4BKXB

The structure of hdac1 in complex with the dimeric elm2-sant domain of mta1 from the nurd complex
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
369
structure length
369
Chain Sequence
b'RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METASTASIS-ASSOCIATED PROTEIN MTA1
publication title Class I Hdacs Share a Common Mechanism of Regulation by Inositol Phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 120
structure length 369
sequence length 369
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4bkxB00
3MENA 5G17A 2VQQA 4QA3A 3EZPA 2VQWG 5THSA 5EEMA 4ZUOA 5D1BA 5IX0A 5JI5A 4QA7A 4CBTA 1W22A 1C3RA 2VQOA 4ZUNA 3Q9FA 4ZURA 4CQFA 5EEFA 4BZ8A 3C10A 4BZ7A 3C0YA 3EWFA 3SFFA 4QA4A 3F06A 5DC7A 4RN2A 5EFBD 5D1CA 4QA6A 1VKGA 2VQMA 4QA0A 5D1DA 3MAXA 4ZUQA 5DC5A 1ZZ3A 2VCGA 5DC6A 5G11A 4LXZA 5A2SA 3C0ZA 3Q9CA 5EEIA 5THTA 1T64A 4BZ9A 5G3WA 5LI3A 4LY1A 5EFJD 5G1CA 5EFNA 1T69A 5EF8A 1C3SA 5DC8A 5EFHA 2GH6A 3ZNRA 3RQDA 2V5WA 5G0IA 5THUA 3EZTA 4RN0A 5EEKA 4ZUPA 1ZZ1A 5IWGA 5G0HA 5FUEA 4QA2A 5EENA 5ICNB 3SFHA 3EW8A 5THVA 1ZZ0A 5G0GA 3F07A 3MZ3A 5EFKB 5G0JA 3MZ4A 4BKXB 4BZ6A 1C3PA 2VQJA 5G1BA 5EF7A 5G0XA 2VQVA 3Q9EA 5G13A 3MZ6A 4QA5A 2V5XA 5EFGA 4ZUMA 4CBYA 5G12A 4QA1A 1T67A 5BWZA 4RN1A 3ZNSA 4A69A 5G1AA 5G0YA 3MZ7A 3Q9BA 3F0RA 4BZ5A 5FCWA 5G10A
chains in the Genus database with same CATH superfamily
3MENA 5G17A 2VQQA 4Q3RA 4QA3A 1HQ5A 1HQHA 3EZPA 3LP7A 3PZLA 2VQWG 1HQFA 4Q3QA 5THSA 3NIPA 4IU1A 4Q3VA 5EEMA 4ZUOA 3SL0A 3TH7A 5D1BA 4CEVA 5IX0A 2EF5A 5JI5A 4QA7A 1P8MA 4CBTA 1W22A 1C3RA 1TBHA 2VQOA 4IU4A 4IE3A 3Q9FA 4I06A 2EF4A 5EEFA 4ZUNA 3C10A 4GWDA 1T4PA 4ZURA 4BZ7A 4BZ8A 2ZAVA 3C0YA 3EWFA 4RHLA 4MYFA 3SFFA 4QA4A 3NIOA 2RLAA 2AEBA 3MFVA 3E8ZA 3F06A 5DC7A 3THJA 4RN2A 5RLAA 5EFBD 2PLLA 3SL1A 3MFWA 4RLAA 3DJ8A 4QA6A 5D1CA 1VKGA 2VQMA 4QA0A 5D1DA 3MAXA 4ZUQA 5DC5A 1ZZ3A 1T5FA 3M1RA 5CEVA 1P8RA 2VCGA 3NIQA 2PHOA 4Q3TA 4CQFA 3THHA 4HZEA 1GQ7A 5DC6A 5G11A 1R1OA 4Q40A 3SKKA 4LXZA 4HWWA 1PQ3A 3C0ZA 3Q9CA 5A2SA 3E6VA 4IXVA 5EEIA 5THTA 1T64A 4RHKA 4BZ9A 5HJ9A 4RHIA 5HJAA 1ZPGA 3LHLA 1TBJA 1D3VA 5G3WA 4Q3UA 3E6KA 2A0MA 3E9BA 5LI3A 4GSMA 4GSZA 4LY1A 4RHJA 5EFJD 1WVBA 5G1CA 5EFNA 1WVAA 1P8OA 1T69A 3THEA 5EF8A 1P8SA 3CEVA 1C3SA 5DC8A 5EFHA 1HQGA 2GH6A 3ZNRA 1P8PA 1P8QA 3MJLA 3RQDA 1P8NA 2V5WA 3MMRA 5G0IA 3GMZA 5THUA 3EZTA 4RN0A 5EEKA 4ZUPA 1ZZ1A 4MXRA 4DZ4A 1WOIA 4RHMA 4ITYA 5IWGA 5G0HA 3TF3A 5FUEA 4IE1A 4QA2A 4IXUA 5EENA 5ICNB 3SFHA 3EW8A 4G3HA 1T4TA 5THVA 1XFKA 1WOHA 1ZZ0A 1TBLA 3GN0A 4IU0A 5G0GA 4Q42A 4Q3RC 1CEVA 3F07A 3SJTA 3MZ3A 3RLAA 1WOGA 5EFKB 5G0JA 3MZ4A 4BKXB 3F80A 1C3PA 2VQJA 4MYNA 5G1BA 4BZ6A 2PHAA 1T4SA 4Q41A 1HQXA 5EF7A 5G0XA 2EIVA 2CEVA 2VQVA 3Q9EA 4MYLA 1RLAA 4GWCA 5G13A 4HXQA 3MZ6A 4QA5A 2V5XA 4IU5A 5EFGA 4ZUMA 4CBYA 5G12A 4QA1A 1T67A 5BWZA 4GSVA 4RN1A 4MYKA 1T4RA 1GQ6A 1T5GA 3KV2A 3ZNSA 4Q3SA 4A69A 3E8QA 1ZPEA 5G1AA 5G0YA 4IE2A 4Q3PA 3LP4A 4RHQA 3MZ7A 3Q9BA 4FCKA 3F0RA 4FCIA 5FCWA 4BZ5A 1TA1A 5G10A
chains in the Genus database with same CATH topology
3MENA 5G17A 2VQQA 4QA3A 3EZPA 2VQWG 5THSA 5EEMA 4ZUOA 5D1BA 5IX0A 5JI5A 4QA7A 4CBTA 1W22A 1C3RA 2VQOA 4ZUNA 3Q9FA 4ZURA 4CQFA 5EEFA 4BZ8A 3C10A 4BZ7A 3C0YA 3EWFA 3SFFA 4QA4A 3F06A 5DC7A 4RN2A 5EFBD 5D1CA 4QA6A 1VKGA 2VQMA 4QA0A 5D1DA 3MAXA 4ZUQA 5DC5A 1ZZ3A 2VCGA 5DC6A 5G11A 4LXZA 5A2SA 3C0ZA 3Q9CA 5EEIA 5THTA 1T64A 4BZ9A 5G3WA 5LI3A 4LY1A 5EFJD 5G1CA 5EFNA 1T69A 5EF8A 1C3SA 5DC8A 5EFHA 2GH6A 3ZNRA 3RQDA 2V5WA 5G0IA 5THUA 3EZTA 4RN0A 5EEKA 4ZUPA 1ZZ1A 5IWGA 5G0HA 5FUEA 4QA2A 5EENA 5ICNB 3SFHA 3EW8A 5THVA 1ZZ0A 5G0GA 3F07A 3MZ3A 5EFKB 5G0JA 3MZ4A 4BKXB 4BZ6A 1C3PA 2VQJA 5G1BA 5EF7A 5G0XA 2VQVA 3Q9EA 5G13A 3MZ6A 4QA5A 2V5XA 5EFGA 4ZUMA 4CBYA 5G12A 4QA1A 1T67A 5BWZA 4RN1A 3ZNSA 4A69A 5G1AA 5G0YA 3MZ7A 3Q9BA 3F0RA 4BZ5A 5FCWA 5G10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEN A;  5G17 A;  2VQQ A;  4QA3 A;  3EZP A;  2VQW G;  5THS A;  5EEM A;  4ZUO A;  5D1B A;  5IX0 A;  5JI5 A;  4QA7 A;  4CBT A;  1W22 A;  1C3R A;  2VQO A;  4ZUN A;  3Q9F A;  4ZUR A;  4CQF A;  5EEF A;  4BZ8 A;  3C10 A;  4BZ7 A;  3C0Y A;  3EWF A;  3SFF A;  4QA4 A;  3F06 A;  5DC7 A;  4RN2 A;  5EFB D;  5D1C A;  4QA6 A;  1VKG A;  2VQM A;  4QA0 A;  5D1D A;  3MAX A;  4ZUQ A;  5DC5 A;  1ZZ3 A;  2VCG A;  5DC6 A;  5G11 A;  4LXZ A;  5A2S A;  3C0Z A;  3Q9C A;  5EEI A;  5THT A;  1T64 A;  4BZ9 A;  5G3W A;  5LI3 A;  4LY1 A;  5EFJ D;  5G1C A;  5EFN A;  1T69 A;  5EF8 A;  1C3S A;  5DC8 A;  5EFH A;  2GH6 A;  3ZNR A;  3RQD A;  2V5W A;  5G0I A;  5THU A;  3EZT A;  4RN0 A;  5EEK A;  4ZUP A;  1ZZ1 A;  5IWG A;  5G0H A;  5FUE A;  4QA2 A;  5EEN A;  5ICN B;  3SFH A;  3EW8 A;  5THV A;  1ZZ0 A;  5G0G A;  3F07 A;  3MZ3 A;  5EFK B;  5G0J A;  3MZ4 A;  4BKX B;  4BZ6 A;  1C3P A;  2VQJ A;  5G1B A;  5EF7 A;  5G0X A;  2VQV A;  3Q9E A;  5G13 A;  3MZ6 A;  4QA5 A;  2V5X A;  5EFG A;  4ZUM A;  4CBY A;  5G12 A;  4QA1 A;  1T67 A;  5BWZ A;  4RN1 A;  3ZNS A;  4A69 A;  5G1A A;  5G0Y A;  3MZ7 A;  3Q9B A;  3F0R A;  4BZ5 A;  5FCW A;  5G10 A; 
#chains in the Genus database with same CATH topology
 3MEN A;  5G17 A;  2VQQ A;  4Q3R A;  4QA3 A;  1HQ5 A;  1HQH A;  3EZP A;  3LP7 A;  3PZL A;  2VQW G;  1HQF A;  4Q3Q A;  5THS A;  3NIP A;  4IU1 A;  4Q3V A;  5EEM A;  4ZUO A;  3SL0 A;  3TH7 A;  5D1B A;  4CEV A;  5IX0 A;  2EF5 A;  5JI5 A;  4QA7 A;  1P8M A;  4CBT A;  1W22 A;  1C3R A;  1TBH A;  2VQO A;  4IU4 A;  4IE3 A;  3Q9F A;  4I06 A;  2EF4 A;  5EEF A;  4ZUN A;  3C10 A;  4GWD A;  1T4P A;  4ZUR A;  4BZ7 A;  4BZ8 A;  2ZAV A;  3C0Y A;  3EWF A;  4RHL A;  4MYF A;  3SFF A;  4QA4 A;  3NIO A;  2RLA A;  2AEB A;  3MFV A;  3E8Z A;  3F06 A;  5DC7 A;  3THJ A;  4RN2 A;  5RLA A;  5EFB D;  2PLL A;  3SL1 A;  3MFW A;  4RLA A;  3DJ8 A;  4QA6 A;  5D1C A;  1VKG A;  2VQM A;  4QA0 A;  5D1D A;  3MAX A;  4ZUQ A;  5DC5 A;  1ZZ3 A;  1T5F A;  3M1R A;  5CEV A;  1P8R A;  2VCG A;  3NIQ A;  2PHO A;  4Q3T A;  4CQF A;  3THH A;  4HZE A;  1GQ7 A;  5DC6 A;  5G11 A;  1R1O A;  4Q40 A;  3SKK A;  4LXZ A;  4HWW A;  1PQ3 A;  3C0Z A;  3Q9C A;  5A2S A;  3E6V A;  4IXV A;  5EEI A;  5THT A;  1T64 A;  4RHK A;  4BZ9 A;  5HJ9 A;  4RHI A;  5HJA A;  1ZPG A;  3LHL A;  1TBJ A;  1D3V A;  5G3W A;  4Q3U A;  3E6K A;  2A0M A;  3E9B A;  5LI3 A;  4GSM A;  4GSZ A;  4LY1 A;  4RHJ A;  5EFJ D;  1WVB A;  5G1C A;  5EFN A;  1WVA A;  1P8O A;  1T69 A;  3THE A;  5EF8 A;  1P8S A;  3CEV A;  1C3S A;  5DC8 A;  5EFH A;  1HQG A;  2GH6 A;  3ZNR A;  1P8P A;  1P8Q A;  3MJL A;  3RQD A;  1P8N A;  2V5W A;  3MMR A;  5G0I A;  3GMZ A;  5THU A;  3EZT A;  4RN0 A;  5EEK A;  4ZUP A;  1ZZ1 A;  4MXR A;  4DZ4 A;  1WOI A;  4RHM A;  4ITY A;  5IWG A;  5G0H A;  3TF3 A;  5FUE A;  4IE1 A;  4QA2 A;  4IXU A;  5EEN A;  5ICN B;  3SFH A;  3EW8 A;  4G3H A;  1T4T A;  5THV A;  1XFK A;  1WOH A;  1ZZ0 A;  1TBL A;  3GN0 A;  4IU0 A;  5G0G A;  4Q42 A;  4Q3R C;  1CEV A;  3F07 A;  3SJT A;  3MZ3 A;  3RLA A;  1WOG A;  5EFK B;  5G0J A;  3MZ4 A;  4BKX B;  3F80 A;  1C3P A;  2VQJ A;  4MYN A;  5G1B A;  4BZ6 A;  2PHA A;  1T4S A;  4Q41 A;  1HQX A;  5EF7 A;  5G0X A;  2EIV A;  2CEV A;  2VQV A;  3Q9E A;  4MYL A;  1RLA A;  4GWC A;  5G13 A;  4HXQ A;  3MZ6 A;  4QA5 A;  2V5X A;  4IU5 A;  5EFG A;  4ZUM A;  4CBY A;  5G12 A;  4QA1 A;  1T67 A;  5BWZ A;  4GSV A;  4RN1 A;  4MYK A;  1T4R A;  1GQ6 A;  1T5G A;  3KV2 A;  3ZNS A;  4Q3S A;  4A69 A;  3E8Q A;  1ZPE A;  5G1A A;  5G0Y A;  4IE2 A;  4Q3P A;  3LP4 A;  4RHQ A;  3MZ7 A;  3Q9B A;  4FCK A;  3F0R A;  4FCI A;  5FCW A;  4BZ5 A;  1TA1 A;  5G10 A; 
#chains in the Genus database with same CATH homology
 3MEN A;  5G17 A;  2VQQ A;  4QA3 A;  3EZP A;  2VQW G;  5THS A;  5EEM A;  4ZUO A;  5D1B A;  5IX0 A;  5JI5 A;  4QA7 A;  4CBT A;  1W22 A;  1C3R A;  2VQO A;  4ZUN A;  3Q9F A;  4ZUR A;  4CQF A;  5EEF A;  4BZ8 A;  3C10 A;  4BZ7 A;  3C0Y A;  3EWF A;  3SFF A;  4QA4 A;  3F06 A;  5DC7 A;  4RN2 A;  5EFB D;  5D1C A;  4QA6 A;  1VKG A;  2VQM A;  4QA0 A;  5D1D A;  3MAX A;  4ZUQ A;  5DC5 A;  1ZZ3 A;  2VCG A;  5DC6 A;  5G11 A;  4LXZ A;  5A2S A;  3C0Z A;  3Q9C A;  5EEI A;  5THT A;  1T64 A;  4BZ9 A;  5G3W A;  5LI3 A;  4LY1 A;  5EFJ D;  5G1C A;  5EFN A;  1T69 A;  5EF8 A;  1C3S A;  5DC8 A;  5EFH A;  2GH6 A;  3ZNR A;  3RQD A;  2V5W A;  5G0I A;  5THU A;  3EZT A;  4RN0 A;  5EEK A;  4ZUP A;  1ZZ1 A;  5IWG A;  5G0H A;  5FUE A;  4QA2 A;  5EEN A;  5ICN B;  3SFH A;  3EW8 A;  5THV A;  1ZZ0 A;  5G0G A;  3F07 A;  3MZ3 A;  5EFK B;  5G0J A;  3MZ4 A;  4BKX B;  4BZ6 A;  1C3P A;  2VQJ A;  5G1B A;  5EF7 A;  5G0X A;  2VQV A;  3Q9E A;  5G13 A;  3MZ6 A;  4QA5 A;  2V5X A;  5EFG A;  4ZUM A;  4CBY A;  5G12 A;  4QA1 A;  1T67 A;  5BWZ A;  4RN1 A;  3ZNS A;  4A69 A;  5G1A A;  5G0Y A;  3MZ7 A;  3Q9B A;  3F0R A;  4BZ5 A;  5FCW A;  5G10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...