4BLQA

P4 protein from bacteriophage phi8
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
267
Chain Sequence
NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLKGVSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
total genus 88
structure length 267
sequence length 269
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4blqA00
1D5CA 4CT5A 4TYNA 3T1QA 3T15A 3W6NA 3CRW1 3C5HA 3BIFA 3LW8A 4JKIA 5BN4A 5DNYB 3ZVNA 4MGYR 2J0UB 2C9OA 3SYLA 1DAEA 3QG1A 2C03A 3BGWA 3EPJA 2NIPA 2YNMA 4NYJQ 4RZXA 1U2RA 1OFIA 4HB3A 1G1MA 2FGJA 3G0HA 1IN6A 5HCIA 4G3XA 1NG1A 2XJ4A 4RCYA 2XJ9A 5JZVA 3AV0B 3A6PC 4FMDB 1W4CA 2CHGA 3BFVA 1VG0B 3LW7A 4Q7LA 1H8ED 1UEIA 3OE7D 4XD7D 2HLDA 4OK3A 4BFUA 4JS0A 4N0EA 3BXZA 4FCVA 1TEXA 3O8CA 1JR6A 1P9RA 4TMTA 5FBWB 2YOFA 2P6UA 3PVSA 4R98A 2JLSA 2R6AA 1C1YA 3B6EA 1IQPA 2X19A 3NEJA 1QHYA 1OV4A 2GVZC 2J7PA 3GD7A 1KDTA 3K70B 2JGNA 5JRZA 4AURA 4IRUB 5LBIA 2OCYC 3AP2A 3BK7A 4E5UA 2WJGA 4XH9B 5IRCD 1XJCA 2BHRA 3P26A 1CBUA 3WBJA 3U5ZB 2QENA 4LPSA 2ZTSA 4G5RA 3OIUA 3GFPA 5KU1A 2NO9A 5G3YA 1G3UA 3ZDQA 5FI0B 2ZJBA 2ODNA 1FZQA 4DXAA 4QNRA 1DAIA 1YE8A 1P7CA 3GQBA 4NCIA 4OI1A 3GLIE 3FFAA 2ZI5A 1U9IA 3K0CA 3SHFA 3A4NA 1P9NA 3ASZA 4A8JB 4AKHA 2O0JA 3FMOB 4QBIA 3VNVA 1XPRA 5M04A 2HCBA 4H1UA 2FA9A 3QXJA 2ZRAA 4OHXA 4BFZA 2AWOA 1SXJC 2VSXA 3EA0A 3RVBA 3TVTA 3FE2A 3QKRA 2ZIAA 4GI7A 5EQTA 1AIPA 1G4AE 1JJVA 2FN4A 1Z06A 4F91B 1QZXA 1EX7A 1KI9A 1KO7A 1U98A 3KKQA 2ZE7A 3U6BA 1G8GA 2GETA 4BRUA 4LPKA 3ZYCA 4Q00A 4AYWA 3HU2A 1E2QA 5E95A 3B60A 2BC9A 3UATA 4IDOA 5C4MA 1P72A 4K81B 4TMWA 3T06B 1TAGA 4PXAA 2WVJA 4IEIA 4PHGA 1G18A 4UJ3A 2NOAA 3QPUA 4HLUC 4JVSB 5C2JB 2OV2A 2FGKA 1W49A 1SVKA 3KJGA 1P2TA 4G1UC 4HB2A 5FOWA 2QROA 3TUIC 1MO6A 3QG5A 2QPTA 2WICA 3CNLA 1WDTA 4PSAA 1E2MA 1G16A 4OHVA 1AGRA 1N2CE 4U5XA 3ZS8A 4HLDA 3BH6A 4QFMA 5LPNA 2I1VB 2NZJA 4C2UA 5GJVC 1ZAKA 2EWVA 3EZ7A 2GAOA 3BB4A 4PAQA 2OAP1 4OYHA 5DI3A 2OCPA 5FBRB 5FPSA 1KK3A 4ZDIA 2ZREA 4Q4HA 2ZANA 1VHTA 2HXYA 2J7KA 4Q48A 3K9NA 3TQCA 4I1SA 1NLZA 1D9ZA 2RKOA 5AJVB 4NYMQ 4DSUA 4Q7MB 4ILEA 1JEDA 2R62A 1TMKA 2QSYA 2VHJA 4FN5A 3RLFA 1XJ0A 4V03A 4JVLA 3CBQA 4RVCA 4IDNA 2LWIA 4GSYA 4UNQA 2QP9X 1Q1BA 5AJYA 3OAAA 2V3CC 2V55B 3ADKA 4M1OA 4XTRA 4HUQB 3CRVA 4PPQA 4KLNA 2NO0A 4NONA 3X2SA 3ADCA 1XWIA 4WA7A 1B0UA 3JZAA 1OXUA 1Z0IA 1NP6A 1HQYE 1U0LA 4LK2A 4C0KA 3SJZA 4B3CA 2PBRA 1SXJD 3F5FA 4WZBE 4AC9A 2WAXA 1CULC 4ZO4A 4DLSA 5CYPA 3J81k 1Q1ZA 2O8FB 3RNLA 2B92A 1C9KA 2JCSA 1GIAA 1T0HB 3EG5A 3KKOA 4YMVA 3H0KA 5J4VA 2ERYA 3RSOA 1ZM2A 3LQRA 4JL6A 1KJYA 1OFHA 2BMDA 3OFNA 4KYIB 4HAVA 3K09A 3I5YA 2O52A 1TF5A 3K0AB 1P6XA 2K5UA 4C0JA 1JR3A 1XMVA 3KB2A 4RZ2A 5F98A 5JRJA 3FHOA 1QDEA 3AH8A 5DE3A 2BCJQ 4HAZA 3GFTA 3K70C 4RCZA 4JLDA 3FFBA 1WP9A 2IL1A 3AGPA 4FCWA 3SZRA 1FTNA 4Q1FA 1OPXA 4QRHA 4F38A 2ZJAA 2PH1A 3ZGXA 4B44A 1L4YA 4Z8XA 1XTRA 2FEOA 2VHTA 3P4XA 5AUPB 1JEEA 1Z83A 1ZM4A 2BKEA 1GRNA 4LHXA 4QC2A 4URWR 5L3VA 4POAA 4CW7A 1R5OA 2WBLC 4TLBA 2XB2A 4EQ6A 1ZUIA 5C4GB 2NQ2C 3FKQA 3GCGA 5KSPA 3U6KA 4D26A 1GDDA 1YZUA 1W44A 1MO5A 4A8JC 1WRBA 1E32A 1S9DA 1E1RD 1ZU4A 2QT0A 2UKDA 1M8PA 2CL0X 1XEWY 1RVDA 3BWDD 2WMNB 4JBXA 1LV7A 1XD9A 2DY1A 2H16A 2I1QA 1R2QA 4KITB 5G40A 1KY2A 1E2HA 1P4SA 2ZPTX 3WHLA 2GCPA 1IHUA 1ZJ6A 5FL7A 1I2DA 2ECKA 4H1VA 4QBGB 4B3FX 2WSSA 3THOA 1SHZA 2Q3HA 3SNHA 1H8HD 3HPRA 1GL6A 1S2MA 2JLYA 3B1WA 3RS5A 1KZGB 4M1YA 3PCRB 2QP3A 1GM5A 3W8RA 4B3GA 1G4UR 1XPOA 1OHHA 2IUUA 2C9CA 3FVQA 4B73A 2RCNA 3B5JA 1D6JA 2OT3B 4Z8YA 4M0LA 1JQLB 3K0EA 2DWQA 4JJZA 3F0TA 5E4FA 4DBLC 5KSOA 1CEEA 2IX3A 4V0LA 1CTQA 3QKRB 2L0XA 2B6HA 3WNCA 1ZNYA 1P73A 3ZVLA 2YINC 2ZRPA 3NG1A 3SI7A 1ONBA 4B2IA 1IJEA 4HATA 5J4KA 2GK7A 2KJQA 1Z6XA 1NKTA 4PC2A 4URVR 1ZCBA 2H8KA 3ZVMA 4AY2A 1HT2E 3OIVA 4WW0A 3ADDA 4EJSC 3Q5EA 3C41J 1E9EA 1E1QA 3BB1A 2A30A 4LDJA 4O2LA 5CYOA 1GP2A 2AK2A 3K53A 1A2KC 4JJKA 2GXAA 2ANCA 4GMDA 3GLHE 1E9AA 2FSHA 4HSEA 5SZIA 821PA 3K70D 5FUWA 1BYIA 1QVAA 4OI4A 1W36D 5CDFA 4V0ME 1IY1A 3X1WA 4IFEA 1CF4A 1NN3A 2EW1A 4EPRA 2QBYA 2A3RA 2OG2A 1E2JA 3SU8A 1MKYA 4HZUB 2GXSA 4WAUA 4JLPA 3EZ2A 4FINA 4TTQA 1DARA 3R9WA 2ZJ5A 2FZ4A 4DCVA 3BH7A 4MGIR 5EE0A 4BASA 3KQHA 4M1MA 1AS0A 4DLYA 3T35A 1H65A 1NJGA 2JASA 4WVFA 5JWOA 4Q4AA 2C5LA 3ETLA 3SYNA 1XD2A 5UKDA 4KV9A 2KWIA 4Q4HB 2N46A 2A9KA 2EYUA 1KDOA 2ORWA 2GILA 1X1RA 5E7IA 4KSBA 1VIYA 4RD4A 3GLFA 4DLWA 4PHTA 2W6JD 2G77B 2QQEA 4JLKA 3EX7C 5DH9A 3GJ3A 2OFOA 5JJKA 3DVLA 3SC3A 5J4LA 1GZSA 4RD3A 121PA 3CWQA 2QUZA 1KO4A 4DRZA 3K9LA 3HYTA 4G5QA 2OFXA 2QRZA 1NVVQ 2C2HA 2FSGA 4LV8B 2CHVA 1ZD8A 3IIKA 5TDHA 4AYTA 1SKYB 4C0BA 1VYTA 2F7SA 3I62A 1G8HA 1S3SA 3EPLA 4LJ5A 2RHDA 1II0A 1IY2A 1EFTA 3FB4A 3U3OA 1OH8A 3HR8A 2AD1A 3I61A 4MDEA 3B1YA 1SVWA 2V4ZA 1MH1A 5EUQB 4Z51A 1AZSC 4FWTA 1DPFA 2V54A 1G8YA 3THWB 1VECA 2YHSA 1P2UA 3C16C 1UDWA 2WIAA 4NMMA 1OH7A 3VKWA 1Y63A 5TVKA 4EFMA 4B3XA 3K8YA 2DYKA 4EFLA 2R8RA 3CX8A 1ELOA 3WMFA 4PX9A 3RS0A 5AWFC 1GWNA 3CH5A 3W6OA 4JLAA 4CEJA 1JBKA 3OIYA 3K1JA 1EFCA 1DAFA 4PZZA 4D82A 4S2EA 4ZDWA 1SVSA 2RH5A 1FMLA 1OJLA 4FCTA 3VR4A 1MRSA 2ZRNA 3QXSA 2D2FA 5KSZA 1Q12A 2A5JA 3PV0A 1VDZA 1W2GA 5BQ5A 3TBKA 3ZD7A 3ADBA 3WY9A 3NBXX 3BBPA 1LB1B 4D0GA 2RGCA 1G7RA 2R6FA 3GJ5A 4YMUA 4EPWA 2JDIA 2GK6A 3RRNA 3UWKA 3RAPR 2R9VA 5HPYB 1OT3A 1KKLA 1G3IA 2PEYA 5ANRB 5C18A 2W2XA 4TZ6A 1V5WA 2ZSFA 5EP1A 4BFVA 4PC6A 4LYAA 1N6LA 4DLZA 1N0UA 2XTZA 2WWYA 1N6KA 2QAGB 2CCJA 2EU8A 3AF3A 4C9BA 2HYIC 2JJ2D 2V1UA 1E2NA 1VTKA 2F1HA 2PMKA 4NTZA 5HE9A 3LY5A 4UXHA 1I4DD 2XOKD 4GOJA 4MQBA 3QKUA 3TK1A 3O8BA 4LHZA 1S0UA 4UNSA 3CRMA 3EASA 3GP8A 1GITA 1XEWX 3GJ7A 4BFWA 1KO8A 2GJKA 3DM5A 4BRWA 1XCPA 1U8YA 3VFDA 2D06A 5JSZA 1N0WA 3MLEA 3U44A 5LB4A 3DOFA 2FH5B 4M9ZA 3T34A 1PVOA 2W2TA 4NYJR 2CBZA 3AP3A 2C96A 4NP6A 4Q1EA 4PPFA 1NI3A 3WMGA 3CF0A 2NZ8A 2FX3A 2WSMA 3DO6A 4DSNA 3KL4A 1RJ9A 4F7WA 1E79A 3U2QA 4R2IA 1LY1A 3MGCA 1VCOA 4WXPA 3WNDA 1FNMA 1EESA 1DO2A 1IM2A 3P1JA 2AK3A 2AR7A 4GBMA 3RWMB 4LJ4A 4YDSA 3RC3A 2AXNA 4UNNA 3AEZA 2B7CA 2HLDD 2JA1A 1RIFA 4B48A 3LBIA 2AXPA 2QAJA 2JLRA 3TSOA 4HUTA 2H92A 1R5NA 4XVRA 4TTPA 3KKPA 4A0RA 3TAUA 4KHZA 2QN6A 1GTVA 1RKBA 5HZKA 3PUVA 3NH6A 2J7PD 4QXAA 4Q03A 4LJ6A 4IVPA 5FTNA 3KQLA 3AVVA 2VP6A 4G5SA 2ZRFA 4Q47A 3QF4A 1AS2A 3CUEF 3B85A 2J0SA 3UMSA 4OKSA 5EXSA 3QVVA 2QPAA 4MH0R 4X8MA 1NBME 1MO4A 3H86A 1II8B 1HYQA 1LVGA 2NTYC 2ZYWX 1EGAA 1MABB 4Q5IA 2Q6TA 5FOVA 5AUOB 3ZH9B 1OF1A 4B3DA 3B1ZA 2JJ1A 2GTPA 3LO5A 4Q9HA 2ZM5A 5FFMA 3SEAA 1M7HA 1OIWA 3LBHA 1XZQA 1F5NA 5BW8A 3H84A 2R6CA 4N3NA 1TUEA 3UG6A 4II7A 1L7VC 4FMCF 5JJIA 4FI3C 5EE9A 5KOYA 3AKCA 2NO7A 3CX7A 4V0KA 2YZ2A 2FSFA 5DGXA 2P6RA 5EZ6B 1CS4C 2CK3A 5HR5A 2HF9A 3I3SR 3MCAA 4OHZA 1F2UB 3DZ8A 4KBGA 1G7SA 1KMHB 1ETUA 1XEXB 2PLFA 1T9HA 4P33A 2YC2C 1XZPA 4B75A 4QM6A 1RRPA 3FDIA 2FU5C 4BLRA 4C0QC 2OAQ1 1R8SA 4C0LA 4UQOA 1KOFA 2XITA 2VBCA 4L9WA 4C30A 4ITRC 3N2EA 4E22A 5CJPA 3SQWA 1IBRA 2CXXA 1VG1A 3W9YA 4ZCIA 4DCTA 3QF7A 4D25A 2CL6X 2ZRCA 4RKFA 4DEXA 4BGDA 3K9HA 5H68A 2OCBA 1J7KA 4GP6A 1OXSC 2IWHA 4B76A 1OXVA 1DAHA 1RYFA 2GZHA 2P5TB 4JT2A 2CVFA 5TMPA 3WMEA 3HWSA 4A1FA 4GRAA 3I73A 4BFTA 2IHBA 2WWWA 3SJCA 2P6NA 5FL3A 1OKKA 1F3OA 2H5EA 1Z5ZA 3GEIA 4CEJB 1NN1A 3P32A 4LBVA 4F93B 1L2TA 1XRJA 3SJBA 1OYYA 1Z8FA 4MITA 4ZDJA 1R0WA 5J4HA 3HJNA 1KO1A 3IO5A 5B58C 5LD2B 1TQ6A 1U81A 4KFUA 2PX3A 4TMZA 3AVXA 2UZ3A 2ZAOA 1Z07A 1ZP6A 2Z6VA 1KHTA 1SVIA 4Q01A 2O8EA 4CEHA 2QAGC 2ZUDA 3KXIA 3DMNA 3EIQA 3MFYA 4NYMR 4S35A 1PUJA 3CF2A 4O25A 1U0HC 2W0SA 3ONWA 2JLXA 2XX3A 2IYXA 1HQCA 4NZYA 2C9YA 1DAKA 2PCJA 2WWIA 3I8XA 2H17A 2OXRA 4PQFA 4DVGA 2ZRKA 1E69A 5A4JA 1U8AA 2FV8A 3LLUA 2A5GA 1Q3TA 1Z6GA 1E3MA 2FG5A 2Z0MA 1G5TA 4E09A 2N1BA 2IWRA 3TVDA 2O0HA 1XB2A 1T6NA 3OAAD 1E96A 2OM2A 1W5SA 2CE7A 4IOJA 4KFRA 2NMVA 2OO7A 2PZFA 3IILA 5L3QA 1V43A 4CF7A 2I3BA 1NY5A 1W4BA 3E1SA 4PSVA 1FFHA 4LJAA 2O8FA 5FR1A 2FFQA 1ZMXA 1ZCAA 2YYZA 1DBSA 4ZI3A 1JXMA 2HCJB 4A2PA 1JB1A 1CIPA 2IW3A 5FUYA 1T8TA 3I72A 1YZTA 4YXWA 3ICEA 4IOKA 3GJ8A 4LJ7A 5JSZB 1RYHA 2W2VA 3K0AA 3U44B 3B2EA 3SR0A 1E2EA 4GL2A 3GEHA 1SGWA 1XTKA 2O8DB 5FPYA 1CP2A 3AF2A 1X8JA 1CJVC 3BD9A 3OFND 4JT4A 3LX5A 1SQ5A 2VSFA 1NLFA 2IS6A 1RJ9B 1VG9B 2CE2X 3DDCA 1ZW6A 1AKEA 2E1RA 3A1UA 4HEJA 1JR3D 1ZM3A 2REOA 3GLGA 5FBLB 4KODA 1RE0A 2NPIA 1N6OA 4YQFA 4LSGA 2IYLD 2G9NA 1CJMA 3P4YA 1G5PA 2XGJA 1X3SA 1P9WA 2ZRGA 2PT7A 3QENA 1R10A 5DIFA 5IF9A 1I4LD 4MKGA 1DEKA 5CB6A 3QIAA 1ZBDA 1R0XA 5BXQC 1YZKA 1P62B 4NDZA 3TR0A 3TSZA 3SDZA 5B64A 5HKKD 3AKDA 3ZQJA 4LJ9A 5FI1B 2DFKB 1N3BA 4TT3A 1XMJA 1GOTA 1XP8A 3NBYC 4IVQA 2VIIA 3QF4B 1OFUX 4RZUA 1GRRA 1OYWA 2J9RA 2YVUA 2F1JA 2GEUA 3W5IA 1QHGA 1VG8A 4IFBA 3HPQA 2YOGA 4GOKA 1TEVA 1N0VC 5CM9C 1OB2A 3IQWA 4PANA 1VYVA 3G82C 1W1WA 2ZSDA 3CZQA 5FL7D 3FKSA 4HDOB 1DTSA 2WSSD 3U60B 3IKJA 1E9RA 4C0HA 2WWGA 1N6PA 1S3GA 1Z0JA 1KNQA 1ZNXA 3GJXC 3LNCA 3QUSA 1D2EA 4Q66C 5KDOA 3GJ0A 1P3JA 4EFNA 2NO6A 2AX4A 1Z6YA 2Q9BA 1OHHD 1T3SA 2EFDB 4CT4B 4YMWA 4TL7A 3MJRA 4DDVA 1AS3A 3B78A 3EZ6A 4JSTA 1XMIA 4B43A 1Z6AA 3QEJA 1WB9A 4D4JA 3KTAB 2BBSA 3W90A 2ZRBA 4N0DA 5GVSA 5JHHB 3N2IA 1Q3HA 4M1SA 2ZR9A 4HLCA 5SZHB 2FNAA 2VP2A 2JAQA 3M0EA 2GA8A 3ND8A 2OZEA 2AHOA 1QBKC 2OLKA 1E1QD 1UBCA 2AN9A 2Z43A 2ZRMA 3LWNA 4TN1A 3PUYA 5JWHA 4LJ8A 5JS7A 2QNRA 2ZE6A 3FWYA 3H4MA 1GUAA 4HZUA 2F55A 1BMFA 4M22A 2XXAA 3WYAA 5LD2C 2ZYUX 3KZ1E 4LHVA 2BM0A 4ZDKA 1G8PA 4BZQA 4B33A 3U4QA 2G1JA 4BWYA 2BWJA 3L0SA 1R8QA 2QM8A 5SZKB 3UPUA 3AM1A 3AF4A 4FMDF 1RRCA 1IN4A 1ESNA 4PTLA 3MRSA 3VR3A 1A2BA 1P61B 2NO1A 5ELXA 2J41A 1JJ7A 2REXB 1CU1A 3A4MA 3CW2A 3KJEA 4Y0VA 2QTVB 3WRYC 2DFLA 4PPNA 2ZS8A 3L8ZA 2E87A 2A5FA 4RKEA 5AJWA 3VX3A 2ORIA 1HV8A 1KK2A 1M34E 4XVUA 2I4IA 2AKAB 5JCPA 2ZI9A 3PENA 4ASUA 3RHFA 4M9QA 4CEHB 2G6BA 2O8EB 5CIWA 3PXGA 1OFTA 2J0QA 1DG3A 3BB3A 3L0OA 3KX2A 2GEDA 3A4LA 2VYFA 4DHEA 3UXMA 4JZKA 3EW9A 1P60A 1NSTA 1NVVR 1PZNA 2HJVA 3NHBA 2JIZA 1XEFA 3FYHA 3QNUA 3WYFA 2QGZA 3CRQA 3U3RA 5A5GA 3QI2A 4FXPA 2QRNA 3ZD6A 3AVPA 4Q1AA 5KTYA 3THWA 2IT1A 3GLIB 4TSFD 5HCNA 1DAGA 1LTQA 2OSBA 3CR7A 3TW8B 2P0EA 1KSFX 5L3QB 4Q9KA 2R44A 2F6RA 4O2RA 4IHQA 1BS1A 2YWEA 3OF5A 4EDHA 1Z0FA 5HZHA 1GL7A 1XJQA 4OQFA 4V02A 4B34A 3OEHA 4KYUA 3B1VA 2A78A 5E7MA 5JEEA 1NJFA 4B71A 3PUXA 3R8CA 4Q4JB 3ZIAA 1N5KA 1R4AA 1YR9A 1UKYA 1TX4B 1QHIA 3W3ZB 3LH5A 1G17A 3GJ4A 4XSHA 1O3YA 4A2WA 2ZR0A 3DL0A 1JPNA 3BRWD 5C46F 3U7FB 4DSTA 2GJ9A 1AZTA 2P3SA 3M1IA 4HB4A 5TB5A 3KUDA 2HJGA 4WIAA 2DPXA 4HDCA 1KY3A 1KMQA 1KAOA 2D7DA 3A1VA 3GLGB 5EP3A 1W0JA 1QVRA 4HLQB 1KI4A 2WKRA 4GT1A 2ZRIA 2GKSA 1MT0A 4IDQA 3LRPA 1XF9A 4DKXA 2C99A 2OCAA 1YHNA 3AF0A 5TY0A 4TYQA 1XMSA 3AP1A 2O0KA 1NSFA 1XCMA 2A5DA 5E7JA 2JDID 1Z3IX 3AVUA 2QAGA 3KXKA 4MYTA 4XWAA 3QXHA 3IHWA 5DI9A 5KNBA 2FJUA 1KZ7B 2Y8EA 1FQJA 1K5DA 1OSNA 1YQTA 2WJIA 3JZMA 4Q7JB 1S96A 5K8UA 3I92A 4W7SA 2ZS9A 4LBZA 4QJ4A 2JEOA 3V4RA 1BO6A 2IYYA 2ZI3A 4PHHA 1TPZA 4TYWA 1LFDB 4DEYA 1E9FA 1US8A 1W2HA 4M9XA 5D3MB 1T3HA 1FP6A 1WF3A 2A2ZA 2VF8A 2VP9A 1T3LA 1WXQA 3FMFA 1O87A 2BBWA 1K5GA 4A82A 2P67A 4YMTA 2P5SA 1N5JA 4FW9A 2F1RA 3TGPA 3AQ4A 2F43A 4MDFA 4MYHA 4X8HA 2QE7A 2GDJA 3CZPA 4W5HA 5F9FA 3OHMA 1EFRA 4ARZA 2NGRA 2GXUA 4PO8A 4IW3B 4CZ2A 3VTKA 3MMPA 4RD6A 4HZIA 1I2MA 4QBFA 2ZITA 4KO8A 1GNPA 2DCUA 4KVAA 4WZ6A 3X1XA 3TUJC 2EFHB 1E79D 2WV9A 3NKVA 5LB2A 5H70A 3UMRA 3RRMA 3LLMA 3V4FA 5LDDC 2XEXA 4PO1A 4YDHB 4PAOA 4M1TA 4QG7A 2CJWB 1XBTA 2KBEA 2AD5A 2VSOA 3AF1A 3LVQE 3TW4A 2ZS7A 3ZZ0A 3K0SA 2RGNC 2FDCA 1QHHB 4DIDA 5AR1A 1XU4A 3CR8A 2IF0A 1D2NA 1E0JA 2XB4A 2OEPA 1JR3E 2XNDD 5FUVA 1G3QA 3LX8A 5CK4A 4DWJA 2PL3A 3QEOA 4NCHA 2FOLA 1GNQA 4AWXA 1FW6A 4TL6A 2QGNA 3VU9B 3W3AA 3QVUA 5FTJA 2XXAB 4BECA 4ZCLA 3NC0C 5L3RA 1II8A 3SN6A 5L8VA 1T4GA 4DDTA 3VKHA 3BAFA 1MABA 3U4QB 2ZSEA 4R9UC 2ATXA 1VCMA 1CJTC 4QJ5A 2X2EA 2C95A 3B1XA 4NCKA 4DDWA 3T1VA 1MR3F 1MRNA 2A5YB 4XSGA 2H57A 2DWOA 1E2DA 1NMYA 4JMPA 3TNFA 2GWHA 5EXTA 1JI0A 3CKLA 3I5XA 4DT1B 4BLOA 2GF9A 3KKNA 4UXJA 2QMEA 3V00A 2HYDA 2JJ1D 3AVWA 2EQBA 3VNUA 2ERXA 1F2UA 1Q1QA 4US1R 1AA9A 721PA 3C4JA 4JKYA 1KMHA 2QY9A 3W6PA 1XEXA 1X8LA 1YJ5A 2GBLC 3QKTA 1ODFA 3N70A 4GZLA 1HA3A 2KE5A 3LXRA 2V6IA 1J2JA 3REFA 2JLZA 3T12A 3KQUA 2RB4A 2IYZA 2DFNA 2CK3D 1DG1G 5G41A 2JJ8A 2RHMA 4Q7KA 2ZAMA 1R7RA 2OXCA 3NXSA 4DJTA 4DLTA 2W0MA 2ZRHA 4P31A 4PC7A 1X8KA 1EG7A 2E9SA 2OBLA 2OBNA 2O8CB 1CRPA 2QT1A 2GAAA 2MMGA 4BLPA 3LXXA 1TL7C 4JLNA 1U0JA 1II9A 1DOAA 1YZGA 3R9IA 4P32A 3CPEA 4MYCA 2F9MA 5GVRA 3IQXA 4GNKA 2FF7A 1CLUA 5SZJA 4JL8A 3TKLA 5B30A 4QGGA 2G83A 1JAIA 3DM9B 3EA5A 1NL3A 4IXMA 5FTKA 3Q5DA 4MRPA 4RFVA 2VP5A 1XPUA 1M2OB 4MUBA 2DB3A 1UM8A 1F6BA 1PLJA 2OBMA 1XTQA 3SBEA 4TMXA 3CIOA 1EXMA 2FPKA 3UIEA 4NCNA 1G6HA 3V9PA 3AUYA 3THXB 1BIFA 1OKKD 4KFTA 4CEIB 4LI0A 1N6RA 4Q02A 4E07A 5KSYA 2ZE8A 3ZLJA 4NKRA 2J46A 3BFKA 1RRFA 3SOPA 4EIWA 2X8AA 5CDFE 1ZIPA 4EAQA 3HU1A 4WBSA 3GLHB 5DYIA 4TQAA 1OLOA 2V7QA 4AG6A 1RPZA 3AKEA 3BH0A 1KSGA 4CYMA 4G5OA 1YVDA 2BBTA 4JLOA 2YOHA 3DHWC 2X77A 4LBWA 4DCNA 4JSYA 1Z2AA 2ONKA 2IS4A 1LS1A 1UFQA 2RGBA 5FBQB 4QGFA 1YZLA 2ZJ2A 3NDBB 1EWRA 1NBMA 4TLEA 1HE1C 4OI2A 1R5BA 2BMEA 3EZ9A 5KUTA 2WJHA 5DYGA 4FMCB 3GMTA 3EPKA 1YRBA 2YJTD 1W7AA 1J8YF 1HY3A 1Q21A 5JHGB 3GLFE 5G53C 1GKUB 4JVMA 1TF7A 3FPAA 1AM4D 4HYYA 2WKPA 1US8B 1KI3A 5BYKA 1IXSB 2J1LA 2BDTA 2D2EA 3KFXA 4M2LA 2CLCX 1YR8A 1J99A 4H9GA 4KU4A 1TNDA 4OHWA 4TZ0A 2YKGA 4BEJA 4M4SA 2O8DA 2VPPA 4AI6A 3TE6A 2GNOA 3G5UA 5JS8A 1OH5A 1TU3A 1E2KA 2F43B 3K9GA 1SXJE 4YXWD 2BEKA 3A37A 2AFIE 3BORA 1CJUC 1KO5A 3R20A 3GJ6A 4TTRA 2FEMA 3NVAA 3VR1A 2IYTA 4OQLA 3F3YA 1QHSA 2YWHA 4IOMA 4ARZB 3QE0A 3TUZC 3T1OA 2QEQA 2LKCA 5HE8A 3AVTA 4KAXA 3D8BA 3MD0A 2WM9B 2GF0A 1T5LA 3D3QA 4I1OA 2ATVA 4BLSA 3T1TA 3M6AA 2D62A 2EFEB 4P3YA 3Q72A 1WBDA 1M6NA 3BOSA 1OW3B 5H1YA 4XWKA 1D8TA 2Q21A 3FGNA 4RZ3A 3QPWA 4B47A 1E2IA 2XAUA 1S1CA 1A7JA 4EKDA 2BEJA 1LNZA 621PA 1Y3AA 4AK9A 2R65A 1X6VA 3C14C 4US2R 3O47A 4NYIQ 5FTLA 1COWA 3CF6R 3LQQA 1IN7A 2CCGA 1LF5A 4I99A 5FUXA 4IDHA 2IS2A 1KJWA 3C7KA 3PFIA 2BM1A 2ZVQX 4KBFA 4QHYA 3L8YA 2SHKA 4LHWA 4DC9A 5JJLA 4PHFA 4XTCS 4TT3D 3AVYA 2W6IA 4CRWB 1WCV1 3DOEA 1NN5A 2GHIA 4QHTA 4B74A 521PA 1OXTA 4MRSA 2AWNA 1QG2A 3MWYW 3L82B 2W83A 1KAGA 2HF8A 3BC1A 3U3MA 1W47A 4TL9A 2QL6A 4XIGS 2QMOA 1Q0UA 4WZAE 4BLTA 2ZETA 4C7OB 3WYGA 3KDSE 1TUIA 1F2TA 2BV3A 3FKSD 1XXHE 2CDNA 2ZYTX 4MRRA 5KNDA 221PA 5J5CA 4L5BA 2UZIR 3B13B 3HYRA 3RRZA 5CB8A 1GAJA 3A8TA 1TQDA 2R6DA 2EFGA 3CPJB 3KTAA 2C78A 2RGEA 4DLUA 4URYR 2WWFA 4C2TA 4DLRA 1G9XA 2OUKA 2HDNB 3U7EB 2UVQA 4MA4A 5AJXA 3AKYA 4P4UA 2FPLA 2F3RA 4KI0A 4EPYA 4V0NA 1IOZA 2EWWA 4GP7A 3Q7PA 3CRRA 5FR2A 4M1WA 3QKSB 4YLGA 1E4YA 1U94A 1Z29A 1K6MA 5TV2A 2O8BB 4BQSA 5FOXA 1DO0A 4N1AA 1UF9A 1Z6TA 1XD8A 2QP4A 1HH4A 2RGNA 2QTHA 1G21E 2WWHA 3RYTC 2WOOA 4A6XA 4MGKR 3TIFA 1BYUA 1BMFD 1MV5A 3OIWA 1W0KA 2H7VA 4JLVA 1E0KA 2TMKA 2WPDA 2WAYA 5C1BA 2BMFA 2IBMA 3REGA 3KB1A 1BKDR 3B9PA 3C15C 3H2YA 2IYVA 5GJWC 4AG5A 4AIIA 4LV6A 4MUAA 5EXXA 4ERNA 2GJAA 2ZJYA 2VQSA 4G01B 4Z1MA 5TXGA 4B2PA 4MGZR 5B2ZA 3GFOA 1JECA 1TQ2A 2BJVA 1KI2A 4YC7A 3PR1A 1P2SA 4TLCA 3DZDA 2W58A 3MUFA 3ZS9A 4X8LA 1ESMA 5K8LA 3IBGA 4QBHA 4AYXA 4OJKA 2WHXA 1GVNB 2ASEA 2X2FA 4ZKEA 5AJZA 5DN6A 4ASUD 4F4CA 1GRQA 2JLWA 2XZPA 1DAMA 3A58B 4OHYA 4A2QA 4CGZA 3FMPB 3CONA 3SFVA 1Z22A 5CM8B 3GLIA 3THYB 1A5TA 3QSYA 4ESVA 4NU0A 4I4LA 4OL0A 1WA5A 2GRJA 2GBLA 2C98A 2JIZD 1TADA 5K8IA 3PEYA 3SJAA 3NDPA 5DSZA 1E6CA 4RY2A 4W5JA 1W46A 3VMFA 4PQYA 1LF0A 2ZI4A 4I81A 5H8WA 1E9CA 3PEUA 5IT5A 2QMHA 5BYJA 4Q4JA 4DCSA 4ESHA 5CITA 1RFLA 4GOXA 4BE7B 4ABYA 4EPTA 3W34A 1E9BA 2DHRA 4MKIA 1XCGB 4HAWA 4A0FA 4PQRA 3SE0A 2AL7A 2H1LA 1X86B 3KQKA 1EWQA 3AUXA 4EUNA 3IIMA 1JAHA 4MRVA 2CEAA 3OEHD 1E94E 2RMKA 3KQNA 2VHQA 1KDRA 4Q9IA 3ZIAD 4LY6A 4OBEA 5F2EA 2JLUA 1WQ1R 4K46A 1ANKA 2RGXA 4V0OA 2FMXA 4C3ZA 4F4IA 1WMSA 1PJRA 2ZSAA 2WWXA 1E0SA 1PLLA 4OK5A 1AKYA 2PMDA 5KO2A 4QNMA 1E2GA 2CL7X 4DB2A 1Q57A 4DUGA 2OESA 1FX0A 1UADA 1VMAA 1CR1A 1GSIA 1KI1A 5IK2A 1PUIA 2HV8A 2LKDA 3MAAC 4NE2A 3O8DA 1KI7A 2ODBA 3RS4A 1ZRHA 1W0JD 2PEZA 3GEEA 2XTMA 3OESA 4I1VA 1IONA 2ZI6A 2WJVA 1NN0A 3D7MA 4PFSA 3E70C 5FOTA 3SQXA 2V1XA 2GJ8A 3LV8A 2WIBA 2BJWA 1RC8A 3NBFA 3UANA 3A1WA 2F3TA 3TSWA 3VX4A 4B35A 1TF2A 5D3MA 3X1ZA 1G41A 1KKMA 2OILA 2ZI7A 3B82A 3KJHA 4G5GA 4PSKA 4URUR 3IIJA 1YKSA 1Q1EA 2Q9CA 3MJHA 4OI0A 3Q7QA 2ZQ5A 1FNNA 4TWZA 1W36B 3VR5A 5D3QA 2FFHA 1KI6B 1FUKA 2VHUA 3VHXA 3IBYA 4D2IA 2XSZA 2GZAA 2J87A 3BERA 4A0HA 1ZINA 1AGPA 1Z47A 4XOIA 1OIXA 3IO3A 2P65A 6Q21A 2G0NA 1CR2A 2YWFA 5JI3E 3KJIA 1WE2A 4P4SB 2VH5R 3E5HA 4LYFA 2EVWX 1VIAA 2REBA 4JBWA 1XTJA 4NH0A 1U99A 2BOVA 4RD2A 4U02A 5A0FA 1CR4A 2QE7D 1T0JB 1VKJA 1F2TB 3QJYA 3OEEA 4Q9LA 2NPFA 2BBOA 3CNOA 3RWOA 1KNXA 3SS8A 3EPHA 4JYBA 2B8WA 4GZMA 1EFRD 3F8TA 3K0FB 3WP1B 1RZ3A 3LD9A 4M9SA 1IN8A 4BZPA 1G20E 1NF3A 2C8VA 2CJWA 2KI5A 4D4MA 1Z63A 2ZSBA 3UK6A 3SYKA 1QHHA 4A4DA 3KFVA 2V8OA 3BE4A 1IY0A 1RW4A 4ZIRA 1G8FA 4PO9A 1Z0KA 1K8RA 3Q3JB 4IOLA 4LCBA 4A0GA 1PV4A 3LBNA 1UDXA 2ZU0C 4YMSA 4DLVA 3UWOA 3VU9A 2J45A 1L4UA 1QRAA 2D3WA 5KYKA 4B6FA 2BVNA 1DADA 4ON9A 3Q9LA 4QGAA 3GLGE 1HT1E 2IYQA 2IUTA 2IXFA 1Z2CA 4Q1CA 4Z54A 1IXRC 2ZJ8A 1Q22A 3T61A 1G3MA 3E2IA 3ZJYA 1DS6A 2J3EA 2ZRJA 2WJYA 1UKEA 3DKPA 4MKHA 1JNYA 3MWKA 4RFSB 4C4PA 3NH9A 4LZZA 4DT1A 4TLAA 1CKEA 2EYQA 4KFSA 1S8FA 5KDLA 4EJSB 1AN0A 1XNJA 4XJXA 3EZFA 421PA 3CB4A 5JI2E 4OJQA 3VKGA 1ZNWA 4E03A 1P5ZB 4FD2A 1NVWQ 2O5VA 2DFTA 4F4JA 3I4LA 3EIEA 3NBZC 1GL9B 3AGQA 3R7WB 2VA8A 4TQ9A 3WNBA 3JVUA 2D4HA 2XNSA 5AUNB 4URXR 2O8CA 2IEYA 2OLJA 4Q19A 5G3ZA 1ZIOA 3VHLB 3L43A 3U7HB 5CIQA 4G0NA 4JLJA 2Q0HA 4IXNA 1Z08A 2CNWA 3VR2A 4FMBB 4NBSA 4ZCMA 5J40A 2D7CA 1XTSA 4PC3A 3LFUA 4OK6A 2NG1A 2RGGA 3NHAA 4B2LA 5AUQA 1CXZA 3TAHA 2G88A 1VCIA 1KIMA 3IEUA 4J0QA 5L3SB 2PCLA 1F48A 2QI9C 3WHKA 1W5TA 4B6EA 5JLJA 1KK1A 4NPHA 4P4TA 3THXA 3TJZA 4CEIA 2KB0A 2CHQA 4CDGA 2XZLA 4Q1BA 1N6HA 4QL3A 4US0R 4JLBA 4Y0AA 1Q20A 2ZJOA 4L8GA 4MRNA 2VO1A 2RGAA 3S1AA 1YR7A 4PZYA 4RD0A 4PAMA 4RD1A 1TTTA 1QHNA 1KSJA 3GPLA 1D2MA 1H8EA 4OQMA 1OXXK 2VP4A 3GLHA 3OE7A 4XD7A 5JWRA 1FX0B 1M1YE 1NMZA 4B3BA 2IYRA 3EC1A 3NTUA 3UKDA 3QXXA 2DWPA 4JL5A 1Z0DA 3TQFA 2PX0A 4IVRA 4AKGA 4V0MA 4QJ3A 1UKVY 4PC1A 1UAAA 3X1YA 4D0LB 3EC2A 1W36C 1HEIA 3MSXA 2WTUA 1AQYA 2BKUA 3N5CA 2V7QD 4X8OA 5JMTA 4RSGA 1XFAA 4KVGA 5E3HA 2FPMA 1SVOA 2YWGA 4DZZA 4D0NA 2ZEJA 4JVNA 4TYPA 1PLKA 4R7ZA 3PEWA 1N25A 3TLXA 1TU4A 3CPHA 1NBMD 3VR6A 5HKKA 5KNCA 2MSEB 1KGDA 1M7BA 2Q3MA 2RGDA 1DVRA 1GG2A 1GNRA 2FSIA 4DB4A 1D9XA 1W48A 1IN5A 2OHFA 1A4RA 1FOEB 2GCNA 3BFXA 4W5WA 1SKYE 3PITA 4YONB 5DHAA 3LDAA 1NIJA 3C5CA 1ZM7A 4A6PA 4NHOA 2PZEA 2IYWA 2QZ4A 3QQ5A 3KXLA 3QY0A 2HT6A 2MSDB 5EUMA 3NEYA 1ZD1A 2LCFA 5BN5A 4O0MA 4GMXA 4Q21A 5FPTA 1E4VA 3TRFA 2D74A 2YV5A 3A1SA 1A82A 4TQUS 3CM0A 2VTKA 2GESA 1W4AA 5HTKA 3W5JA 4R71A 5FPKA 2J0VA 1UEJA 4A92A 1EK0A 1P2VA 4JYCA 1SVLA 4AKIA 1FL9A 2IYSA 1UKZA 1OB5A 1A1VA 5IDVA 4IKEA 4ZIRB 1JALA 5BWMA 4IDPA 4LYHA 3FHCB 5EP4A 1TQ4A 5JFGA 4LUCA 4C0AC 2HUPA 3TMKA 4NYIR 2FZLA 1KTVA 3DPUA 5P21A 1VPLA 3NC1C 2GCOA 4TMKA 1GILA 1YZNA 1E9DA 4BUJA 4TYYA 3I1FA 4LBYA 1S9HA 2G3YA 5AK0A 1GKYA 1COWD 1KI8A 2IEZA 2IHYA 3R9XA 3U3KA 5KHOC 4L9SA 3ECCA 4Q9JA 2R6GA 2VP0A 1HTWA 4TMVA 1N5IA 3LA6A 1EX6A 1FQKA 4DLXA 5EE1A 2QA5A 3B7GA 2IC5A 1CJKC 3HP1A 2BMJA 2W6ID 1ZU5A 1NVXQ 2VL7A 1B23P 4C7OA 2B8TA 4WOPA 2KSQA 4O3MA 4HDQB 1ZUHA 2QM7A 2IYUA 5FTMA 1UBGA 2WJJA 4LRWA 1G3RA 2PJRA 1UPTA 2N42A 3B9QA 1AK2A 4QOSA 1I4TD 4XWOA 5DI3B 2AKYA 3W8NA 5FH9A 4EPVA 3OZXA 3UMFA 5KPJA 3FHTA 1AJEA 1QHXA 4ZPXA 1U90A 5F3WB 3PG5A 1C4OA 1J70A 1FP7A 2G1KA 1CR0A 4XVQA 3VQTA 4I1UA 4ZI2A 3QKSA 3CLVA 1SVMA 2ZUBA 1NRJB 1G7TA 1QG4A 2PT5A 4M1KA 1N6IA 1E2LA 1ZNZA 2F9LA 3I32A 3CNNA 3IHLA 5FBVB 2O8BA 2J5XA 1NIPA 4UNRA 4FWIB 2HXSA 1ZC4A 2CMKA 3EAQA 3Q85A 1JQJC 4IJMA 3TH5A 3VAAA 2P2LA 4LV5B 3O8RA 3ZQ6A 1ZC3A 4TSFA 1SXJA 3SBDA 4LHYA 1VYUA 5JECA 4QM7A 1LS6A 2Z4SA 1NNEA 1G64A 2GJSA 4KXFB 2ZYVX 1J90A 4GFDA 1G5RA 3QOFA 3D31A 5EE3A 1DE0A 2QORA 2QU8A 3PEVA 3LVRE 5FOSA 2Q3FA 3IUYA 1CRQA 1W0KD 1ZYUA 2GEVA 2WPDD 1NKSA 3S1AB 1VHLA 4BEBA 1NY6A 2ODEA 3JVVA 5GJCA 3AVOA 4HLUA 4QHSA 4OQNA 5DO9A 1E99A 1AQUA 4ACAA 2ZVPX 1KK0A 4Z1MD 2ZU6A 1WBBA 3ICQB 2PLRA 2JLVA 4LC0A 2KBFA 3ZZUA 2JATA 4L15A 1R0YA 4BLQA 1R0ZA 4HB0A 1L8QA 1M7GA 2Z4RA 2R2AA 2WMOB 2ZE5A 5CLLA 4LWZA 5J4YA 5DN6D 4MYUA 2DBYA 1G7CA 1UBEA 3RABA 4CIDA 5DLQC 4D6PA 1MO3A 1HUQA 1ZM9A 2AFHE 4L16A 1EFHA 1E1RA 1YRAA 1QF9A 4DSOA 4L4UA 1NVUQ 1G19A 4JLMA 3QXCA 2MMCA 2X1VA 4EQ6B 5GJBA 1W4RA 2GVDC 2C04A 3T5GA 1U9IC 1BH2A 3K0CC 4GPTA 3SHWA 4LYJA 1DELA 4M8NE 3EARA 4QKQA 2VLIA 2CLDX 1XXHA 3ASYA 4KLZA 2HEIA 2IUSA 3FMIA 3AVQA 4JBYA 1NG9A 4A15A 3RS2A 4DCUA 1KYIA 1H8HA 1SHKA 2J0UA 4RJLA 5FPHA 1HE8B 3P20A 2QMUA 2H18A 4CVNA 2QTFA 1KJZA 4LOAA 3WBKA 4ZV4A 2QPOA 4LC1A 4BPBA 2VEDA 1N6NA 2FFAA 4KJZA 4PPGA 5CJ2A 1OIVA 2QQ0A 2JLQA 4C0SA 3LAWA 1E98A 4UKDA 1M74A 4HAXA 4BZXA 3EIHA 1HURA 3HR7A 1S1MA 3A36A 4B32A 3L0IB 2BIFA 2RAPA 4DUGD 5JBQA 3KUCA 3IDQA 3M4YA 4U7DA 4TL8A 2WKQA 4IEEA 2ZRLA 1VCNA 5IK2D 2OE2A 1FMJA 4OQXA 1KDPA 4NCJA 3D6TB 4UNPA 3BJIC 3HDTA 3QPVA 5FOUA 3EWSA 5DISB 4AD8A 1E0AA 1YR6A 4HI0E 3QBTA 2PJZA 2OFWA 5EE5B 4LJYA 2GCOB 2XNDA 3CH4B 4F92B 4A36A 3H1TA 1JXOA 3X1DA 3U7GA 1KI6A 4D81A 2W00A 5CLQA 2FWRA 3MG9A 1SZPA 2VF7A 3PUWA 1JPJA 1J8MF 1E2PA 3WP0A 4Q1DA 2WZQA 3PIRA 3L2OB 3I8SA 4Q18A 2PZGA 2ONJA 4P4SA 4QGHA 2QBYB 2IXEA 3QBVA 1YU9A 3THYA 4URZR 2VHCA 2XSZD 2GZDA 1XDBA 4A9AA 3IGFA 2Z83A 2HT1A 5KDDA 1S4QA 2ZRDA 3IPXA 1P75A 2B21A 4JIMA 3MWJA 3KKMA 4U00A 2CVHA 4A8JA 3RRYA 4BFYA 5EJEA 3IEVA 1SULA 4M53A 3K0FA 3ND9A 2FFBA 2W6JA 1FPMA 2QG6A 1G6OA 1NLYA 4TLDA 3FTQA 2V6JA 3L0PA 4UXIA 3ZVRA 5K8TA 4Q4AB 5KPDA 2IS1A 1GKIA 1XD2B 2IF2A 5B57C 1IXZA 3OEED 4D4KA 4LX0A 3TR5A 3RC8A 3IPYA 4HAUA 2B7BA 4NL4H 2MSCB 4R2HA 1ZUNB 3GLFB 2EFCB 3R8FA 4WXRA 2ANBA 4DDUA 1T8UA 3B8HA 1E2FA 1XTIA 3BS4A 3DMDA 1GFIA 5F9HA 2XZOA 2V9PA 3P27A 1T5IA 4ACBA 3NIBA 3ZZTA 4P0TA 2XTNA 1SXJB 3WXMA 3T5DA 2CLSA 4PR0A 3CWZA 3RS3A 5JEDA 3K09C 1LW7A 8OHMA 4RFSA 4D4LA 1ZVQA 3CO5A 5EXPA 2ORVA 1ZD9A 3NWJA 4K8OA 3MWLA 5J47A 3UG7A 1XX6A 3PQCA 4EJSA 4PZLA 2ZJZA 1EFUA 3DEFA 1FTSA 2J59A 2ZUCA 2ZXUA 3RDPA 2YC4C 2CCKA 2F1IA 1R6BX 1F60A 4LGMA 3RSLA 4UJ5A 5TARA 1RRGA 3FOZA 3PJRA 5JCZA 1U8ZA 3Q8XB 4HAYA 3C8UA 1KSHA 1YZQA 1UBFA 2G0TA 1FUUA 2IA5A 1Q44A 2ODWA 3R7WA 1UJ2A 4GDFA 4ZKDA 2A7QA 4KSCA 1G291 4W9MC 3DKVA 3RANA 4BFSA 1E9SA 3HU3A 4FIDA 2IK8A 4Q4LA 5EP2A 3PUZA 1IJFA 1Z28A 2Z5FA 3CX6A 2C77A 2BCGY 5IHPA 3A1TA 1N5LA 5CK5A 2Q9AA 5GADl 3U3JA 1X1SA 3SFZA 4D80A 1NMXA 2ZROA 2VRWA 1OE0A 1OH6A 4HUQA 1BOFA 4M21A 2GXQA 2IXGA 5BN3A 2JJ2A 4DIEA 3RS7A 3WRXC 3EWAA 2QSZA 4KCGA 1IAQA 1T91A 2FE4A 2XOKA 1MOZA 2WOJA 2ZR7A 5L3SA 1SKQA 3AB3A 4BFXA 4EPXA 2CNWD 2DR3A 3EXAA 1Z0AA 3U61B 4AKEA 5DHFA 5EZ5A 1XXHB 4MKFA
chains in the Genus database with same CATH superfamily
1D2AA 1AKVA 4I4TA 4CT5A 2VT3A 3NT4A 1H1DA 4NFHA 4U4AA 5DNUA 4R8SA 5JJBA 1L5OA 1QKKA 3T9BA 3EEFA 1IIBA 3MRXA 4QOJA 5TS3A 1DAEA 1W34A 3QG1A 3BGWA 4ZTBA 3EPJA 4H4CA 4BP9A 2HBYA 4HN9A 2A9JA 3OVMA 4CCWA 1G1MA 1BMDA 2Y05A 3AG5A 4G3XA 2XJ4A 4KBYA 2H07A 5TPZD 1DSSG 5JZVA 1BQ4A 3TRKA 3A6PC 4GR5A 3KQYA 2NVUA 4GUDA 4M7OA 3H75A 1W4CA 2CHGA 3BFVA 1VG0B 3GC6A 3OLVA 3RUAA 1UEIA 4HZGA 3CVVA 1T4CA 4M8IA 1R6TA 2VDKB 5KIAA 2ODTX 2Y1GA 4N0EA 5AVXA 1M8JA 1SKAA 1XZEA 4G97A 3WZ2A 1CF9A 3KZXA 4RU1A 4ZAGA 4MLZA 5BR8B 2Y2VA 5FBWB 4R0VA 2QYSA 4RDIA 3OUUA 2NZUG 2GHRA 3SQMA 3EIWA 2UYCA 3LGSA 4K0RA 5A3VA 4MRAA 3AHHA 4FOTA 3K35A 3PI6A 4I55A 1TZBA 1MA0A 5JC8A 3DR3A 2JGNA 1YCGA 1I7LA 4FR5A 4UD6A 2B30A 4JFAA 3TOSA 5DTIA 5IRCD 5ICCA 4XH9B 1SXHA 1ZOLA 2QVGA 3HVUA 2YV1A 3QGMA 4I0WB 2BHRA 1W85A 2QTWB 3WBJA 1HQKA 2MIIA 3EEYA 3EZLA 3P5BA 4EG4A 4Q3KA 4F3NA 4X7MA 1U0OC 3VR6D 2ZTSA 3V2HA 1I0ZA 2R8EA 3OIUA 3GFPA 1P1KA 3GVIA 4JODA 2EXXA 3GRRA 2NO9A 2COUA 1G3UA 2DQ4A 3Q88A 2V4MA 3SMVA 3DMTA 4XR9A 4WXMA 4EL5A 2ODNA 5AW6A 2OQRA 4DXAA 5KTRA 4QNRA 1DAIA 1UBMS 2RG1A 3ETDA 3GQBA 4PTZA 4OI1A 1ZGJA 1SZCA 1JHZA 1P4RA 1RWMA 1DU4A 1U9IA 3S7ZA 4R1SA 1I0LA 5KTOA 1RAAA 1QX3A 1X9HA 3HUUA 4BP8A 3OG9A 5BQFA 2PV7A 5L4SA 2VDVE 1P9OA 5IT0A 3GARA 4FYWA 3MWFA 3I9V6 1YQQA 1Y7TA 1RBQA 2FJPA 4QBIA 1YS1X 1XPRA 4QWMA 4FGKA 1TJ3A 1DKMA 1UM9A 1YC5A 4H1UA 1IBCA 4A3SA 2B8JA 3CSUA 5K4AA 1YF3A 1EE9A 1DJNA 2AWOA 4OXKA 1SXJC 3HXMA 1YFLA 4PNEA 4E1AA 1CY7A 1FDVA 5KOJB 3RV4A 3LDUA 1Y3DE 4R16A 3WB2A 3WGHA 3OQBA 4TM7A 1E9VA 1JYEA 5C3MA 3JTEA 5DW0A 2BF7A 1PWZA 4JI1B 2O2IA 3HU2A 1GAXA 1E2QA 3UATA 1EHCA 4IDOA 5C4MA 2QD1A 2AXQA 2GEJA 1Z5WA 2A0WA 2GK3A 2RKBA 5DHPA 4PXAA 1NR1A 4IEIA 4PHGA 4UJ3A 4MGHA 3QPUA 4HLUC 3LPNA 3GWGA 1Q7EA 3KKEA 4MO2A 2BH2A 2QYHA 1KY4A 4LGVA 1JDBC 1Y33E 3ESXA 3FLAA 3I9FA 3RFXA 2AIRA 4HYQA 1SVKA 1V8PA 1YMQA 4P0QB 3CKYA 4TSKA 5LZ2A 4HX9A 4G1UC 1H66A 3ZI7A 3LOUA 4ZAFA 1KQOA 4YMLA 4QFCA 2BGLA 3UAYA 4BFCA 1YI1A 2EFYA 3M89A 4NLLA 2GYWA 1PVDA 2QPTA 3AOEC 3VO2A 2BKLA 1AGRA 3VOBA 1Z4IA 1XKXA 2R48A 3FDZA 4F86A 2QI9F 2G25A 4L4ZA 3NDIA 1V7QA 2NZJA 1RMQA 2Q4EA 3OIFA 2VTBA 5GJVC 1ZAKA 2EWVA 4C2UA 3EZ7A 1BGWA 1C50A 1M72A 1QAOA 1TJ5A 2OAP1 1IXKA 3BB4A 2B2CA 2OCPA 4OYHA 4PAQA 1MQSA 3ZE6A 3NBAA 5C5CA 5F2NA 3PNKA 3BWMA 4PYJA 1MFZA 2ZANA 3IUBA 1P7ZA 5IXYA 1HEUA 3U7RA 4GWKA 1ISHA 3TQCA 4NBLA 2BTOA 4QODA 1NLZA 2PGAA 1HDYA 5KWEA 3AIMA 4XZ3A 2R62A 3ONVA 4HDNA 4IMRA 2Y9MB 3RLFA 3GFSA 2D1SA 3CGWA 1W9MA 1N5MA 1XJ0A 3FWKA 4V03A 4JVLA 5HNKA 1Y6FA 4RVCA 3TIIA 1BZYA 1K27A 1UXOA 1YH3A 4BNWA 3EMKA 1XAHA 1GG9A 4QPJC 1NUAA 5DPMA 1ZK0A 1CY4A 1MJGM 2DFPA 2I6FA 1HF3A 1P74A 3LNTA 1ZL2A 3CRVA 4HUQB 4IG9A 4TTIA 4XGKA 3HJCA 1ZIDA 1DWQA 4DZRA 1Y5IA 2NO0A 2AMJA 4NONA 1XWIA 5GQSA 1B0UA 5TGTA 1BXKA 3JZAA 1NP6A 3QVTA 3TE7A 2QYTA 5BRJA 4LK2A 2OBXA 3OOWA 4WACA 4DZZA 2CMHA 1U8UA 2Z8YM 3G5LA 2XT6A 3KSBC 4CUJA 1Q92A 1XV5A 4MIYA 3QLVC 4MI9A 4WZBE 2WAXA 3PC6A 2I03A 4AC9A 1CEYA 1M10A 3H9QA 3C45A 5D87A 4RA9A 2O8FB 3PFFA 4XB1A 4DFDA 1T3ZA 1QTRA 4BMSA 1T0HB 3VJRA 4YMVA 3RVLA 1YS9A 4UHHA 4RELA 3NLLA 3BMCB 2PMWB 1ZM2A 2ZP1A 1YONA 1KJYA 3LQRA 2W6NA 3OFNA 3RVPA 3SS7X 5KJ6A 1U2GC 2E4XA 3FCUB 3D6HA 3JQGA 4OFXA 1F1BA 5AOVA 2RK6A 2WF6A 3I5YA 1F7VA 5LQDA 5BP7A 1YBFA 5LBUA 5LP6C 1N1GA 1P6XA 2YWRA 1JR3A 1O9BA 4RZ2A 4C2BA 1VJ5A 2ZIWB 3FHOA 1QDEA 3C5EA 3UVEA 2BCJQ 4A1OA 3D4NA 3GFTA 3K70C 1Y8QB 1VBNA 3RAJA 1BG6A 1FFWA 1SHJA 3AGPA 1OLSB 3MWEB 4FCWA 4LF8B 2PWPA 4QRHA 3FY4A 3E05A 3ZEAA 3CVYA 5DM4A 1QYWA 2WRZA 4MPDA 5ALSA 1O57A 1V8BA 2P68A 2XMSA 5AUPB 1JEEA 1Z83A 2BKEA 1E64A 2GBIA 2ZB7A 4URWR 5L3VA 4AJEA 4POAA 3JAWA 2XBUA 4HX5A 1YGYA 4AZTA 1XO1A 1E5VA 1NASA 2ZSJA 4XGQA 4PYOA 5ENZA 1CUDA 4H17A 5CG1A 3QK7A 1WXXA 4GZ3A 3FKQA 1EFVB 1L7DA 1A2OA 1ULZA 2HUNA 1C7EA 5KSPA 4D26A 1MO5A 1SMKA 4A8JC 1UFVA 5A62A 1WO8A 2GBPA 3CG4A 3NB0A 4NARA 5KKNB 4AS2A 5F12A 4GLOA 1TT5B 3OIDA 2Z1NA 1WU7A 1ML4A 4JBXA 1DUIA 1FYEA 3M5WA 1JG1A 4DABA 1VE3A 1UK8A 2FDRA 3ZGNA 2QSUA 1R2QA 1UC4B 3OPYA 3KZKA 1ZVVA 2R25B 3MVEA 2B4TO 1K5HA 1P4SA 2ZPTX 4AUKA 1KY5A 3OLQA 1ZJ6A 3DCJA 2Z1MA 3I9OA 2X40A 3KTOA 1I2DA 3R3HA 3CGGA 4QBGB 1NXWA 3JD3A 4MYRA 2QTLA 4UHFA 1SHZA 3LZ6A 4IRMA 3PLRA 3GN1A 4I2VA 1GL6A 2BGTA 1K7FB 2X7XA 4OLAA 4DPKA 4PLVA 1JDSA 4M1YA 3EXIA 4B3GA 2CXNA 5A3RA 3I3OA 4KO3S 3W0LB 4NR0A 4WY2A 2AUTA 2C9CA 1I4EB 3NGXA 3DAHA 1GT6A 4Z8YA 3K0EA 4ABTA 4M7RA 2IZ1A 1JX6A 3OEYA 4DBLC 3TPZA 3BUSA 5JE8A 4MWDA 3SIPA 3WQSB 1X13A 4I3HA 1LA2A 1P3DA 1RJGA 4HPWA 1P4HA 2YINC 4J49A 1ONBA 1RXUA 1IJEA 3EDMA 3H8VA 2FR0A 3MUNA 3OC0A 4JLUA 2HRQA 4X6YA 5ELLA 1QAQA 4YUAA 3TR6A 2FLVA 1Z5OA 2CZQA 3H18A 3PE3A 2H8KA 4YV2A 3OIVA 3B7PA 3D3WA 4EJSC 5A5FA 4D5EA 1OBOA 1R9NA 2FZGA 3NRJA 3COSA 4LDJA 1UJNA 3CUUA 3MD9A 1GP2A 4DMMA 2EZ9A 2OHGA 5I9NA 2V03A 4JJKA 4S3MA 5IAKA 5SZIA 2WB2A 3C3KA 4GG1A 4ROSA 4YROA 2BP7B 2C94A 1BYIA 1QVAA 2DPYA 1I5OA 2RAVA 3BREA 1C1DB 3Q8KA 3LUKA 4UUMA 3MQ2A 4V0ME 2X0EA 3X1WA 1C5KA 4AS3A 2OYSA 4K9NA 1E2JA 3IFSA 3SU8A 2Z2ZA 4L4SA 3RW9A 4JLPA 1OFUA 1RVV1 4KSYA 1X80A 3ROMA 3AIKA 2ZJ5A 2FZ4A 4GXTA 1DGQA 5DHRA 4BASA 3KQHA 2OY0A 1HKUA 1XTVA 2E5WA 4HDAA 1AS0A 1E7WA 1L4KA 1H65A 4X24A 4DLYA 4Q4AA 3ETLA 4L3VA 3MCZA 3KVNA 4L3WA 4KV9A 2KWIA 2J6IA 2N46A 1PZEA 2A9KA 4IO1A 2EYUA 1RQNA 2JH8A 2ZWPA 1MDBA 4MS1B 4KSBA 3VYWA 4D46A 5K6AC 1VIYA 4RS3A 2F8SA 4DLWA 2ZGVA 3K6JA 4PHTA 1ZJWA 5JJKA 1U0FA 3D1LA 2OFOA 4HMPA 5I4IA 1W19A 4GM1A 3WL7A 3ZDRA 1EXNA 5J4LA 5AOCA 3O9VA 4RMJA 4PZ0A 1G63A 1FFBA 5EKXA 4G5QA 3DE3X 1WHSB 4QZVA 3IKTA 2FSGA 3VC1A 1Q7BA 7REQA 1QF7A 1OLXB 1REQB 3B36A 1VYTA 2V5UA 1G8HA 4Q37A 3EPLA 2C07A 4HBGA 1U5BA 1IY2A 1LPMA 2AD1A 2CHEA 5FADA 4E2YA 3BE5A 3OJCA 2O2YA 3D1VA 3KALA 4F71A 4E4YA 3F47A 4MDEA 2CDAA 4ZN6A 5IKPA 3IT1A 1VL6A 1A76A 3RGWS 3UBTA 4X00A 3T52A 3FBWA 1G8YA 1OAOA 4HDSB 3B3QA 4UAGA 3THWB 2PX4A 1EDOA 1UDWA 3GLTA 3QY9A 4NMMA 4U6QA 1WXEA 4H2DA 3R74A 1Y63A 4V24A 1NUUA 3SZMA 3P2YA 2RGRA 4KHPB 1T9CA 2H1SA 4B3XA 3ZV6A 4R83A 2ALJA 3UAVA 2DYKA 4X41A 2Z2YA 3L8MA 1YQUA 3HNRA 3TOVA 3Q6NA 4LMAA 4RIFA 3KOMA 4JLAA 4CEJA 1DTWB 4KR6A 4DOMA 1DAFA 1QHFA 4GM0A 4PZZA 3PZRA 2QRJA 2G7ZA 4ZEWA 1E63A 2ZTHA 4S2EA 1TYDE 5IJXA 2OECA 4YJ3F 4BTEA 1NAHA 1SXQA 1CZLA 3ZR4B 1YKGA 1ZRMA 2RDMA 4RQAA 3VR4A 7ADHA 2ZRNA 5LYJA 3G79A 3QXSA 3ZCRA 3AJEA 2A5JA 2NT4A 2OOKA 1VDZA 5FWYA 4XYMA 1L9XA 2ZT5A 4HNRA 3ZD7A 3WY9A 4BPRA 5TJ9A 1EFDN 4D0GA 2YCBA 2DH5A 2G28A 3I39X 1EVIA 1RHRA 3HC7A 4IJQA 3VKUA 2V5VA 4K86A 4YMUA 2JDIA 1A4IA 2YN0A 4X1OA 3UWKA 3OJXA 1JI3A 3RAPR 1CQZA 1F0YA 3STYA 4E70A 2X86A 2OD7A 4ZT4A 1TKRA 2AYYA 5KWVA 3WRYA 1V5WA 5EP1A 3HL0A 1Z7EA 5LLDA 1VDMA 3TSAA 3EWNA 3E3AA 4QVGA 5GONB 2XUGA 1N0UA 2VJBA 4WINA 2O0LA 1N6KA 4G2NA 2QDXA 1AQNA 1ODLA 2X1LA 2HYIC 3SXUA 3LQKA 4ZOBA 3F90A 3HHPA 2V1UA 5H9VA 4AMYA 1E2NA 1MAUA 2F1HA 2NVBA 1CS0B 5CDUA 1RIIA 3QKUA 1KEPA 3TK1A 2R1VB 3B2QA 4AJKA 3EASA 2A8YA 4NPCA 1GITA 3EBPA 1KO8A 1B1AA 2GJKA 3DM5A 3QU2A 3TBHA 3L7IA 2GNAA 3RTAA 1U8YA 3J81A 2D06A 3ZHXA 1TYZA 1ZA1A 4LXHA 4XDGA 1C4KA 2QD2A 2PPLA 2FQYA 3DMHA 3H1PA 3DEAA 4V2IA 2FZWA 1THTA 1U2EA 2FH5B 4XWYA 4DLLA 1PVOA 2W2TA 1FBTA 4NYJR 2OHIA 1N2EA 2CBZA 3DBHB 2ZWIA 3FZQA 3ZUPA 4QOHA 4EF6A 2OBYA 3I8OA 2QQGA 3NHLA 2FX3A 3BHMA 4BBZA 2P6OA 3KL4A 1IH8A 2QJTA 4F7WA 5IWAB 2C8JA 1E79A 3JRWA 2P9CA 4L50A 1O4WA 3U2QA 2PBZA 3OPYI 3UK2A 1N33B 3D6UA 3MGCA 1GZ4A 1JVNA 4FE3A 4WXPA 5FPQA 1RYYA 1DO2A 1M2WA 4B7UA 1IJBA 2BRUA 3AR9A 4GBMA 3L7NA 3N2YA 3TINA 4DNOA 4HVAA 1UZNA 4ZO7A 3RC3A 1FS5A 5C32A 4KLRA 2AOWA 5EPUA 1C9MA 4CLEA 3CT4A 4P93A 3AEZA 1CB0A 3ZG6A 1ZI9A 4J94A 3B53X 2OZKA 3JS5A 4XA8A 2H92A 4CMBA 1R5NA 3W2HA 4BKQA 5KQGA 1BE0A 4BQPA 3ANLA 3FWZA 4O2BF 2PUBA 1GGEA 1XZHA 1HLGA 2XE7A 3ZDFA 1AKTA 2ON6A 4N65A 5JSUA 1JUDA 3V32A 1NVDA 1U3DA 1DIAA 2OGZA 2G4VA 2XRMA 3PUVA 4M8LA 2OMKA 2WJAA 1UJ6A 3JVDA 4HFNA 3QWFA 4IVPA 4YJ2F 3EFEA 3WDMA 4CUZA 1N2JA 4NSNA 1D7OA 2HBQA 2RONA 3TJRA 1VE6A 1A98A 2VP6A 1XTPA 2G08A 4G5SA 1J1IA 1JEQB 4FNMA 1K4MA 4Q47A 2AOTB 3KWJA 3MK31 4MUXA 3U39A 4LOLA 4REMA 3BQ9A 2I2WA 5EXSA 5G0SA 5ICFA 3ZJ4A 3U09A 2QPAA 3GLRA 4FFMA 4MH0R 4Z4HA 3AZOA 1KYYA 4GVPA 2WW8A 1TM7E 3E9DA 4F60A 3UJ6A 1EGAA 1MABB 2AJLI 2VHZA 3NBMA 2XUKA 1WTAA 5U4QA 5IARA 1R6XA 1CCWA 3WYBA 3C7TA 2JJ1A 2PAAA 3LO5A 1GN9A 3SEAA 4AJ2A 3UGJA 2HA2A 4H7IA 1JHMA 4JA2A 3A1DA 3U4MA 4MTCA 5JPIA 1BVHA 1F5NA 2XT9A 5FI3A 3H84A 4N3NA 5DSTA 4BX2A 4M8SA 3UG6A 5KOJA 3WKDA 2HSDA 1CZRA 4FMCF 4D5GA 3SDBA 1JQDA 1C80A 5KREA 2YDYA 1X7XB 4FI3C 1FJXA 1SCJA 1OREA 4QDJA 4F56A 1V8DA 2PRSA 1CIJA 1ULSA 2FSFA 2HQ1A 1S02A 4G4JA 4XCQA 1WXFA 4K9PA 5DGXA 2CK3A 2XKBA 3I3SR 3MCAA 1F2UB 1K8ZB 2X41A 2W48A 4IQ0A 5E1DA 4UDXX 3V8RA 2JKVA 2WIGA 2YFHA 4LZAA 3HZHA 3PZBA 3S2GA 3R3XA 1I7SB 3TLKA 2PLFA 5IU6A 3FTEA 1EAYA 4B75A 3GT3A 5FO1A 1RRPA 3GVCA 4EW3A 3UB3A 1CZNA 3DAFA 4H3VA 3X2FA 4ZGWA 3V1LA 2A67A 1UKAA 3MOGA 1RMYA 3DZCA 5E6RB 2XITA 1NF9A 1OJ7A 3SBOA 4EW1A 1JDJA 4YCCA 1I7NA 4FJ0A 1Z8HA 3GI1A 4QLAA 3EPRA 1C1HA 3GZTB 1Y1LA 3RHSA 3ETJA 3WYNA 2QXTA 4DEXA 2W6MA 3HB9A 3SLRA 1U0EA 3KPYA 3HJFA 3K9HA 5H68A 4IMIB 1J7KA 5DW3A 2X9VA 3GYBA 1OXSC 1JYSA 1TT7A 1GSHA 2VC2B 3DBLB 5IC5A 4ETWA 2Y0BA 3MIIA 5CW2A 1I3MA 5ERGB 1WU8A 3I73A 4BFTA 2WWWA 2YQZA 5FL3A 1OKKA 1Z5ZA 1OWMA 3B6KA 4G36A 4F93B 3WISA 4C5CA 4YXFA 1E3JA 2MSNA 1SC1A 2H4WA 2Y1EA 3TQRA 3DQPA 5FRDA 4CHTA 2VKQA 1VJDA 1XU7A 1Z8FA 2Q8NA 2X5NA 4HL6A 3FPGA 4MITA 3IO5A 4ZCPA 1QNLA 1YJQA 3QQPA 3ZWVA 1PDWA 2JI9A 3HA5A 4C4SA 5B58C 3ODGA 1J1ZA 3AVXA 4ZYUA 1D7AA 2VA9A 3UTCA 4KR0A 4UFNA 2UZ3A 1QNFA 2ZAOA 1ZP6A 4L76A 1KDYA 3DTNA 3K1ZA 2O8EA 4CEHA 3DDWA 3TDNA 2XV1A 2ZIGA 3AYZB 3P0EA 3GFVA 4NYMR 1U3CA 4F06A 1Z4KA 1O6ZA 2VXOA 4CV3A 1XQ1A 2IRWA 4FX5A 1AY0A 2BELA 1K08A 2WWIA 3MT8A 4A8HA 5A4JA 1U8AA 4DIKA 2CXHA 1JA1A 4CM7A 5LP1A 4N41A 4N49A 4EHNA 1QR6A 1INLA 2Z0MA 4YRRA 3AU9A 1A50B 1EGVB 2N1BA 3GX1A 4ICIA 4Z53A 1Z17A 2A88A 1W5SA 5DNVA 2PZFA 2JA2A 1E1YA 1L5RA 1CE8B 4JQZA 3DZGA 1GPBA 1PJAA 1PS9A 1V43A 2WUEA 2PYDA 2I3BA 1RQGA 3E1SA 2O8FA 4QU9A 1E8DA 3H19A 4AMBA 2FP3A 3SM3A 3HXPA 4ZI3A 1DBSA 3QPBA 3KHSA 4HF7A 2Z5VA 5GV8A 4UQLA 2CLKB 1XZCA 1S2LA 2DR0A 2JFOA 1IG3A 2ZB3A 5EFZA 5FUYA 2CDCA 4Q6BA 3B12A 4YXWA 4ZGBA 2UZ0A 2GKOA 4AL4A 4RULA 3ICEA 5JSZB 5HG0A 2BDUA 2ETVA 1IULA 2VOEA 1EVJA 3B2EA 4GL2A 1PJ3A 5C1OA 2B94A 3MSCA 3NYQA 2IEBA 4CGYA 5HJ5A 1ECGA 1Y8QA 1X8JA 3P2IA 2FCAA 2VSFA 1E7QA 2IS6A 2HHLA 1VL2A 4QXPA 3SAJA 4KQHA 1RJ9B 2NU6B 1JKFA 3DDCA 2E1RA 4XARA 1ZM3A 3GLGA 1J21A 2QHXA 4Q9NA 3VVMA 3GUYA 4JUDX 5DOZA 2AGVA 4P2GA 4YQFA 2QGFA 3HLYA 2JJMA 3DC7A 1BKYA 2Q5LA 5ALXA 4IJ5A 3F4KA 4GQIA 2WLSA 1WB6A 1WX1A 2YHBA 1Z33A 3N28A 3EZNA 4GH5A 1Z62A 1QO0A 3RC7A 1OGIA 3DB2A 1VMKA 1I4LD 4RA6B 5ER6A 5K51A 3NVMB 2DT8A 3IS3A 4YBRA 3LM8A 1WQ3A 2IPLA 1VIVA 3IDAA 4BNFA 1VLVA 1U1GA 3OTGA 3TSZA 2V7PA 1F4LA 1TT5A 3TZEA 4P36A 3ORYA 5HKKD 3GNTA 4LWPA 4R8MA 4UMVA 5FI1B 4C5AA 5JCJA 1W1UA 2AX3A 4MVJD 1N3BA 5KX5A 4TT3A 1OCEA 1XMJA 4NZNA 4Z0PA 3T9EA 3U26A 4BMPB 4D41A 4IVQA 4O1MA 3OPNA 3R44A 3TWOA 1ZD3A 4ILKA 4WDRA 2I6SA 5AI9A 2WEKA 4LYEA 1XLVA 3TCNA 4UFPA 2P9JA 1QHGA 3DVAB 5TGZA 2PH7A 4IFBA 2F4NA 3P9RA 1SD5A 1TEVA 1T36B 5K45A 1RXCA 2HSEA 1VRCA 3IQWA 2BFCB 1HDXA 3C6XA 3LUHA 2B25A 4HR7A 4QYWA 3U1VA 4AN4A 1R0RE 1UH5A 4XRGA 3CZQA 2F3QA 2CXOA 3FPEA 5IN4A 4HDOB 1AX9A 2G8NA 2WSSD 3U60B 1BDBA 5KOHB 1U7DA 4CODB 3LNCA 5FA5A 4AVYA 2P11A 2ILVA 4IQ8A 2A9VA 1OWOA 1P6QA 2YFYA 2FLWA 2WIKA 1D4OA 2LBPA 3AF5A 1U9JA 4I3FA 4OPMA 1U2TA 2O0MA 3UV7A 4J3JA 1T2UA 4UTXA 2OP1A 5DM60 4CT4B 3N3BC 4DDVA 1DCFA 2GSDA 4B43A 4BJHB 5JAOA 3DBIA 5IKMA 1MT3A 1J9ZA 4TTJA 5A4FS 3OZSA 3KTAB 4Y0NA 2WFMA 4AJ1A 4WZBA 4C4TA 4N0DA 5GVSA 5JHHB 2HPZA 4B3MB 2HZBA 4M1SA 2B8NA 4QUGA 2PXAA 4XYGA 5AVKA 4O8CA 2ZYAA 1NPDA 1D6NA 2H1RA 1RS0A 3I1JA 4XCXA 1C1DA 1DC7A 1Y7LA 2AHOA 5JYEA 2AN9A 1UBCA 1JDNA 3ER6A 1Q3KA 2BL4A 2VNSA 1ZJ4A 4KKVA 4LDNA 5FV4A 2RHWA 4LJ8A 5A4AA 2QNRA 1EJ6A 3FWYA 1PRYA 4E7PA 4B7AA 2GN4A 4XEUA 3WLTA 2HMAA 2PA0A 3Q0TA 2ZWMA 1G8PA 4BZQA 4FFBB 4F3RA 4B33A 4ZDKA 5ICMA 3U4QA 3USCS 4KNVA 3HEAA 2QRPA 2H2DA 3L0SA 1JIKA 2QM8A 4XDYA 4ZRDA 5SZKB 4HNQA 2JGJA 3QEMA 2VK1A 3CH6A 3K30A 4B4WA 5A04A 3A31A 1KAMA 4RWZA 5JD4A 2ZUFA 3RI3A 3MRSA 4X93A 2B98A 2Q7XA 4CWAA 1P61B 3IXMA 1PFUA 4S1PA 1AMOA 5I7VA 1CU1A 4X92A 2DBQA 4HYTA 3GLKA 2C2WA 2CJFA 3BXEA 4R40A 2FQQA 2CKMA 4PPNA 1QLJA 2K7ZA 3DV0A 5A71A 2XCRB 4RLHA 4AO8A 1JHAA 2I87A 2NWQA 5BV0A 2G9RA 2AOXA 1W88B 3PENA 4PONA 5B53A 5JAUA 4M9QA 2G6BA 4OOEA 3W3AH 3IURA 4PXYA 1OFTA 1SOUA 1YR3A 3BB3A 1C7RA 2WM2A 4CKCB 4LXIA 3A4LA 1J8FA 1OLXA 2VYFA 1REQA 4LEIA 1CDEA 4W9NC 3HY6A 1P60A 1ACLA 3NHUA 5IJAA 4C2AA 1NVVR 2CNOA 4U2DA 1F6DA 3MINA 1C9JA 4WLFA 4D99A 1XEFA 3G68A 4HNGA 1QIIA 3O1HB 1DBIA 2IPMA 4C3OB 5A5GA 4J0GA 3THWA 5ULLA 1CWUA 1YCFA 1DAGA 2X14A 1Y48E 3CR7A 2P0EA 2NP6A 4Q9KA 3OH8A 4DS3A 2W43A 5KYGA 3LL4A 4AJ9A 3C7CB 5PNTA 2Z1DA 5F1OA 1YIDA 3NOXA 2FUG6 2JIOA 4V02A 4ZVTA 3OURA 2D3TA 1N32B 3VU0A 1GA6A 3OEHA 4ECEA 4F8YA 1DLIA 4B71A 4BL5A 5BV8A 2R4UA 1DTWA 4INOA 2Z2KA 4B83A 2Y1XA 5IXJA 2NSDA 2AZ4A 1TQHA 2OUIA 4YDRA 2YW2A 4ER6A 5JATA 1UKYA 3DE5X 4P3OA 1PX0A 2VHVA 2FWMX 3O4JA 3W3ZB 3LH5A 3WC4A 1RPNA 3GJ4A 4DLBA 2CYCA 3KJZA 1UKCA 5K0EA 1DLJA 1W5AA 3BRWD 3HH8A 4WDQA 2QW0X 3A26A 1J0DA 1DJOA 1AUVA 2P3SA 1S6YA 4Y6OA 4HB4A 2HKIA 1H2AS 3L06A 3BXPA 4IHKA 4WIAA 4KR9A 3L4BA 2B0CA 5JAQA 4O4HF 2FAXA 3U62A 2Q1UA 5B58T 5MGNA 2X23A 4D6XA 2YX1A 4F04A 2WKRA 1CY8A 3IP8A 4PLWA 4EX6A 2Y68A 4PIPA 1WDMA 2GKSA 2X3FA 1E59A 3R7LA 4IDQA 4ENSA 1NOKA 1Q2XA 3R40A 2OENG 4G1CA 3C6MA 1RHUA 4GAEA 4TYQA 3N0XA 1XMSA 2A5DA 4N0QA 2QVXX 3CMCO 1R74A 4XQ9A 3WLHA 5KNBA 3I6ZA 1FFGA 1HEYA 3OTQA 3KZMA 5FDFA 1TD9A 1E7YA 1YQTA 2WJIA 1X8XA 3DD5A 1KMCA 1N2CB 2G1AA 5DN9A 4AP9A 4EG0A 3I92A 1UOOA 5K8UA 4DV1B 1F8UA 1USKA 3G9QA 2JEOA 3QVJA 3V4RA 4OKNA 4JZYA 2PQ0A 2YR0A 1JLSA 1TPZA 4L5AA 4UBKA 2PDAA 1L5YA 1E9FA 4DEYA 1EFAA 4QGBA 2OV4A 3ESQA 4KREA 4OIFA 1YQGA 2BISA 4IZIA 3G2KA 5TR9A 3R2JA 1WXQA 1HMPA 4L4RA 1O87A 3E9NA 1JTVA 1PT8A 3M6XA 1XZKA 2Y1WA 4YMTA 3MLBA 5LN1A 3DBHA 4JI8B 1B93A 3BWVA 3VHXB 4IO0A 5ALDA 1Y3HA 2Z8XA 3NOQA 2JFYA 5A06A 2PNFA 3UMYA 2IYEA 2XCOA 4AUMA 1U6JA 2AKEA 3DO8A 4CF4A 1NTOA 1ZK4A 2I6TA 4FFPA 4V38A 5AW3A 1Y42X 2I71A 1C30B 3R3UA 3M6FA 1IEWA 3U1TA 1DEXA 2JGMA 3VTKA 4JYMA 4EB8A 4HZIA 1I2MA 4QBFA 3KR9A 4KO8A 1GNPA 1CVRA 1J2YA 2DCUA 2QD4A 4M88A 2QUBA 2EFHB 5SY4A 3H7AA 1MG0A 3OTHA 3WLKX 4ZHQA 3VZRA 3F6RA 1A9OA 3TN7A 2AZDA 3S44A 3V4FA 1BRMA 2B20A 4QYXA 4WLOA 2LR0A 4PAOA 2H85A 2PKQO 3D7KA 3IQHX 2QRLA 3KEQA 4KQEA 3GJSA 4MWOA 1BJRE 4MYDA 3MGBA 3ZZ0A 2RGNC 1QHHB 3EG9A 4X95A 2B1QA 5L7WA 4EB6A 4MS1A 3LY8A 3PLNA 3CR8A 2IF0A 3NAZA 3ZW8A 4BBPA 1N2XA 1GA4A 1E0JA 2OEPA 1X9GA 4IQGA 2W6CX 4LX8A 1TA0A 2VF4X 1JEQA 1LPPA 3EH2A 3GRUA 3FUVA 3L05A 2AOTA 5LR6A 2JD0A 4GZ6A 3NT2A 3FPKA 3VU9B 1UOPA 2VYVA 3CF4G 3AX6A 3W3AA 3RVDA 5M2QA 3TGLA 5FTJA 1PS0A 4ZCLA 5L3RA 2N9UA 3VKHA 3BAFA 5DEOA 1MABA 2EEZA 2X2OA 3DZHA 3N74A 4V3BA 2BFPA 5EKSA 1V6CA 1Z6PA 1WP4A 4YCLA 5I7AA 4MEBA 3PXCX 4I4CA 2DPLA 3RC1A 5GM2A 1DQPA 1BD4A 3RIYA 1M73E 2XUQA 2H57A 2DWOA 1USVA 2WD8A 3IMFA 4OHRA 4ZCTA 3DFKA 4JMPA 1OV6A 4DV2B 1EVYA 4TS3A 3AHGA 1JI0A 2CLLB 2JLAA 4IJKA 5LA6F 3I5XA 1GTL1 1QONA 1X7XA 2QMEA 2VWHA 1O94D 1V25A 1A5SB 4FLFA 3AVWA 1MA3A 3AONB 4JB2A 3O3NB 1VZ3A 4EKIA 4K6MA 2FEXA 1QIMA 3ITDA 3TB4A 4AAYA 1F2UA 4HQKA 1Q1QA 2PQ2A 4US1R 721PA 2D13A 3C4JA 1U28A 2QY9A 2W4IA 1VXOA 2X8JB 3I4CA 4CF3A 1HA3A 1QG0A 2JLZA 1QMGA 3T12A 4ZU3A 3KQUA 3Q40A 2IYZA 5J3JA 1JWAB 2J30A 2VT6A 3A9SA 5MN4A 4DV5B 4QUJA 3H2GA 5JSHA 2JJ8A 4C14A 3HKBB 1PBNA 2RHMA 1NT2A 4Q7KA 4QG3A 4F5YA 2YVLA 4DJTA 2ZRHA 2BLLA 5JD3A 4PC7A 1X8KA 1EG7A 1VSBA 1OWLA 2OBLA 3LKBA 3LUJA 1QGOA 1XK6A 2P6PA 5T4FA 3ZCTA 3DNFA 2GAAA 3KD2A 4CTMA 3ZY5A 2UU9B 4EP1A 3T1YB 2FKNA 1DOAA 1YZGA 2ISSD 3DBLA 4AROA 4YBZA 3O82A 2E4ZA 3N76A 4FFOA 4P32A 3WIDA 2WA2A 5E3IA 1H4SA 4U2GA 1Z8DA 4E12A 4PZCA 3DM9B 3P2EA 3OU6A 3EA5A 5FTKA 1E5LA 5HQJA 1XPUA 3RIMA 5KVCA 4MUNA 4MUBA 5KS2A 4EMUA 3ZZNA 1NUPA 4R5HA 2QD3A 4R1OA 5TQVA 3LHDA 1UIMA 3N0WA 1YZFA 4HNAB 4OCZA 4UOQA 4MUKA 2FPWA 3NHKA 1M83A 4X97A 4TOIA 4Y6LA 1XDWA 1TCCA 4NCNA 1GADO 3V9PA 3AUYA 1BIFA 4H0NA 1QZZA 2YIMA 3R5HA 4TS9A 3WGZA 4CMEC 4E07A 2YZ7A 3TKAA 3EVDA 2AEFA 3RRJA 5KSYA 4DR5B 2Y27A 1SWVA 3ZLJA 2J9YB 3MPOA 4HNUA 4DIBA 1RRFA 1YDWA 3A1CA 4Z99A 2QV0A 3QE9Y 4DQ0A 3KG2A 1R3DA 2ZXEA 2C2OA 4BRSA 1KIFA 1L0BA 2Q29A 4DA4A 3LBFA 4GKVA 4WBSA 5DYIA 4TQAA 4M0DA 3V7NA 1DRWA 3RUFA 1RPZA 3BH0A 1KSGA 1A5AB 3HVHA 2YOHA 2VCEA 2FQWA 5I8PA 4JSYA 2ONKA 1BWRA 1CE8A 1R37A 2ZW9A 4WLUA 5D7NA 1Y6RA 3NDBB 2KS6A 1IUNA 2DT5A 2IEAA 2ICAA 4CMIA 3CO0S 1R5BA 3D7NA 4IDFA 3RG8A 4CQNA 5EHQA 4QM7A 3H4IA 5LIRA 4EO4A 1G0NA 2HU2A 1LJ8A 2P9YA 5C81A 1Q21A 3ML1A 3EFOB 2ONCA 1KVRA 3DFIA 3LYAA 3V9AA 5FJIA 4PICA 3T9CA 1TF7A 1TAQA 2OHJA 3I09A 5BYKA 3O2NA 1KI3A 3QKWA 4QJIA 1IXSB 1HC7A 2PT9A 5B7PA 2D2EA 4TRNA 1YR8A 4H9GA 1FJHA 1GGJA 1N9KA 5H80A 2WHEA 2E85A 4DCJA 4H60A 3AFHA 3INRA 1WXDA 4BEJA 3RG2A 4YTEA 5LMCA 2VDPB 4AI6A 3V6LA 4HP8A 4Q12A 4HCJA 1TU3A 3IP9A 1AZWA 2N47A 1MNQA 1SXJE 1ISFA 2BEKA 5DGIA 4WBXC 1AC5A 4BO5A 5BORA 4TTRA 2FEMA 3AY3A 3GNLA 3VR1A 2CBXA 3KLPX 4YQYA 5DK6A 1T5BA 2EX4A 2ENWA 4FFDA 3IAEA 3W4IA 2F8MA 3MCUA 1DIRA 3JR7A 3GT0A 3T1OA 2LKCA 2Q8PA 3P4UA 3HBJA 5EJ7A 3MD0A 2WM9B 2NUPB 1T5LA 3I45A 1ADBA 1ZI8A 3ANNA 4QUIA 5BWLA 3M6AA 4IUYA 3NBKA 2RBGA 3OQNA 1V0JA 2EARA 1OW3B 3AI1A 4I46A 1UQUA 3L0BA 3D4PA 4OREX 2Q6IA 3EGXB 1M2KA 4RHUA 2W71A 1B14A 1D8TA 1TCVA 2PMCA 4N01A 1JBQA 4LS3A 1R0SA 4FP9A 3MYRA 1A7JA 1NLMA 1PQWA 4ECAA 2FSPA 2Q0XA 3KQVA 3T5MA 4EYOA 1URPA 4BNYA 4RTPA 5GAJA 2EGHA 1X6VA 2ZAYA 2CB9A 3O47A 5FTLA 3FWNA 4CIAA 2X9GA 3I30X 3RV3A 1X7DA 5DBOA 4H59A 1WG8A 2OV8A 3CCBA 2NV2B 1BEEA 2PS1A 3O73A 4PGAA 5FUXA 4BQRA 1PW5A 2Q5CA 4KDCA 5ALGA 3RSGA 1KJWA 1UODA 1NVFA 3DVAA 3UQYS 3EDQA 4TRMA 5BQXA 2VWPA 3PFIA 3TLCA 2JHCA 2I2AA 4Z4IA 4XTCS 3Q9SA