 1OXYA 3RI5F 3FHEA 2MNJB 1N0XH 3U9UA 3EYQC 3MRFB 2ZUQB 3QFDB 2DQDL 3VNZA 1NGYB 4JEGB 1FZOB 4XAWH 2HCZX 3LHPL 1YECL 1KCSL 2DQIL 5KVEL 4JFHD 4K9EL 2DYPA 3EADA 5IW6B 2H2PD 4DPCX 3V6ZA 2G9HB 3FT9A 2XN9D 3BT0A 4EXPX 4EI5A 1OAQH 4LKXB 1P5UA 1QSFA 3SCMC 4MKMA 4MNGE 3WNLA 5JLZA 4KUZH 5FO9A 1BMGA 1AS6A 1JV5B 4L18A 4MA1C 4OCYH 1JPSL 1E4WH 5D5MB 5DJAA 3ULVF 3TBVA 4HT1L 4PJXE 4BFKA 1TSRA 1NL0L 1JV2A 1DN0A 3NJVA 3L4VA 3LSOA 3R7QA 1MFCH 3VFUB 2WYTA 1KT2B 3NIGB 8CGTA 1LP9F 3SDDA 2PP9A 2VABA 1HNGA 2XVLA 4JLRB 3HPLA 4NERA 3VGBA 1SBSL 3VXSB 1T1YB 3BEVB 3T0EB 2VXUL 4KKAC 3VG9B 1HHKA 4RMSA 1BW8A 3EO9H 1KYOJ 1LMKA 2VLKD 5AKTA 5T1JA 4UTBA 3RWDB 5DURB 3F7YA 4ADGA 3GBMH 1QI4A 4JPSA 1FLRH 1N2RB 3WN6A 2QQNH 4XNBA 2F61A 2XFXA 4XBMA 4HK0B 3APCA 5FLUA 5KSVB 1RZ7H 1HQ4A 4L4VB 2D7MA 2W91A 2AEIT 2Y5TA 3VQ2C 1LDPL 5DZOA 3MRQB 2K1MA 2AJVH 5DK2A 2ILLA 3FOLA 3VFVB 2FX8H 3GSNH 4KROC 3GSOA 3PHQB 4LAJH 1C5BL 4FZEH 4RAHA 2NT1A 4PRBB 3IU3B 4XCNB 2V2TB 4ZFOB 3RP1A 1Q0XH 1XMEB 4JL2A 1RSFA 3FFCB 4XZUB 5DHVH 4ODTL 3G9AB 3G6JB 2IDTA 3IXAB 4HYTB 1QBBA 1T1WB 4RWYH 3CN3A 2FJUB 3B7TA 4KY1H 2IADA 1NMAH 1XIWD 4ZUTB 5B1JA 4W9FC 1MH5B 3A6OA 3ZGIA 2DM3A 5AG9A 5FAAA 1FHNA 1FV1A 2V5SA 2AK4A 1MW3A 4Z3JA 3F5WA 5EU4B 3T0VA 3VB9A 4LCUB 3GLAA 3IDMA 1XGRB 5F96L 4JK0D 4L8DA 2YRBA 4PJBE 5EBLA 5C71A 4K3JL 2DTML 4WUUA 3OR7A 1KN4L 4JG9A 1INEH 4K07A 4MWFB 2XXMB 2HLFD 1NFDB 4JFDA 3VD0A 2OTUA 2YFNA 1OE2A 2IH3A 2Y07L 5GGSA 3ECUA 4NCDA 1IZJA 1IARB 3U6XA 4OZIA 4UDUB 1OOAA 4TQHA 3NAAL 5HHOA 1GSKA 1QSEB 4LF3A 4OCMC 3WAKA 3DTUB 1TG8A 3QQDB 4MXQD 5FDWA 2X4RB 1MLBB 5FHAL 1VRSA 1RIHL 4XNXH 3OX8A 2UZYB 5JOFA 3B2MA 4NXSA 3IDNA 3L9RB 5F8QC 1P9MA 1JNJA 4PJGE 4JGMA 3EO1B 2X87A 2NTSP 3QAQA 2ZX8A 3CLEL 3IGAB 1I8MB 3HC0B 1DJSA 3D6GA 4DVRL 3CFEB 4ESKA 3CHRA 1OF2A 5CZKA 5EZJB 1TVHA 3KLSA 3DHUA 1K5NA 3LH9A 1RMFL 1YEDA 3KYAA 5BW7A 3G08B 3GXFA 4S1DD 3SBRA 5DLML 4PTUA 4ZAKA 1G7MA 4ABWA 4YHLH 3GK8H 4JX0A 4PS4H 1KY7A 3IU4H 4U6XA 3RE0A 3KPPA 1KNOB 4LLQA 2V2XB 1CG9B 3ARVA 4V33A 1NTDA 1G9HA 1MY7A 4YN3A 4JFUA 4G8EA 2A6IB 2ZKHH 4M4RA 2JVUA 2E9BA 4CMHC 2EIJB 3KL5A 1X4YA 1S7WA 4Z3HA 3QPQC 5IUCA 1G1CA 3IYLW 2I27N 4HXBH 4ZO8A 1U8IA 3OKDA 2H7WA 4P06A 3RIAF 2F8OA 2GEQA 3SOBL 1U95A 1E3FA 1YUKB 4GRMB 4ZI8A 3VMOA 4FXGC 2IBGA 3TU6A 5EOQH 3FO9A 4TPRH 5BZZA 1F4WH 1KFGA 1X7QA 5ERWA 3QDGE 4OFKA 4P2QA 2N7BA 5ACMA 3K1DA 5INCB 3ETTA 1AQKH 4JM2F 4YMPA 3O3AA 2WXLA 2X28A 3QXTA 2F53E 3B56A 1BFOA 1OHZA 2W65A 1MIMH 4PS3A 4HJGB 5FFGA 4NUQA 3VMNA 3D0VB 3SE6A 2HWZH 2CAKA 2F5AL 4Y1SA 1Z3GL 5JUEL 4JQIL 4APXA 2OXGA 2W88A 3C5SA 3DOHA 4J2QA 1N0XL 4KXBA 4FP8L 1CICB 1PZUB 5DD1H 1MWAB 4QHNB 3V0VB 3D39D 3CFBA 3QUZD 4UYPA 4HIJA 5DTFA 1YDPA 3D5OF 1IEAA 2BJML 2HH0H 1PKQA 3U0PA 2GBTA 4P5TB 1XGQB 3FN9A 3LMJH 2BSCA 4P04A 5EO9B 1U8JA 4F7PB 5KJRL 3L4WA 2ZP0T 3CU1A 5F21B 1EX0A 2HUEA 2DQMA 2DL9A 3LDBB 2JELH 5I1LB 3X3FH 3HVNA 4BGDA 3VFWB 1TU2B 5HD8C 2BHYA 5A16B 4A7VA 1YN7A 2G5RA 4BQCA 3EO0A 5IJBC 1RP8A 1XHHA 5EOCL 2NSXA 3G5ZA 3ZDXB 5L4IA 4KKZA 4C83B 2WINB 2F54E 5E9DB 5DJ6A 2YPVH 1ZTXE 2DQUL 3QDJE 2AABH 3VXTA 1U4EA 1MVYA 4JREC 3ZVVA 2EILB 4OZHE 3ME0A 1U8KB 4HD9A 3VH8G 1G7QB 4OKDA 3ZRCC 5HYQB 1DSFL 3H7BB 4XNUH 2GFBB 4PGEB 1JZJA 1ZGLP 1LO0H 1FLRL 3QUML 2QQNL 5BZDB 4JGHA 3F04A 3EBGA 5JHDE 3H9YA 1ZS2A 3P02A 4GKNB 4AVHA 5E23A 4NP4H 1U8CB 2VR9A 3H54A 4NKOA 3MV8A 3NCMA 2AJVL 4U7SA 5DQ9A 4YSUA 2FX8L 3GSNL 4Z7UE 4JPVL 2CDFA 2DYPD 5FFLA 4GO9A 4KJPC 4G9FA 1HZHL 1PFOA 3GPSA 3LV3B 3SKOB 1WC7B 2VR8A 2VR4A 5FX3A 3H9SE 5GS2D 5FYKL 3HS0A 3RVWC 5CJ5A 3FSZA 3TEWA 4FLHA 4IDJH 3QNXA 2CKBL 3TT3H 4RWYL 5ITBH 1XCTB 2VDKH 1A47A 2VLJD 2JK5A 2Y36H 1NMAL 3QS2A 4KY1L 2V9QA 2BCKA 4KVCL 2NPLX 1MVUA 4AK2A 3WY2A 2WQRA 4WNJA 4EOWH 2AJXL 4HW6A 1CO1A 3V4PA 2BINA 2J44A 1LWJA 2J2ZB 3OKOA 3JSSA 4Y5YA 2RALA 4KITB 4M1CC 3MCKB 5IROA 3A67L 2YGPA 1INEL 5E8NB 2ARJA 2NY1B 1I1RA 2EYTB 3L54A 5JR1H 2DQEH 3MQIA 4KFMA 2E9IA 4Z95H 5AB0A 2D31B 3DUSA 1QRKA 4W4NA 2H41A 2XZZA 1PIGA 2KZWA 3CUPA 4OJEH 4X7TA 3V0JA 5D4JA 5IFAH 3NJIA 2VMEA 3P4OA 2IQAA 3L3KA 2R23B 3PDOA 3AAZA 4W9KC 4XNXL 3COOA 1TQCB 4Q9RH 2ZP9A 3UTQA 1ACYL 3T1WA 3QXVA 3F58H 3RVUC 2QELA 2H0FA 3P2TA 1YEKL 4G9DA 4HMCA 4Z7AA 2NCMA 5IVOA 4MAYA 4HX1A 5HSFA 1JDAA 1JGVH 5T3XD 4MCYA 4TXVB 3MTRA 3NSDA 4X5WA 2FJFA 4P3DB 4XO9A 4QRUB 1JPST 2VQTA 3GXUB 2F08A 4N0RA 2DBLH 2HX9A 2L3BA 2XETA 4LOUD 5FHBH 4FTVD 3TPKA 5EU7E 3IU4L 3O6ML 1JUFB 1YYLH 4GINA 3X2QB 1OAZH 4R3SA 4OLVH 4AV0A 2I25N 4BZYA 4UOJA 2E74C 4JG0L 2VXTL 2YA2A 5CD5D 3FQ1A 3MO1A 2QGEA 4PJ7E 2LFGA 1HHHB 4GKZB 4L4TB 2X9WA 1ZLEA 3UYPB 2VDOB 2NZIA 5ICYA 4HXBL 4JFDD 4YGVA 2PR9A 3FU5A 5I8KL 3BMWA 4PJDB 43CAA 5I71B 1QFHA 4Z1PA 3N40P 3LS5H 3NFPA 1A3QA 4HXAL 3GI9H 4MMZB 2XTLA 3NCBB 3RWIA 5JDSB 1I1YB 2DDQH 2YSSB 1WE5A 4IU2B 1IB5A 4UQCA 4TNVF 4L5FE 1MHCA 1AQKL 4GP4B 2XWRA 2XVGA 1GJUA 1JZGA 1VF5C 4DW2L 5I5RA 4IRSA 3HW7A 4UT6L 3T6QC 1MIML 2DJMA 3QEGH 4WI7A 5LN8A 4PVMA 2FWOA 2MKWA 2Y7NA 3TO4A 3X1NA 3J07A 3TEZA 1Z32X 5EU7C 3IB4A 1T03H 1NGZA 1SHXA 4GG6E 4MKTA 2VWEE 2JCCE 1W80A 4DKEH 3X1BA 2DICA 1BREA 3QXAB 5F1NA 1ZT7A 4ZFFB 2I5YL 4BSWA 3PWUB 5T5FA 3ESNA 2PNDA 1BQLH 3LMJL 3MUY1 2HRPH 2YEVB 4UOQA 3VQLA 4WJG3 3ATDA 3FBKA 4YUEH 3CZSA 1SY6L 4FFZA 1GGBL 3VXME 2X4OA 3H9HB 2JELL 5FYJU 3QUXB 5CBAB 5E24E 2VAJA 5GGRB 1WGVA 4KKRA 3AXIA 3AVEA 3QCUL 3GMQA 3GXMA 5F88B 2Z7WA 1FYTB 1EXUA 1S9WA 3QP3A 3CVHB 3MFFA 4Y2DD 2XPZA 5EB9A 3HB3D 3KS0J 1T20B 3C5ZA 4WCYH 1IGCH 4BZ2H 1V05A 4NOFA 2WIIB 3D30A 3U1SH 4BUGA 3MU3A 5C2BH 4GT0A 4GBXA 2ZWSA 3QJHA 1FL3B 1C08A 2B14A 3BFWA 3TFBA 2IAND 4ZUSA 1Z5LB 2D4DA 1FJ1B 3SE8H 1FL5B 2CMRH 1WO2A 2VWEC 4M61B 5BZWA 3EJQA 5GRXG 5TDOA 4AGOA 1JZEA 3WDHA 2PPDA 2RR3A 1XSIA 3D9AH 2B59A 1HHJB 4X98B 5CP7B 5F3BB 4S1SL 2P1YA 4NJ9H 4EAEA 3L3IB 2ADYA 4P4KA 3EGDA 2GTWA 3N6YA 4AIOA 2EIEA 3NPSB 4OSUL 4AQEA 1S7XB 5HI3D 3Q1SH 1JE6A 2OR7A 3OC5A 4WO4D 2A99A 3WNMA 1XEDA 1H8NA 4XBGB 4B3EA 3NABL 1OTTD 1JYNA 3Q2VA 1AGDA 1KYAA 2ZXEB 1KDJA 2J4WL 4QRTB 2Q0ZX 5EMYA 5AALA 4NWUH 1KB9J 4CGTA 1YEIH 3TT3L 5ITBL 3R0MA 4FFYL 4WKZB 1NMBL 2IOOA 4IGBD 4LHUG 4L9LA 3WLBB 4PJGF 5EF2A 4DGUA 3GBDA 4GEIA 4F7CA 2J6EA 4O58H 1NGWA 3F7PC 4HD5A 2CH8A 5E8EA 2XZCH 4EOWL 4D0DB 4OAWB 5AZEH 2HJKA 4RMQA 5JQ6H 2WB7A 5C92A 1ETZB 2XU9A 1NCWH 1D5ZB 1EXGA 1ZSHA 4WWKC 3RVVD 3EYVA 1EUTA 1WD9A 1T3FB 2ALAA 2D03H 3AT9A 1GYAA 1P2CB 1YYML 1MAKA 3QI9B 4XX5A 4Y5XC 1FUNA 2DQEL 1MJ8H 5IMLA 4F7EB 2V5MA 4DP9X 2YIHA 3DRQA 1F3JA 4YJZL 3PHAA 5LCVA 2AW2A 4X4XA 4A2GA 1MCQA 3T4YA 3P11H 4N8VA 3AG2B 2BNRB 4HWBL 1TT6A 4QKXB 3FCSB 4ZPVB 3AREC 2XBZA 4XP9H 4JG5A 3FT3B 3GSUA 4G7RB 1XWVA 1RUKL 1D3CA 3HLAA 1BWMA 1YEGL 1OAJA 2VN5A 1C12A 2YAEA 5FM5O 1NEPA 3N1FC 1O6SA 4ORZC 2FHFA 4Z0BL 3RY4A 3ZHLA 3QG7H 4X0KA 3F58L 3OJDA 1UB6B 4OZFA 5F9OH 5INDB 5AOKA 4WI0B 3N2JA 1RI8A 4WLCA 1OE3A 5CO1A 3VQMA 3UMTA 4YAQB 4AYID 5I1GH 5DSCA 4FXKA 3WS3A 2OYKA 3FB7B 3LNGA 5DJ0A 2VKWA 1YNLL 3CMGA 3C12A 1M1SA 2R29H 3NSXA 3TBCA 2GK0B 2P5EA 3HA0A 1S5HB 1RK0B 3WOVA 4FNUA 1AI1L 5CEZD 1A3RL 4KXAA 2ADGB 4DKTA 3NCCB 4JRFA 3W0WA 5ILTH 2YHGA 3V4VA 3ILPB 4XB8A 5HYJD 3DGDA 1LEIB 2CALA 3A6BL 4X7CC 3QNZB 3Q9PA 4JO2L 3S34L 3MNVB 1QI5A 4PY7B 4HWZB 3SKNA 1HE7A 1KWGA 1FO0L 3OZ9H 4PRHA 1BXVA 4Z78B 4R0LC 4NQXB 1WTLA 5CZRA 4KOBA 4PGCA 1WFOA 2X40A 2CNZA 4U1SB 3JYCA 2YLKA 3KJ4C 3IJSB 2OR8A 4G59C 4OJFL 2HN7A 1LE9B 3DOIA 3KPRA 3RTQA 4OJAA 2CUMA 2PYFA 1DLHA 1BF2A 1NICA 2AXHA 3Q44A 3TEXA 2XQ0A 5DZLA 3MLWL 3FDWA 3LN4B 4NZTH 3QEGL 1N12A 3VXUA 5I73B 1C7TA 4MAYD 3SCMB 1G1OA 4FNPA 4OZHF 3VU2A 5I8OH 3OMAB 4HUUA 4MQ7A 4Y2OA 2ZCLH 3B2UD 2WKOF 3FAWA 3KYNA 4FJ6A 4MA1B 1CJYA 3TZVC 3WXWH 4LDCA 1J8HD 4ZQTA 4F24A 5JIIA 2CLRA 4XN5A 5DYOB 3QR1A 3PXLA 4OU3A 5JW3L 2ICCA 3VFSA 1K8DA 4PJ5D 4GSQA 4HJ0D 4B50A 3OV6A 1KYDA 3SDCA 3H7LA 4YDVA 3ZN6A 1KXHA 5BO1H 1NINA 1T89C 4Z7UF 3KPNB 1KXTB 3FU7B 1XZWA 2DLGA 1DCEA 1N5AA 2DZEA 5TFSL 1IGCL 4YE4H 5C09A 1BVNP 1CQYA 5AB1A 5JIKA 5JA8B 3UCQA 3U1SL 2GK2A 2IDQA 1WD8A 4OGYH 4QXUL 3OJVC 5C2BL 2XJKA 5J1SC 4ETQB 1MWAH 3SPGA 2VERN 3DUUB 1B4RA 2JB6B 1QEWA 4AQOA 1KOAA 2FATL 4MNGB 5LNDA 2LABA 3CPUA 4MQSB 5FM4A 3VRIB 5CZXD 1KTLA 4AYSA 2JXMB 4PJXB 5KBLA 3L6FA 1ES0A 4G8GE 4N2HA 5B8CB 2JJSA 3I50H 3L7EB 3WFCH 3LNIA 1AXTH 1RCYA 4LESA 3WJJC 5C0CD 5CCGE 2AQNA 4HS6A 3MOQA 1AANA 4U3XA 4U6HA 3BH9A 4M02A 1Y0LB 1FFQA 1QOKA 4EZMA 2DWEB 5E6ID 4WHYG 5CCKH 4GQQA 2J25A 2CJTA 5IQ7H 1NWPA 2EE6A 4L0YA 1NDGA 3BT2H 5I19L 2C9QA 1EHLH 1A1OB 1FGNH 1YEIL 4PBVC 3EUUA 3MVSA 4ELMF 1AR2A 1CI3M 2GSGA 2EIMB 4Q0XL 4FABH 4X50A 3W11D 2MEJB 1ZVSB 2WLKA 5C0JA 1SN5A 1BG1A 4BH7B 4R84A 1NFKA 1JI2A 2MH4A 4Z7QE 2R1XB 1KWKA 5GSVB 4RRPG 8FABA 2ICWJ 1NH6A 4OCSL 4F8OA 3F6IA 4FJYA 1NCWL 4PR5A 4WUKL 1KJ2A 4NPJA 5C6PB 3SE4A 2IFGA 5C7ZA 2OBGA 2YUZA 3MRPA 4JZNB 2D03L 4EUPA 2N0KA 5GGVY 4FMVA 1JZ5A 1DJZA 4BK5C 5D9SA 1SVZA 4G6KH 4BFNA 1TFPA 2A0LD 2AQ1A 4J3TA 4ZFOL 1OSZB 4MB5A 3P11L 4TVPE 3QEUA 5BRZA 2WLLB 1M7DA 4PJ7F 5IM7A 1TXKA 3EDKA 3MLXL 1SF5A 1XMWA 3KPQB 1IJNA 3PXJA 4I89A 1NGQH 2R2EA 3QG7L 2VLLB 2YXWA 1NFAA 5LHDA 2NZ9C 4BWUA 3PJLA 3PWVB 5F7MC 2ZX9A 3ZL1A 3U2SA 4L4VD 1AP2A 5I1GL 4FX5A 1PEZA 5EN2B 1F3DJ 1KF9B 2QPDB 1ECYA 3RPBA 3JUYA 1JVLA 3NIDE 3WFEH 4LSTH 3B5GA 1I1FB 4F9PA 4TVSa 3RBGA 3FK3A 1YA5A 3W9DA 1HEJC 4Q6KA 4NQDA 1BZEA 4YFLF 4KO9A 4S2SA 2BERA 2JLLA 1E0OB 3HZKA 2JIXD 5FV2A 1TTAA 4FXGB 5FB8A 3JV0A 4F15B 1CXKA 1CGWA 2J73A 4DUXA 2IAAC 1UGNA 4OI9A 1UWXK 4Z7WB 1L9QA 3ARYA 1BLIA 3GHBH 5IZ7A 2XBTA 5L2KD 3G6AB 3POHA 1S3KH 2ZZUT 2YQBA 2V7NB 1L7TH 3DUHA 4EZKA 3UEZA 4Q14A 5DD0H 5I6MA 3MLVL 4E0RA 1IM9A 4WSJA 2W59A 4NZ8A 1FFPA 4DZ8A 2Q76A 2R1WB 5HJGA 4LLMB 2DAVA 5IEHA 3OZ9L 3IFOB 3RLSA 4XNDA 4TULH 1BBJB 2J5LC 4QOKB 3LD8B 4WEUD 3MRNA 4O5LH 3TV3H 4PJFE 3DX9A 1IFHH 4AMKH 3UABA 1MNUH 1P7QD 3BPOB 1W72A 5EBGA 2EO9A 3A6CH 5E1IA 1QSFE 1E4HA 2VIRA 3JT0A 3IJEA 2E6PA 3QIWA 1A5FH 3OAZK 5DZNA 3ARFA 3LOWA 4ZMQA 5E0FA 1KCVH 2PR4H 2XKNA 3S98A 3NEEA 2EXWC 1S7TB 4PCSA 4FI7A 3TVMC 1QSED 2XWEA 1MHHB 4WHDA 4B9FA 4HU8A 2HJLA 2VITB 3ML9A 1H15A 4XZ4A 4XO3A 5E8OA 3QQ9D 4M5YH 2VDOH 3M1OA 2QPSA 5DR5H 4M8VA 5M95B 3WXWL 2EDBA 3QDGB 3B9EA 2WOBA 5CEYB 2P26A 4OCWL 3I75B 1L0QA 4ZMLA 4LLVB 5CU9A 3CSPA 1H6EA 5ETUA 2F53B 4YIQB 2P8MA 1R3HB 1SJEA 4JREB 3SIKA 5FKAA 4OZGB 3W0WD 1AD0A 4F7MA 5FECA 1F3RB 4ODBD 2XXCB 4O02B 3J7HA 4FKHA 4R4BA 5AYUL 2P5WD 4GW4B 1ACXA 5KTEH 1XF5A 4UOZA 2MTPA 4LCCB 4OIBA 1EAPA 4ILDA 1P5UC 5CLWA 5IEKA 5IREA 2C3VA 4PWFA 2J8UA 5DFAA 1AHMA 2I60L 1YMME 4LDLB 5ECJE 1S8DB 3GMOA 3ZZ1A 3JWNG 4OGYL 5DK0A 4ZMWA 4MYPA 5K9KB 4GAFB 2AI0L 2BIIA 1GR7A 2UVFA 2CUHA 2Y7QB 1KB3A 3G5VB 4BFGA 3VI4A 1LO2L 4B9CA 4DNLA 1NOFA 2R4RH 5DJCA 4CW1B 3C6LA 4UQIM 1FSKB 1MCPH 2MQ0A 1GOGA 3HR6A 2IBZY 1J0JA 3O2DH 1N6UA 5T8IA 1WT5C 4H0GA 3VWKA 3FN0L 3I50L 3IFNH 3ZR5A 2Z31A 2FR4B 4NNXB 3VFRB 1IFRA 1WS7A 1S3RA 1XH2A 1RZ8B 1XDTT 3MRHA 4MTMA 4LK4A 5H37G 3CVHH 3PJSB 4HF5H 3TBWB 2FGZA 3CMOH 1CF8H 3HCVB 1CT8B 1KIQB 1SLVA 3C8KB 3BVTA 3CC1A 3QJSB 4UT7L 3SE9H 5ANMA 2Z64C 5KBNC 5CCKL 1G9NL 3RPIB 1UXSB 1A6PA 5LWYH 3LKRA 4WFHE 1UJTA 1MFBL 1QSVA 4PRNB 3WS6A 1KIRB 4RX4D 3BWAB 4PGBB 5DRNB 5FGCE 1N8ZA 4P2RE 3VFTB 3MUJA 1H5BA 3GMMA 1EEZA 3BDXA 4Z7OB 1JHLL 5HI5D 4DO5A 1QZNA 4UU9B 4HISA 3PGFH 5H2BB 4B9GA 3UBFA 4LASH 4QO1B 4TQIA 5C07A 3BSZH 2DQGH 1VACB 1Q90A 1DDHA 4J39A 2APVA 1VB9A 3HAEA 3H9SB 5DUBA 5GGQL 1MRCL 2YGQA 1Y6KR 2CSPA 4G6KL 4QXTA 2QHRL 4GW5A 5DUPL 2HTKC 4B9YA 1NGPH 3RX9A 3FTXA 3IEAA 3O3EB 1Q9WA 5I5IA 4R90L 2F8XC 3LN5B 2PKDA 2WHVA 3BE1L 2UY6B 2ZOKB 3KWVA 3SGKC 4RA3A 3QQ4B 3GMPA 4TSAL 3WEBA 2YPKB 3CH8A 1NGQL 1XFPA 1XR8A 3FO2B 1UEYA 4ZO7A 4ENED 2QQKL 4P9ML 2EXYD 3QUHA 1U91A 3N41B 4HIQA 1T1XA 5F1OB 1V54B 1N5YL 2VM3A 2B1HL 2CO2A 3I6KB 2DEWX 5ICZB 4ZQKB 1TETH 3RIFK 3EHBD 4BZ1A 1P9MC 3WFEL 1EGJH 2YRLA 4BXSV 1BQKA 1VZGA 5C0BA 4X6FB 1U8NB 3B34A 4NKDB 4RBPK 1FZKA 1DSWA 1RZJH 4HKBB 4ZMNA 2O72A 1QFPA 1ZDQA 2ALWA 5B38A 3K0WA 1O6VA 2OMYA 3UYOD 4BH8A 5IVXA 5DFVC 1K6QL 3QORB 1ZANH 4PW3A 3C6SB 4ZAKC 4PG2C 3KCPB 1U8LA 1B0RA 2BMKA 1MJJB 3ZY7A 1IC4H 1ILSA 2YEQA 1L7TL 2A38A 3REVB 3FQUB 4AYBA 4ZMYA 2QMJA 5F7LB 2P7TA 4EVNB 2K7PA 2PUQT 2YWZA 3GSVB 3K4ZA 1EWHA 4B9PA 3A4DA 3QWNA 4G7YH 3DC0A 3H55A 5DC2A 3LKSB 3CSYB 5D1ZA 3PPEA 4JO4H 3LXAA 2V3FA 3V7AE 2A74C 1MNUL 2V7HB 4A7UA 4XWOD 3A6CL 4Q58C 4L1TA 4PW4A 2P9RA 3WKML 4F2MA 2H6PA 3DNKA 1FC2D 5D70L 4WK0B 5KN5A 2YGVA 4D8PB 1JGDA 1PD0A 4E41E 2PR4L 3P4NA 4CN4A 4OLWL 4LCWD 5SWSD 5EOTB 2Z4QA 3IJYA 2B1AL 4Q2ZB 5EU6B 3WFDH 1F8TL 3FTWA 1ZCRA 1JF1A 3WL9A 4J3OC 4M5YL 1DQDH 3LRLA 3LB6D 3PJNA 3MRLA 4JZOA 1G1KA 3KYOA 3B7YA 4OLEA 4JPIA 4AH2B 2LVEA 3GGWA 2LU3A 1S7VB 2DV6A 3HI5L 2SEBA 5MENA 2P46B 3FRPB 1S7RA 2VN6A 3DX7A 4WDIB 4XPAH 3OF6A 3LEXA 5A2LH 4QRQB 3NVQA 4RGNB 2YMTA 5IHZA 1I9IH 3VRJA 1K85A 1J1XL 5AWNH 2R0LH 1WISA 2JCCB 2R0KH 4FJZA 5CUSH 2J12B 5KTEL 2BNQA 1IM9D 3MV8E 4B5EA 3AQZA 2HT4C 3GEFA 3NA9H 1MFEL 1Q9LB 4X7EC 2QT6A 4JQVC 4OQ1A 3RJOA 3ECBA 3D3VD 4ZMZA 1D9KA 4XH2B 2E7MA 2ZG1A 4B6ZA 1NAKH 1PIFA 4OFYA 2ICEC 4PJAE 3MRJA 3QEQD 1GIGL 5K9QI 4JMXA 4IS6B 3AMKA 4NUJB 3VXMB 2R4RL 2XIBA 5LJYH 2VISB 1V27A 1MCPL 2AXGA 4I3SL 3KLLA 5FCUH 2DS4A 3U4EA 2Y2TA 1A6AA 3V6OA 4B7LA 4FHBD 2KL6A 1ACZA 3S48A 3L3OC 2XFGB 3O41B 5IB2B 4AE0A 1ITBB 3UJTL 1TLMA 4RWHA 2E8YA 3HUJB 1AC6A 1JWUA 4N6QA 3CXDL 3O3BA 4XCEA 3AQDA 1BFVL 4G43B 2VLRB 3TJEH 3ARWA 1CF8L 2E7CA 2AMGA 4JJHA 3SE9L 3D87B 2WZPA 1OAYH 4KZDL 3GB7A 4UQ3A 1BFTA 3ZDYB 5E2UH 2DI9A 2C7UB 3O11B 4HIEB 4LT7A 2OJEB 4QKTA 5HVGB 1CMOA 4D9QD 4FD0A 1UXLA 2Y5EA 2KH2B 1AXSB 3BOVA 1PX4A 3ECQA 1ETA1 1B2WL 3DX6B 1OB1A 2EO7A 5E1GA 4IRJB 1MAJA 5K5YA 2Z8WC 2GTZB 3FQXA 2YD3A 4KVNL 5DI8B 4ZUWA 4LASL 2VAAA 3F7VA 3T6XA 3BSZL 2DQGL 3NIDF 4D2NA 3F3HA 2W60A 4R2GC 5EEUA 4GT7A 3OR6B 2QMKA 4YXKL 1KLUA 5KSAD 1ORQA 2EKJA 4LSVL 4MJIE 2NY5C 1Q9KA 3BH8A 2YPLE 2WLNA 3BMVA 1QR1B 3MGOB 3ARGD 1I7ZB 2OMBA 2H9GA 1C1EH 3O6FA 1WGOA 4MXVF 5CGBA 3VACA 4LKCB 3VWKD 4G8FA 2E7LC 1JZ7A 3BO8B 1JGUL 3VGFA 5BQDA 3P30L 4K94H 3DX8B 3IMUA 4U1LB 2NY0B 2BDNL 1DO5A 2BP8A 3FQWA 2GB2A 3UC0L 3ATEA 3N0AA 5EWIH 3MLRH 4KKBC 4NO0B 2NXZC 4X6EB 1FRGH 3I9IA 2HLAB 1WA1X 4ZXBB 3GO1H 5I74B 5GJSL 4PJFF 4CILA 2YBGA 1XGPA 4RGMB 2P4AB 5BXFA 2GUYA 2XBDA 4I9WE 2F0CA 1A7RH 4QPEA 2ZIDA 3VI3B 3ZE2F 1UJ3A 3NRQA 5IFJB 3MA7A 4GMSL 1QA9A 2OMTA 3WUWB 2K9FB 4PLKC 1BQHG 3MJ7A 4DGVH 2H1PL 4QRPA 2ZOOA 3VH8B 3ZL4L 5AD0A 4JFXB 2W95A 4TSBH 4M7JH 1ZANL 3KJ4B 2P8PA 1E6JL 1G0DA 1IC4L 3GMRA 2AQPA 1BYOA 1PSKH 2X70B 1Z0MA 1A2YA 3MKGA 4NKMA 3JZ7A 3MRKB 4OLZH 2OULB 3WHXA 3BHBA 2V17H 1WUZA 3MCLH 2E9WA 4LHQB 3K6OA 1R3KB 4QXGL 5GS0H 1A7OH 2J56A 1ZSDA 5T1DH 3LS4L 5DQJA 1S7SB 4G1EA 4R5VA 4L8CA 2ZQKA 1DJYA 1GGIL 3DMMA 3JBG7 5HHXH 3FCTA 2J20A 1SJHB 1ML0A 1A3LL 1UH2A 4QXVA 3UTTA 3ZYOA 2EDHA 2O61B 1IGFL 4PJ6A 5DT1L 2BNRD 1F2QA 1O5PA 2B4CC 4IK7A 2ZXAA 5FYLE 1WA0X 5ISZB 3E3QE 4Y9BA 2MOQA 3N85H 4I2XB 3QQ3A 5LUMA 4IRSC 3FULA 1HWWA 4JDVB 1AC0A 2XKSA 3QUMA 1NEZG 2YUVA 5DD6A 2GVYA 3TO4C 3KGSA 2B9BA 1PFCA 3S35X 3AT8A 4NKIH 1U3HA 4WTZA 2CLVB 4XCFL 3LHAA 2VDMB 1M2VA 4XPAL 3VSTA 4BFEA 2PW1B 4DN4H 5G5DB 5ACZB 4WU5B 1T21A 1I9IL 5DJDB 2AV7B 1UZ8A 1UFGA 2FSDA 4FG6D 3GSNA 5DJ2B 2Q3AA 1VSCA 2XACC 2R0LL 4E36A 1IVLA 5BZXA 1D7CA 1OAUH 2VO8A 1DANT 1UUNA 4OR1A 3RL2B 3BVNB 1BQRA 1EAQA 4B53A 1F58H 2V3DA 3NA9L 4OF3A 5DHVA 5HVHB 3HE7B 2HMIC 3VGHA 3MCYA 2ROYA 3K71B 3CAFA 3IFLL 1PKOA 4P59L 4CNIA 5ANHA 1NAKL 1KPRA 2E9JA 2VDRL 3MRDA 4JGUA 3KXFA 3JTTB 1KSRA 3FUMA 4W93A 1SN2A 5DMJB 1MHEB 1FZJA 3E3QC 3QAZC 1CTOA 4PIBA 5CKAA 1JRHI 1DCLA 5GRVK 5CN1A 4FULA 4GBXC 4C56A 4HAKA 1KB5B 3SJVB 3QR2A 1XSKA 1ZLSH 3JXAA 3X14A 3LXCA 3HBGA 4Q56A 1BYNA 3WKNA 1UENA 4O02H 5CLZA 2UXTA 1WAAA 1MFVA 2HX8A 3WY3A 1QLRB 3CFDB 3OZLA 4GYBA 4NT6B 3PWNA 3P9LA 4FQXA 1OP3K 2X4UA 1JWSB 3TJEL 1U8QB 4Y0GA 4YSCA 2JH2A 3QRGL 3Q1EA 5MEND 1DO6A 2VXVH 1J8SA 4PYHA 4QHLA 2VZ3A 2FYYB 2IFFL 4HV8B 2UWEB 4G8GB 2X1WL 5MHSE 2OSXA 2UX7A 4PV1C 2OW7A 3C5JA 1AG0A 3BQUA 1UWGL 1V3JA 3RILA 5EC1A 2XZAH 4YSOA 1N3NB 5DVLA 5F9WB 3ILDA 3H56A 1U8OB 2B77A 3MBWB 4ISVB 2BNQD 3F05A 3U0WH 5B7FA 3PAYA 2QKIA 4OIIH 2XRAH 1ZTXH 2NY3C 1J9CT 1KYUA 1O6TA 1J05B 4X4ZA 3EF7A 3KPSB 2QGBA 3VD3A 3B9KB 5KS9B 1A9BB 4JCWA 3L2NA 3EFOA 4ZDHB 1C5CL 1MCWM 3IN2A 2Z3FA 4A38A 4HKJB 2CJUL 3ALXA 2QBWA 3CIQA 4I3RL 1Y18A 4J3OF 4Z7QB 2JKRM 2Y7LA 1KTRL 2DJSA 1IJ9A 3BZFA 5KBPA 3V0WH 3MMEB 4FLSA 3K3QA 5KVFH 4PB9H 2P5EE 5C7XL 1XL6A 5IBLD 2HRLA 1P7KA 3QRBA 3KEDA 3GXIA 1S7UA 1MF2H 5EU5B 5IGXL 1TQBC 2GKIA 2HZHA 1FNGA 4KC3B 2XZQL 4YLQT 43C9A 5I0DA 1ET5A 1K8IA 4KZEL 2X4NA 4U0QB 3GO1L 4Y1AB 3ZTNH 1XGUB 2BP3A 1E9PB 4HS3B 2WZPD 1NLDH 2PWDA 1LYQA 2OMUB 2YD6A 4FS0A 4PRHE 4XXDA 3WFHB 4D8OA 5KVGH 4HFWB 3SY0B 2HKFH 5IJCC 3MYZA 1ND0B 4ZFGH 3CZKA 1WBZA 5FYJH 1UHVA 3BW9A 2CU9A 4U6VL 2ORBL 3MJWA 1Z9PA 4ZS6C 1OGAA 3HC3H 1N0LB 4JRWA 1IBGL 3IM1A 2J5LB 4R8WH 4UM9A 2P52A 4QRAA 2OQJA 4TSBL 1KV3A 3LZPA 5A40E 2PTVA 1HHIA 4JRXA 4TNWK 2FBJH 4KI5D 1NFIA 1A7NL 2ZAIA 4GI6A 4I48B 4P46D 4YX2L 4B7IA 2FX7H 2XKUA 2EVFA 3BD3A 3L5WB 3MCLL 5CJ8A 4CJ0A 3TCLA 4DZBB 3V0AC 1AHWC 2VDLB 4PG9A 1QFWM 5T1DL 1UWEH 1UYWH 2VDNL 1WFUA 3EYOA 3K6FA 1A4JB 2ZE0A 3DJRA 3V5DB 2EH8H 4JFZL 5HHXL 5IESH 2CD0A 5KEZA 4MYWB 3JVGA 4N9GB 3FQ2A 4OD3H 2YOCA 3HNSL 2YPVA 2LLGA 1WSST 4Y9FA 3UZEC 1OGTA 4LHUB 4XB7A 4XVTH 4JFFA 3MRGB 2RQEA 4AQ1A 2EE2A 3S2AA 4QHKJ 3G6DL 5BS0B 5B3JE 1T2QH 1IU1A 3VXOA 1RULL 5D1XB 5JIMA 4LSRH 3T4AA 1D2OA 1FCCA 3N85L 4U0RB 5C09E 3UZVA 4NM8L 4EN3A 1ETB1 2A5UA 3MUGA 3RGVB 2AHIA