4BLQA

P4 protein from bacteriophage phi8
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
267
Chain Sequence
b'NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLKGVSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
total genus 88
structure length 267
sequence length 269
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4blqA00
1UBGA 2VPPA 4BLOA 5GJWC 2V4ZA 3SFZA 2PBRA 1PUJA 4MUAA 2JLQA 5FBWB 4YQFA 4BLRA 3OESA 5KSZA 2QAGB 4MDFA 2EYQA 3BB4A 1E2HA 4RCYA 2IUTA 3RAPR 2C77A 2J0VA 2F1RA 1LY1A 2AXPA 1LTQA 3AVUA 2CLDX 4I99A 3MUFA 2FN4A 4QG7A 5KNBA 1G6HA 2TMKA 5CM8B 1VTKA 4O25A 2JLXA 2CHVA 2WJYA 3LX8A 3SJCA 2WOOA 1LS1A 1VHTA 2BOVA 1Q1ZA 2KSQA 3Q72A 2G88A 2ZJ8A 4L4UA 4G1UC 2QP3A 3VHXA 1H8HA 2F43A 4M22A 3RS0A 3K0FA 2RH5A 3B1XA 2WKPA 2OAP1 1U0JA 4TLAA 4TQ9A 3OE7D 1CRPA 5E7MA 1R8QA 4KCGA 1UDXA 2XGJA 3F8TA 3BH7A 5JZVA 1OPXA 4B32A 2IYXA 1GM5A 4DUGD 1X1RA 3L0IB 3QNUA 2VP5A 1E0KA 1Q0UA 1SVMA 3VR3A 4LBVA 4P4SA 3VKGA 1LF0A 2D7CA 4DBLC 3HYTA 5B64A 2NO9A 1T3HA 2GEVA 2VYFA 2ZPTX 3DMNA 3QUSA 2WWXA 4LC0A 5DE3A 3DL0A 2XX3A 1Q1QA 1U81A 3OF5A 1N6OA 2ZRGA 4IJMA 5JECA 4P33A 2FZ4A 1VYVA 4KFSA 2D3WA 1HT2E 1JEEA 2YOFA 2SHKA 3H84A 5H70A 3SYLA 2G3YA 4JS0A 1DO0A 4JVSB 4RJLA 4BPBA 3WBJA 4AI6A 4P31A 5EE0A 1W4CA 1ZM4A 2PH1A 2X2EA 3MAAC 4BLSA 2QQ0A 4HEJA 3SOPA 1XCGB 3EW9A 3QBVA 4YONB 5BXQC 4R98A 5BN3A 2Z4RA 2Q3HA 1AN0A 3QVVA 2P3SA 1UEIA 2NPIA 4PZYA 5CYOA 4BWYA 3VR5A 4C7OA 3KKMA 4EPXA 2B7BA 1G8FA 4MGZR 5HCNA 2FE4A 1VCMA 3BORA 2QT1A 1V43A 1VIAA 1XU4A 1S3GA 5G3ZA 2IYLD 3THYA 1X1SA 2REXB 2WICA 1U9IA 2QGZA 3AVPA 4URYR 5AJWA 3PR1A 1KJWA 1KO7A 3ECCA 5J4LA 4PFSA 2GILA 4Q4AB 4Q7JB 3QF4B 5FPHA 4P4TA 4GL2A 2PT7A 2QP4A 4D4JA 4LSGA 1I2DA 3BFXA 4BE7B 2O8BA 2MMGA 3K9LA 4YXWD 3BWDD 1YZKA 3MCAA 2W6JA 3A4MA 3AH8A 4YC7A 2HDNB 1ZNWA 1CU1A 2JLUA 1W46A 4HDOB 4G5SA 4ZDIA 3RWOA 2O8CB 1TUEA 3SC3A 1KKMA 3TJZA 1JJVA 3BE4A 3UMSA 3LQRA 3QKRA 2RGGA 2P5SA 3PIRA 5FOXA 2JGNA 3EASA 4L9WA 3IGFA 1UKYA 1KK0A 1WDTA 3ETLA 4RD4A 4I1SA 5KHOC 1W36B 1G3UA 1GKYA 1P72A 2ANCA 2GJ8A 5BYKA 2Q9AA 5DYGA 1R0WA 4BRUA 1MABA 4NDZA 1G5PA 1ONBA 1R0ZA 2ZJZA 3SYKA 1YZQA 3X1WA 3DO6A 2FA9A 2EFEB 2ZRIA 4F93B 5C2JB 3SNHA 2BMJA 3ZS9A 5KSYA 3WMGA 1KY3A 1ZM7A 1ZM2A 4B34A 1FMLA 3O8RA 5JSZA 4BZPA 5JJIA 2OO7A 2DHRA 2QBYB 4PZLA 4GZLA 1KK1A 2OCBA 5DYIA 2D4HA 3MWJA 2FEOA 3GLIA 5G53C 2A30A 1GWNA 2VSOA 2QTFA 3B1WA 1OXVA 3C16C 2WSSD 5JFGA 1E4VA 2O5VA 5FI0B 1JAHA 5UKDA 4D0LB 4XWKA 4RD6A 4XVUA 2G0TA 1AJEA 3L8ZA 5DSZA 1DO2A 2N1BA 4QBHA 2GTPA 1CBUA 1ZM9A 2YJTD 3A1WA 2IXGA 1L4YA 5DLQC 2EW1A 3AF0A 4M0LA 1T9HA 1F2TB 3RS5A 1HV8A 3REFA 4QHSA 3Q3JB 3K9HA 4LHVA 2ZSFA 3HU1A 4URUR 4BFUA 5C46F 3RRMA 2V6JA 2QTHA 2A7QA 2V9PA 4LHWA 3QE0A 3EZFA 3W3ZB 5CJPA 4B3GA 1GSIA 2GZAA 1G8GA 4AKGA 3VR2A 4V0NA 1J2JA 2BDTA 3LH5A 4BFSA 5FOTA 1HUQA 1NN5A 2AKYA 4CYMA 1Z63A 4XVQA 1II9A 3AF1A 5FBQB 1E99A 4KVAA 3KJEA 4ACBA 4DJTA 1QHHB 2FG5A 2F3TA 3TH5A 1MOZA 4IDHA 1G21E 2QORA 3QY0A 4IEIA 4OI2A 5BN4A 4BGDA 4R71A 3PUXA 4A0RA 1XTRA 4NPHA 1EFUA 3EA5A 3VNVA 2DYKA 4TLDA 3UWKA 4XTCS 1SVLA 5FPSA 1J8MF 1Z5ZA 1DADA 4B3FX 1CR1A 1XEXB 3Q7QA 4B6FA 2QL6A 3EZ2A 3B6EA 4HUQB 1TQ2A 3C4JA 1A5TA 5DN6A 2VO1A 4QHYA 3KJGA 4D6PA 2W83A 3EZ7A 3LVRE 3T5GA 4HATA 2X77A 4Q48A 2FEMA 2H57A 4G5OA 4I1VA 4JVLA 1CRQA 3FKSA 1JALA 2OT3B 3QBTA 4A82A 3FB4A 5J47A 2QP9X 3ICQB 1JEDA 2RGDA 3KTAB 1CR2A 3AVVA 3FFAA 2CCKA 2QMUA 3LXXA 2ZAOA 3C15C 3J81k 5KO2A 5TB5A 3U4QB 2BMEA 4Q9LA 5TVKA 4FD2A 2XTMA 3GCGA 1GVNB 4TLBA 2BJVA 4V0KA 4Z1MD 5H1YA 2NMVA 1EFHA 1JQLB 1RRCA 3VKWA 1EFTA 2DBYA 1IN6A 1ZRHA 5GJCA 2D62A 1UEJA 1HY3A 2W2XA 1EFRA 4NYMR 4DDVA 4OK6A 1CTQA 2V7QD 4ESHA 3SQWA 2IYSA 4ZI3A 1NRJB 2PEZA 1SZPA 1E2JA 2GAOA 3IIJA 4QHTA 1KOFA 4Q47A 2E1RA 3JZMA 4ZCIA 5FR1A 4K8OA 3IKJA 4H1UA 3GJ4A 2QMHA 2CK3A 2C8VA 4Q9HA 5BYJA 4PPQA 4B35A 4ZV4A 2ZSDA 4AURA 4PZZA 3AVXA 2ZR7A 5DNYB 3TAHA 4BLQA 4KHZA 5JCPA 1M7BA 1JNYA 2C99A 4GI7A 3UIEA 4TMWA 4KU4A 4TT3A 1NBMD 2OCAA 1E2LA 1S96A 4PR0A 3RYTC 1NLFA 4B71A 1JECA 2XXAA 3LX5A 4Q4HA 4IXNA 2W6IA 2NO7A 1G18A 1ZU5A 1RC8A 4Q5IA 1T0JB 1LW7A 1N6NA 2BM1A 3PCRB 1IY0A 1AZTA 4KYIB 1FPMA 2WIAA 4JKYA 2JJ2D 1IOZA 1KI4A 4Y0AA 1E9DA 5BN5A 2GZHA 2NQ2C 1MT0A 3PUVA 5EUMA 5L3QA 3W5IA 2D7DA 2P6RA 3CUEF 3UATA 1OIVA 1AS0A 3VHLB 4CEIB 5M04A 4KYUA 3AKDA 5CIWA 5FBLB 5TDHA 2O8EB 3K0AB 4WXRA 3KXLA 4M1OA 4HDQB 4A92A 4LPSA 2WPDD 1PJRA 2FU5C 1JR3A 2IYYA 4EIWA 2P67A 2IWHA 3RRNA 3WYAA 5F3WB 4WZ6A 1KYIA 3KKPA 5FL7D 2VTKA 421PA 2ZJ5A 1E0AA 2ZJOA 3PUZA 1ZIPA 2UZIR 2ZU0C 4D26A 2GAAA 3PUWA 1FX0B 1G20E 3GJ3A 4L16A 4LOAA 3KKQA 2VP2A 3QIAA 3GP8A 2PMDA 4IDPA 2OFWA 3HYRA 4LWZA 4OL0A 2QAGA 2ERXA 3TK1A 3RLFA 4C0JA 5AUPB 1Z47A 5IDVA 4ZIRB 2G6BA 3N2EA 4B43A 1P4SA 1N0VC 3I1FA 1FUUA 4M9SA 2ATVA 4MKGA 1AQYA 4JBWA 3TW4A 4C3ZA 4ILEA 1DAGA 3FHTA 1NJFA 2OFXA 4W9MC 3RVBA 3QXSA 5KU1A 4TSFD 5FOSA 4DDUA 4JLBA 2XB2A 2QSYA 3CWQA 4TL8A 3GJ5A 4UJ3A 5JMTA 1CJUC 2I1VB 3X1YA 2ZVQX 1S8FA 2ASEA 1K5DA 1NVXQ 5CIQA 5B58C 2C96A 2IYUA 2ZI7A 4KLZA 2JDID 1MV5A 2BCJQ 4NU0A 4BFVA 1GNPA 2WKRA 5SZJA 1OKKA 4KITB 1GNQA 4LI0A 3M6AA 1QHGA 3BD9A 1AZSC 4CEJB 1E2KA 3CX7A 4AKHA 3I73A 4ZDKA 4LPKA 1OHHA 2ZI5A 1IXZA 1KNQA 2B7CA 2UKDA 4LJ6A 1BH2A 2RGNC 1QHSA 2CDNA 2F1HA 3FYHA 3OEED 4TTQA 3ZLJA 2LKDA 1JJ7A 4JZKA 5JEDA 1KI6A 1GRNA 2R6CA 5H68A 3VAAA 4II7A 3VU9B 1AA9A 2FSHA 1XPRA 3AVWA 3WHKA 5JI2E 3ADKA 2GESA 2ZJBA 2FNAA 5FTJA 4AY2A 2JJ1A 4IHQA 1E1QA 3SU8A 5EUQB 2ZRAA 1U8AA 4WA7A 1XEWX 4X8OA 4BFTA 4ZKDA 2HF9A 4C2UA 2AXNA 1D9ZA 2GK6A 2Q9BA 2BHRA 5EXPA 3ZQ6A 4AYXA 4LJ4A 2QM8A 2VHTA 4G3XA 1DS6A 4ZDWA 1ZAKA 1FNMA 4PQRA 3RWMB 1ANKA 4G5RA 2YHSA 3OFNA 2H17A 1AS2A 1XD8A 1YZUA 3FMFA 4OI4A 4TTPA 1NBME 3GLGA 1VCIA 1KI9A 4TMKA 1IXRC 1QG4A 1P75A 1NVVR 3K70D 1Z3IX 2IWRA 1TF5A 3L8YA 3ZZTA 5CB6A 1IN7A 2W00A 4Q1AA 1U0HC 5CB8A 3V4RA 3LWNA 2OCPA 1TQDA 1TF2A 4JVMA 5DI9A 4FXPA 4NL4H 2O8CA 4TL6A 2EFCB 1G8YA 2HEIA 2CVHA 5FL3A 3I4LA 3AVYA 1Z22A 2GXSA 1UBCA 3DZDA 4IDQA 3X1XA 3ZZ0A 3IPXA 2ODNA 3TKLA 3MFYA 1SVKA 1N6PA 5LB4A 3LW8A 5EXSA 4RZ3A 3KKNA 3K0EA 4PHFA 3EX7C 1Z07A 1D2NA 1N2CE 1QF9A 2ZUBA 1KDTA 1ZUNB 4ZO4A 3W9YA 3ZVNA 4JSTA 4TMVA 4PC7A 1Z6XA 2ZRBA 1US8A 2VHQA 3K70C 3H0KA 1FNNA 2AL7A 1SVWA 4A0FA 3SN6A 4A15A 2CLSA 1T91A 1XX6A 2HJVA 4JSYA 1SGWA 4C0QC 1XJQA 3D7MA 2D74A 2QBYA 1NY5A 3VMFA 3U44B 1YHNA 5F9HA 2ZR9A 3GLHA 1GRRA 1RRPA 2CCGA 1WE2A 1KO4A 3K8YA 4EPYA 4PHGA 3B9PA 1W44A 3ZIAA 2AN9A 1MO4A 3TAUA 2QAJA 1VKJA 3W34A 3MLEA 1Z0DA 1OH8A 3U2QA 1COWD 3NDBB 1FQJA 1P2SA 3RRYA 5IK2A 3GJ8A 1GNRA 4EJSA 1E3MA 1ZUHA 5EZ5A 4CF7A 2YNMA 4ZI2A 3K9GA 3KUCA 1EWRA 1F2TA 1NP6A 1QHXA 1Y63A 1ZNZA 1Q57A 1XMSA 2A9KA 3QF7A 4ITRC 4URXR 4TTRA 2XNDD 4NBSA 1KMHA 3RDPA 1E2EA 3K0CC 1QG2A 3BH6A 4QOSA 1KSHA 3TSZA 1SKYB 4B3DA 3UANA 1YR8A 3IPYA 1MH1A 2R9VA 3L0SA 3GMTA 4GBMA 1AIPA 1XF9A 5FTLA 2HYDA 2FDCA 2LKCA 4TYPA 2R6AA 4D4LA 3PENA 2CMKA 1G41A 3GJ6A 3O8CA 3AVTA 4BFZA 4IKEA 1N3BA 3AM1A 1OIWA 2I3BA 3KXIA 1QHNA 3B60A 3AKCA 2P6NA 2VRWA 2XTZA 2JAQA 4LC1A 3CX8A 3H1TA 1Y3AA 2HV8A 2RMKA 4B6EA 1GL9B 1E9FA 1VDZA 3X2SA 5J5CA 2YC4C 3D8BA 2G77B 4EPVA 4WW0A 3CKLA 2WM9B 4TLEA 2VHCA 3DDCA 2Q3FA 5GADl 4D4KA 4NE2A 1IJEA 4BFWA 1XEXA 5DIFA 1Z0JA 4LZZA 1N0WA 4NP6A 2ODEA 4HB0A 4DLXA 5JLJA 4NTZA 2CNWA 3QKSA 1CR0A 4QBFA 2OM2A 3B78A 4BQSA 1DVRA 3I32A 1Z28A 3R7WA 2WV9A 2ZS8A 5GVSA 1OH5A 3IIMA 3E1SA 1GILA 3Q5DA 4OJQA 5KSOA 1RFLA 5FOUA 3UPUA 3SJBA 2VF7A 2V8OA 2VP0A 2PCJA 3KTAA 3RANA 1QZXA 1XXHB 4OI1A 3SFVA 3CZQA 2W2VA 2B6HA 1AS3A 1N5KA 3MSXA 1A2BA 4Q19A 5FOWA 4URWR 3SJZA 1DG1G 4BZXA 2WZQA 4V0LA 2CCJA 4Q02A 5F9FA 4IVRA 1U8ZA 3WMEA 4WXPA 1KDRA 2QM7A 4HZIA 1A4RA 4LV6A 4ESVA 4LV8B 1CJTC 4DXAA 5ELXA 1BKDR 1G9XA 2AD5A 3TIFA 2EFGA 1JQJC 4N0EA 2X2FA 1GG2A 4O2LA 2JA1A 2H18A 4IW3B 3VR6A 1K8RA 1KZGB 1OFIA 2ZEJA 4F38A 4IDOA 2O8DB 4JLNA 4MRSA 3R8FA 4U00A 4V0MA 4KJZA 3W6OA 3THWA 2FPLA 3LA6A 1X8KA 4LK2A 2J1LA 1NLZA 1SXJA 4PC6A 2IUUA 1G4AE 5EP4A 4Q4JA 1U94A 4QNRA 2WVJA 1CXZA 1BMFA 2REOA 4NYIQ 4AG5A 3K70B 1U8YA 1V5WA 1XCPA 4DEYA 4E5UA 4MGKR 3CPEA 4XOIA 2B8TA 1XP8A 4POAA 1GP2A 3RSLA 3FDIA 1N5IA 5KOYA 2GBLC 2Z43A 4HAYA 1HQCA 2OEPA 3P4YA 4PAMA 3GEIA 4UXJA 4D0GA 1ZMXA 5J4HA 1OFHA 4LYAA 1H65A 3FMOB 3ZH9B 2J59A 3IEUA 4TL7A 3TBKA 1J70A 1YZTA 5CK5A 3T1QA 3AUYA 1AQUA 5FUVA 1E0SA 1XD2B 4B76A 4A4DA 3MD0A 4XD7A 3K0AA 1VG0B 2ORWA 4QL3A 1U99A 4XTRA 3I5XA 2H8KA 4A8JB 4IVPA 1JI0A 4YDSA 3T15A 3BJIC 3B1ZA 3NC0C 5FTNA 5P21A 2PL3A 4XWOA 1JPNA 2RHDA 2QRNA 1WBDA 1Z0IA 1FX0A 2C78A 4IDNA 3ASZA 5TY0A 2X19A 4NMMA 1ZCBA 3CNNA 1FMJA 4KFUA 3KL4A 5J4VA 1RE0A 2V1UA 4TQAA 4DKXA 6Q21A 3B8HA 2JASA 3T1OA 5JRJA 4ZIRA 1R5BA 3W6PA 5DHFA 2OBMA 1NL3A 4C0LA 3GJ0A 4MRRA 3DMDA 1ZP6A 2RHMA 4RD2A 1TQ6A 2GRJA 1QVAA 3RSOA 2IF0A 1EX7A 4BZQA 3FHCB 2X1VA 1CLUA 2JIZD 3V4FA 1UBFA 1P73A 1P9WA 4LYFA 1J90A 2FPKA 3NBXX 4NHOA 4DSUA 2GF0A 2QQEA 4I1UA 2IYZA 5JHGB 3OEHD 2YWHA 5D3MA 3NKVA 3T61A 2JLZA 1XD9A 2A5DA 1UPTA 1IN8A 3GLGE 4L5BA 2IUSA 2FFHA 1XWIA 5HKKA 1AGPA 2J7PD 2RAPA 2ZRNA 1D8TA 3U7EB 2O8FB 4PX9A 4ACAA 2QE7A 4JLJA 1M7HA 2GDJA 4DB2A 1KIMA 5AUQA 3PV0A 1KO5A 2MSDB 3QG5A 3CF6R 821PA 1PUIA 1WBBA 4KSBA 4F91B 4JMPA 5L3RA 4JL5A 1M1YE 2GF9A 3MWLA 5EP1A 2XB4A 3TE6A 1HURA 5KDLA 3ADBA 4B3BA 2HUPA 4GRAA 4Z54A 2WWHA 3MJRA 3P27A 2FH5B 1UKZA 1GL6A 4C0AC 2V1XA 3TUZC 2HXSA 4PPFA 2GXAA 2HYIC 2YOHA 4M1TA 5CJ2A 1SXJD 3FMIA 2R6FA 3CM0A 2CJWB 4P4UA 4XSHA 1Z6GA 4PC3A 1EK0A 1NVWQ 2GWHA 4QKQA 3A1TA 5FUYA 5K8IA 1DOAA 1MRSA 2JEOA 2GVDC 4EFMA 5IT5A 1CIPA 1ESNA 1BO6A 3A37A 2XSZA 3FPAA 2ZREA 1NMXA 1ZM3A 1G4UR 3LQQA 4E03A 1E9RA 3AP3A 4ARZB 2AK2A 2WAYA 1NG9A 1D6JA 3D3QA 3QXCA 2D06A 1RYFA 2ATXA 1H8HD 5CDFE 3I8XA 3SHFA 5KUTA 4PC1A 3EPKA 2GCOA 3FHOA 1YJ5A 4DCSA 4YMTA 2VHUA 3KXKA 2ONKA 1G17A 1KK3A 2HCJB 2XITA 1Q1EA 3IBGA 2F1JA 1HA3A 2F3RA 4GMDA 2J46A 2B8WA 5HR5A 3ZD7A 1KO8A 1VPLA 4IOKA 3LW7A 4MQBA 3R9IA 2V6IA 3U5ZB 3ICEA 1FTSA 2C9OA 1P6XA 2BBWA 2OG2A 4BFYA 2CHGA 2P2LA 3TNFA 4GT1A 4B74A 2ZRMA 1TF7A 1RIFA 2QENA 2WMNB 4TL9A 2HT1A 4CVNA 1SVIA 4OBEA 4LJ8A 4A6XA 2J0QA 1HE8B 3N2IA 2DCUA 4UJ5A 1C9KA 3EPJA 2L0XA 4EFLA 2QZ4A 1QRAA 1Q1BA 2QA5A 1P2TA 5AR1A 5E4FA 4QM6A 4AD8A 1TX4B 2V54A 3RS4A 1Z08A 5GJVC 4RFSB 5KYKA 2XOKA 4QJ4A 3TLXA 1KI3A 4I4LA 4V0OA 3TUIC 1W4AA 2NO6A 3CBQA 5EE5B 1IY2A 2ZE5A 1VCNA 1P3JA 1IM2A 1G6OA 2ODBA 3T5DA 4B2PA 4FMDB 1BYIA 1XJCA 2JCSA 2WJHA 1U0LA 3RC3A 3OAAA 2P5TB 3FMPB 1RZ3A 3GEHA 2A5YB 1QHYA 4GMXA 1KAOA 1W0KA 3IHLA 1OV4A 4MH0R 3PG5A 1S1MA 4Q1FA 2WWWA 4PO9A 4OHZA 3NHBA 2ZJAA 3OHMA 4MYTA 4QGAA 3QPVA 3CIOA 1XEWY 3KFVA 4NCNA 5AK0A 2FPMA 1GAJA 3HR8A 2WKQA 1W49A 2W6JD 1MO5A 3AKEA 4CEHA 3AQ4A 4OQNA 1J8YF 1N5JA 1UM8A 3TR0A 3QENA 5EXTA 4MDEA 2MSCB 1GKUB 2J0UA 3F5FA 3QQ5A 3W8NA 1TL7C 1E1RA 1KMQA 3W6NA 1OXSC 5F2EA 3BB3A 1QDEA 2QMEA 1LS6A 2ZITA 3IIKA 4LJ5A 3UXMA 4DB4A 1II8B 3B9QA 1UJ2A 2OXCA 2RGNA 3BK7A 4TYQA 2EFHB 2YWEA 4GOKA 5H8WA 2QU8A 3CH5A 1Q44A 4Q21A 3HPRA 5CLQA 1KI7A 3F3YA 4PHTA 3GLFE 3KQLA 1VG9B 3GPLA 1XFAA 3LO5A 1J7KA 5C18A 4R2IA 3CNOA 3EWSA 2O0HA 2QUZA 1SXJE 4M1MA 1HYQA 4Q1EA 1KDOA 1OF1A 2CVFA 2VEDA 4AYTA 1JBKA 1YU9A 2IW3A 4K46A 4IRUB 1W2HA 2DWQA 2PEYA 4PQFA 5FFMA 1W2GA 3ZS8A 2QPOA 1EWQA 3MWKA 1T8UA 4F4CA 1TNDA 1IHUA 1RYHA 2XZOA 4KFRA 1Z6TA 3VQTA 4DLYA 4US0R 2VHJA 1IBRA 4JLOA 1W5SA 5HCIA 2DFTA 4TYNA 3A4NA 1NVUQ 3C5HA 4B33A 2JLVA 4MGIR 1XXHA 4N3NA 4NCIA 4OJKA 2WWGA 3MJHA 2G0NA 4C0BA 4TYYA 3EARA 3KFXA 2QROA 2IYVA 3HJNA 2ZTSA 4KI0A 1FFHA 3PEUA 4DC9A 3KQKA 2YC2C 1E79A 3V00A 2AR7A 1TAGA 1FW6A 2DWPA 1YVDA 2BMDA 1OYWA 2IA5A 1KI2A 4BASA 5AUNB 2AHOA 2ZRHA 1OE0A 1E4YA 3HU2A 4E22A 1CJVC 4KV9A 1OH6A 1YRAA 3I72A 4OHXA 5K8LA 1WA5A 1ZBDA 1RJ9A 5AJYA 1W5TA 2O8DA 3QKTA 4RZ2A 1ZNXA 2RGCA 2F43B 3FFBA 1BOFA 5FBVB 3K0FB 1YR7A 4RKFA 2E9SA 5G3YA 3SHWA 1R5OA 2Q0HA 1W1WA 1T6NA 4JLDA 2ZRJA 2FWRA 3CRVA 5BQ5A 4MRNA 1SVOA 5DN6D 2HLDA 4JJZA 1ZVQA 2C95A 2NTYC 3F0TA 1LFDB 1NSFA 1FZQA 3BS4A 2BVNA 5E7IA 1NG1A 3KX2A 1M8PA 2Q6TA 3I8SA 3T34A 3U60B 5KDDA 2XZLA 1KJZA 5KPJA 1T3LA 3FKSD 3ZVMA 1OB2A 4FINA 4CRWB 1UF9A 3LD9A 3RS2A 3WYFA 4JBXA 4DRZA 1AGRA 3C5CA 3P20A 4B3CA 4MGYR 3AF2A 5CLLA 3BB1A 3IILA 2UVQA 2FJUA 5KPDA 2I4IA 1HTWA 1YZLA 1KSFX 1XTSA 5EE1A 1K5GA 1G3IA 2GJSA 4WAUA 1RPZA 1YE8A 3UMRA 4CDGA 5L3SB 4QNMA 4AWXA 4OKSA 1KJYA 4DLTA 1N5LA 2BCGY 2WHXA 3K0CA 5E3HA 3G0HA 3I3SR 1VYUA 4C7OB 3SI7A 4PAQA 4OQLA 1EFRD 1G3MA 4W5WA 4XVRA 3RRZA 2Z83A 3FOZA 3JVVA 1GDDA 2GCPA 2C9CA 4BRWA 5TARA 3U3JA 1W0JA 2VP9A 5EE9A 1Q3TA 2IS2A 1VYTA 2FGJA 3LLMA 1W4BA 3THYB 1NNEA 1Q22A 4B75A 2IS4A 1ZC4A 2CK3D 4BFXA 3SS8A 4X8LA 3OZXA 4ASUA 5CK4A 1E69A 1FP6A 2ZANA 2OFOA 4PPGA 1T3SA 2W0MA 3NXSA 1SQ5A 2IYTA 2PZFA 4L15A 3BERA 4QXAA 5AWFC 4ZDJA 3GFPA 4TT3D 4UNPA 3K53A 1YQTA 2OE2A 3EIQA 4Q4LA 3ZDQA 4BEJA 1RRGA 1XMIA 3KB2A 1DARA 3TVDA 4B44A 2W6ID 2Z5FA 1VMAA 2EYUA 1NN3A 3P4XA 4S35A 1N0UA 3BAFA 4Z8YA 4EDHA 3BFKA 1SKQA 4JBYA 3A4LA 5FBRB 2QPAA 3GLIE 5HTKA 1A1VA 4DLUA 4HLCA 2EU8A 3E5HA 4ERNA 3QKRB 4A0HA 4LJYA 5JI3E 4FMDF 3DHWC 4R9UC 1VG8A 5B30A 4IOLA 2IYWA 4D82A 3HWSA 4Q4AA 3QF4A 1MABB 3H4MA 1JR6A 4MYUA 3GD7A 2C98A 4PAOA 1JR3D 1MRNA 4HDCA 4AKEA 4CGZA 1E2MA 4P32A 2R65A 3L0OA 2NG1A 2OLKA 1QHIA 2R44A 2PLRA 5JJLA 3W3AA 5JSZB 2QEQA 3T06B 2QI9C 4WIAA 3M4YA 1UFQA 2GCNA 4ZKEA 1G7TA 4UNSA 2BJWA 4K81B 4UNNA 2N46A 4Q7MB 1NF3A 2O0KA 3AGPA 3B82A 1XMJA 2C9YA 4ZCLA 3VR1A 1NY6A 3TQCA 4GSYA 2IS1A 1KGDA 2XTNA 2DWOA 4FCTA 3WYGA 3ADDA 1JPJA 4OHYA 1Z2AA 4HAWA 3AGQA 3SBEA 3PEYA 4U5XA 2GHIA 2BEJA 4OHVA 4S2EA 4ARZA 4EUNA 2R62A 2VP6A 4LHZA 4GOJA 5HPYB 1S4QA 4M4SA 1E9BA 3LBIA 4KVGA 1D9XA 1ZW6A 4OHWA 2Q21A 3A8TA 4JLMA 521PA 2H1LA 2D2FA 1FQKA 5A0FA 3WP0A 1ZIOA 3WRXC 4D80A 1OJLA 1S1CA 4JIMA 1NMYA 5HZKA 3OIUA 1D2MA 3TMKA 1B23P 1ZUIA 4CT5A 1OKKD 1W7AA 2NO0A 4PPNA 4ABYA 2NIPA 2GBLA 2PZEA 3TGPA 5FPKA 1OHHD 4Q1CA 1YRBA 621PA 2OAQ1 3D6TB 3LV8A 4OQXA 1KTVA 2UZ3A 3KQHA 2VSXA 3TRFA 3ADCA 3Q9LA 1I4DD 1L8QA 2WBLC 2O52A 3KJIA 2PX3A 4U7DA 5FH9A 3CR8A 4A8JC 1Q20A 3UKDA 3CO5A 2NZJA 3P1JA 2A5FA 4W5JA 2EWWA 2A2ZA 2WWIA 4LBWA 4A2PA 2ZQ5A 4M9ZA 4BLPA 4HB3A 4FWTA 3RNLA 1F60A 3ZQJA 4UKDA 1OH7A 1EFCA 1O3YA 2JJ1D 4IOJA 1E1QD 2GETA 3VX4A 1A82A 3SYNA 3RS3A 1QHHA 4N0DA 2OZEA 2PMKA 1TTTA 3NDPA 2DB3A 3N70A 3RC8A 5JCZA 4ON9A 1G16A 2FSIA 1OIXA 2IK8A 1DELA 1ZD9A 4E07A 2REBA 2P0EA 1G7CA 4JT4A 4EAQA 4Y0VA 2QTVB 5JHHB 5EP2A 1QBKC 1FL9A 4GNKA 3I5YA 3B2EA 3AUXA 4NCKA 3OE7A 2JJ8A 3OFND 3ZVRA 3BC1A 3K9NA 3QEJA 4M9XA 1OT3A 2N42A 4URVR 3AV0B 3MWYW 1Z29A 4HUQA 3WY9A 4DUGA 2FZLA 5GVRA 3EIEA 1I4LD 4JLAA 1JB1A 4RKEA 1P5ZB 2Q9CA 1TEXA 2XEXA 4AC9A 2ZYTX 1FOEB 3THXB 4AIIA 1E32A 1I4TD 4YMVA 3H2YA 3QJYA 1DEKA 4OQFA 4Q1BA 4LRWA 4XH9B 4C30A 4YMSA 2BKUA 2C04A 1E2IA 1CKEA 1KSGA 3UWOA 2QG6A 2C03A 2KWIA 4LBZA 5FOVA 5KNCA 2WJGA 4RZXA 3NTUA 5FTMA 3CZPA 1Z6AA 2ORVA 4Q1DA 4FCVA 1W47A 3I92A 5DISB 1KI1A 3T12A 1WXQA 3PFIA 3U4QA 1SHKA 4KXFB 2R8RA 1GITA 5EE3A 3AVOA 2A5JA 4RD0A 4MYCA 1M6NA 3U3OA 1II8A 3W5JA 3FKQA 5CITA 1JR3E 2FOLA 1T5IA 3LDAA 5JRZA 2RB4A 2ZRCA 3KJHA 1CJKC 4Q4HB 1C4OA 1VG1A 2ZE7A 2ZYVX 4AK9A 1IXSB 4WBSA 2ZAMA 1R0YA 2OBLA 4M2LA 1GZSA 1TQ4A 1X86B 4HLQB 1E2NA 1XTQA 3EC2A 4Z51A 3DOFA 1UADA 1WB9A 1X3SA 4W7SA 2NPFA 2GVZC 2LCFA 3DEFA 2DPXA 2J9RA 1S9DA 1BS1A 1OSNA 5CYPA 1GL7A 2RGBA 4I1OA 5L3QB 3L0PA 2J87A 2G1JA 5DO9A 4DHEA 3QVUA 3ZIAD 4C2TA 4TYWA 1DTSA 1U98A 5HE9A 2GNOA 1LB1B 1Z0FA 3TQFA 2GKSA 2YVUA 2IXFA 4DLWA 4AKIA 2ZSBA 5IK2D 1TU3A 3HPQA 4HSEA 4YXWA 1ZYUA 3BXZA 5C4MA 3CRW1 1UBEA 4PSVA 3BIFA 3GQBA 3R20A 4DT1B 2ZRFA 3IHWA 5L8VA 5J40A 2RCNA 1P2UA 4JYBA 1G8PA 2QMOA 2HJGA 4OK5A 1E94E 1U2RA 2ZU6A 2ZI3A 4LHXA 4TMZA 1VECA 3B13B 2A78A 2RKOA 3L82B 1OXUA 2QY9A 4D2IA 1KAGA 2IS6A 1P60A 3KUDA 2DY1A 2W58A 1XJ0A 2BEKA 4DZZA 4WZAE 5JWOA 3DKPA 4D0NA 2ZXUA 1AKYA 4HAZA 4CEIA 1CR4A 1PZNA 1GTVA 5G40A 2GK7A 1F3OA 4F4JA 4HAXA 2O8EA 3TW8B 3VNUA 4MKIA 4NONA 5KDOA 2PX0A 2YINC 3O47A 4LHYA 3UG6A 5C4GB 1IN4A 3LAWA 1FUKA 4FMBB 4MKFA 4ZPXA 5JS8A 3L2OB 4EJSC 4LCBA 2G83A 1G1MA 3T1TA 4OI0A 2KJQA 1NIJA 3LNCA 3N5CA 4D4MA 3DPUA 3K09C 1NKSA 5B57C 1EG7A 4LGMA 1YR9A 3FVQA 3ND8A 4DWJA 2ZRDA 2CNWD 1RVDA 5D3QA 1E2PA 2WSSA 1NIPA 3A58B 2ZS9A 1DAFA 3IQWA 1EGAA 4G0NA 2IT1A 1NMZA 4GFDA 2AKAB 3KB1A 4IFBA 2J0SA 2XAUA 1OFTA 4B48A 1OW3B 4B47A 4Q03A 1A7JA 1UKEA 2OLJA 4HAVA 2QSZA 3A6PC 1Q12A 2DFLA 5AUOB 1E0JA 2WMOB 3QPWA 3CRQA 4UNRA 2FMXA 3IBYA 2VP4A 3U7HB 1KI6B 2E87A 2WTUA 4QGHA 2OBNA 3ZJYA 4NYIR 1KZ7B 3AEZA 3WNBA 1IY1A 4LJ9A 3LFUA 1G291 3GJXC 1DAKA 3ZGXA 3Q5EA 2F7SA 1VIYA 5L3SA 2OXRA 4V03A 2F1IA 1X8JA 4DSOA 2IC5A 1R5NA 3FGNA 2R2AA 121PA 4RY2A 3ZVLA 1OLOA 4QBGB 1R4AA 2V55B 4LDJA 2A5GA 2KE5A 4JYCA 4CEJA 1G19A 2WIBA 2CL6X 4NKRA 2QPTA 1GKIA 5FTKA 1KDPA 3I61A 4RZUA 2CL7X 3O8BA 3GJ7A 2YYZA 2VH5R 5EZ6B 1JXMA 3LY5A 221PA 3VU9A 2ANBA 1WMSA 4G5QA 4LYJA 4X8HA 1R8SA 5AJXA 4JLKA 3GLGB 4O3MA 4M8NE 3DVLA 3EPHA 1BMFD 1NN0A 5LBIA 5CM9C 4Z8XA 1CF4A 1XBTA 1XPOA 2ECKA 2FGKA 3AVQA 4HZUB 4RD1A 1BYUA 3R9XA 1X6VA 3D31A 1MO6A 4UNQA 1P7CA 1G3QA 3RABA 4LYHA 3GLHE 4HLUC 2OSBA 2GXQA 2BBOA 2A3RA 1YKSA 4HB4A 1OXXK 2DFNA 2HT6A 4QRHA 4HAUA 1HQYE 3PUYA 3FE2A 1CJMA 2RGXA 3LLUA 1CP2A 4RSGA 4BECA 3BFVA 2AFIE 2IHYA 2VBCA 3NG1A 3KZ1E 4Z1MA 1F48A 1WP9A 4XD7D 4D81A 5DI3B 1SXJC 3E70C 1GIAA 4M1YA 5KTYA 1ZJ6A 4AG6A 1US8B 4JKIA 3QI2A 3TSWA 1P2VA 2V7QA 4MYHA 4PC2A 3NWJA 3LRPA 1DE0A 2JATA 3NBFA 2W2TA 3R9WA 2QT0A 2VQSA 3IO5A 4NZYA 4EKDA 1ZC3A 2PCLA 4FMCF 3U6KA 3GLHB 2G9NA 2GA8A 3S1AB 4RVCA 1XRJA 5JBQA 1DBSA 4DLRA 1GUAA 1N6IA 4FW9A 1JAIA 3CPHA 3BGWA 4LJAA 8OHMA 5HZHA 3KQNA 1DPFA 4DVGA 3B7GA 2IEZA 1N6LA 2DFKB 3EWAA 4CZ2A 1CEEA 4EJSB 1E9CA 3PXGA 1NBMA 5A4JA 2Z4SA 4C0SA 3IQXA 1Z8FA 1F2UB 2ZJ2A 4QC2A 1KMHB 1ETUA 1L4UA 2IXEA 4HI0E 1II0A 2BC9A 4PSKA 5TMPA 3NVAA 2DR3A 1G5TA 4RCZA 3NBZC 4R7ZA 2JJ2A 3NEYA 1K6MA 4W5HA 1QVRA 3U44A 4NYMQ 5HKKD 2CE7A 4QFMA 4TZ6A 2PJZA 1W4RA 4DDTA 2QE7D 3QG1A 4KFTA 3JZAA 4L8GA 3CR7A 4M1WA 1HT1E 2AK3A 3NHAA 4KLNA 3B85A 3WBKA 721PA 4FCWA 2LWIA 1R6BX 2B92A 2WPDA 5HE8A 4DLZA 4KBGA 4Q9KA 1XPUA 1G3RA 5FL7A 2JLYA 3SDZA 1G8HA 2C2HA 4DIDA 4PQYA 1N6HA 2BBSA 2XNSA 4KODA 3U7FB 4PO1A 3IO3A 3I62A 3CRRA 2ZETA 4IVQA 1KY2A 1XTJA 1XNJA 4M9QA 4GOXA 4DLSA 3ZD6A 1LV7A 2IL1A 5FUWA 1LNZA 3QKSB 3SQXA 1ODFA 5LB2A 1P9RA 2ZVPX 4B3XA 4CIDA 1S0UA 3R7WB 3WNCA 1U9IC 4I81A 1TADA 1E2QA 2FFAA 2XSZD 4Q7LA 4A0GA 1B0UA 2QRZA 4MKHA 1T8TA 1HEIA 4IXMA 1RRFA 4JL8A 5TV2A 1GOTA 2ZYUX 4V0ME 4TSFA 4BUJA 3BBPA 5L3VA 1F6BA 4DCVA 1C1YA 3P32A 4EQ6B 2ZIAA 3X1DA 1YR6A 2B21A 2Z0MA 4OYHA 1CULC 2QGNA 2JLRA 2MSEB 1TEVA 3QKUA 2NOAA 2JDIA 5KNDA 1WF3A 1Z06A 1NN1A 5FPYA 3NH6A 2WSMA 1ZNYA 1G7RA 3U6BA 3K0SA 2WJVA 3IDQA 1TMKA 4U02A 4WOPA 4YLGA 3W8RA 3G82C 3QXHA 3THXA 1AKEA 3E2IA 4YDHB 4G01B 4QBIA 4A2WA 1DG3A 1ZINA 4F7WA 3TVTA 1HH4A 5LD2C 3DM9B 3NH9A 2HCBA 2AWOA 3PJRA 1CS4C 2RGAA 3PITA 3OEEA 2H7VA 3CNLA 4F92B 3CB4A 5FI1B 3GLFB 4PTLA 2ZUCA 3AF4A 2ZRLA 4DSNA 2X8AA 3THWB 4C4PA 1XEFA 2I1QA 2AX4A 3LXRA 1N6RA 2ODWA 1SXJB 2CE2X 3MGCA 1TUIA 2FFBA 3MMPA 4Q4JB 1JXOA 3BH0A 2PLFA 3HDTA 1A2KC 1UKVY 1LVGA 4TMTA 2WWYA 3M1IA 4KAXA 2YWFA 4JL6A 3FTQA 4LBYA 4TN1A 4CW7A 4NCHA 2ZM5A 3BRWD 2XOKD 4PANA 3WRYC 1DAEA 1Z0AA 3L43A 3OIYA 5FPTA 2KI5A 3RHFA 2HXYA 3TR5A 3VR4A 3QPUA 5FR2A 2C5LA 2ORIA 1E9EA 2BBTA 1S2MA 3B1YA 4XJXA 2GEDA 2YKGA 3DKVA 3OAAD 3EAQA 2ZI6A 4GPTA 5SZIA 1RW4A 1W0KD 4GP7A 1M2OB 3DZ8A 1DAMA 1R0XA 4LV5B 5E95A 1E9AA 1AM4D 4QJ3A 3M0EA 4QGGA 5G41A 5EJEA 2NO1A 2FV8A 2ONJA 4A1FA 3NC1C 2GJAA 3BOSA 4JLPA 2GZDA 2H5EA 2XZPA 5AJZA 2Z6VA 4P4SB 5EP3A 4D25A 3AKYA 1R7RA 4NYJQ 2V3CC 1XCMA 4DIEA 4DT1A 2VA8A 2H16A 2EVWX 1O87A 5LDDC 4EPRA 1MR3F 3A1VA 2K5UA 2WJJA 2BM0A 4HLDA 2MMCA 1FTNA 3VX3A 3EIHA 5J4KA 3KDSE 1E1RD 1P62B 1E2GA 4H9GA 1F5NA 1E96A 1E6CA 4PXAA 4US2R 4JLVA 1IN5A 1M7GA 2R6GA 4Q00A 2CBZA 1UAAA 2J45A 1XD2A 1VCOA 4A8JA 4LX0A 2PJRA 1BIFA 1P9NA 2FSFA 1SHZA 3DM5A 1N6KA 1SULA 3ASYA 4HUTA 2BV3A 3EXAA 1S3SA 1N25A 1NVVQ 3A1UA 5D3MB 5EXXA 2GJ9A 3X1ZA 2Q3MA 1ELOA 5BW8A 1U90A 3EPLA 1Q21A 1NI3A 2Y8EA 2CL0X 3V9PA 4O0MA 3LVQE 3QSYA 1E98A 1UDWA 3SBDA 2F9MA 1TPZA 1XMVA 2F6RA 4Q9JA 3C14C 3WXMA 2J5XA 1Q3HA 5B2ZA 3B5JA 2OUKA 1COWA 1H8EA 3JVUA 4BLTA 1D5CA 1D2EA 3GFTA 5JEEA 2P65A 1ESMA 5IRCD 2O8BB 2ZSEA 1AK2A 4QGFA 1GRQA 2EFDB 1E9SA 1MKYA 2GXUA 3ZYCA 1DAHA 3NIBA 3ONWA 4FWIB 5K8UA 2XNDA 3DOEA 3U7GA 2AWNA 1E2DA 3VKHA 3SEAA 3SJAA 4UXHA 1PVOA 3KKOA 3P26A 3U3MA 1X8LA 2J3EA 3FWYA 2YWGA 3A1SA 2PZGA 3Q8XB 4X8MA 4TQUS 1S9HA 3G5UA 4NYJR 2VSFA 2O8FA 2IHBA 4US1R 4A6PA 3PEWA 2AFHE 1E79D 5LD2B 2KB0A 1IAQA 1Z2CA 1T4GA 4EPWA 3AF3A 3AP2A 5EQTA 1YZNA 2KBEA 1G5RA 5JWHA 5KSPA 4DLVA 5JWRA 4KSCA 2QN6A 1WCV1 2ZE8A 1J99A 2IF2A 3PEVA 4MRVA 2YOGA 4XIGS 5SZKB 2XJ9A 2FF7A 3R8CA 2F9LA 3NBYC 1OXTA 2NGRA 4PSAA 3REGA 4GP6A 2GCOB 3SZRA 1KI8A 4DCTA 3GLIB 1G64A 4A36A 2CJWA 2RGEA 3CX6A 3CW2A 5DHAA 3THOA 1NKTA 2BKEA 4MA4A 2ZSAA 2HLDD 3LBNA 4P0TA 1KHTA 1L2TA 1M74A 3IUYA 3ND9A 3EG5A 5F98A 2CLCX 4Q18A 2J41A 3C8UA 1HE1C 4JT2A 4DSTA 3CF0A 3EA0A 3K1JA 2IYRA 4HYYA 3RS7A 2H92A 1Z0KA 5DGXA 4HZUA 1VHLA 3AB3A 3QEOA 1YZGA 2ZRPA 1XDBA 2CHQA 3OIVA 2CEAA 4UXIA 5E7JA 2FFQA 5TXGA 2IYQA 4M1KA 4PHHA 5JJKA 4O2RA 4TZ0A 2VLIA 1ZCAA 4XWAA 5K8TA 4IEEA 1ZD8A 1IJFA 3C41J 1TU4A 3U61B 2YZ2A 2J7KA 3MG9A 4V02A 4JVNA 4A2QA 3EC1A 4KO8A 5DI3A 1L7VC 3VFDA 3VTKA 4P3YA 2QAGC 4L9SA 1ZU4A 4JJKA 4F4IA 3WMFA 5IF9A 1SKYE 1M34E 4QJ5A 4WZBE 1W0JD 3SR0A 4DCNA 4DEXA 3CRMA 5IHPA 2BWJA 3OIWA 3S1AA 2WAXA 3UMFA 1OYYA 4OK3A 1Z6YA 2EQBA 2P6UA 5CDFA 1PV4A 4ASUD 2ZJYA 4YMWA 3ZZUA 5LPNA 1R2QA 2JLSA 4DCUA 1H8ED 5C1BA 4TLCA 3UK6A 2IX3A 2ZI4A 2WJIA 4Q01A 2WOJA 1ZD1A 3HP1A 1XTKA 1EX6A 3LBHA 1XZPA 4RFSA 2ZYWX 3B1VA 1F2UA 4QM7A 2ZUDA 3CPJB 4MRPA 4BEBA 4CEHB 3K09A 3PVSA 2F55A 2ZI9A 4NCJA 3WP1B 1Z83A 3QOFA 4LUCA 4PO8A 5DH9A 1PLKA 3QXJA 1XZQA 4Q9IA 2CXXA 5J4YA 4UQOA 1MO3A 2YV5A 2J0UB 3C7KA 4C0KA 1R10A 4DDWA 4A9AA 4GDFA 1KO1A 2IEYA 3Q85A 3H86A 1XTIA 3EZ6A 4EPTA 1E2FA 2GJKA 2FX3A 4E09A 3TUJC 4GZMA 2OILA 4FI3C 2VF8A 2NZ8A 4FN5A 4Q7KA 1NLYA 2BMFA 1GFIA 1KNXA 3GEEA 5ANRB 1WRBA 3U3RA 3HR7A 1RKBA 2VIIA 1G7SA 2HF8A 4B2LA 1XXHE 4ZCMA 3U3KA 4FMCB 2OCYC 2XJ4A 3MRSA 4TMXA 1EESA 4AYWA 4H1VA 5BWMA 5SZHB 1FP7A 3KQUA 1OFUX 3CWZA 4HB2A 4IFEA 4OQMA 2G1KA 3WHLA 4LJ7A 4FIDA 1IQPA 1W48A 2OV2A 4MUBA 3T1VA 1KSJA 5FUXA 4R2HA 3WNDA 4N1AA 4B73A 4M1SA 3GFOA 2ZS7A 2BIFA 1W36D 4RFVA 2OESA 1T0HB 5AJVB 4C9BA 2XXAB 1I2MA 2D2EA 3PQCA 2JIZA 1DAIA 3UG7A 3HU3A 3NEJA 1EXMA 4TWZA 2OHFA 2WWFA 1SVSA 4XSGA 1XB2A 4B2IA 2PT5A 3OEHA 3CH4B 3CLVA 2ERYA 4EQ6A 4M53A 4M21A 1NSTA 4NH0A 1T5LA 1IONA 2ZR0A 3A36A 1KKLA 4LY6A 2J7PA 4IOMA 5GJBA 3O8DA 3T35A 5JS7A 4J0QA 4YMUA 2O0JA 3QXXA 1NJGA 4WVFA 2ZRKA 2ZE6A 3TSOA 2VL7A 2R6DA 2KBFA 4URZR 1PLLA 3IEVA 4Q66C 4HLUA 1OB5A 2FSGA 4EFNA 3Q7PA 2ZROA 1LF5A 4G5GA 5A5GA 3CONA 2AD1A 3EZ9A 2W0SA 4C0HA 4KBFA 4MITA 2IBMA 1W36C 1P61B 2GEUA 4RD3A 1RJ9B 2EWVA 3CF2A 1PLJA 2QNRA 2JLWA 1KK2A 3GLFA 1WQ1R 3W90A 4CT4B 3SE0A 3AP1A
chains in the Genus database with same CATH superfamily
1UBGA 1VFPA 4E2XA 2P4HX 2O3TA 2VPPA 2IX9A 4HTFB 5GJWC 1L7DA 3D59A 3RU3A 2GI4A 3ZKWB 4BLOA 5FBWB 3FVWA 2Q9UA 4MQ5A 4BLRA 4BVBA 5D51S 2NXWA 1M1NB 2WUWE 3DCYA 3LKBA 1NPDA 2Q2QA 3KQWA 5LQDA 4KO3S 4GQAA 1PNQA 1Y33E 4RCYA 3VC7A 1PR1A 2AOVA 5EKTA 2VAVA 3S0JA 1LBSA 2F1RA 2HA6A 5JS6A 3FDZA 3LPLA 1H4TA 3KQMA 3DSRA 3AEKB 3MTAA 1ENZA 1TVKA 1MPTA 5CM8B 2LUOA 2FPPA 1LSUA 4J49A 1E5XA 1NRXA 1VLVA 1ZJ5A 3H2ZA 2IZOA 3H3XA 3A7DA 4M88A 4A2CA 4ZGBA 2KSQA 2R6ZA 1GHTA 2A1IA 2Y67A 3G88A 4K40A 4NPAA 2G88A 1J2RA 4RTKA 1Q0QA 1UBHS 3HI4A 3Q6MA 5U1PA 3NHMA 3R74A 3VV2A 1U2GA 5E2AA 2VYQA 1U0JA 2D1YA 1BDBA 2XH8A 1M2OA 3M2TA 2DHDA 2XGJA 3IR6A 5TQ2B 1T25A 3BH7A 3QZUA 3QM1A 4MWGA 5ALUA 3PHGA 5E4JA 3TDKA 1C4XA 4EKIA 5IJ0B 5ALKA 1OPXA 5JZVA 2IYXA 3AHDA 1R66A 4DUGD 4RVGA 3L0IB 4BNFA 2X9VA 3HO6A 2P4QA 3QNUA 4U9UA 3L8GA 4WFKA 1LPNA 2IZ1A 1N2JA 4PX2A 1SVMA 3MAJA 4JJ6A 5CFLA 4JUBA 3D6UA 2XQIA 3LXUX 4DBLC 2D6FA 3KOZA 1MPXA 1UXJA 2A9JA 2CEKA 1U2PA 2QTWB 3K2EA 4QYSA 5FUBA 2ZPTX 4Q9NA 1RLMA 1C80A 2EKPA 2W11A 3QUSA 3CVVA 5DE3A 1X3LA 1Q1QA 1W0CA 3TTSA 5EPUA 1JBQA 1U81A 1N6OA 2NSDA 3SF8B 5FQOA 4LVOA 4A7PA 3S44A 4YRMA 4CLRA 1JLMA 1HT2E 4CTNA 1BKSB 3H84A 3BHMA 4REMA 4S0ZA 5ICGA 4JS0A 3BMNB 1Z88A 3D4PA 4WH0A 2GN2A 1I3NA 3WBJA 4CODB 4DJJA 4OQYA 4TUYB 1WV1A 2X2EA 1H2FA 4BLSA 1Y7HA 4PTYA 3I8OA 3TIVA 3NV9A 4QYIB 4GHWA 1UJ6A 1T9AA 4FPXA 1TDJA 3DBRB 1D4AA 4AF6A 5BXQC 1MXFA 2VXOA 3N7TA 1AN0A 3QVVA 5DBIA 3V34A 2O0MA 3CH7A 3OF2A 1TQHA 4F7DA 3ZN2A 1DGQA 4DL9A 3VR4H 5TJHA 4NESA 4ARUA 2VK8A 3AERA 2FE4A 1CRZA 4UU0A 2I4RA 5A9SB 1I9CA 3MWGA 4MDFA 3BORA 2PT9A 1VIAA 1XU4A 1JR2A 2Q3LA 5G3ZA 4WBNA 2ZG6A 4QO7A 4DMGA 3U4IA 1GG9A 1X1SA 1DRWA 2QGZA 5HG0A 4ARCA 5AJWA 3DKRA 3PR1A 1P0FA 3VSBA 4HQOA 1ULSA 2FMUA 3PFKA 4HUJA 4KPUB 3OCVA 4L75A 5J4LA 1F7UA 4Q7JB 3QF4B 2AF3C 3JQDA 1OU0A 4ODIA 2QP4A 4PPYA 5HIJA 4EBFA 5AVZA 4LSGA 5FUMA 1B8NA 4GL2A 2E3JA 4H4EA 4AIRA 4YXWD 2JCBA 3QEMA 3BWDD 1NHGA 1GGJA 3MCAA 2JK0A 2WP8J 5K3OA 3Q1LA 1Z26A 1U3CA 3D7NA 3ENZA 1OX5A 2ISCA 3M1AA 4JX9A 4K9SA 2PXHA 2X9LA 4LXQA 5FWYB 4WEOA 3TR6A 5A5VA 1Z73A 4OG2A 1JJVA 1G8SA 3BE4A 3UMSA 2DY0A 3AYXB 2HMWA 2QL5A 3PIRA 1QZ3A 3HBFA 4YP7A 2GMWA 3DE4X 2PWPA 5IEJA 3IGFA 2YV4A 3AOEA 4II2A 1E18A 4NMXB 5KHOC 3PICA 1ZH4A 4IZIA 4R69A 3F8WA 3G79A 2LZ0A 2FZCA 3C6MA 3O1IC 3ILYA 2GD2A 2Z4TA 1MABA 3LHIA 3OT5A 1Q3KA 3TZLA 4BRUA 2GEBA 1ONBA 1P0IA 1AY0A 1R0ZA 2AX3A 3GZJA 3JW8A 2ADMA 3DO6A 2FA9A 1MD9A 1LD3A 1M6HA 3QFCA 2ZRIA 4WDQA 4HDSB 4BO1A 4HN4B 4FB4A 4BZPA 1Y3IA 3OF3A 3BPSA 3QA9A 5HGJA 5AESA 4PZLA 3FWPA 2OCBA 3MWJA 2FEOA 4NZOA 2F2TA 3WRYA 2MYPA 3FTNA 2X22A 2E6KA 3IV9A 5FI0B 1V16A 2FEKA 2PRJA 5E3JA 4U5QA 3AL0C 5JYDA 1KPGA 1YS7A 2WYOA 9MHTA 3ZCTA 3L8ZA 5DSZA 2N1BA 4R2LA 4WEQA 1XE3A 2AFIB 3FRIA 4RLHA 3RG2A 4CL3A 3WO0A 1L4YA 4KXVA 3ZZMA 5JFTA 2OXTA 1YS6A 2P3QA 2OV8A 2B4YA 2PLAA 4D4GA 3CT4A 4DDHA 1TT7A 5HOQA 3I2JA 1U7DA 3L1JA 4U7PB 4QHSA 4PNZA 3Q3JB 4URUR 1HR0B 2ZSFA 3HU1A 4MCIA 5I5GA 2X8JA 4GGMX 4CM8B 1PS9A 4N6NA 1ESEA 1R0RE 3K5WA 2CL5A 2EF1A 3BL6A 3GJYA 5CJPA 3ZHZA 1GSIA 4B3GA 1PFQA 1OLUA 2GZAA 2DU8A 5CJJA 5KC8A 1A9QA 1EGMB 4C4SA 1J2JA 2BDTA 2PL5A 1O94C 3CCBA 3HACA 3NT4A 2XOEA 3K96A 4EJ0A 1II9A 1RWPA 2DULA 3OZWA 4FU0A 2HMYB 2GR9A 2HADA 3LFTA 5F1OA 3QGMA 5DK4A 2FG5A 3IMGA 3VAZA 1J24A 4IEIA 2A1UB 3ZWCA 1RM5A 5BN4A 1UBOS 1RI5A 1DBQA 1SELA 1DBIA 1MEOA 4NPHA 4S12A 1EFUA 1N2CA 4YCSA 3PKIA 4DCOA 2JI9A 3SWWA 1BHQ1 1SQ0A 3IDFA 4FX5A 4TLDA 5AJUA 4ZT6A 1VGRA 1WHTB 3SGLA 1PWXA 3LFHA 2XQKA 4Q3AA 4ZWNA 4FWBA 3E8SA 5DLDA 4IX1A 1YS4A 2IZ7A 1EI9A 1USWA 5BSMA 3WGJA 5DM1A 4PZ9A 2IZZA 3EZ2A 3K0KA 3P5BA 4HUQB 3CCCA 5BYBA 5DN6A 3QKWA 1WJGA 1YAJA 1EUDA 3QLUC 4EUFA 5ALFA 3T99A 2W83A 4RIIA 3KZXA 5C8YF 4HATA 1MO2A 1OAOA 1ZKMA 2X77A 1DRUA 4KIWA 4NARA 5KI6A 4NHOA 1DXQA 2FEMA 1MOQA 2H57A 3A3KA 4EBBA 3T5PA 3PP8A 3N5KA 4WY5A 2O50A 2ZUEA 3TGWA 1TTHA 2B2NA 2QLNA 4A82A 2CKDA 4X00A 2YJNA 1DU4A 4IJ6A 2A0KA 2RGDA 1PF7E 4HMPA 4HXGA 2AKEA 1M9NA 4ROTA 3VAYA 2Q7XA 1YD7A 3AY3A 5KKNB 3V42A 3WGMA 4Q3CA 3AK4A 1NUPA 5CA0F 2Y0DA 4Z9YA 5JD6A 4MKZA 4DFDA 2GSDA 3K9QO 4L0MA 3U0VA 1N77A 2BMEA 2AMVA 3WV5A 2AQHA 2ZB7A 3GCGA 4TLBA 2BJVA 2BW0A 4R54A 3L6BA 1ZEJA 3EGOA 4RDHA 3VYUB 2PH5A 1V8BA 4L8LA 4KAFA 4ALMA 5AXAA 1HX7A 1QIJA 3VKWA 4DY4A 4JOCA 4JU9A 1ZRHA 4MWSA 4GZ3A 1VHDA 1RC0A 1XN1A 3Q8WA 3SIRA 1JP7A 2W2LA 1GEEA 1UEJA 2BEUA 3FYUB 4Z0TA 4NYMR 4DDVA 1AB6A 1CTQA 1JPVA 2ENUA 2GTHA 4RHFA 3SQWA 1MQSA 1O6CA 1DKRA 1NRJB 2PEZA 1RAGA 5FAXA 3PWTA 1E2JA 1FDRA 2GAOA 2CFRA 3E1KA 3IIJA 4QHTA 1WXIA 1KOFA 3WRVA 4BN0A 5ALVA 4C5CA 4XFDA 4YJFB 4FUQA 3HJRA 2HW8A 2FQ1A 4K8OA 2GBCA 2YN2A 1VIMA 5F4BA 2QTMA 1L6RA 2H06A 3KJXA 4J0FA 2Y1KA 1HSOA 1GUBA 3PXAA 4NBRA 2ZSDA 3STYA 3HVRA 3VO9A 1CP3A 2JFZA 2Q6VA 5GIPE 4BLQA 4OMUA 4KHZA 3RYCA 1M7BA 1JNYA 2C99A 4GI7A 5IVHA 5FAKA 1EM8B 1S96A 5G0TA 1H6BA 1PUXA 3A28A 4N76A 1XLVA 5KC9A 2NVOA 4E6PA 2NO7A 1ZU5A 4OGWA 4B8YA 2H4ZA 2DCMA 2G1PA 3QWHA 1NA5A 3GH3A 5E6UB 1VE3A 2ZIXB 1JKFA 3MBOA 3CSDA 2XDAA 1L7NA 1IY0A 1OAKA 1CDEA 1POWA 1YQEA 2JBAA 3GEGA 1B3RA 3PCRB 1FPMA 4YJ3F 2JJ2D 2V98A 3L7BA 1BX1A 3AT1A 5T4FA 2G25A 1H66A 1TT5A 2YFYA 3UYKA 3WLNA 5CDGA 1JIVA 2I29A 4NS1A 2GZHA 2NQ2C 1X74A 4YA6A 4PYNA 3W5IA 5KJ6A 1ZGAA 4K6MA 5CH5A 1OIVA 3ELWA 4QTZA 3N8GA 3PC8C 4NC9A 3SC4A 5IXJA 4QOGA 1MUUA 3NKLA 2E7ZA 2GZSA 4FONA 2O2IA 3JYLA 3N3AC 2O3SA 4JMLA 4UMFA 1CIVA 3AETB 4G1MB 5CIWA 4YUXA 5CLFA 2J6HA 4WXRA 3LQFA 4R05A 3TFOA 4V0RA 1JW9B 2IYYA 3IDSA 3L7DA 3RRNA 3WYAA 3FWZA 4BV2A 3KKPA 2VTKA 2ZJ5A 2Q1WA 5B4UA 4ABTA 1MX1A 3PUZA 5AK4A 2UYYA 2FVXA 4RU1A 3EXIA 1QF7A 3GJ3A 3BA1A 3KSRA 4LOAA 4UU7A 4XW2A 2VP2A 1U04A 2W6PA 2OFWA 3ZKWA 2PPLA 2NVUB 4PF1A 1RI1A 1VSUA 1M1NA 2ERXA 3WK8A 1VKZA 3MJVA 4O2BA 3WL8A 4BU1A 3RLFA 2JI8A 5AUPB 1Z47A 4ZIRB 3QUBA 3ABZA 2F3SA 2IY8A 3IAFA 1E1CB 4MV6A 1NNLA 4B43A 4CKBB 2IOFK 2X0FA 4MKGA 1ZK2A 2CFOA 3C7DB 1AQYA 3FGOA 3QU4A 4DXDA 3PHHA 4DMKA 3X1MA 2GD1O 1EHIA 2FEWB 2DTEA 4RHCA 1TQ8A 2G8NA 2OFXA 1ST2A 1T9GS 3RVBA 3QXSA 5KU1A 4Y6RA 1W87A 2HDOA 3AEXA 4L73A 4TSFD 2VUIB 4Z7OB 4DDUA 2JIPA 4JLBA 4LJRA 1RLUA 2GDZA 1XZJA 2QSYA 2VBGA 3FCCA 3QY9A 4TL8A 5JMTA 2GQ0A 2I3DA 4KOAA 1ZISA 1QQ5A 1NP7A 3CN7A 3D7KA 1SHUX 2Z04A 3FIUA 2JDID 3MTEA 4AM8A 2BCJQ 4NU0A 2C97A 3QVJA 4BFVA 1T4CB 4D8UA 4D46A 1FEZA 2XW6A 4TMYA 4LI0A 3BD9A 5B6PA 2NP7A 4WZAA 1E2KA 1TUGA 5JZ9A 1TFUA 4ZDKA 1A98A 3VU1A 1I3KA 3CSUA 2ERCA 4OP1A 2JHCA 1D07A 3VOAA 1PZFA 2Q1TA 5ILQA 3B3FA 3TLEA 1Z5PA 3MELA 2RGNC 1QHSA 1Z18A 1V45E 2I76A 2WJ4A 4PCVA 1EIWA 1J0XO 4R0MA 4AJEA 1T2EA 2L82A 2Q62A 4ZVOA 3GDHA 5JEDA 1IG3A 1RJGA 5HHTA 4GPEA 4HF7A 3MJDA 4Y6SA 1Z13A 3ZCUA 4II7A 4P3OA 3VU9B 1AGXA 1TRHA 2F1OA 4JJIA 1NMQA 1W35A 2FSHA 1CRLA 2XODA 5GONA 4HJXA 2P3LA 5KAMA 4BO8A 1JJAA 1IZ7A 4BYMA 3L5OA 2EJCA 2M6KA 4QYIA 3RRFA 5K0FA 3STWA 3EDRA 2NYRA 3DBRA 4KH0A 1IQUA 4JP2A 1CZRA 3CVOA 5IJWA 4IHQA 3CVWA 2ASVA 3GG9A 1ZK4A 5GAJA 4AB1A 4DNFA 5KYTA 3K35A 2C5FA 4C3UA 1RP1A 4J0DA 3HC7A 5KQMA 4P4LA 4ZKDA 1J06A 5FHRA 3UY4A 3A2KA 2Q9BA 1YMVA 2D1FA 5A9SA 1FFWA 5TGTA 1IIBA 5FNVB 2Y2VA 3QIVA 3G2NA 1BXGB 2HTFA 1DS6A 3IP7A 4QREA 1ZAKA 2REQB 1TZCA 4TM7A 5EG5A 3OFVA 1E3TA 1YBHA 4G5RA 3RUEA 1DEXA 3G6WA 4K2AA 3OPYA 5COQA 1YA8A 5ECWA 3R0XA 5ESRA 3VYSB 5IARA 2LDXA 1ZGGA 3SSNA 2OBXA 3HNPA 3L6DA 4OH1A 1L5FA 4R40A 4IINA 4FYYA 1RJWA 1NVVR 1U3FA 1TF5A 2AW5A 2HPZA 3V1NA 3EOZA 1X7ZB 1H2HA 2J3DA 3L8YA 4HC4A 1VHWA 3L04A 2ODQA 1SFRA 1XDUA 1IN7A 2W00A 4L28A 1U0HC 4Q1AA 2B9EA 2QJOA 1VI6A 4BQRA 5F76A 2WILA 4G41A 5LN1A 3PQ7A 4RY0A 5DI9A 4FXPA 3K1ZA 5EJ2A 4TL6A 5FWYA 3TLGB 5AHKA 1NXXA 2QX8A 2HIAA 2WWTA 1OWOA 3H1EA 3I4LA 5DXAA 3AVYA 3KT3A 2FP4B 3IB6A 4WACA 4H18A 3X1XA 3N6XA 2VNKA 3TKLA 3RC2A 1ZMRA 1K3TA 3IQDB 4GMHA 4S1PA 3SMQA 2H1VA 2AC4A 2QG9A 3INGA 1N6PA 1JEYB 3LW8A 5EXSA 4IDDA 1KE2A 4DLLA 4KRXA 3FPFA 3KKNA 4PHFA 2ZXEA 3T1YB 1Z07A 3GX1A 4RK1A 4DE5A 3TLAA 1D2NA 5IN4A 1QF9A 4H7JA 1JFTA 3BRSA 3ORFA 3F98A 4JSTA 3CSSA 2EHDA 4AULA 4WVLA 4BC0A 4PC7A 4QBTA 2IYOA 2VHQA 5IZCA 3WL3A 1BN6A 2IIBA 2XI4A 3SN6A 4QLOA 4CU5A 5BUQA 1T5BA 3GRAA 4E2FA 1SGWA 2V7PA 2C07A 2XYQA 3GEDA 3KUXA 1D2CA 4FZ3A 1N0HA 2YRFA 4IH9A 1OX4B 3KYJB 3RT1A 1NDHA 3GLHA 3U48A 4DM4A 1WZ2A 4MOWA 1RRPA 1T1EA 1U3TA 2XUFA 4LQDA 4NCBA 1F6DA 2QUHA 1W44A 4DTCA 2B1RA 1SBHA 4X1YA 3TAUA 3HKDB 4PYJA 3W34A 3MLEA 1Z0DA 2H3HA 2VFAA 3NETA 5FWAA 1GGEA 1COWD 3U2QA 4CM4A 2TSYB 5IMSA 5IFLA 3RRYA 3NDBB 4IZOA 3GJ8A 2AFIA 2VBIA 1I94B 2VP3A 5EZ5A 3OA0A 3F7MA 1Q2XA 3UMMA 4JI1B 2EERA 3KUCA 2FWMX 1EWRA 3C3YA 2VPXA 3DCNA 5LP1A 3BWMA 1DB3A 1PFVA 1P3DA 3P2IA 4F45A 2P9BA 1N34B 3K0CC 1SCJA 2AB0A 4AJPA 1ZG3A 4B3DA 3TSZA 1O58A 1GLNA 1PK8A 1TAQA 4ALJA 5CDHA 5D86A 3IPYA 2R9VA 4ZQCB 4MUIA 2KHZA 2CXQA 1F7VA 4WZBB 5C34B 2XF8A 1UXOA 1KEWA 3Q2OA 4GMGA 3F46A 3K8ZA 3TFQA 3AM4A 4DIUA 4EWLA 2FDCA 4E5MA 3B51X 1TU0A 3NRJA 1IUKA 3GJ6A 2CLOB 4GMFA 4UCFA 4IKEA 3AM1A 2I3BA 4R7TA 2QTZA 1QHNA 1WDKA 3KXIA 4M9CA 3WSWA 5JYCA 4FR2A 1BS2A 1MAVA 2FLWA 4AZSA 4YMHA 4RH1A 1CY6A 2PZ8A 2P6NA 2Q45A 3AKCA 5JAIA 3A9CA 3RBZA 3N7AA 1CUUA 3Q7RA 3RYHB 2A1UA 1HM5A 1N75A 2Q7DA 5SYMA 1Y3AA 2HV8A 2RMKA 3ZWNA 1GL9B 3DKKA 4GU5A 1EU1A 3FPSA 3W9UA 1JMVA 2ZYDA 1M2KA 4EPVA 4WW0A 1XNQB 2WM9B 1X38A 3DDCA 4BKUA 1TB4A 2FE1A 3QPAA 4D4KA 1UC5B 4NE2A 3A4TA 5G2OA 4BFWA 3L46A 5DIFA 1USKA 4LZZA 1P6QA 4LY0A 4JEMA 5TMEA 1N0WA 1GPBA 4NP6A 3W2GA 2WWVD 1UDRA 1T5OA 1F8XA 2VPYA 2Q1UA 5EJ8A 1CZKA 2CNWA 1CR0A 2O7NA 4UZSA 3B78A 3U4MA 4H77A 1IRXA 1YV9A 3OTOB 3R6WA 4YRRA 2I03A 4EL0A 6YASA 4ZEMA 4KGZA 4MV0A 2C94A 1ZD2P 2R1VB 4Y1RB 3P2MA 1DJMA 4LXHA 1KARA 3SJBA 3FWHA 5K2OA 1R9MA 1A04A 3WIBA 1TECE 4B85A 1ORHA 3RANA 3W5UA 3EGXA 1RPTA 4OI1A 3SFVA 3ZDFA 5FPQA 3KR9A 1L7AA 3CUWA 3T7EA 1CG6A 1N5KA 2TYSB 3MSXA 1AO0A 2H1OA 4RLQA 1GQOA 3HCNA 4NFLA 3RF7A 1S5PA 4JX8A 1IMJA 1VMIA 4MCAA 3VPSA 4CMBA 3NTVA 5F12A 5F9FA 4TXNA 2C9DA 3RM3A 4WXPA 1A4RA 2IJGX 4LV8B 3C6XA 3E9ZA 1CJTC 4C01A 3PRJA 3HGTA 1XZMA 4X97A 5LQNA 5ELXA 2AD5A 1V11A 2OCXA 2EFGA 2OZPA 3H2KA 2X2FA 1GG2A 4K9RA 4O2LA 1JVBA 2JA1A 4F2GA 3VR6A 2OCDA 1L5ZA 3ZWAA 1YMUA 5BY2A 4CLOA 3WDSA 2PSDA 3WLSA 1KZGB 4YPVA 2CLFB 1OFIA 3AZQA 1NE2A 1MENA 2ZEJA 3N58A 2O8DB 1PV1A 3RFFA 5HM6A 4MRSA 3R8FA 4U00A 3GGPA 3DZFA 4LAFA 3ZHUA 1ZFNA 1F2DA 4OMFG 5AVKA 2O20A 7ABPA 1ZOLA 2JGIA 1RQRA 2VDLB 3DEHA 3RU7A 4PC6A 1XLTA 4D9CA 5LUAA 4QX6A 3KV3O 1J0DA 3GOQA 2P9EA 2FLVA 2I7XA 4W82A 1H6CA 3WAKA 1AKWA 2JAPA 1V5WA 1EM8A 3GY0A 3DMPA 1U1GA 4HX5A 5D00A 3UAOA 3V6MA 4UOZA 3RHZA 1SWVA 4OJMX 1I7SB 1L9KA 2C3MA 5AOBA 2B8TA 1JEJA 2PUBA 4NV1A 3EIWA 5F5LA 3T0IA 3BRQA 2A9QA 5BRNA 2OEPA 1CB7A 5JSKA 1WZNA 2IZ0A 1ZMXA 3ZTWA 1WHSB 1IDN1 5LIRA 2FTKE 2JJMA 3H9BA 4K6KA 3KT6A 1JFRA 1HK7A 2WG0A 1H65A 2WF8A 3I2HA 3ID6C 1X7HA 2WFLA 4F2HA 5KKAA 1LDEA 3T1QA 2W22A 2GK3A 3ZY2A 3AETA 3MD0A 4XD7A 3DE0X 1UKBA 1VG0B 2JHAA 4IVPA 4JLWA 3CXUA 5BVGA 2ROQA 1IB0A 1U6JA 1HNXB 3MAGA 4RM2A 5FTNA 2OVBA 4B5LA 1RADA 1SCUB 3KQOA 4DUYB 2I3AA 1G2IA 3HE3A 5JE8A 3MWFA 3KPJA 2R2GA 3IQIX 1W52X 4IDNA 4CG2A 5IKXA 5TY0A 3MCVA 3U09A 2OO5A 2X19A 2TMGA 3LP6A 2RHWA 4KFUA 2ZBRA 2ZWIA 1XNGA 3A6LA 4HAIA 1D7OA 1QU2A 1JHZA 2VUSA 2GO7A 1SUCA 1JHVA 3B8HA 1BGWA 3Q87B 4XCQA 4ZIRA 2AS0A 5C5DA 1CV2A 1WMFA 3IMEA 1E1CA 4IRMA 3W6PA 5DHFA 3A4YA 2ZVDA 2FX5A 2PFSA 4ZD6A 4AY4A 4O4JB 3GJ0A 4C0LA 4W5NA 1V7ZA 2E0IA 4RD2A 1TQ6A 3BIWA 1UJMA 3IPRA 3DEKA 4E1VA 3AM3A 4FOOA 5DNEA 3V4FA 2JIZD 4DCJA 5DRTA 2X9NA 1P73A 4LYFA 4YRPA 3W8DA 2FPKA 1NNSA 1WPRA 1GGVA 1MX5A 1QZZA 1OFGA 1Z68A 2G63A 2LD4A 1PEYA 2H00A 2QQEA 2ZIFA 1MJ5A 3OTQA 4FGLA 4BB9A 3OEHD 1X0VA 2DPGA 2FR1A 2MSNA 1FFXB 1MF7A 1X1DA 3ESXA 1OAAA 3NKVA 3QLJA 4BMPB 1SEPA 4FDLA 2LTAA 3RB8A 4D1YA 2JLZA 4F86A 1U8XX 2FW7A 2IUSA 3FFXA 1XWIA 2JIDA 3NBUA 4HS9A 1AGPA 2RAPA 4MW7A 4C7KA 5J58A 1UFRA 3E0QA 3PQFA 4X1OA 4PX9A 1T4CA 2FR8A 4EEKA 1M2VB 3RJMA 1M7HA 1CUCA 1FYXA 1QYVA 2GDJA 4KN8A 1FXSA 3KL2A 3RS9A 2YFKA 3HHEA 1KIMA 3QVKA 1ZVKA 1KO5A 1P7PA 2RBGA 5SV2A 4YUWA 5GTDA 4YJDA 3WGLA 4ZCPA 1HDCA 1M2JA 1PBTA 2H2GA 2OG1A 3QV1A 821PA 1NBOA 2ALJA 3DZBA 5JO0A 1WBBA 1E7QA 1YB1A 4HGRA 1L9XA 1L5SA 3LMKA 1PK7A 4UBIA 5CHYA 1YQUA 2RI6A 4WT7A 1M1YE 1JTEA 4G5YA 3VI4B 1I33A 1C14A 1HURA 4U7FA 5KDLA 3FNHA 3MTDA 4QVIA 1A9SA 1E5LA 2V1XA 2AN5A 2FPSA 1YQWA 4CF3A 2YOHA 4M1TA 1IE3A 4NG4A 1F20A 3FMIA 2R7NA 4RF4A 4XSHA 3FGZA 3M9LA 1LH0A 2OQVA 5KOHB 1RI2A 5FEMA 3O03A 1QCDA 3RRJA 5HQTA 4MVJD 2HB6A 1R6UA 3CPSA 5FUYA 5K8IA 4OVKA 4ZTBA 1MRSA 2GVDC 1QH0A 3DE7X 3QUQA 5IT5A 2H1WA 3AI3A 1CIPA 5KQSA 2XA1A 2AN4A 2ZREA 3CRNA 2CJFA 4IS2A 3X43A 3AJEA 3LQQA 3OU2A 4JT9A 3UOAB 1YK1A 2B34A 3V8PA 2WAYA 1D6JA 4BNDA 2D06A 5FNVA 4H3VA 1XAHA 2G08A 1BXGA 2QVXX 2WM3A 2ATIA 3N0WA 2CMFA 3DQPA 3KJQA 3RSFA 6GPBA 5CDFE 2V7BA 2QRGA 4M7RA 3L01A 7GPBA 5KUTA 1UP4A 1QGAA 3UW1A 1D03A 2DSNA 3FHOA 3G8BA 1YJ5A 3BZUA 2F67A 1DBRA 4LZOA 1VHJA 2VHUA 4Q15A 2NPOA 3BXFA 1L5WA 3QELB 1YQXA 2YCBA 2BFBB 1G17A 2ONKA 3T54A 5AW2A 5LU9A 5ISMA 1X77A 4PYMA 2HSZA 1E8NA 1A8QA 1VA4A 3S2ZA 3VR3D 1Y8ZA 1L6IA 1J49A 4TQGA 4Q3NA 2D00A 4NJMB 1CUYA 4QXOA 3R9IA 3NNSA 3IDAA 3ZE1B 2C9OA 2H59A 2X6TA 1URPA 2OG2A 1LK7A 2EKZA 2P2LA 1NW7A 1Z4IA 2P9JA 1MEEA 3MRTA 4JOBA 4UZEA 5LMCA 4J9UE 4WOBA 3TLGA 3LHFA 2HLNA 4KEAA 5C7LO 1TF7A 3ESBA 5JXGA 3RUFA 3GGJA 2Q8PA 2HT1A 2FPRA 2YV2A 2FP4A 3IIIA 2J0QA 1LJLA 2GEFA 4A6XA 3O1LA 3R5JA 2BONA 2FN7A 5EGSA 3MBIA 1C9KA 4XWTA 1AXEA 3RD5A 2W98A 1NBIA 2NSHA 3FUVA 4DLNA 1LEHA 1P2TA 3OLCX 4MZXA 5E4FA 4QM6A 3HJTA 4AD8A 4PBTA 4NFYA 3PHBE 5HRUA 3A9RA 1CPYA 5GJVC 2X5NA 2DLNA 4RFSB 2WU4A 4PLTA 4QDZA 1OTXA 3QVLA 3TLXA 3AIOA 3VR5D 1SD1A 1I5RA 1L4LA 5T6MA 1WKVA 2VHYA 2NO6A 1PFUA 4QTUB 5CU7A 2ZE5A 1VCNA 1IUPA 2A94A 4QDOA 1IM2A 1LPBB 3NHJA 3EN0A 3R4VA 1GD1O 3KZMA 3WGKA 1LBTA 1FQWA 2XZTA 2MHCA 5DPMA 3TFWA 1OX4A 1KJIA 2JKVA 2H5LA 5JARA 1EJ2A 1RCTE 1LPAB 2P5TB 1CZUA 3GEHA 3UV3A 1OZAA 1W0KA 3IHLA 4XJSA 5CH3A 1B41A 2JL1A 1WXHA 2ZRQA 4Z3KA 2IH5A 3W5AA 1Y0BA 2AHRA 4Q9AA 4GRIA 1IOVA 1OOEA 2B5WA 2ZJAA 3I64A 4FFDA 4XGRA 2WUEA 5HILA 3O38A 5LZ2A 2VJKA 3NDIA 4NBLA 1MQAA 2FPMA 1RR6A 1YCFA 2A0XA 4KVFA 2I6GA 3LXMA 1GAJA 5FNZA 2WKQA 3G17A 4KIFA 5YASA 1JU9A 1Z62A 2IE0A 3OE5A 3WNZA 4CEHA 2J9FB 3AQ4A 4LCEA 3LIPA 1J8YF 1UJ4A 4Y9UA 2OLEA 3HCFA 5DNWA 3LQYA 3ZE2B 4YAKA 4YUYA 3S8EA 2INGX 4KK3A 3TR0A 3QENA 4V2IA 5JNSA 3TZKA 4IKPA 5EXTA 1PEKE 4MDEA 2ZTVA 1OGYA 3OE1A 3BL8A 1GKUB 3WLOA 3F5FA 3W8NA 3UAGA 3ZYZA 3S2GA 2BF7A 2VNAA 3W6NA 1OXSC 3JZIA 1H0HA 4B3IA 2VOEA 2PRYA 3OP4A 2XWQA 3ENVA 4QUIA 4LJ5A 2QRLA 3TIGA 4IIUA 5JLAA 1II8B 5EAIA 2VT7A 4O2BF 3IALA 4NZPA 3QHQA 4EKGA 4YCDA 4CMGA 4WLNA 2VDUE 4TYQA 4GOKA 5H8WA 2EP5A 4HK4A 5DM2A 4B2YA 5EMMA 4IHAA 1KI7A 1ST3A 4KQGA 1MN6A 3GLFE 5KOJB 1VG9B 3MCZA 2NV2B 3KQLA 1NAHA 1GDTA 5D8DA 4R2IA 2W4MA 4QECA 5CVUA 3EWSA 3LCJA 3E9RA 3FJYA 1I0LA 1VA5A 1HYQA 4W6ZA 4DSAA 1VKNA 3DULA 4KXXA 3K9FC 2JI4A 4YRCA 2CVFA 4AYTA 3R4CA 1IBMB 4DNQA 3RC7A 5C53B 2IW3A 4E4TA 4NBNA 2PEYA 4NI5A 4PQFA 1SUEA 4Y30A 5FFMA 5HOEA 4RSHA 5CVCA 4P2BA 1RTKA 3CTPA 5CH8A 1H2RS 1CE8B 2BR4A 2FMIA 5HMMA 2HWWA 1T8UA 2PBFA 3OQBA 2CV1A 4FZ5A 1SH7A 1RYHA 1Z8DA 2R1VA 4KFRA 4MV1A 5DBHX 3ZE6A 2FSVC 3B6JA 3IEKA 1C0LA 3KTOA 1S3IA 1W5SA 4WLUA 1NVUQ 3EF0A 1KTIA 1WUHS 3K5IA 4UQLA 2WWGA 1MOSA 4MLPA 2G0NA 2ZWAA 4C0BA 1RXWA 3PSAA 4GPAA 4PNEA 1J9ZA 1DQSA 1Q0RA 5HZGA 4XWWA 3B9RA 4C0WA 3U4AA 5FWXB 1KQPA 4CLXA 3TXAA 4DN6A 3GLFB 1DV2A 2OP0A 4LJSA 3VR2D 2CBXA 3V4VB 1U2DC 2ZTSA 2D2IA 1E62A 4I8XA 4EARA 2JJQA 5LLDA 3H18A 3TCNA 4DC9A 3KQKA 2HQRA 8LDHA 2QS9A 3V00A 3IQEA 2P90A 1FW6A 4P83A 5ALEA 3WR5A 3PHIA 1OYWA 3EMVA 3V7WA 1OE0A 1E4YA 1C0EA 1P1CA 1QRUA 5FO1A 2X3YA 1NX9A 4AXBA 4MV9A 4QLBA 2HZBA 3RKSA 3GBSA 3UGQA 1JG4A 4BZZA 1RJ9A 5AJYA 4BS9A 3EAGA 2R7KA 4B6JA 2O8DA 2RGCA 1NXTA 3FFBA 5FBVB 1A72A 3K0FB 3I1IA 1LFAA 4RKFA 3DD5A 3SHWA 1E0DA 2BKVA 3E7WA 2X2PA 1R5OA 1I2ZA 4OKIA 4S04A 1UBSB 3L4BC 2FWRA 3ESDA 3CRVA 5BQ5A 1FYEA 4R1QA 5K0SA 3RVJA 4BQEA 2V58A 3G2QA 1N5DA 1P3Y1 2HLDA 5JCJA 2C95A 1LFDB 4KIGA 4GDMA 3E2MA 2BVNA 5E7IA 3H8WA 1SCQA 1D4ZA 1M8PA 2X76A 2BZ0A 3I8SA 2MSKA 4MI3A 4XM0A 1KJZA 5KDDA 5LYJB 3O9MA 2OPBA 3M6IA 3LJKA 4UAVA 4D5GA 2X0IA 4MSUA 4L4YA 2CSUA 2DTDA 4HZGA 1Z5UA 3ZOKA 2XNHA 3O3MB 4RDXA 3A6EA 1M2FA 4JBXA 3C5CA 3ZDRA 6LDHA 4Z9XA 4MGYR 3AF2A 3BB1A 1FLAA 3HL0A 2H7YA 4IIEA 4OMCA 5F2NA 2EGUA 1FUEA 2I4IA 1CD5A 1Q1AA 1Z7BA 3PUKA 1XTSA 3DTVA 4NBUA 5EE1A 1L4NA 1R9GA 3UMRA 4CDGA 3HUDA 4L4RA 1NJSA 4YJ2A 4OKSA 5KAPA 1WZEA 3FDJA 2BCGY 2IRWA 3STTA 2MSWA 2P2CA 3G0HA 1W30A 3D3KA 5FJIA 3I3SR 3GMSA 3JQEA 2FK8A 3HP4A 3HY4A 3SI7A 3VR6H 5I5EA 4C7OB 1UPUA 4MZDA 3DMTC 4H2DA 1OTHA 2EJUA 3H5RA 2HO5A 4G5XA 1X7GA 4W5WA 2W8BB 3RRZA 2AZDA 3ZCVA 3VPBA 5BSFA 3KPVA 5TARA 1RI3A 3U3JA 1OBVA 3AUFA 5DCLA 5EE9A 2IS2A 5FYDA 2NU9B 4B17A 1FFSA 1RBMA 3FFTA 1X1CA 3EJ6A 4RQBA 3W78A 1UAGA 2P2SA 5LSAA 1PEDA 4DYHA 4B0PA 3RU9A 4WPGA 3V7UA 3SIWA 3G1TA 4X8LA 4ZEVA 3LYAA 5CK4A 4MW2A 3PX7A 2PZAA 4QXAA 3QVSA 4UCXA 4Z2YA 3E9MA 3C1UA 3GFPA 1NI4A 4TT3D 1VSBA 1POXA 2NXCA 3K53A 3P9SA 2DERA 1A5AB 3BICA 1DARA 3CR3C 3OUZA 4DW8A 2NV6A 2W6ID 2GN0A 2Z5FA 1IWBB 3H2BA 1VMAA 2ZCUA 2EYUA 3NALA 1HNWB 3HLKA 2OBFA 2XY4A 5ETJA 1F0NA 4EDHA 3TAXA 5JNRA 3KXPA 5FJJA 3DVRX 1L7OA 2D5BA 4JBYA 4LCJA 4IDAA 2QPAA 3FOAA 1E5QA 4EAAA 2O54A 3PYXA 5I51A 1ZESA 4OQDA 1M2HA 3CLTD 4HLCA 1LUAA 3E5HA 4P92A 3JCZA 3BMXA 5K0NA 5KHAA 4DWVA 1O4VA 5K6RA 2H0AA 3DEIA 4ID3A 2M6LA 3DHWC 2R0QC 2YL2A 1M2VA 1MBZA 4B80A 1QGED 1TVCA 2Z58A 3DF7A 4FNAA 3COYA 1QB8A 2XMZA 4R68A 3HWSA 4UD6A 4C20A 4COKA 4PR3A 2Y1DA 3TM4A 4D82A 2Q5JA 3CZ4A 4CMCA 1JR6A 4MYUA 4YNBA 2C98A 3GVHA 4Z9FA 4R8KA 3QHAA 1EGVB 3W7BA 1K7CA 2YN0A 5EEHA 2IIQA 5DOVA 3PC2A 4AKEA 4CGZA 1E2MA 4P32A 4K3VA 3GDWA 4YAJA 5I7FA 2R65A 4PXYA 4Y2TA 1AQNA 1OCEA 4GUAA 1RT9A 5EL0A 3AG6A 3SVZA 5KJFA 2ZT6A 1C3EA 2QEQA 5J2TB 4ARIA 1FC0A 3ZHXA 1T29A 1JSXA 3A6HA 1JT9A 3L8FA 4LWPA 3E4CA 2AMYA 4YQZA 4ZKEA 3ZHQA 4YXFA 2BEWA 1FMTA 5IAGA 2BJWA 1NVBA 3KZOA 3LC2O 3OPVA 2XGOA 3R77