4BLJA

Galectin-3c in complex with bisamido-thiogalactoside derivate 2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Controlling Protein Conformation Through Electronic Fine-Tuning of Arginine-Arene Interactions: Synthetic, Structural, and Biological Studies
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords GALECTIN-3
total genus 36
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bljA00
1S0EA 2W68A 5H9RA 5DZGA 1VALA 1KJRA 2ZMLA 1QNYA 2SBAA 2EXJA 3SH3A 3WDVA 5GLVA 2AYHA 4M3CA 1DQ2A 4AYUA 1SLAA 2CNAA 3M3CA 3B69A 4LBQB 5JOZA 2A3YA 4P14A 4XIKA 4XBNA 3V65A 4ZKTB 2A3WA 2AREA 3HN1A 4XJUA 2A75A 2GMPA 2V73A 2A6YA 4TYSA 1PZ9A 2W39A 5F5QA 3ZSJA 1LHNA 2WLQA 2W08A 1ONAA 1LU1A 3UJOA 5H9QA 1C57A 2JKBA 1AXZA 5GZFA 3LSDA 3SNMA 2WT2A 3RMYA 1JYCA 1V6OA 4LBKA 1DGLA 1DIWA 1UPSA 3WUDA 4XBLA 2AGSA 3I8TA 4K21A 4LBQA 1DYKA 4PQ9A 1AX1A 3ZYPA 2ZGLA 1QNWA 1CPMA 1D0HA 3B9CA 3N35A 5IK8A 1GKBA 3WLUA 4FPLA 5F9TA 2YZ4A 1BZWA 4WVVA 4JRAA 3U4XA 1IKQA 4Y1VA 2E7QA 2WT1A 1LOEA 1BKZA 2PHXA 2ZZJA 4BM8A 2D6MA 3KM5A 3VKFC 5IK7A 1R1ZA 1X50A 2D7FA 3O5SA 1WBLA 1HQLA 2JE7A 5GZGA 2ARBA 4XXPA 4K1YA 1OFSA 4RA0A 1MACA 2A70A 3OPZA 4YFZA 4XJ9A 2YMZA 1V00A 2CYFA 3O0VA 1Z78A 1KITA 1SLCA 1W6PB 1G7YA 5JDBA 4BLJA 4Z8BA 1CJPA 3JUUA 4AVSA 4UW5A 4Y1UA 4YM2A 2B7YA 3ZSKA 4GWNA 2P34A 3SISA 5KXDA 1GLHA 3AP4A 1MVEA 1W6MB 1G9AA 2CL2A 2DVFA 1HQWA 4Y26A 1LESA 5GZEA 3AZZA 1KQRA 1MZ5A 4FPKA 4YZ3A 2WT0A 1QU0A 1V6LA 1GICA 2DWRA 1GBGA 1F9KA 1O4YA 3WDTA 5T52A 2YROA 4M3CE 4AWDA 3D6EA 1AX0A 1N1VA 2WSVA 3PVEA 2LTNA 3M1HA 2FHRA 3AK0A 4M01A 5CNAA 3B00A 1S0JA 1AXYA 1RITA 2R0HA 3PVNA 5HCFA 5CAZA 5DUWA 3FLTA 4L8QA 2E6VA 1JN2P 1VAMA 1LCLA 1IS3A 1HKDA 1GZWA 1N3PA 1MS5A 2ARXA 2G4IA 1UX6A 2ZGNA 2VUAA 1DZQA 1KDMA 1APNA 4YZ1A 3AZYA 3IKWA 4R9DA 4AVVA 1FAYA 5DUVA 1LENA 3WZ1A 1LOFC 2P2KA 4YW1A 4YFWA 3WV6A 3D5OA 2PHWA 1IS6A 5JOXA 1WW6A 4FPCA 2Z42A 4XDQA 4SLIA 2WJSA 4ATFA 3O0WA 1D2SA 4Y1ZA 5GLTA 4YG3A 3ATGA 5CB7A 4FPHA 5T5LA 1CR7A 5T50A 2JJ6A 3WDUA 4PBOA 3GALA 2P3JA 1DQ1A 4YGBA 3O0XA 4I30A 2ZA9A 3QCWA 4RL7A 1V6NA 4PBPA 3IPVB 3ZSLA 5JMCA 4FOWA 5KXEA 5GJ6A 4Q8KA 2FMDA 2VU9A 1Q8SA 4DQAA 1MS3A 1F31A 1MZ6A 1SBEA 1BJQA 3BTAA 3AP7A 3PJQA 5DUUA 3WOGA 2DTWA 1QMJA 1ULDA 2DUPA 2WQZC 2YV8A 2VW0A 3ILRA 4YW2A 1DFQA 1JYIA 1LGBA 2AUYA 4Y24A 2PHRA 4DRRA 5JOYA 3N7MA 4FP2A 2JD4A 5CBLA 5KXBA 1IOAA 2DUOA 2GNBA 2DV9A 2ZGPA 3AYEA 4XJAA 2LALA 3OGGA 5DZEA 1YIFA 2RHPA 4XTPA 4U2AA 4YM0A 2NYYA 1CESA 1URXA 1LHWA 2ZGRA 4OZXA 3FLRA 3RMXA 2EF6A 5GLWA 1QDOA 2AENA 1FNYA 1QGLA 4M3CB 3AP9A 1N1SA 4BQ1A 2PHFA 5E8AA 4K20A 3ZYRA 3OJBA 5IT6A 1QF3A 1YI7A 2ZGSA 2UWCA 4F83A 3MW3A 2I2SA 2D6LX 2ZHMA 5IK5A 1LOCA 4UW6A 1Q8QA 3NV4A 5LK5A 3WCSA 1TEIA 3QLQA 2AH2A 1S0DA 3B01A 1AF9A 4GWMA 3USUB 1PZ7A 2VW1A 1N1YA 4Y1XA 4WV8A 4XYXA 4YGCA 1WCSA 2ZGTA 1A78A 3BOPA 4XMAA 2NP0A 2WKKA 1W6NA 3JU9A 4YW5A 5IK4A 4DS0A 3OY8B 2NM1A 1BXHA 4UW3A 1GNHA 3T2TA 4BPZA 1JHNA 1LTEA 2GMEA 2CWMA 4PCRA 1N3OA 2ZGUA 2YY1A 4P9YA 4ISQA 4IQPA 3WNXA 4C1WA 1MS0A 1G86A 2NMNA 4XJZA 3OYWA 4YZ5A 1ENSA 1G9BA 2VH9A 1MVQA 1WD4A 1W6QB 1UAIA 4XILA 2ZBJA 2A6WA 2C9AA 2P3IA 3N7KA 4FOQA 3ILFA 4AGRA 2A71A 2D6KA 3B3QE 3AZWA 1O4ZA 3OY8A 1CPNA 4YGEA 4YM1A 3RQ0A 1DHKB 4R9AA 4P9XA 3IMNA 2TEPA 1Q8VA 1YRZA 1SLIA 3OBRA 2D6OX 2ZGQA 4YG6A 4KBBA 4JCKA 4PF5A 5GZCA 1DQ0A 1W6PA 5T5JA 1LOGA 2XG3A 3IN9A 3N3HA 5JLVA 1V6IA 1Y7BA 1W6QA 1GANA 2DU0A 2E51A 2EXKA 2KM2A 3MEPA 3WG1A 5T55A 3MW4A 1C4RA 2R1DA 4M3CF 2D3RA 1WW7A 1VAVA 3ZXKA 4AVTA 4GXLA 4NO4A 3AX4A 1WBFA 1S0FA 4NOTA 1AX2A 3VV1A 1HLCA 2A6ZA 4XHXA 1C1LA 4CZSA 1UZYA 3FFZA 1IS4A 1DBNA 5JVVA 1CONA 4D69A 3AZXA 4M00A 1OKQA 3LCPA 5EWSA 1B09A 2GN7A 4P9WA 4Y22B 5HCBA 1SCRA 1RIRA 1RINA 2EXHA 1LEDA 1CVNA 1YXWA 3AZVA 4FPFA 2R1BA 2DVBA 5SV8A 3UJQA 1YYNA 1Z0HA 2VY0A 1GZWB 3H0OA 2ZABA 3RS6A 1OQ1A 3AYDA 2EXIA 1EPWA 3C2UA 2OW4A 5HCAA 4CTEA 2BQPA 1MS4A 1GV9A 3AJZA 2ENRA 4LBOA 1C1FA 1S0CA 2DVAA 4XMIA 5EYXA 2R16A 3FUQA 2PELA 1WLWA 1JOJA 4YGDA 2VXRA 3APBA 3V0BB 2DURA 3POSA 3WCRA 1KRIA 1LHUA 5DG2A 1LHOA 1NXD1 2DUQA 2CY6A 2GALA 1GYKA 2EALA 3M3QA 1UMZA 1SLBA 3WG4A 1VLNA 4YZ2A 1JW6A 3RSJA 5BYNA 3WG3A 1SLLA 3AYCA 1DLLA 1GZCA 4AGVA 1ULFA 4CRQA 1UN1A 1W6NB 3AP5A 2ZGMA 3M3OA 5FREA 3AXEA 3SLIA 3VKLA 5GALA 3VKMA 3TB0A 1Q8OA 2GNMA 3UL2A 3A4UA 4XXAA 1G9CA 2ZKNA 4Q8LA 2UURA 3PMEA 2NMOA 1MS9A 3V0BA 3UK9A 1KJLA 1G9FA 2D6PA 2ZAAA 3FLPA 4FPJA 5JOWA 3T1MA 3TAYA 1WLCA 1LGCA 1LULA 5T5PA 3R4SA 3R05A 1AZDA 2UWAA 5T54A 3DGTA 1MR5A 1MS8A 2UWBA 4Q2FA 1UKGA 3BIWE 4WZFA 4C1XA 1WD3A 1A3KA 2A6XA 2A5ZA 2E53A 1AXKA 2EAKA 2GNTA 3INAA 3NV1A 4Q1PA 4HL0A 4BMBA 2H0BA 3NV2A 1HDKA 3ASIA 3M3EA 4WVWA 4XTMA 3PVOA 5GLZA 2DVDA 1DQ6A 1LOBA 3DUIA 3L2YA 4FOYA 1G8WA 1V6KA 3NWKA 4FPEA 3VKNA 4GKXA 2OVUA 1SBFA 1W0OA 2JDZA 4XBQA 1MS1A 1ULGA 1XQNA 3ILNA 2UU8A 1UL9A 4FP3A 1H9WA 4XHBA 2D6NA 2OUJA 2A7AA 2YXSA 1FATA 2JE9A 2ZMNA 4ISRA 4Q26A 3VKOA 1BYHA 2P37A 4AGGA 1QDCA 2AR6A 1PZ8A 3V64A 4K1ZA 2A6VA 3RG0A 1W6OB 1S0IA 1G9DA 3CNAA 2ZHLA 4BMEA 4ZXKA 2DVGA 4FQZA 4XZPA 2JECA 4ITCA 5EXOA 4YM3A 1N1TA 3USUA 1FNZA 1H30A 5GZDA 4HANA 2ZHNA 3HR9A 3M2MA 1I1EA 2ZGOA 4Y22A 1W6MA 2NZ9A 5E89A 2ES3A 5GM0A 2ZGKA 4DFSA 1JXNA 4U36A 1NLSA 1LHVA 1Q8PA 4Y20A 2DYCA 5AVAA 5T5OA 2WNEA 2SLIA 3WHUA 3N36A 1W6OA 3AP6A 1AJOA 1GNZA 2DTYA 2ZMKA 1WLDA 4XOGA 1LECA 1H9PA 2CWSA 3WG2A 1ENRA 1U0AA 2R0FA 3V0AA 4YG0A 4YZ4A 4ATEA 3ZVXA 2A3XA 3NV3A 4JC1A 1N47A 5IUQA 3POWA 4UW4A 4Y20B 2DU1A 5GLUA 5H9SA 4R9CA 4GKYA 1AJKA 1FV3A 1LEMA 1LOAA 4Y1YA 3WDYA 2EIGA 4W65A 1CN1A 1QOSA 2D44A 3ZSMA 1N3QA 4LBJA 1FV2A 2GN3A 1DYPA 1BQPA 4H55A 4LBLA 4R9BA 4Q27A 3SH5A 1CQ9A 5FRAA 4DPNA 3WUCA 3ZXFA 3V0AB 2P3KA 1W0PA 1S0GA 3OBTA 1ENQA 2D3SA 3OYWB 3ENRA 5H9PA 2V5YA 1IKPA 4XE9A 4ASMB 3A0KA 3VUOA 4TZDA 2WSUA 3ZXLA 3KQRA 5DXDA 3WDXA 1SCSA 3O12A 1V6MA 4FPGA 1GZ9A 1LOFA 1QOOA 3N7LA 1SFYA 2PHTA 1ZM1A 1AVBA 4GA9A 4GALA 3Q9OA 2OUHA 2R49A 3MPPG 1SACA 2D3PA 5L73A 1VIWB 3A0NA 4YW4A 2CTVA 1J1TA 2GNDA 1LODA 1I3HA 3POYA 4MYEA 4XIOA 3WHTA 5KXCA 1CIWA 1WUVA 3HMYA 3FBYA 4DRVA 1F5FA 3SH4A 2GDFA 2PHUA 3D4KA 3W59A 4BLIA 1JBCA 1KDKA 1FYUA 2W52A 4YLZA 3ZPYA 3T1LA 1A8DA 2ZACA 1SLTA 3ZXEA 3AYAA 1GSLA 4FPYA 2NN8A 3IM0A 4LBNA 2ERFA 3MW2A 4Q1RA 1DQ4A 1IS5A 1DQ5A 1FX5A 2VW2A 1SBDA 5CA6A 3N7JA 5DG1A 4FOVA 4XJWA 3LSEA 2E7TA 1ZA4A 3IPVA 1Q56A 3AXDA 3I4IA 2D43A 1QOTA 1JUIA 4BOWA 4FPOB 3WDWA 1WW4A 2GMMA 3BODA 3GNEA 4XJ8A 1LU2A 3FUOA 3RRDA 2XB6C 1ULEA 2ZHKA 1LGNA 3W58A 4FVVA 1YO8A 4YW3A 1S0BA 2HYKA 5EYYA 3R4UA 4FQ4A 4LBMA 3AJYA 3ZXJA 1LJ7A 1V6JA 2C5DA 2Q5TA 5DUXA 5DZFA 1ULCA 1S1AA 5E88A 3AFKA 3WVJA 1UZZA 1WW5A 1QKQA 3SITA 4LBQD
chains in the Genus database with same CATH superfamily
1NCRC 5H9RA 5DZGA 5CFDC 2ZX2A 2YC0A 1US3A 2EXJA 3WDVA 4J1XA 4M3CA 1UXXX 3RI8A 3GM8A 3M3CA 2DBNA 3O7OA 2A3YA 1CAXA 3QOPA 3O1OA 2QQOA 3N9OA 2A3WA 2AREA 4OULA 4RQPA 4W6YA 2PHLA 1RUC1 4TYSA 5F5QA 4MHRA 4PIZA 3POGA 2WLQA 2VULA 4C0BA 5IAVA 2HWE1 4OHXA 1DGLA 3QACA 3QH7A 1NCQC 2G9GA 2BP6A 2ZGLA 1CPMA 2I07B 2VMEA 3URFA 4GB33 3N35A 4KWLA 2RR13 1BK0A 1GUIA 3VDAA 5AFBA 5AC92 3U0ZA 1GKBA 2BUKA 3T08A 1RUG1 2YZ4A 3R6SA 3WP5A 2PTMA 1XNDA 5BPXA 5LEKA 3ZYHA 2FDHA 3H7YA 1ENXA 4IERA 4Y1VA 5F3EA 4AFAA 4Z2WA 5ACA3 2WT1A 3ZYFA 3PHMA 4I0BA 3LEMA 1QJX1 2D6MA 3KM5A 3VKFC 1XSQA 4TTGA 4Z92B 3FC0A 1YNAA 5IYYA 1HQLA 2JE7A 4HPKB 4YPJA 4AFBA 2JXAA 4K1YA 3P3PA 5J98B 1MACA 1OC1A 2DCJA 1V00A 1Q3EA 4BLJA 2LRPA 3BPZA 4QPGA 1C5HA 3UT0A 2VMGA 2VMFA 1IG3A 4Z8BA 2C0ZA 4Y1UA 4NHLA 4ONUA 4YM2A 2R041 3HJRA 4IW3A 3ZSKA 5KXDA 2JENA 4KU8A 1VRH1 1FOD1 4YRDA 1CAVB 4UT5A 3O1PA 4BU2A 4Y26A 3ZKUA 1HW5A 4KGQA 2D93A 4C90A 1US2A 3FJSA 3WNNA 5A3PA 3WDTA 5FV3A 4OUSA 3MZHA 3PUIA 1W8NA 1OA4A 1OT5A 5BNOB 3D6EA 1OMIA 1G6NA 4I09A 5FY8A 3VDCA 3MIFA 3BPSA 3E6BA 3HNYM 3PVEA 4QPYA 3RYKA 2FHRA 1TME1 4M01A 4QB2A 4L11A 1DU3D 4Q4V3 2DCYA 4QX5A 5DUWA 3MICA 1XU1A 3UKTA 1QJU1 5CKMA 3BB6A 2IC1A 1AYM2 1JN2P 1IS3A 2BV4A 4MX3A 1VAKA 1OOPC 5AC91 1AL23 1UX6A 2WAAA 5FK8A 4DXSA 1KS4A 4KMQA 1XOYA 5FKCA 3ZFFB 1UU5A 4TLGA 1PVC2 2BU9A 1RJ8A 3CO2A 2RMU1 1AUYA 5LA2A 5JPMB 3A7QA 1O6UA 3IKWA 4AVVA 4AEMA 5J1XA 1IPJA 2JICA 4AK3A 2YC2A 4YW1A 3D5OA 1X9TA 4CUCA 5JOXA 3VBFB 1UOBA 3GBFA 1C3HA 4JGYB 4LHKA 3FBMA 5HV4A 2HEVF 4A45A 3PTYA 4XCAA 3U4SA 2ORXA 5GLTA 2E33A 3KVBA 3GBGA 1UQXA 1RUD1 2QUOA 5E16A 1H0BA 3WDUA 3MHZA 5C33A 4IE5A 1POV1 4ZHNA 3GALA 3W21A 1CAWA 1DQ1A 1H2KA 4INDA 2X53S 4YGBA 4PJYA 3O0XA 1LNSA 1PNGA 2OIIA 3IIIA 3QCWA 4RL7A 4K7JA 4LT5A 5JMCA 2XOMA 5JZGA 3HNBM 5A7PA 3SXWA 2DCTA 4Q4W1 4QHZA 2FMDA 3RWKX 1Q8SA 4XETA 4DZGA 3WOGA 3PJQA 1NKGA 5DUUA 1JOPA 3CZJA 1Y4WA 3M3IA 4IGOA 2D40A 3J8F1 4RHV2 3ZM8A 2BGPA 1L3JA 3POEA 5DABA 1W0NA 4A2UA 3BTZA 3ZXDA 1ZZ6A 1ULDA 1BLZA 2WQZC 5ABJA 2VW0A 3I3QA 1GP6A 4JKMA 4UOJA 3RZMA 4RN5A 4UAPA 1SG3A 2AUYA 2PHRA 5JUVA 1MZEA 4E2SA 4FP2A 3ES4A 5FP4A 5CBLA 5D1IA 1IOAA 2DUOA 2DV9A 2OQ7A 4E4HA 1XXNA 5AFEA 5A3MA 1LR5A 5LEJA 1RUF2 5DZEA 1YIFA 4XTPA 2K0GA 4EZ4A 2NYYA 3ZDSA 1CESA 2XVKA 4AEKA 1LHWA 3I7DA 4JKKA 1WMEA 3BVCA 4XUNA 4D7TA 1NG0A 5EQUA 3KLSA 3NJXA 4RYDA 4P9IA 4BQ1A 2AEZA 2PHFA 4RHV1 5ANNA 3H7JA 1NY71 4UFJA 2ARAA 4IE0A 2QQLA 4CU6A 3THCA 1AYN1 4LMFA 5FPBA 3WW1A 1OVPA 4LA2A 5C8WA 1W2TA 1PO11 1UU4A 1EAH3 2AH2A 4GWMA 4Y1XA 1X8EA 2RR12 4WV8A 4Z2AA 1Z7S1 3ZXGA 3AL5A 4XQWA 3IAPA 4HN0A 4XMAA 3GZTB 2XKPA 3JU9A 4YW5A 1PIV2 4RR3B 1CX4A 4LIVA 1ND2C 3DPRB 3CBNA 1OF4A 1X36A 4XPVA 5D2AA 2QQPA 1O5LA 1JHNA 1PK6B 2VOTA 2VMCA 4XAAA 3W9AA 4XZUG 4AI2A 1W2UA 1N3OA 2D98A 2ZGUA 4IQPA 3WNXA 1MS0A 2BBAA 4XJZA 4AQTA 1XNKA 3OYWA 1ENSA 1QXPA 1CAUA 2VH9A 1E5HA 2YPJA 1UAIA 2E7AA 3KCXA 3N7KA 4FOQA 2VZVA 4IUGA 5A7WA 4QPIA 4UFMA 3MBWA 2A71A 1YJKA 4BQ5A 4WVMB 3RQ0A 3HVDA 3THPA 4QHOA 2FCVA 4P9XA 3D0JA 5FPXA 1Q8VA 1YRZA 1SLIA 2RS53 4PI2A 2D6OX 4B29A 1IPSA 5GZCA 1WGPA 3AVRA 2P5BA 3IN9A 1YFXA 2QNKA 1V6IA 5J48A 1ND3C 3RI9A 1W6QA 3H9AA 2DU0A 2KM2A 4HFSA 5I8YA 4FTEA 5T55A 5FY1A 1TNRA 2PAMA 2J7MA 2R1DA 5FOBB 4Q4V2 2D3RA 1VAVA 5BNPC 4NO4A 2ID4A 5FOJB 2RS31 1WBFA 1Y9QA 1X8MA 4NOTA 1IHMA 2XBO3 3VBRB 2A6ZA 3MIBA 2Q8OA 2PN5A 3VD4A 4XHXA 4PDWC 5A1LA 1UZYA 4A42A 1DBNA 3FZ3A 1JYTA 1PM4A 2F4PA 3WF2A 5IVCA 3LCPA 1B35A 2K2SA 5FTTC 1FPN1 3TWIA 5EJ3A 1UWWA 2EXHA 2GP5A 4FI9A 2WNVA 3AZVA 1CVNA 1B35C 2Q4SA 2IXIA 5K0UB 5LA0A 3AKPA 3I54A 2VY0A 4I02A 1GZWB 1I5ZA 2HEWF 3VDBA 3LE0A 4V2WA 5I8SA 2MEV3 3AYDA 3UGGA 1RUI3 3LIGA 2RM22 3ZYBA 2WBKA 4KG0A 3HEIA 2ZEXA 3A21A 3PMSA 4CTEA 1MS4A 1GV9A 3RFRA 4LBOA 2DVAA 2WYFA 5BNPA 2W87A 3FUQA 1JOJA 3OB8A 5A6QA 2VUDA 4LXLA 4QX7A 1GOGA 3POSA 1LRHA 5LBEA 2BW8A 3O1TA 2YFZA 2GALA 3SKJE 3WG4A 1UMZA 4MV2A 1JW6A 3UV9A 3AYCA 1DLLA 3BU7A 3J9SA 4XDOA 1W6NB 3ZYGA 3SLIA 3VKLA 3BYWA 3VKMA 3PDQA 4MZUA 1CGPA 4QM9A 1Q8OA 2GNMA 1JOBA 4FAGA 3H8RA 1WCDJ 1UMIA 1S2EA 2BYVE 3JBG2 2YGMA 3ZYIB 2PLV2 4QQOA 2RR11 1H8TC 3UK9A 4AVAA 1W8FA 4YW6A 3P5BA 5JOWA 5K7PA 3T1MA 1WLCA 4LO7A 4WM7B 3N4MA 3NNGA 1RUF3 5T5PA 4D94A 4CE8A 2DBIA 5T54A 3DGTA 1MR5A 2IVJA 2UWBA 2VNGA 3CL1A 5CYYA 4TN7A 1TG7A 3ZXAC 3NV1A 1ND2A 2E53A 3INAA 4PQQA 3KGZA 4GWIA 4QGNA 3UGHA 2WS93 5FXWA 4DY5A 1PGSA 5JI9A 4WVWA 1CWPA 4BDVB 2QDNA 4XTMA 3PVOA 5FXVA 2XHKA 5T3NA 4LHSA 5GLZA 4NROA 4FOYA 3ABZA 4K8FA 2XL7A 3VHRA 3NWKA 1ZBA1 3WW2A 4BIFA 3OD4A 4WM7A 1OKOA 1QHDA 2ORZA 4NHKA 3POFA 1AR71 2VZPA 4O9EA 4FCAA 4XBQA 2W9XA 5C9AC 5ACA1 4UF0A 2OUJA 3KMHA 1H2NA 3J4UH 2GC0A 1D0GA 4Q0PA 2WZR3 1PZ8A 3V64A 5D21A 2A6VA 3RG0A 4AHXA 3LA2A 4BMEA 1UIJA 4L0PA 4XZPA 3Q8EA 2ZHNA 1VBC1 1I1EA 3WNPA 4Y22A 3D8CA 4Q4X3 5GM0A 2ZGKA 5FZEA 3PIJA 4GAZA 1NA1B 5FMOS 1FOD3 2CGOA 4Y20A 2DYCA 2YC4A 4ZY9A 3DECA 1T6GC 3OGVA 4ZXEA 1IPKA 2WO1A 5T5OA 4B4RA 4CDXC 3I3MA 3MF9A 2GH8A 4Y5TA 3C3VA 3MIEA 4AHWA 4ZZ8A 2F4LA 4CCDA 4A6OA 2X09A 3WG2A 1AHSA 1U0AA 1X82A 5FO7B 5FUIA 2X5IA 2XJPA 5IUQA 3POWA 4EE2A 3KCYA 4Q4V1 4RGAA 1W99A 1AJKA 1RMU3 1ZZBA 3QD6A 3WDYA 5FK7A 1CN1A 3NKGA 4AL9A 1TMF1 5F5CA 1N3QA 4LBJA 1FV2A 1COV1 2KXLA 3ETQA 5FMCA 2ADDA 5KC5A 4Q27A 1H2LA 3K3NA 1RHI3 3SH5A 2AACA 2XPJA 5DAQA 5J09A 4LE3A 2PLV1 1A6CA 3VD7A 2UY8A 4AEDA 4XUTA 3KT1A 2D3SA 3ENRA 5H9PA 2V5YA 3C7FA 4BJ0A 3VUOA 4TZDA 1UZWA 4QX8A 1Q5OA 2VD7A 3MFCA 5EV7A 2WNVC 1SCSA 2HWB3 3O12A 4FPGA 5JR2A 1QOOA 3KV9A 3K2OA 2EAAA 4AR2A 2PHTA 2OA2A 3EMRA 3NNMA 5FYHA 1ZM1A 5FDBA 3BTYA 4XEZA 3MPPG 3CEWA 3HWJA 5C7GA 1TZOA 3A0NA 2PXJA 2C26A 3I59B 3NNJA 5FZMA 1UMHA 4XIOA 3WHTA 5FO9B 3KD4A 2HWD3 2WDBA 3D4KA 2J1AA 4BLIA 4CP0A 1ZA7A 3MIDA 3PUSA 4UFHA 3ROUA 5C5UA 2W52A 4HSLA 2BEOA 3HT2A 3ZPYA 2QZ2A 2V4VA 4COVA 5KHKA 3BCWA 2R32A 4FPYA 3MW2A 1DQ4A 1FX5A 1QJZA 5D8AA 4YVSA 1VBA1 4YVWC 4NIGA 2W0XA 3N7JA 3TNPB 4HETA 3H1MA 3VD9A 1ASJ3 5FP8A 2P6CA 4FOVA 4CDQB 5C3PA 3KCCA 1Q56A 3FFQA 2D43A 2WNOA 1JUIA 1W9TA 4DXTA 1WKYA 1GP4A 3IT8A 4BOWA 3NW4A 1K5JA 4FPOB 2CAUA 3WDWA 1ND3B 1T2XA 4XJ8A 5LASA 4NWWA 2XB6C 1ULEA 4ET7A 5G05L 4BE3A 1AYN3 1JHJA 3POJA 1YO8A 2VBPA 4FVVA 4LK6A 4R4ZA 2K46A 2PFWA 1ZREA 3NMBA 1S0BA 1RXFA 1HJGA 1PO13 1R093 1XRUA 3OSDA 4FQ4A 3AJYA 5EYYA 5C6CA 1LJ7A 1V6JA 2C5DA 3CMGA 3R0RA 3K4DA 5DUXA 5DZFA 5E88A 1S1AA 1O7FA 3AFKA 3KF3A 3SCFA 4XFIA 4NRQA 1JZ2A 4KNCA 3S7EA 4IE7A 3OUJA 4KI5M 5LBCA 2WN2A 2ZMLA 1QJY2 1QNYA 2SBAA 3VGIA 2W95A 1UNBA 1QQP2 3OGSA 2VVFA 3WP3A 1MEC1 1RVF1 4IGPA 4AYUA 4LBQB 3KSCA 3AKQA 4XIKA 4XBNA 5L9BA 2WZPP 4DXRA 4XJUA 4AI0A 2HBTA 2WQ8A 4XW3A 1OD5A 1PZ9A 5CFDB 2BOIA 5F37A 3NJVA 3VBFA 2XVLA 3HQXA 2W08A 3C8XA 2W46A 5H9QA 1UOGA 3B93A 2WT2A 3RMYA 3SNMA 3C7EA 4JAAA 4XUPA 1NT0A 5CG9A 1V9U1 4PLNA 2QFEA 4AVBA 3TNQA 1DIWA 1H4GA 1YWKA 3VBUC 3N9LA 4UFIA 1VB2A 1JUHA 1QH7A 1GU3A 3KF5A 4XBLA 3WUDA 3KHBA 4LBQA 1BBT2 2OZ6A 2XBO1 3KHCA 1CAXB 2RS51 1AX1A 2VBBA 4H7MA 3RPQA 1QNWA 1WWYA 5DPNA 5FZ3A 3BI3A 1D0HA 1W8ZA 3MIHA 5CFDA 2ZOEB 2AZ5A 2CU5A 3AM2A 2O14A 5JAXA 2W2IA 4OUMA 4B7KA 5F9TA 1OXCA 1BZWA 1EUTA 1XPWA 3SEPA 5M0TA 1HRI1 1VRBA 2YUEA 3LA7A 1IKQA 5JSRA 1NY72 4N53B 4FAHA 4GD4A 1OPOA 3LPFA 1LOEA 1WCQA 2ZZJA 3VDDB 4XAEA 3RZZA 2D7FA 3O5SA 2WUHA 1WBLA 1OQDA 5DDJ3 2ARBA 4D6RA 4XXPA 4RA0A 1OFSA 3OPTA 2A70A 4YFZA 4XJ9A 5A1AA 1GWMA 4L92A 3O0VA 2GZWA 1G7YA 5BNNC 3N9QA 3JUUA 4AVSA 1BEV2 3THTA 1GWLA 4GWNA 4CXWA 1YFUA 5JXJA 1W6MB 3MUY1 1R1A1 1ULPA 2DVFA 1HQWA 3T2PA 3G6JB 5ERLA 3RDIA 3SQOA 3DYPA 5HPOA 3MO4A 4YZ3A 1V6LA 1NXMA 1L7RA 1O4YA 2QBXA 4YNIA 2YROA 1C28A 1VBD2 4AWDA 1AX0A 3DYMA 2VTXJ 2GC3A 1NX9A 5CNAA 3B00A 1RITA 2R0HA 2VZUA 3IMMA 3TEWA 3HAGA 5HCFA 1ZRDA 4OMDA 1GQPA 1L7LA 4OQ9A 1BMV1 2B42B 2E6VA 4QQHA 2LW8A 1QQP1 5CZKA 2ZGNA 1RUH3 1N3PA 1GZWA 2ARXA 3H3LA 5CIRA 4E2GA 1LAJA 4XDPA 5AVPA 1TME2 2OZJA 1DZQA 1HB3A 3EYPA 4HK8A 1UYYA 1APNA 4CCCA 1O5UA 2WS91 1WA6X 3J26N 5ISLA 3S57A 4CPBA 5DUVA 4C0HA 3KV5A 1NZCA 1IS6A 5IJRA 5F7UA 4ASLA 2BVBA 2XWBB 4Q29A 4XDQA 1ZZ9A 3O0WA 2V4AA 1D2SA 3NJYA 4QXKA 3TOJA 1RUNA 4RR3C 3OPWA 1MZFA 2EIEA 5T5LA 1ZRIA 2VCMA 5T50A 1PIV1 3AC0A 4IV3C 1E5IA 2JJ6A 4PBOA 2KA3A 4P02B 2PQSA 3HN3A 4JGZC 5FBJA 1M06G 4JGYC 4I30A 1D4M1 1GOHA 4LEJA 1V6NA 2CDPA 3IPVB 3ZSLA 4CCEA 4FOWA 2GC2A 1U5ZA 5GJ6A 1NE4A 2VE1A 2VBDA 3CZUA 3ZN6A 1MS3A 4W6WA 1MZ6A 1SBEA 2GSYA 3BTAA 3NO8A 4QHBA 4RS5A 4B8EA 4ZU4A 5LRRA 1TMF2 2ZZQA 4QDRA 1QMJA 5EJ1B 4Z07A 1W3VA 2RS12 1VBD1 3EQEA 3WF3A 1DFQA 5F32A 1EAH2 1FXZA 1XYPA 4X8PA 5DN2A 3WQ1A 4Y24A 5JOYA 2BVVA 4N7UA 2QQNA 1HRV2 2DFCA 2WFF2 3O14A 2JD4A 2DDUA 3OBAA 3X29B 3IB3A 3F95A 3AFGA 4EWDA 4PIXA 2ZGPA 1RYYA 4KWJA 4GH4B 3FMGA 1EUUA 4N43C 1RUE3 2HBUA 4YM0A 3AKRA 2OT7A 4LA3A 5IFPA 2CGPA 2F17A 3VBHB 2XJQA 1QWRA 1URXA 1JZ7A 1Z7S3 4CA9A 5DAWA 4OZXA 4QDQA 4K8RB 3IDAA 5GLWA 5LY1A 2WRAA 4QXBA 4AXOA 1XNAA 3GCWA 2O8OA 3NKTA 4S2FA 4Y33A 2Y60A 4K20A 3ZYRA 5CISA 5A3OA 1YI7A 2B46X 2UWCA 2ZGSA 3ZFFC 3UKVA 4EN7B 2X05A 4CEYC 1Q8QA 1QH6A 5LK5A 4XCBA 4AVCA 1S0DA 1O8PA 2EIBA 1RUJ2 4XQDA 1HB2A 1H6XA 4HT1T 2VMDA 4XYXA 4EV0A 4YGCA 1OI6A 3ON7A 1WCSA 2CSGA 2ZGTA 1A78A 3BOPA 4CDQC 2FDFA 3B5LB 5L7OB 4MXWB 3ZFEC 3W5NA 4N90A 4BXFA 2NM1A 1BXHA 5EPAA 1O8SA 2XQXA 2GMEA 1W05A 5FYUA 5B4XA 2RDRA 2X29A 2VCBA 4ISQA 4ORFA 2VR4A 4AW7A 4I01A 2NMNA 3T4HB 5KHJA 1KD7A 1DCSA 1HQNA 4YZ5A 4RQPB 5FZKA 1ZBE2 3JQWA 1REEA 3M4FA 1WD4A 3M70A 1ACCA 1ZZCA 4FXKB 3VD3A 1ZBE3 2O0OA 5LRSA 4N7IA 5A6YA 2FDKA 4OMCA 5L7OA 1BK1A 5FMOL 4B4PA 4BCUA 3VHNA 1O4ZA 1CPNA 3Q8BA 4R9AA 4S2HA 4WM8A 4YG6A 4PF5A 4ZPIA 3ZR5A 3S6PA 1W6PA 5T5JA 1LOGA 1QJY1 1H8TB 3N3HA 3P1IA 2WZR2 4RS5C 4E4SA 1R64A 3JD73 4Y5Z0 1RUE2 2W1QA 1W8TA 3ACLA 4GULA 4LNVA 3L2HA 3MW4A 2P6HA 2JE8A 4M3CF 5BUVA 2QQKA 4LOTA 2HWC1 3ZXKA 3H8UA 4GXLA 1PGL2 4DO0A 1DYOA 1S0FA 4QPWA 4W6XA 3I2OA 5HXMA 3VV1A 1PVC1 5LBFA 5KHHA 3THDA 1SMVA 5JIAA 5JCTA 4DINB 1JZ4A 5J37A 5FUPA 1UY4A 1IS4A 3FFZA 2E31A 2Q0AA 2JKXA 2D5FA 3PUQA 3AZXA 4IL7A 1T6BX 2JX9A 2XR4A 3AMPA 3M8LA 4R52A 5EWSA 5LBBA 3T0BA 2GN7A 4FSJA 5HCBA 4JV4A 3HT1A 4EN0A 1NQDA 4MADA 4MGKE 2B4KA 4Y3OA 2PHDA 1LEDA 1YXWA 2VQTA 4MGQA 3I59A 4FPFA 5A6XA 3UJQA 4DNYA 4B1LA 3LDKA 1HXS2 1W9FA 2BWCA 5FPLA 2NLRA 2XKOA 1AR63 3C2UA 2R071 1O59A 3WY6A 1MEC3 1RVF3 1XB9A 3DF0A 1RB8G 4XMIA 3AJZA 4LPLA 3CU7A 1C1FA 2CGNA 2VG9A 4L99A 3U1XA 5CA6A 1B35B 3I2IA 4HSJA 1OD3A 2VXRA 3APBA 5EJZB 1HB1A 1RTVA 4GB31 5F2WA 3TRSB 3WCRA 3WQBA 4QU1A 1J59A 5DG2A 3ZMNA 4NAOA 4BQ2A 1KRIA 1NA1C 1UY2A 1ZNPA 3I2DA 4AQSA 2DUQA 2BNOA 2CY6A 1GYKA 3DXTA 4PT6A 5TSWA 1VLNA 4CU9A 4YZ2A 5BYNA 3WG3A 4B4QA 3I2KA 2ZEYA 4IE6A 1GZCA 1W2NA 3VZLA 1ULFA 4AGVA 5JSPA 1VBE1 4LQRA 2WZ8A 5DAXA 1OUSA 2ZGMA 3AXEA 1V70A 5GALA 4CCJA 1Y3TA 3HD8B 3TB0A 2RJ2A 1STMA 5CFCC 4ZU5A 4DRRA 1G9CA 1DGWA 2ZKNA 1EY2A 1VP6A 4FXGB 3MIGA 2BZDA 1D4M3 1HN1A 1W9WA 2RDNA 4HVRA 3T4VA 4FBFA 3WNOA 1UXZA 4B3NA 2W1WA 4EWEA 1RUI2 1IQAA 2ZAAA 1AR73 3CJIC 3FLPA 4FPJA 4IESA 3ZDVA 1BMV2 4QKBA 2LS6A 1PO23 1LULA 4ZS2A 3R05A 1KEXA 2X8KA 4IE4A 4F7ZA 4B7EA 3AVSA 1MS8A 4BA6A 2GC1A 2VQ0A 2VM9A 3LQCA 1WZXA 1HXS1 1UKGA 3BIWE 4WZFA 5FY9A 5I0SA 3I2FA 1AXKA 1F5JA 2EAKA 4XC9A 3DKQA 1ALYA 2H0BA 2IVIB 2XWJB 3AMMA 3DCQA 3M3EA 5IVFA 4D7SA 4L2NA 1DZTA 4M4RA 3RVHA 2ZX3A 1SQ4A 3L2YA 4J6GA 1J84A 1VBC3 1G8WA 2VJXA 4FPEA 3RJRA 3R4DB 4N43A 1EV12 2JDZA 1MS1A 3ILNA 5SV5A 1S2KA 4DOUA 4FTSA 3EB7A 4FP3A 1E5RA 1UY1A 1H9WA 3WT3A 4UBGA 2E63A 1Y9GA 4Q26A 5FP7A 1FATA 3OCPA 4D0QA 2P37A 3GYDA 1MQTB 4AGGA 1QDCA 2AR6A 5FZ7A 4YVSB 3RZHA 1MEC2 1RVF2 1W6OB 2K9ZA 2V09A 2VOXA 2ZHLA 3JB8A 1W39A 4ITCA 4FFGA 1N1TA 2XUMA 5C9AB 1H30A 2HEYF 2VZRA 5EFUA 4Q4X1 4QQ2A 2ZGOA 3IBMA 3LDRA 4Q4Y3 2ES3A 4DFSA 1HRI2 1R092 1ND3A 1XC6A 1LHVA 1Q8PA 3LEGA 3C7OA 3RJ2X 5IVYA 5AVAA 5FO8B 4NJ4A 5FYYA 1COV3 3OEAA 1W6OA 3AP6A 3ZFGB 1IG0A 2XXZA 2VL4A 1WLDA 4XOGA 4OQ8A 1P8JA 1H9PA 2CWSA 2JDNA 2QZ3A 1ENRA 3I2GA 3LFMA 3V0AA 4YG0A 5L9RA 2YHJA 2KR2A 4YZ4A 3KZ4C 2A3XA 3NV3A 4QMAA 2MEV2 3QH6A 4ATEA 2DFBA 1QEXA 3DL3A 1RXGA 2JG8C 4GH4C 4UW4A 4Y20B 3USSA 5LK7B 3WNLA 4GKYA 3CHXA 1DDLA 1LEMA 4Y1YA 4IEXA 5LW9A 4ZONA 4LKDA 2LM3A 4NPRA 1NQJA 2J1TA 1GQGA 2CHHA 2GN3A 3CDZB 1BQPA 4H55A 2BRTA 4COWA 2JDMA 1AR82 1DGWX 1GOFA 3DPRA 3LKJA 3Q8AA 4JGZA 4R9BA 1OLRA 4DPNA 1JZ8A 4K6BA 3V0AB 1W8OA 4OHZA 2WQ4A 4P5HA 4IV1A 1O3SA 1J3PA 1ENQA 2ZPXA 1POV0 3PTRB 1JMUB 3KV6A 3JZVA 3LEKA 4K9SA 3GGLA 1CIYA 3ZXLA 4YVWA 4BK4A 2HWB1 4CEWC 1PMIA 5DXDA 5FZ9A 2HWC3 5F6LB 5FY5A 3VBRC 5JWPA 3OGRA 5J7MA 3BIEA 2YYOA 4OYUA 2QQIA 3L9JT 4V1PA 2OUHA 2R49A 1RC6A 3LWCA 1RUOA 1UZVA 3V56A 3ZFEB 2JB4A 1JU3A 4HXCA 5BNNA 1FMD3 4LUKA 2HWD1 3NNFA 3ME2A 2IXCA 4YVWB 4DRVA 1F5FA 3SH4A 1RHI2 1FYUA 4IGQA 2HLEA 2ZXQA 4Q0VA 4YLZA 2ZACA 4O7XA 1S2BA 1OSGA 3ZXEA 1GSLA 2NN8A 2OKXA 5F3IA 4LBNA 2ERFA 2R072 3GXUA 2VW2A 3ZOIA 4NE9A 2YU2A 4BWOA 2Y64A 5ABJC 4OHWA 2VO5A 4TWTA 2C9KA 4LOSA 2E7TA 5FCCA 1ZA4A 2B9UA 3IPVA 1QOTA 1D4M2 4KBZA 2JB8A 1JYNA 4W4ZA 4SBVA 4FTBA 4RS5B 5BV6A 4GJYA 4GIQA 2Q8DA 1WW4A 4LTAA 5JZGC 1S4CA 1YQCA 3GNEA 3EO6A 1YCIA 1UU6A 2FMYA 2VZQA 3FUOA 2YDEA 2ZHKA 2R042 4JX0A 3W58A 3PUAA 5C3RA 3D3AA 4K3UA 4P08A 3MDPA 5CU1A 5FQ0A 2ET7A 2HYKA 2OQ6A 2ARCA 4LBMA 2X5IC 3WF4A 5JXHA 4C91A 4E8CA 2FDIA 2GAUA 2JDKA 2QQWA 5FBZA 5GLUA 3SITA 4MGSA 1VALA 1VJ2A 4HONA 3ZO0B 1EV13 4NN0A 3SH3A 3WNMA 4UYBA 1AYM1 3DV8A 2OPKA 4EN8B 4CDXA 2AYHA 2XJSA 1AR93 1DQ2A 1HXS3 2O1QA 2CNAA 3B69A 5FQ0B 2QQVA 1AR92 1W03A 5FIXA 3VZKA 3V65A 4ZKTB 3HN1A 1CAUB 2A75A 3IDBB 2O8QA 2VOWA 2YU1A 2Y6HA 3WF0A 3ZSJA 4CPBD 3WP4A 4JVAA 1EYBA 2H6CA 1Y43B 1LU1A 2YPDA 3LGRA 4UFLA 3UJOA 1AXZA 1CD3G 1HRI3 1NE6A 1ZBE1 2VZTA 3LSDA 4AOCA 4URAA 4HVOA 2P3YA 3LOBA 4LBKA 5FLHA 1I9RA 2ZAHA 4I2OA 1OHFA 4OI2A 5FXZA 3RZLA 4P00B 2AGSA 1UYPA 1AL21 1PVC3 1DYKA 2IFWA 3Q8FA 3ZYPA 5A3LA 4NHYA 3I3EA 1UCXA 2WYSA 1PM7A 5FZ4A 3VDDC 4CU7A 4META 1ULOA 5IK8A 4MGIE 1W2AX 2WNUB 2Y0OA 4FPLA 3WLUA 4EYUA 5HI0A 1I5PA 5CFCB 4MHUA 2WWJA 1OURA 4BQXA 4JRAA 5D8AC 5C3SA 2OYZA 4GMP3 3MPBA 2P1BA 4OUEA 4CP2A 3CJIB 5A7WB 5BNNB 4BXSV 1BVVA 5FZCA 1BKZA 1HB4A 2PHXA 4BM8A 3G7DA 4JTOA 5CKQA 4YW7A 4RGGA 1SHWB 2H6BA 1X50A 1VBB1 3FWEA 5DAPA 2BNMA 3OBZA 4WVMA 5GZGA 2YBKA 5J96B 3ALQA 4QWNA 2YMZA 5IVBA 3HBKA 1Z78A 4BB3A 1SLCA 4A3ZA 3OGJA 3OUHA 5JDBA 5C8CB 2WFPA 1CJPA 1H8TA 3W5MA 3PJYA 3OG2A 2B7YA 1JI6A 4AHYA 4A7ZA 2Y33A 5EIYB 4Q0SA 2B5HA 3EXUA 1U12A 2RDSA 1YIPA 2CL2A 1VMFA 1RUF1 1BBT1 1PGL1 3F2ZA 1JH5A 3PL0A 2VQAA 5GZEA 1KQRA 3JBG3 4FPKA 1HRV1 2WFF1 2WT0A 1QU0A 2DWRA 1GICA 3WSOA 1GBGA 1NCQA 3ES1A 4O9GA 1W9SA 4M3CE 3M7AA 5I8TA 1SDWA 5FR3A 3RZGA 3J8F2 1OH4A 1RUG3 1PGW1 2J1UA 2JDYA 4AI9A 3J8F3 1AXYA 3LD8A 5BXXA 5CAZA 2J22A 4RR3A 1KFUL 3WEZA 4L8QA 1RUD2 2J1VA 1VAMA 2W68A 3MV01 1HKDA 4IEPA 4PHZA 4XFGA 3VBUB 1PO12 2XBO2 4NMIA 4EWAA 1WMFA 1SFNA 4M0HA 4COUA 5L19A 1K42A 2ZX0A 3E97A 5BY5A 3JCIA 5C71A 4JDNA 1WMDA 5JMOA 3AZYA 3U37A 1LENA 3WZ1A 4IV3B 3TYJA 3WQ7A 3NRUA 5JXIA 4FPCA 3VZNA 3LPGA 2B8MA 2RG4A 2Z42A 4YWAA 1J3RA 2JG9B 2WJSA 4SLIA 4AEDB 4ATFA 4XF0A 3MI8A 3Q8CA 3ZIXA 4YYOA 4YG3A 2BDRA 1PIV3 5CB7A 1TQ5A 1CR7A 2FD8A 4WM8B 5EP9A 3SKVA 4COZA 2ZX1A 4CDWB 3RYPA 2ZA9A 1IGOA 5FZOA 4ZU7A 4PBPA 3OF1A 3AMHA 3LFIA 4RQPC 1AR83 4XF4A 1EAH1 3LEIA 4NPLA 4BYYA 1F31A 1TME3 1U5XA 1BJQA 3EHKA 2VTFA 3AP7A 4HG6B 4X8NA 4Q4Y1 5JXGA 1W8UA 1FT9A 3U10A 2PA7A 4ZS3A 4M0NA 2DUPA 2HYXA 3ILRA 4Z82A 1NCRA 3U07A 1JYIA 1BCXA 1LGBA 5KXBA 2WR9A 2XGXA 4RD7A 3VBOB 4MG2A 5FLIA 2GNBA 4QPIC 2LROA 2IWGB 3K46A 3H8OA 2ET1A 2LALA 5L36A 3DEMA 3I2HA 2RHPA 4P5YA 4U2AA 2R061 1FI2A 1VMJA 1KFXL 5FPZA 5L9VA 2ZGRA 1C8M2 2YB7A 3TN91 5LWBA 1RGSA 3FLRA 3RMXA 2J1RA 1O3RA 2RS11 2ZTNA 1QJU3 3VHOA 1QJX2 2XJVA 1QGLA 4M3CB 3AP9A 2WO7A 5A80A 2RS33 1RUD3 3CF6E 3OOXA 1AYM3 1POQA 4Q4Y2 3RNSA 2VVDA 3RGBA 4NIHA 4I0AA 2YBSA 2OXBA 2WS92 5IT6A 2VMHA 4R8HA 2VZ1A 4F83A 1OLQA 2D6LX 4UW6A 4Q4W3 3QLQA 1OQEA 1DGRN 3B01A 2Y6JA 1NZIA 1PX4A 4QKNA 3S0MA 3I2JA 5C9AA 4GQ7A 1PZ7A 3KGLA 1N1YA 3PNAA 2XQRA 4HVQA 5C4WB 4LHNA 1L7QA 2ZEZA 1REDA 3T2QA 4CEWA 2NP0A 5CKNA 2WN3A 5ACA2 1GMMA 1W6NA 5IK4A 1NA1A 4FFIA 4DS0A 2VOVA 2RM23 4IV1C 2Q1FA 1WMXA 3OY8B 2ILMA 3H42B 4LR4A 4S2GA 1GNHA 2HJIA 1LTEA 3KB5A 4PCRA 2HWE2 3RWNA 4A4AA 1NAEA 1G86A 3JD71 1QXRA 5FY4A 1PMHX 2WC2A 4WZCA 3SCGA 5A6ZA 5C4WA 1MVQA 3I3DA 4DIQA 2C9AA 2VPVA 2X5IB 4G4FA 4AGRA 4CCMA 2D6KA 2HH9A 3B3QE 1A34A 3AZWA 4AF9A 4LHLA 1UPIA 4HPKA 1C5IA 2BGCA 4MSVA 5KR7A 1OLME 1W3XA 2MHFA 1SFPA 2TEPA 4MO3M 4KBBA 1CAWB 3UKNA 3W20A 4QPGB 4HZFA 5HBAA 5A7NA 5EHDA 4N43B 1Y7BA 2E51A 3MEPA 2UYBA 3WG1A 4CVUA 3CJXA 1F8VA 2WIIB 5FAXA 1WW7A 5J3UA 4AVTA 1RUG2 4A44A 1R1A2 2VAUA 2XLFA 3AX4A 4LK7A 1YUDA 4LITA 1BEV3 1C1LA 4IEWA 4CZSA 3TBDA 5BNOA 5JVVA 4CDQA 1CONA 1RUC3 3EBRA 2CDOA 2W1UA 4M00A 3WW3A 1B09A 4P9WA 4Y22B 2JIJA 3ZR6A 4CEYB 5EZWA 1RINA 4MLOA 4P9JA 3WQ0A 4XFFA 1YLLA 3FHQA 1YYNA 4MGZE 4ARXA 1Z0HA 2PAKA 1XE0A 3WINE 4MH0E 2HWB2 5CEHA 2OS2A 2C1FA 2ZABA 3RS6A 4IEZA 4CXXA 2EXIA 2BFUS 1CAVA 2I74A 1H1IA 4NRPA 4PF1A 1UD1A 4CP9A 5HCAA 1PNFA 2BQPA 4PDWA 1WCUA 2JEMA 2QQJA 3T0DA 1S0CA 5EYXA 4F8AA 2P4EA 1UW8A 3KWVA 4Q0QA 4HBNA 1WLWA 3MUZ1 1HX6A 2WINB 3ZLIA 1VRH2 4ZZ5A 2BGOA 4C8DA 1J58A 2DURA 5FYCA 4NIIA 3V0BB 1YEWA 3GHNA 5FZHA 4AEJA 4G9SB 3VLBB 1NXD1 5FZAA 2G19A 2Y6FA 3M3QA 2EALA 2F6BA 1VBE3 5F1RA 1SLLA 1V9U2 1EV11 5C8CC 2OPWA 4CRQA 3J7NA 4A7KA 2XJUA 1XNTA 1ZZ8A 5ANQA 1NLQA 5FREA 3MYXA 3CKHA 4JGZB 4BK5A 1JYVA 1NUKA 1O4TA 3ZFFA 2UURA 2TNFA 3CQOA 2VQUA 3V0BA 1YI9A 4D8MA 2MNGA 3NJZA 1AR62 2ZS6B 2BJSA 2Z2SB 4I0WB 1FPN3 2FZ1A 2RMU2 3POBA 5K4LA 2WAOA 5FZBA 3SEEA 3T0AA 3TAYA 4HKLA 1LGCA 2IXHA 4LO5B 2WA4A 4LIUA 3R4SA 1AZDA 4IEYA 2GH2A 2UWAA 4JGYA 1QJU2 2L9LA 4E8DA 1TNFA 3K4ZA 1R1A3 3E5QA 3T3YA 4NVPA 1RUI1 2A1XA 4URTA 4C1XA 1WD3A 1A3KA 2GNTA 2A5ZA 3NV2A 1XE7A 5FKBA 4IEUA 4BQ3A 2VXJA 1JZ3A 1XJAA 2GP3A 3IAQA 1DQ6A 4AE2A 3DUIA 2P17A 1JYWA 3BU0A 3E5XA 3VKNA 1SBFA 5F5AA 4AFCA 4NIAA 3ZYJB 4GJZA 1H6YA 4QD2A 3ZN6B 2UU8A 1UL9A 3KT7A 5IVVA 2JIGA 4OFGA 4XHBA 5AC93 1K12A 1GNYA 2D6NA 2YXSA 4ISRA 2JE9A 1YC61 2R062 2VC9A 2IXLA 1VPHA 3JXSA 4OLLA 4K1ZA 2FCUA 3ORJA 3CNAA 5A70A 1OF3A 5FZ8A 4LO8A 3S7IA 2JECA 5EXOA 2E32A 4YM3A 3USUA 1FNZA 2VNRA 5GZDA 3HR9A 2QE3A 5I0RA 4JDMA 2NZ9A 2B39A 1MQTC 1C8NA 5FFOC 3OEBA 4XFAA 4U36A 4D7YA 3LIHA 3TEYA 1BBT3 4RGKA 4X6QB 5JIUA 2QCSB 2WNEA 3VB9A 4FFFA 4X6RB 2IXJA 2SLIA 5LATA 3N36A 4JQRA 3U11A 3WHUA 4K40A 5A3WA 4NPMA 2AEYA 3FN9A 1GFF2 1GNZA 2DTYA 4LKEA 2ZMKA 2VUJA 5FWJA 2HWC2 2VNOA 3ACGA 1YQ2A 2XONA 5A7SA 2R0FA 4OI0A 5F8PA 1DG6A 3PIGA 4JC1A 4QPIB 1N47A 1PX3A 4NWVA 5C8CA 1ODNA 4AI8A 2DU1A 3FHAA 1OLMA 4R9CA 4CXYA 3ZFGC 4R4XA 1FV3A 1LOAA 4TLFA 4UFKA 3ETPA 2EIGA 4AI3A 4W65A 2D44A 3ZSMA 4CCOA 1J3QA 1QJFA 2WZR1 3VBSC 3WNKA 1DYPA 1DGRA 2ZX4A 4M4PA 1SDDB 5DDJ2 3GCXA 5FLJA 1RUC2 1CQ9A 1ST8A 1F4AA 2P3KA 4A3XA 1AR81 4LKFA 1YHFA 5B4NA 1W0PA 3OBTA 4NRMA 1XE8A 2ZEWA 1PGW2 2H0VA 1YFYA 1F15A 5LB6A 4CDUC 3OYWB 4OZOA 4QGMA 4ASMB 1TE1B 3A0KA 1UZ0A 1EP0A 2PYTA 1OPMA 3KQRA 4PLOA 1EPZA 1UYXA 5E6HA 2RJLA 3N7LA 1SFYA 1JS9A 3JD72 3ACFA 4Q0UA 1CZSA 4WBBA 2W47A 4BQWA 5HCHA 3PURA 3H8XA 3VBUA 3Q9OA 4QQLA 2Z79A 3VBHC 1I6XA 2B45X 2VGDA 5L73A 1VIWB 4IV1B 1FMD1 4CUAA 2RJKA 1UO9A 1Z7S2 2CTVA 2UYAA 2GNDA 3ECQA 1LODA 1I3HA 3POYA 4HMZA 4MYEA 1REFA 3GJAA 4J1WA 5I0UA 4A7YA 5B2GB 3FBYA 3LOIA 5ABJB 3RYRA 2HWF3 3W59A 1BVP1 1V9U3 2JG9A 2XMLA 3MFAA 1A8DA 4XUOA 5FUNA 4UF0B 3NNLA 1VBB2 1WCKA 2FDGA 1VBC2 4XF9A 4Q1RA 1IS5A 1ASJ2 1DQ5A 2W92A 3O1UA 4GMP0 4QX0A 4JRLA 5DG1A 1RUJ3 3H1WA 2PLV3 3LSEA 5FZOB 1H4HA 3P3NA 3AXDA 1UYZA 3B94A 4OCTA 5FYBA 2R7EB 3TN93 1K3IA 3AB0A 1NOVA 1E57A 1X33A 2GMMA 3S30A 4Y4RA 4FFHA 2WWUA 4NR1A 2Y6GA 1GP5A 1NCRB 2TBVA 4D6SA 4MOAA 2IXKA 5FPVA 4QX1A 3N9PA 4BIOA 2XJRA 1AL22 3ZSEA 3K77A 3R4UA 3UETA 5FY7A 3ZXJA 4DUVA 3WF1A 1W2OA 5FYMA 2Q5TA 2V5DA 5F39A 3BALA 1K5MA 3WVJA 1UZZA 4ARYA 1WW5A 4LBQD 1S0EA 5LA1A 3K3OA 1KJRA 3UYJA 4KU7A 1AR91 1D7PM 1PK6A 3PU3A 4XQ4A 5GLVA 4Y5SA 1PMJX 3IDEA 4EZHA 1SLAA 1OBNA 2GU9A 5JOZA 5LY2A 3AL6A 4QDSA 4JHTA 2RV9A 4P14A 4IEOA 3J7MA 2YG0A 4OI4A 5DDJ1 4CDUA 4BZ4A 2WA3A 1ZRFA 2GMPA 2V73A 2A6YA 3C7HA 5BNQA 2W39A 1O91A 3NAPB 1O3TA 1LHNA 2FQPA 1ONAA 5A3TA 4E4DX 1C57A 1QXJA 2JKBA 5CVRA 5GZFA 1ZVFA 1JYCA 1V6OA 3KQ4B 4ES9A 3I97A 1UPSA 2Y26A 3MGUA 1KGYA 2WNUC 3UGFA 3WP6A 1SZBA 4AZZA 5FYTA 1VBE2 2BFUL 1RUH1 3I8TA 1VBB3 1FOD2 4K21A 4MGYE 5A32B 1R082 3VHPA 5FZ6A 4G3YC 4PQ9A 1VBA3 2XJTA 5HV0A 1XYOA 3B9CA 3NAPA 4OHYA 1OH3A 4JHZA 1W90A 3U75A 5DMYA 3S5QA 1KS5A 4AEDC 4WVVA 4TXWA 4H7LA 3HOBA 3U4XA 2CV6A 3PUHA 5K9YA 3T2OA 2E7QA 5A32A 3RZKA 5IK7A 1R1ZA 4YARA 5F5IA 2JD9A 1QJX3 3HBZA 1MQTA 1C8M1 2RE9A 4AQ2A 4CP1A 3LZZA 3OPZA 5D8AB 2CYFA 2W5FA 4LUMA 1UOJA 1KITA 3ZKYA 1W6PB 3TEXA 2OX0A 2J42A 4KH9A 2WWSA 4UW5A 1V0AA 2WLPA 3SISA 2P34A 3CLPA 1G9AA 1GLHA 3AP4A 1MVEA 5CG8A 2Y0IA 1X7NA 3GBWA 1W9YA 1LESA 3P6BA 1HRV3 1CJDA 1IZ3A 1D4VB 2WFF3 1MZ5A 3AZZA 1W06A 3I3BA 1F9KA 1ZBA2 5T52A 1VB4A 2BBVA 1ZBA3 3EJKA 5A33A 1N1VA 5KHGA 2WSVA 1RUE1 2E26A 2LTNA 5KC6A 3M1HA 2MPFA 3AK0A 4OVEA 1JU4A 4COYA 4CEWB 1HV1A 4F3JA 1S0JA 4PIYA 2R043 5FYVA 3PVNA 3BN6A 4GWJA 4YSFA 4MXWA 1VRH3 3FLTA 5I0TA 3KVAA 1LCLA 2QKDA 2Y8KA 3VBFC 3E5UA 1MS5A 2G4IA 2VUAA 1NCQB 5C5TA 1KDMA 1RL3A 5CADA 1R083 4HK9A 5A7QA 4A6SA 4YZ1A 4Z1VA 2JDPA 4R9DA 1FAYA 5KBFA 4P9LA 1LOFC 2P2KA 2KD7A 3AKSA 4H2AA 4YFWA 4MXVA 4XF1A 3WV6A 2PHWA 2ETEA 3QBQA 1WW6A 1HV0A 1SEFA 3HNMA 4XABA 4QXCA 4CDWC 2DF7A 5IAXA 5IVJA 3NQHA 3WD5A 2J1EA 4YVSC 4NHMA 4QX2A 4Y1ZA 3ELNA 1J1LA 3ATGA 1ND2B 3DPRC 4FPHA 1DF0A 2IUWA 1PVXA 4AG4A 1UF2C 2HKXA 2P3JA 5FZIA 5LZ6A 1XYNA 1CX1A 1YFWA 4QB6A 4NAMA 3KV4A 5KXEA 2JG8A 4Q8KA 1AYN2 4LLOA 3ZMOA 2VU9A 4JTNA 4DQAA 5FJKA 3VBOC 5FYZA 3BUCA 4EN9B 2DTWA 3B02A 3MLJA 4L97A 2RS13 5IW0A 1TMF3 4YW2A 2YV8A 4ASKA 3ZPOA 1QQP3 4Q4W2 4AFMA 3VD5A 4S2DA 3ACIA 1K5MC 3N7MA 4JZRA 4QKDA 3VDDA 1POV3 4KWKA 5FZ1A 1W8HA 4QPGC 3AYEA 3E1F1 3KT4A 2JG8B 4KGGA 4JQTA 5FZFA 2R063 4XJAA 3OGGA 1AR72 3ST7A 2JDHA 2PMWB 2EF6A 1HN0A 3J7LA 1QDOA 2AENA 1FNYA 4HN1A 4JDOA 1N1SA 2RM21 3GHMA 2HWF2 3LB9A 4O65A 3SHRA 3LA3A 5E8AA 4CP9B 5KWRA 2RDQA 3ACHA 4PDWB 1W8WA 4RHV3 3D0SA 4IDZA 2XLAA 3OJBA 4ES8A 5FP9A 1VBA2 1Q43A 1QF3A 5DQ0A 1JODA 1HIXA 3MW3A 2I2SA 2BNNA 2ZHMA 5IK5A 2DCKA 1UOFA 1LOCA 3LDBA 3NSTA 3NV4A 3WCSA 4D3WA 1TEIA 1W04A 5FYIA 5C3OA 2G9ZA 1AF9A 5JPNB 3USUB 2JDAA 2VW1A 2BWAA 3HQUA 5GKAC 4BH9A 4N9HA 3I49A 2Q8CA 2Z5WA 4CU8A 2JG9C 2BOJA 2WKKA 3K48A 5HXVA 2VNVA 5A3UA 4E4ZA 1AR61 4N8MA 4LO4B 4UW3A 5IATA 5FZ0A 3IWZA 3T2TA 2BERA 4BPZA 2CWMA 2R30A 5F3CA 3HPNA 1RMU2 1WLTA 2YY1A 4P9YA 4I3PA 1X9PA 4C1WA 2YFUA 5C4WC 3ZFGA 3JB4C 1JTZX 5KHIA 1G9BA 3B9IA 4LLFA 4N9IA 2XDVA 1W6QB 4XILA 4BQ4A 2ZBJA 2A6WA 1BHGA 1XNBA 2P3IA 5CFCA 3ILFA 5FZLA 1LKNA 4WVZA 2TUNA 3KS7A 3K4AA 3OY8A 2BTVC 4YGEA 4GB32 4YM1A 2R073 1COV2 1DHKB 2JDUA 1VE0A 2QTWB 2G1MA 3SMHA 3IMNA 2Y6KA 3VBRA 3OBRA 3IIAA 2ZGQA 4JCKA 1DLCA 1DQ0A 2XG3A 1LB2A 1QY4A 2PQQA 4DEVA 4XVHA 5JLVA 5JZGB 2WO3A 4P9GA 4WM7C 4XUQA 1GANA 1XBFA 2EXKA 2VCCA 5F6KA 1PO22 4I3GA 2HWE3 1C4RA 2WNUA 4XFBA 5LA9A 5I91A 2HWF1 3H3UA 2E9QA 5K0UA 3B7MA 5I93A 3DKWA 3HIFA 1AX2A 5APAA 4HLTA 3E6DA 1HLCA 4N53A 3DXUA 4MUVA 1BEV1 3CJIA 3BKZA 2HWD2 5K0UC 4KQ7A 1YQ6A 4AHZA 4QXHA 4D69A 3AMQA 5FXXA 2B9VA 1RUJ1 1UKRA 1OKQA 2WL1A 3DYOA 3N9NA 4GH4A 4LE4A 5BNPB 3AKTA 2VZOA 4IETA 4LO6B 4TSVA 1SCRA 3FL7A 2EVXA 1RIRA 4W50A 2DCZA 5SV8A 2R1BA 2DVBA 4HKOA 3H50A 2XHNA 3H0OA 1WA4A 5K8SA 5E1RA 4BHPA 1OQ1A 3OTFA 1EPWA 3VZOA 3U14A 2OW4A 4IEVA 3VL9A 5DAVA 5G04L 2ENRA 3O1RA 1TVGA 2R16A 2RVAA 3DN7A 2PELA 4YGDA 1GQHA 5FZGA 5FZDA 3TEZA 5FMDA 4MVTA 1ZRCA 1FMD2 1LHUA 2ZCWA 4Q5OA 5C70A 1LHOA 1VR3A 4AQ6A 1SLBA 4EROA 3RSJA 2VECA 3N9MA 5LCWL 2WO2A 4CDXB 4DY3A 3AMNA 3VL8A 1H8VA 3FX3A 1XU2A 4WM8C 1UN1A 3BGAA 3AP5A 2MEV1 3M3OA 5JSOA 4BISA 4CUBA 1OUXA 2FCTA 3GF6A 4Y4YA 4AAPA 2FDJA 2I45A 3A4UA 4XXAA 3UL2A 1QJY3 4Q8LA 3FE5A 3PLQA 3PMEA 4CSWA 2NMOA 1MS9A 1KJLA 1G9FA 1RJ7A 2D6PA 3OUIA 4DUWA 3T30A 4QQPA 1DZRA 3A23A 3GJBA 1K45A 2QQUA 4NHXA 4NIDA 2ATFA 2YGLA 4Q2FA 4OI1A 1IQDC 2Y6LA 3H1YA 4EJRA 2NQYA 1U5YA 2A6XA 4Q1PA 3K75B 4BMBA 4E2QA 3H3ZA 4Q4X2 4HL0A 1RUH2 3JBG1 1HDKA 3ZFEA 3ASIA 1NLRA 1OFNA 3PVBB 2VVEA 3T09A 3ZIWA 2UY9A 2DVDA 5FYSA 1LOBA 3VBHA 3ITQA 4IXLA 4CDUB 4CCNA 1V6KA 1KXGA 1QJEA 2BPA2 4HKWA 2W94A 1HJFA 4GKXA 1GWKA 2OVUA 4DB5A 1W0OA 3NAPC 4KG8A 1CZTA 4XFCA 2Q1ZB 1ULGA 1XQNA 4DUXA 4CDWA 5IHRA 1OVSA 3CIHA 3J7HA 2Q30A 1F35A 2FZ2A 1D2QA 1MPXA 2A7AA 2ZMNA 3VKOA 2QVSB 5BNOC 1BYHA 3D82A 5FP3A 1Y9MA 4EQVA 4LULA 4D6QA 1G9DA 1S0IA 4QM8A 1C8M3 4QAWA 4ZXKA 2DVGA 4FQZA 1J83A 1F4HA 1XSRA 5F2SA 3VBOA 1H1MA 1OA2A 2ZJCA 3HQRA 4OHVA 3U78A 4BQYA 1PHMA 3RZJA 4HANA 4UWDA 1YJLA 3M2MA 3ZN4A 4B1MA 3VBSA 4V2VA 1W6MA 5E89A 4UXAA 4IEQA 1OOPB 5IWFA 1JXNA 4CCKA 2W1SA 2C24A 1NLSA 3MLLA 1NYWA 2IZWA 3GZEA 3IDCB 1A8MA 2VCAA 3NL1A 1PK6C 2D5HA 2Y38A 4CUGA 2XH6A 2Z69A 2VZSA 4AAXA 1AJOA 1S55A 1SPPA 1W28A 1R081 2W91A 4DXZA 4DEQA 2A73B 2ZKLA 4LKSA 1LECA 2X10A 4AI1A 3VBSB 4QGLA 1K5MB 4AFDA 4QKFA 1OOPA 4H14A 1PO21 3ZVXA 1O3QA 1GR3A 1JZ5A 1U5IA 5JI7A 1VBD3 4PLMA 5A1FA 5H9SA 4E27A 5FPUA 3NVCA 3O1SA 4W8JA 1QOSA 3JQXA 2IFRA 1JYXA 4NUBA 1SPPB 1YQ8A 1UIKA 1E5SA 1ZX5A 2C4XA 3A22A 4LBLA 4DMIA 5JR7B 2R6QA 3FHIB 1ZYBA 2QDRA 5FRAA 1H2MA 1ZZ7A 4J25A 3WUCA 3ZXFA 1RHI1 5F3GA 1AL0G 1OA3A 2VUCA 1JZ6A 1S0GA 3VZMA 1DP0A 4XFHA 2WABA 1IKPA 4XE9A 2J1SA 2Y34A 4JKLA 2C6SA 2WSUA 4O61A 4XACA 2Q8EA 4CCLA 2RS52 2LUWA 3WDXA 2EICA 1RMU1 3BOWA 1V6MA 4KL1A 1GZ9A 2XLGA 4QU2A 1LOFA 4QX3A 4FT8A 4RFRB 2N7GA 2YBPA 3VN4A 3BTXA 2V72A 2EA7A 2Q1MA 1AVBA 1FPN2 1QIQA 2RMU3 4GA9A 4GALA 1ODMA 1VMHA 2ADEA 2VZ3A 4UI9L 3TN92 3WW4A 5L7OC 1SACA 4H3WA 2D3PA 4RFT0 5FJHA 4CYDA 3O1MA 1XNCA 2QQMA 2VTXA 4PI0A 4YW4A 3MF6A 1YQ5A 1J1TA 2AC1A 2WNVB 3PU8A 4IV3A 5FPAA 4FO9A 5KXCA 1CIWA 1WUVA 2G9FA 2VOKA 3HMYA 5J36A 4XF3A 4L9BA 2GDFA 2PHUA 2RS32 3C7GA 3POIA 4XURA 4MGTA 1JBCA 1KDKA 3GZUC 4LORA 3WXPA 3T1LA 2Z4FA 4EN6B 1M4WA 1SLTA 2JWPA 3AYAA 4LJHA 4RSUA 5IVEA 3IM0A 2EIDA 2NPIA 3IZOA 5C3QA 1SBDA 1GZTA 2CAVA 2W3JA 1H1AA 3GDBA 1UX7A 2D97A 3MLKA 4GZ9A 3SC7X 4E9KA 4XJWA 1ASJ1 3SCHA 3WR0A 3ZX7A 3GZAA 1CZVA 3I4IA 1ZRRA 2QJVA 1UY0A 2FBEA 3OD0A 5FMBA 5A3NA 3VZJA 3K51A 4CEYA 4N53C 2XUEA 5A7OA 3ZN5A 4QT6A 4GMP1 3BODA 5FWEA 3E6CC 1LU2A 3RRDA 5IFTA 5I0DA 2XL9A 3UESA 1LGNA 1UY3A 5FY0A 4HOOA 4UBHA 3O1VA 5A33B 2VMIA 4YW3A 2PAEA 2WZEA 2XVGA 1R091 3WX5A 4QB1A 1ULCA 3S5AA 3LF7A 3MV11 1F2NA 4KWUA 3UNPA 4A41A 3LAGA 1QKQA
chains in the Genus database with same CATH topology
1NCRC 5H9RA 5DZGA 5CFDC 2ZX2A 2YC0A 2EXJA 3WDVA 4J1XA 4M3CA 3RI8A 3M3CA 3O7OA 2A3YA 1CAXA 3QOPA 4RQPA 2A3WA 2AREA 4OULA 4W6YA 2PHLA 1RUC1 4TYSA 5F5QA 4PIZA 2WLQA 2VULA 4C0BA 2HWE1 4OHXA 1DGLA 3QACA 3QH7A 1NCQC 2G9GA 2ZGLA 1CPMA 2I07B 3URFA 4GB33 3N35A 4KWLA 2RR13 5AFBA 3U0ZA 5AC92 1GKBA 2BUKA 1RUG1 2YZ4A 3R6SA 3WP5A 2PTMA 1XNDA 5BPXA 5LEKA 3H7YA 1ENXA 4IERA 4Y1VA 4AFAA 4Z2WA 5ACA3 2WT1A 3PHMA 4I0BA 1QJX1 2D6MA 3KM5A 3VKFC 4Z92B 3FC0A 1YNAA 1HQLA 2JE7A 4HPKB 4AFBA 2JXAA 4K1YA 3P3PA 5J98B 1MACA 2DCJA 1V00A 1Q3EA 4BLJA 3BPZA 4QPGA 4Z8BA 1C5HA 2VMGA 2C0ZA 4Y1UA 4NHLA 4ONUA 4YM2A 2R041 3ZSKA 5KXDA 2JENA 4KU8A 1VRH1 1FOD1 4YRDA 1CAVB 4Y26A 1HW5A 4KGQA 2D93A 4C90A 3FJSA 3WDTA 4OUSA 3MZHA 1OA4A 5BNOB 3D6EA 1OMIA 1G6NA 4I09A 3MIFA 3PVEA 3E6BA 4QPYA 3RYKA 2FHRA 1TME1 4M01A 4L11A 1DU3D 4Q4V3 2DCYA 4QX5A 5DUWA 3MICA 1XU1A 3UKTA 1QJU1 3BB6A 2IC1A 1AYM2 1JN2P 1IS3A 4MX3A 1VAKA 1OOPC 5AC91 1AL23 1UX6A 1KS4A 3ZFFB 1UU5A 1PVC2 1RJ8A 3CO2A 2RMU1 1AUYA 5JPMB 3IKWA 4AVVA 4AEMA 1IPJA 2JICA 4AK3A 4YW1A 3D5OA 5JOXA 3VBFB 3GBFA 4JGYB 1C3HA 4LHKA 3FBMA 2HEVF 3PTYA 5GLTA 3GBGA 1RUD1 2QUOA 5E16A 1H0BA 3WDUA 5C33A 1POV1 3GALA 1CAWA 1DQ1A 1H2KA 4INDA 2X53S 4YGBA 4PJYA 3O0XA 1PNGA 2OIIA 3QCWA 4RL7A 4K7JA 4LT5A 5JMCA 5JZGA 3SXWA 2DCTA 4Q4W1 2FMDA 1Q8SA 4XETA 4DZGA 3WOGA 3PJQA 5DUUA 5BNNB 3M3IA 4RHV2 2D40A 3J8F1 1L3JA 4A2UA 3ZXDA 1ZZ6A 1ULDA 2WQZC 5ABJA 2VW0A 2AUYA 2PHRA 1MZEA 4E2SA 4FP2A 3ES4A 5CBLA 5D1IA 1IOAA 2DUOA 2DV9A 5AFEA 1XXNA 5A3MA 1LR5A 5LEJA 1RUF2 5DZEA 1YIFA 4XTPA 2K0GA 2NYYA 3ZDSA 1CESA 2XVKA 4AEKA 1LHWA 3I7DA 1WMEA 4D7TA 1NG0A 3KLSA 4P9IA 4BQ1A 2PHFA 4RHV1 3H7JA 1NY71 1AYN1 3WW1A 4LA2A 5C8WA 1PO11 1UU4A 1EAH3 2AH2A 4GWMA 4Y1XA 1X8EA 2RR12 4WV8A 1Z7S1 3ZXGA 4XQWA 4HN0A 4XMAA 3GZTB 2XKPA 3JU9A 4YW5A 1PIV2 4RR3B 1CX4A 1ND2C 3DPRB 2QQPA 1X36A 4XPVA 1O5LA 1JHNA 1PK6B 3W9AA 4AI2A 1W2UA 1N3OA 2D98A 2ZGUA 4IQPA 3WNXA 1MS0A 4XJZA 4AQTA 1XNKA 3OYWA 1ENSA 1QXPA 1CAUA 2VH9A 2YPJA 1UAIA 2E7AA 3KCXA 3N7KA 4FOQA 4QPIA 2A71A 1YJKA 4WVMB 3RQ0A 3THPA 4P9XA 3D0JA 5FPXA 1Q8VA 1YRZA 1SLIA 2RS53 4B29A 2D6OX 5GZCA 1WGPA 3IN9A 1YFXA 2QNKA 1V6IA 5J48A 1ND3C 3RI9A 1W6QA 3H9AA 2DU0A 2KM2A 4HFSA 5I8YA 4FTEA 5T55A 1TNRA 2PAMA 2R1DA 5FOBB 4Q4V2 2D3RA 1VAVA 5BNPC 4NO4A 5FOJB 2RS31 1WBFA 1Y9QA 1X8MA 4NOTA 1IHMA 2XBO3 3VBRB 2A6ZA 3MIBA 2Q8OA 2PN5A 4XHXA 4PDWC 1UZYA 1DBNA 3FZ3A 2F4PA 3LCPA 1B35A 2K2SA 5FTTC 1FPN1 3TWIA 5EJ3A 2EXHA 2WNVA 3AZVA 1CVNA 1B35C 2Q4SA 2IXIA 5K0UB 3AKPA 3I54A 2VY0A 4I02A 1GZWB 1I5ZA 2HEWF 5I8SA 2MEV3 3AYDA 1RUI3 2RM22 4KG0A 3PMSA 4CTEA 1MS4A 1GV9A 4LBOA 2DVAA 5BNPA 3FUQA 1JOJA 3POSA 1LRHA 2BW8A 2GALA 3WG4A 1UMZA 4MV2A 1JW6A 3UV9A 3AYCA 1DLLA 3BU7A 3J9SA 1W6NB 3ZYGA 3SLIA 3VKLA 3VKMA 4MZUA 1CGPA 4QM9A 1Q8OA 2GNMA 4FAGA 1WCDJ 2BYVE 3JBG2 2YGMA 3ZYIB 2PLV2 4QQOA 2RR11 1H8TC 3UK9A 4AVAA 5JOWA 5K7PA 3T1MA 1WLCA 4LO7A 4WM7B 3N4MA 1RUF3 5T5PA 4D94A 5T54A 3DGTA 1MR5A 3CL1A 2UWBA 2VNGA 3ZXAC 3NV1A 1ND2A 2E53A 3INAA 4QGNA 3KGZA 2WS93 4DY5A 1PGSA 5JI9A 4WVWA 2QDNA 4XTMA 3PVOA 2XHKA 5T3NA 5GLZA 4FOYA 4K8FA 4CDWA 2XL7A 3VHRA 3NWKA 1ZBA1 3WW2A 4BIFA 3OD4A 4WM7A 1QHDA 4NHKA 1AR71 4O9EA 4FCAA 4XBQA 5C9AC 5ACA1 2OUJA 3KMHA 1H2NA 3J4UH 2GC0A 1D0GA 4Q0PA 2WZR3 1PZ8A 3V64A 2A6VA 3RG0A 4AHXA 3LA2A 4BMEA 1UIJA 4XZPA 2ZHNA 1VBC1 1I1EA 4Y22A 3D8CA 4Q4X3 5GM0A 2ZGKA 1NA1B 5FMOS 1FOD3 2CGOA 4Y20A 2DYCA 5T5OA 1T6GC 4B4RA 1IPKA 4CDXC 3MF9A 2GH8A 3C3VA 3MIEA 4AHWA 3WG2A 1AHSA 1U0AA 1X82A 5FO7B 2X5IA 2XJPA 5IUQA 3POWA 3KCYA 4Q4V1 4RGAA 1AJKA 1RMU3 1ZZBA 3QD6A 3WDYA 1CN1A 3NKGA 1TMF1 1N3QA 4LBJA 1FV2A 1COV1 2KXLA 3ETQA 4Q27A 1H2LA 3SH5A 1RHI3 2XPJA 5J09A 4LE3A 2PLV1 1A6CA 2UY8A 4AEDA 3KT1A 2D3SA 3ENRA 5H9PA 2V5YA 3VUOA 4TZDA 1Q5OA 3MFCA 5EV7A 2WNVC 1SCSA 2HWB3 3O12A 4FPGA 1QOOA 2EAAA 2PHTA 2OA2A 1ZM1A 5FDBA 4XEZA 3MPPG 3CEWA 3HWJA 3A0NA 5FO9B 3I59B 3WHTA 4XIOA 3KD4A 2HWD3 3D4KA 4BLIA 4CP0A 3MIDA 3ROUA 2W52A 4HSLA 2BEOA 3HT2A 3ZPYA 2QZ2A 4COVA 5KHKA 3BCWA 2R32A 4FPYA 3MW2A 1DQ4A 1FX5A 1QJZA 5D8AA 4YVSA 1VBA1 4YVWC 2W0XA 3N7JA 3TNPB 4HETA 3H1MA 1ASJ3 4FOVA 4CDQB 3KCCA 1Q56A 3FFQA 2D43A 1JUIA 3IT8A 4BOWA 3NW4A 4FPOB 2CAUA 3WDWA 1ND3B 4XJ8A 4NWWA 2XB6C 1ULEA 4BE3A 1AYN3 1ZREA 4FVVA 1YO8A 4R4ZA 2PFWA 1S0BA 1XRUA 1PO13 1R093 4FQ4A 5EYYA 5C6CA 3AJYA 1LJ7A 1V6JA 2C5DA 3R0RA 5DUXA 5DZFA 5E88A 1S1AA 1O7FA 3AFKA 3SCFA 4XFIA 4KNCA 3S7EA 2ZMLA 1QJY2 1QNYA 2SBAA 3VGIA 1QQP2 2VVFA 3WP3A 1MEC1 1RVF1 4AYUA 4LBQB 3KSCA 3AKQA 4XIKA 4XBNA 2WZPP 4XJUA 4AI0A 4XW3A 1OD5A 1PZ9A 5CFDB 3VBFA 2XVLA 3HQXA 2W08A 5H9QA 3B93A 3SNMA 2WT2A 3RMYA 4JAAA 5CG9A 1V9U1 4PLNA 2QFEA 4AVBA 3TNQA 1DIWA 1H4GA 1YWKA 3VBUC 1VB2A 1JUHA 1QH7A 4XBLA 3WUDA 4LBQA 1BBT2 2OZ6A 2XBO1 1CAXB 2RS51 1AX1A 4H7MA 3RPQA 1QNWA 1D0HA 3MIHA 5CFDA 2ZOEB 2AZ5A 3AM2A 5JAXA 4OUMA 4B7KA 5F9TA 1BZWA 1HRI1 3LA7A 2YUEA 1IKQA 5JSRA 1NY72 4N53B 4FAHA 1OPOA 1LOEA 2ZZJA 3VDDB 3RZZA 2D7FA 3O5SA 1WBLA 1OQDA 5DDJ3 2ARBA 4XXPA 4RA0A 1OFSA 2A70A 4YFZA 4XJ9A 4L92A 3O0VA 2GZWA 1G7YA 5BNNC 3JUUA 4AVSA 1BEV2 3THTA 4GWNA 1YFUA 1W6MB 1R1A1 2DVFA 1HQWA 3G6JB 3RDIA 4YZ3A 1V6LA 1NXMA 1O4YA 4YNIA 2YROA 1C28A 1VBD2 4AWDA 1AX0A 2GC3A 5CNAA 3B00A 1RITA 2R0HA 3HAGA 5HCFA 1ZRDA 1BMV1 2B42B 2E6VA 4QQHA 1QQP1 2ZGNA 1RUH3 1N3PA 1GZWA 2ARXA 5CIRA 4E2GA 5AVPA 1TME2 1DZQA 2OZJA 4HK8A 1APNA 1O5UA 2WS91 3J26N 5DUVA 4C0HA 1NZCA 1IS6A 4ASLA 2BVBA 2XWBB 4Q29A 4XDQA 1ZZ9A 3O0WA 4QXKA 1D2SA 3TOJA 1RUNA 4RR3C 1MZFA 5T5LA 5T50A 1PIV1 4IV3C 2JJ6A 4PBOA 2KA3A 1M06G 4JGZC 4JGYC 4I30A 1D4M1 4LEJA 1V6NA 3ZSLA 3IPVB 4FOWA 2GC2A 1U5ZA 5GJ6A 1NE4A 3ZN6A 1MS3A 4W6WA 1MZ6A 1SBEA 2GSYA 3BTAA 3NO8A 4QHBA 4RS5A 4B8EA 5LRRA 1TMF2 2ZZQA 1QMJA 4Z07A 3EQEA 2RS12 1VBD1 1DFQA 3WQ1A 1EAH2 1FXZA 1XYPA 4X8PA 5JOYA 4Y24A 2BVVA 4N7UA 3WD5A 1HRV2 2DFCA 2WFF2 3O14A 2JD4A 4DRRA 3X29B 3AFGA 4EWDA 4PIXA 2ZGPA 4KWJA 4GH4B 3FMGA 4N43C 1RUE3 4YM0A 3AKRA 4LA3A 2CGPA 3VBHB 2XJQA 1QWRA 1URXA 1Z7S3 4OZXA 5GLWA 4AXOA 2O8OA 3NKTA 4S2FA 4K20A 3ZYRA 1YI7A 2B46X 2UWCA 2ZGSA 3ZFFC 3UKVA 4EN7B 4CEYC 1Q8QA 1QH6A 5LK5A 4AVCA 1S0DA 1RUJ2 4XQDA 4HT1T 4XYXA 4EV0A 4YGCA 1OI6A 1WCSA 2ZGTA 4CDQC 1A78A 3BOPA 3B5LB 5L7OB 4MXWB 3ZFEC 4N90A 2NM1A 1BXHA 2GMEA 2X29A 4ISQA 4ORFA 4AW7A 4I01A 2NMNA 5KHJA 1KD7A 1HQNA 4YZ5A 4RQPB 1ZBE2 3JQWA 1REEA 3M4FA 1WD4A 3M70A 1ZZCA 4FXKB 1ZBE3 2O0OA 5LRSA 4N7IA 5L7OA 1BK1A 5FMOL 4B4PA 4BCUA 3VHNA 1O4ZA 1CPNA 4R9AA 4S2HA 4WM8A 4YG6A 4PF5A 3S6PA 1W6PA 5T5JA 1LOGA 1QJY1 1H8TB 3N3HA 2WZR2 4RS5C 4E4SA 3JD73 4Y5Z0 1RUE2 4GULA 3ACLA 4LNVA 3L2HA 3MW4A 4M3CF 5BUVA 2HWC1 3ZXKA 3H8UA 4GXLA 1PGL2 1S0FA 4W6XA 3VV1A 1PVC1 5KHHA 1SMVA 5JIAA 5JCTA 4DINB 5J37A 3FFZA 1IS4A 2Q0AA 2D5FA 4IL7A 5KC5A 3AZXA 4R52A 2JX9A 5EWSA 3AMPA 3M8LA 4FSJA 2GN7A 5HCBA 4JV4A 3HT1A 4EN0A 1NQDA 4MGKE 2PHDA 1LEDA 1YXWA 3I59A 4FPFA 3UJQA 4DNYA 1HXS2 2BWCA 2NLRA 2XKOA 1AR63 3C2UA 2R071 3WY6A 1MEC3 1RVF3 3DF0A 1RB8G 4XMIA 3AJZA 5CA6A 3CU7A 1C1FA 2CGNA 2VG9A 4L99A 1B35B 4HSJA 2VXRA 3APBA 3TRSB 1RTVA 4GB31 1J59A 3WCRA 1KRIA 5DG2A 3ZMNA 1NA1C 1ZNPA 3I2DA 4AQSA 2DUQA 2BNOA 2CY6A 1GYKA 5TSWA 1VLNA 4YZ2A 5BYNA 3WG3A 4B4QA 5JSPA 1GZCA 4AGVA 3VZLA 1ULFA 1VBE1 2ZGMA 3AXEA 1V70A 5GALA 1Y3TA 3HD8B 3TB0A 5CFCC 4ZU5A 1G9CA 1DGWA 2ZKNA 1EY2A 1VP6A 4FXGB 3MIGA 1D4M3 4FBFA 4HVRA 4B3NA 4EWEA 1RUI2 1IQAA 2ZAAA 1AR73 3CJIC 3FLPA 4FPJA 4IESA 1BMV2 1PO23 1LULA 3R05A 2X8KA 4F7ZA 4B7EA 4BA6A 1MS8A 2GC1A 2VQ0A 1HXS1 1UKGA 3BIWE 4WZFA 5I0SA 1AXKA 1F5JA 2EAKA 1ALYA 2H0BA 2XWJB 3AMMA 3M3EA 4D7SA 4L2NA 1DZTA 2ZX3A 1SQ4A 3L2YA 4J6GA 1VBC3 1G8WA 3RJRA 4FPEA 3R4DB 4N43A 1EV12 2JDZA 1MS1A 3ILNA 5SV5A 1S2KA 4DOUA 4FTSA 4FP3A 1H9WA 3WT3A 4UBGA 2E63A 4Q26A 1FATA 3OCPA 2P37A 3GYDA 1MQTB 4AGGA 1QDCA 2AR6A 4YVSB 1MEC2 1RVF2 1W6OB 2K9ZA 2V09A 2VOXA 2ZHLA 3JB8A 1W39A