4BLQA

P4 protein from bacteriophage phi8
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
267
Chain Sequence
NSIIDLGPRVQSLMEQLATTKLEEGVKNLDMGSVYEITTVMVLGNSILGFHKGDLVKMVRPSVSARDLIGVGYATASAAVVRQRLIEHKIEAGAELIISGTAGGKTVLTNHYAAQMCAKGLKVAVVSMAEAERPLYGSVLHVFAALHLAAVSDVDVLYVDSLRSVYNELGGNLKGVSRQVDGMLTALDQYARAVNMRVVFTLNPSDDENVDAAVRSVFKTASASMHTARRIKSFAVNGTAFTAETEIHLRADRSNSANRVSGDLVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P4
publication title Tracking in Atomic Detail the Functional Specializations in Viral Reca Helicases that Occur During Evolution.
pubmed doi rcsb
source organism Pseudomonas phage phi8
molecule tags Hydrolase
total genus 88
structure length 267
sequence length 269
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11602 NTPase_P4 ATPase P4 of dsRNA bacteriophage phi-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4blqA00
3OIVA 4I81A 4P31A 1Q1QA 2D74A 3DL0A 4Q1AA 4RD0A 4M9SA 4YQFA 3DDCA 4TYPA 4BFSA 3SBEA 3EPLA 4HB0A 2WZQA 2OUKA 2OCYC 1NY5A 1N6HA 2QMEA 1N25A 1NVVR 5KUTA 3ZD7A 1TEVA 1IJEA 5FOSA 2HT1A 4D25A 4OK6A 3MD0A 3BFXA 1E6CA 4MKGA 3DM5A 3P20A 4CVNA 3UATA 5KOYA 1G1MA 2Q9BA 2J41A 3KKMA 4MGYR 1N5JA 1NVVQ 1W49A 4I99A 2XJ4A 1YU9A 5JHHB 4HLDA 4C0QC 2QUZA 4F4CA 4JJZA 1LF0A 4JLMA 5EE0A 3SYKA 1JI0A 1PLLA 3CB4A 1OSNA 3V00A 4HLUC 1ZP6A 2WIBA 1E9AA 2ZM5A 1FNMA 4URYR 2FH5B 1CF4A 4R2HA 4MKFA 4ZDKA 5FL7D 4XVUA 4KFSA 1MO4A 2QQEA 4RD3A 4ACAA 1VYVA 3B13B 4UJ3A 4JKYA 3K0AB 8OHMA 1G16A 4IXNA 5LBIA 5CYPA 4JIMA 1R7RA 1AZSC 1G8GA 3M4YA 2PJZA 2WBLC 4RZXA 4M0LA 1G17A 3X1XA 2IYZA 1KY3A 3TUIC 1R0XA 4Z54A 3FMFA 2R62A 4V0OA 5CJPA 2RHDA 2VSFA 4BEBA 3THWA 1VIYA 1XPOA 1GL9B 3FOZA 3ZS8A 4IDQA 2GJ9A 2HUPA 4TMTA 1I4DD 2N42A 2ZUCA 3TBKA 3T1VA 1TX4B 4QBFA 2VSXA 3GPLA 4K8OA 1G8HA 1XMJA 2V7QD 1YZLA 4WOPA 1E9BA 4UNSA 4DEXA 3U60B 3V4RA 2O8CA 5E7IA 2NO9A 3OE7D 2E87A 2WKPA 5FL3A 2JLSA 5EXSA 3ND8A 2ZJ5A 1E69A 1K8RA 3OEHA 3UWKA 2O0JA 4LJ9A 4BECA 1S96A 2GILA 3RLFA 5JWOA 4I4LA 3AM1A 2ZIAA 2XJ9A 3BC1A 3HYTA 4GDFA 1KI4A 1SVMA 1DEKA 4LZZA 2CVHA 2HCJB 2Q9CA 3FKSA 3OEED 3QPUA 4FI3C 4MYUA 5DIFA 2IYSA 2X2EA 2Z4SA 4Q7LA 2XB2A 3B2EA 5IK2A 1KSGA 2JASA 3SQWA 2V1UA 3WYGA 1CLUA 3TAUA 4QRHA 1T0HB 1AGPA 2H17A 4G1UC 1BMFD 1SXJA 4M1KA 1A5TA 4AKHA 4JLJA 4IFEA 4V0NA 4ASUD 1R8QA 4PO9A 2PLRA 5BYJA 1L8QA 2NOAA 2NGRA 4MGIR 4X8HA 5CM9C 4XJXA 1W4BA 2JJ1D 4IJMA 3FFAA 4HDCA 2DFKB 2V54A 2J3EA 4Q66C 5FTJA 3AVTA 2IS2A 1GWNA 1E9SA 4MRRA 4Q7KA 1GRRA 4JLPA 4DJTA 1JJ7A 1OXUA 3ZGXA 2IYTA 1FMJA 3BGWA 2FSGA 4H1UA 1UKEA 2C77A 2XTNA 2P2LA 1Q21A 4QHSA 1EFRA 4TN1A 3VU9A 4MH0R 1GP2A 1U94A 2H1LA 2WAYA 4FCVA 2FEMA 3CKLA 1DBSA 3A1WA 4OHYA 2C03A 2PEZA 3T5DA 2W58A 2YWGA 4QJ4A 4WZAE 2VRWA 3MWKA 1AS2A 2BJVA 3LX8A 5BXQC 2W2VA 4Q7JB 1EX7A 1BYUA 1ZU5A 2E1RA 3AGPA 3CR8A 4DBLC 3THXA 2REBA 1P2SA 1SXJE 4CGZA 1DOAA 4IVPA 1P6XA 1MO6A 3RVBA 1FZQA 4RFSB 3DKPA 2ONJA 4JLAA 3SBDA 4L8GA 2JLWA 4DDTA 5HKKA 1TADA 2C9CA 4JSTA 5DLQC 4C2TA 4TTQA 2R6DA 4K46A 4WVFA 1XMIA 4LCBA 1IXZA 1PLKA 3AQ4A 4LJYA 1N3BA 1WRBA 4NYIR 2V55B 4A36A 3FHCB 4B35A 1IBRA 2EFGA 1MOZA 4L15A 4HZIA 1IN7A 2CLDX 5G41A 3RAPR 2MMGA 2FFQA 4QL3A 2GK7A 3CONA 2H5EA 2QI9C 4AD8A 3LW7A 2BBSA 2BV3A 2TMKA 3L82B 4LBYA 3LVQE 1JEDA 2G83A 4LHXA 4NYIQ 4DDVA 2YZ2A 1TTTA 2BMFA 3WYFA 2NO1A 2GZHA 4JBYA 5IDVA 2QU8A 3GLHE 5LB2A 4AURA 5JI3E 3VU9B 1G7SA 1WDTA 2RAPA 1YR9A 2GXQA 2HLDD 1MO3A 1E2KA 1R2QA 4MUAA 4AG5A 3LXXA 1NIPA 1IXSB 4GMDA 1W4RA 2WJYA 5CM8B 2ZREA 1E2GA 3MAAC 1CU1A 5EP2A 4ZKDA 5LDDC 3WMFA 4B6EA 2BHRA 2ZRBA 1E2EA 3THXB 1NVWQ 3EZ7A 1NRJB 4KBFA 1EXMA 5DN6D 4A8JA 4HAZA 1KY2A 3KB1A 1ZM3A 4PX9A 1W36D 1G3UA 1KI8A 1KDRA 3BRWD 1KMHB 3AF2A 5K8LA 4O0MA 3REFA 3SFVA 3LBIA 4JLVA 4BWYA 2VP9A 4JYCA 2WWHA 2FFHA 1U8AA 4J0QA 3IQXA 3MMPA 3NXSA 3FDIA 2CHQA 1VYUA 4TMKA 1G3MA 3CM0A 4JT2A 1Q0UA 1YR6A 3D31A 3N5CA 3AKCA 2RGXA 5L3RA 4DCSA 1XPUA 1MKYA 1W2HA 2DWQA 1XTQA 4F7WA 5CIQA 1ODFA 4KO8A 1XX6A 4Q00A 3QXCA 1W2GA 1U2RA 2H92A 2ZJAA 3AGQA 4RVCA 421PA 4D0NA 4XWOA 1VYTA 3JVUA 3CR7A 4BEJA 1NN5A 5BWMA 1E79A 2QMUA 1VCNA 3K0CA 1FUKA 1KO8A 1XCPA 5FPYA 1DO2A 4JL6A 2ZPTX 5FFMA 1TF7A 4DSNA 1JAHA 2GRJA 2H57A 1XXHB 2ZRCA 2XSZD 2J45A 1N6OA 3W90A 5C1BA 2ZS9A 2BCGY 2GESA 3U44A 2GEUA 2OV2A 1G9XA 2O52A 4NCIA 2W2TA 1KI9A 1XFAA 1Z5ZA 2B7BA 2GCPA 4FXPA 4E22A 1SVSA 4EJSB 5L8VA 3AB3A 1FQJA 4GFDA 4IVRA 1AS0A 1YRBA 2VA8A 1QF9A 1P75A 2AD5A 2ODWA 5GJCA 4RFVA 4ZCLA 1FP6A 1G291 1N5KA 3MG9A 1RZ3A 1LTQA 4HAVA 5B2ZA 3FHOA 1RRGA 1W5TA 3IEUA 2G0TA 4MRPA 4AY2A 1TF5A 3UKDA 1ZU4A 2JIZD 4UQOA 1M34E 3X2SA 5J4VA 1KNXA 4V0LA 2ODBA 4EFLA 3WBKA 3Q8XB 2A2ZA 3LBHA 3U5ZB 2J7KA 4EQ6B 1U81A 2WJIA 1KJZA 2ANBA 1QHHA 3U7FB 3I1FA 3P27A 3VHLB 1G18A 4TMZA 1G7CA 1X6VA 4OBEA 2EVWX 5H68A 1RVDA 3ZVLA 4BE7B 3W8NA 1FTNA 5B57C 3EX7C 4I1SA 4HDQB 1LNZA 2RGBA 4AG6A 3BB1A 1HUQA 4JBXA 1L2TA 1RRCA 2NG1A 1W4AA 4JVNA 4M9QA 2ZR9A 3QXXA 2OFOA 3AF3A 2QE7A 1COWD 3KQHA 1NLYA 4N1AA 2YHSA 4TYYA 4Q4HA 4EFNA 3L0PA 2V9PA 3LH5A 1TF2A 2WSSD 4Q21A 5CK4A 3U44B 2C78A 3TVTA 5JJIA 2FJUA 3D6TB 4TLAA 4U7DA 3E5HA 3GFOA 2XITA 3U7EB 4NCKA 4C4PA 1UM8A 3EPKA 1Z22A 2Q21A 4V0KA 4BGDA 4E09A 3SYLA 4RKFA 3QI2A 3QF7A 4KXFB 3KQLA 1NY6A 4A2WA 4JKIA 3K0FA 3BH7A 4GL2A 3K0SA 1KO4A 3QF4A 2FOLA 4OI4A 4RZ2A 2ORWA 3AUYA 3IO3A 3G5UA 4CEHA 3BS4A 2ZQ5A 4GZMA 1JR6A 2OLKA 1CR2A 4PTLA 3KQNA 5IT5A 1N6KA 1QHHB 4I1UA 1JNYA 1XRJA 2X8AA 4RZUA 3BH0A 2WJJA 2IS6A 3A4NA 4MRSA 1NN1A 3JVVA 4C0JA 4ZO4A 3GJ8A 3FE2A 4LGMA 2ZYWX 1X8LA 4LYFA 4M21A 4PO8A 1Z0KA 3IPYA 4BZPA 3BFVA 4DLZA 1KDTA 2J87A 2XTZA 4NL4H 3W5JA 2VLIA 4OQLA 1G4UR 1Z28A 4DDWA 3GLIB 3U61B 1W0KA 2JLZA 3THYA 2FMXA 2BOVA 2R6AA 2I3BA 3U4QB 2KBFA 4MDEA 2MSCB 1HT2E 4QG7A 5FR1A 1RJ9A 1P61B 4US1R 1ESMA 4PHHA 3VQTA 2XTMA 4NPHA 2RKOA 1CR1A 4FN5A 1B23P 4JZKA 1T3HA 1T0JB 621PA 2AWNA 3OHMA 5GVSA 1BO6A 3KQKA 1CJMA 2FGJA 1E1RD 4Q01A 3RC3A 4ESVA 1DTSA 1T8UA 2YYZA 3I8SA 4ILEA 4DLSA 3CX7A 2QZ4A 5HZKA 2ZROA 1VG9B 2NPIA 3K9LA 4ZV4A 4Z8YA 4CEHB 4O2RA 5C4GB 1OKKD 1KSJA 3EAQA 1KIMA 4UKDA 3U3JA 1WA5A 3IDQA 3TUZC 3L8YA 5TY0A 2PEYA 2QORA 3NHBA 3AP1A 4HYYA 5FL7A 1E2LA 3AP3A 5K8UA 1X86B 2HEIA 3KX2A 1EGAA 1OH8A 5DISB 3ZZUA 1E1QD 3AF4A 1KDPA 2ZEJA 1CJTC 3PEUA 4A6PA 2W6JD 1N0VC 4FMCB 2P67A 1JJVA 3QKTA 4JYBA 1M1YE 5IRCD 2HYIC 5KTYA 5JI2E 1OH6A 4QBIA 4HEJA 2QP4A 4YMSA 1RJ9B 3GJXC 2F3RA 1VKJA 5FOWA 2XZPA 3T1QA 1II0A 4B43A 4ARZA 2OESA 2WOJA 3ICQB 5EQTA 1Q57A 4PC3A 2V7QA 4BLPA 2QP3A 4PANA 2VHCA 4DLWA 1LFDB 3GQBA 1N0WA 3B1WA 1JPNA 4OK3A 2KE5A 3OE7A 3HR7A 2QAGB 3W6OA 5AJXA 4WXRA 4M1SA 3I32A 3QPVA 4BUJA 2RGNC 3LD9A 3R7WA 5F9FA 2ZETA 3A1UA 4M1OA 1M6NA 1OLOA 5JS7A 5J4YA 2IF2A 5AJYA 1E2FA 2DFNA 2CL6X 5KDLA 1TUEA 1L7VC 2QSYA 1G3IA 3OEEA 3SR0A 2F6RA 5FPTA 1R5OA 3OF5A 2PZGA 2ZRFA 4KVAA 1AJEA 3RRYA 5GVRA 3P4XA 1G8YA 1JQJC 4OHVA 2ZYTX 3B7GA 3FB4A 1IHUA 1II8B 4OQFA 5EP1A 2R6GA 2A5GA 4ZDWA 4DSTA 4EPTA 5K8TA 3CX8A 3C5CA 4RCZA 5EUMA 3QG5A 1TPZA 2FX3A 2IWHA 4CIDA 3TAHA 1BMFA 3MWLA 4Q9JA 5HCNA 1LB1B 1SKYE 4B3BA 4ASUA 1A2KC 1PUIA 4PZLA 2EWVA 3P1JA 2JJ1A 4R98A 2GJAA 1Z83A 3UMSA 2P0EA 2KI5A 4PC2A 1OYWA 4TSFD 2FDCA 2HV8A 2VQSA 3C5HA 1E9DA 3F3YA 1NP6A 1OXSC 2GJ8A 2P65A 2VYFA 4EJSC 4CEJA 3NKVA 1KNQA 2B8WA 3NC0C 1MRSA 2IS1A 5B30A 2BMEA 1ZNXA 4BFWA 1FTSA 2IYVA 3KL4A 1AKEA 1ZC4A 2HCBA 2IX3A 4MUBA 5FOXA 4E5UA 3CPHA 2CJWA 1GL6A 3AVXA 5ANRB 2XNSA 5CDFA 5M04A 2AHOA 2ZI4A 1XP8A 3KXKA 1GAJA 4KVGA 3A8TA 5UKDA 1GSIA 1U8YA 2XOKD 3ZIAD 3KXIA 1WXQA 3NTUA 4AC9A 3W3ZB 2O8EA 4B73A 4DCUA 3Q5DA 1OPXA 2FPLA 1QG4A 3DOFA 4OQMA 2VHUA 2HF9A 2O0HA 3ZD6A 1Z08A 4O3MA 1OFUX 2H18A 3PUXA 1G64A 3ZDQA 4X8MA 4M53A 1S4QA 2ZUDA 2R2AA 2ZJ8A 3H1TA 2QTVB 2V6JA 3C16C 2XNDD 4PC6A 5SZHB 5KDOA 1A82A 2A5FA 4ZDIA 5KPJA 2LKCA 2O8BA 4NMMA 3PXGA 4OL0A 1JAIA 2GCOA 5LPNA 4Q03A 2PT7A 2A5DA 5AR1A 4TLBA 2ORVA 1G6OA 221PA 1YZNA 2K5UA 4KJZA 4NZYA 4XWKA 3ICEA 2XX3A 1E96A 2ZI7A 3D8BA 1TU3A 1I2DA 4P3YA 4CEJB 2GAOA 4G5SA 2KJQA 2IC5A 3GP8A 1OF1A 1J8YF 1CP2A 2BVNA 3LLMA 4FMDB 5L3QA 3AVWA 5CDFE 2HLDA 4LUCA 3B1ZA 2Q0HA 3A4LA 3UG6A 3B82A 5AWFC 3MCAA 2UZIR 4NONA 5CLQA 4TYNA 4TL8A 4DWJA 1JR3D 2O8EB 1UFQA 4GOXA 4BQSA 4Z51A 4Q47A 5DN6A 1UBEA 4JVLA 2F55A 4MDFA 4MRNA 2FPKA 3R8CA 1VMAA 5H8WA 4F4IA 1E98A 3AEZA 1AS3A 2YOHA 3MWYW 1KHTA 4G5QA 1XEXB 1Z63A 1KMQA 1KAGA 4LX0A 1UKYA 2X77A 3NDPA 1G7RA 4P4SA 2GCOB 3SU8A 1OIXA 3H0KA 3H84A 5EXTA 2B21A 4DUGD 1ZD8A 1ZUIA 4Q1DA 3GFPA 3RYTC 1XMSA 2VP0A 1GILA 1ZVQA 2QBYA 3PCRB 4G5OA 4MYCA 3DMNA 4GSYA 3R9IA 3CF2A 5L3QB 3AVPA 1L4YA 1F2UA 3L0SA 5FR2A 4HUQB 2XSZA 2IEYA 3WXMA 3ND9A 2ZR7A 2DWOA 1GITA 3NG1A 5KSYA 1AQUA 4R2IA 4BLTA 2GKSA 3UPUA 4LSGA 2FFBA 2QPTA 1ONBA 4P33A 3UANA 5H1YA 2ZUBA 4O2LA 3HU1A 4C7OB 1XTSA 1I4TD 2ZI6A 4BFZA 2O5VA 3CH4B 2OAP1 2OLJA 1CJUC 3NBZC 4B6FA 3AVOA 1GM5A 4C0SA 2JIZA 3KKOA 3OIUA 5FOVA 1Z6GA 3KB2A 3A6PC 2NQ2C 2Q6TA 2ZE7A 3VR4A 4A0FA 4ZI2A 5BN3A 4TTPA 1KI2A 4LJ7A 2GAAA 3EIHA 5D3MA 2OBNA 3A4MA 2IYLD 3QENA 1P5ZB 2ERYA 2X1VA 3KJGA 4NKRA 1SHZA 2LCFA 4C0KA 4CEIA 1QHYA 2IYUA 1KKMA 4DCNA 3BE4A 4HLQB 3ADCA 1GVNB 1XMVA 4HSEA 4Q4AB 2IYRA 4YXWD 4X8OA 5DYIA 1RE0A 1OXTA 4NP6A 3CF0A 2QG6A 4A0HA 1B0UA 1JXMA 5AUQA 1UF9A 1COWA 1T9HA 1W47A 2QAGC 3B60A 4KSCA 4F91B 3BD9A 2YINC 2WJGA 1F2UB 1E9EA 5DI3A 5FBWB 1ZJ6A 3U3MA 5JEEA 4OJKA 4PR0A 4BFVA 1WBBA 2WSSA 2VL7A 4LC1A 4Q19A 2XGJA 2G1JA 3IIMA 2QGNA 5FBQB 4B3CA 1XJQA 4LI0A 4NBSA 1TQ2A 1XEFA 1D9XA 1KYIA 1E2QA 3WNCA 3AP2A 4C30A 2AWOA 1XTRA 1EG7A 2C98A 1XU4A 3GEEA 2JEOA 1OYYA 1DELA 3SOPA 3Q3JB 4LC0A 1SVOA 4W7SA 3QOFA 2CL7X 4JBWA 4XD7D 4TL6A 1DS6A 2QQ0A 3M0EA 2PMDA 4B2LA 5JJLA 4IFBA 3KJHA 1JECA 2FN4A 2F9MA 4M9XA 1J2JA 1OXVA 3FMOB 2RH5A 5D3MB 1OHHD 1M7GA 4PQFA 4A0RA 1W4CA 4U02A 2C99A 3FWYA 4GZLA 4D0LB 2ZRDA 4NU0A 1OXXK 2ZI3A 3LA6A 2D3WA 4A0GA 4ZI3A 2AN9A 3ECCA 4TT3D 4TLCA 1VG8A 3TGPA 4B2PA 1HA3A 1RW4A 5TVKA 5JRJA 2WICA 3LVRE 1XD2A 3M1IA 4KYUA 1M8PA 1QDEA 1RPZA 1TEXA 1VCIA 2ZRGA 4EFMA 2IS4A 2D2FA 2WHXA 3TIFA 4HUTA 4PO1A 2EFCB 4Z1MD 1W46A 3THWB 4QNMA 4PHGA 1Z07A 2IWRA 5A5GA 3QQ5A 1E1RA 1Q44A 2D4HA 4AKGA 3CNLA 3KJEA 1G21E 1H8HD 1GOTA 2JDID 3IIKA 3LNCA 4JLDA 3UMRA 3WBJA 4NYMR 3M6AA 4G3XA 4OYHA 1KJYA 1OKKA 2D7DA 2O8CB 4B33A 2ATVA 3QEOA 3B8HA 4F92B 1E2MA 3EXAA 1E94E 2H7VA 4GRAA 2JA1A 2GNOA 1KAOA 3MGCA 3Q7QA 1M74A 4NYMQ 4NH0A 1XCGB 2ZAOA 3EA5A 3PENA 4PHTA 3IPXA 3VX4A 1E1QA 3CRQA 3GLHA 4FMCF 4MITA 2J7PD 1ZINA 1OIWA 1VG0B 1UEJA 2W2XA 1HTWA 2KBEA 2LWIA 3UWOA 1IQPA 2W6JA 3RS4A 2VP6A 2WWIA 4OK5A 4BRUA 4KSBA 1OFTA 3BB4A 1KO5A 1S2MA 2A78A 3I72A 4KU4A 3RSOA 3SHFA 4HDOB 5K8IA 3AKDA 3L0OA 1XD2B 3IBYA 5TXGA 4URVR 4TQAA 2WMNB 1EWRA 3KXLA 2PLFA 4B2IA 1SXJB 4V03A 4ABYA 4CT4B 1VDZA 2WOOA 3TH5A 1U9IC 3RS2A 1CXZA 2XB4A 2QA5A 4GI7A 4XVQA 3VR3A 1Z2AA 2YC4C 2IYYA 5CJ2A 4PQRA 5DI9A 1RC8A 4HB4A 2FPMA 3FHTA 3SQXA 4XWAA 3L43A 3TQFA 4ON9A 1CRPA 4L9WA 4FW9A 2GBLA 5C46F 5JS8A 2A5YB 2ZSBA 1F5NA 4IVQA 4QOSA 2AD1A 4AYWA 2VP4A 2FZLA 4PHFA 1GUAA 5TV2A 2J46A 4B47A 4IRUB 3VR5A 2IL1A 1IY0A 1ZD9A 1WQ1R 2NIPA 4KAXA 4Q1BA 4QNRA 2J0SA 1TQ4A 1C9KA 4Q4JA 1DAHA 2Z6VA 2NZ8A 4YC7A 2J5XA 3R9XA 3GLHB 3RS3A 2Q9AA 4ACBA 2DCUA 3CO5A 3VAAA 5A4JA 1Z47A 3K70B 3VR1A 3CPEA 3RHFA 3CRW1 2AK3A 1D6JA 5J47A 1E4YA 5JLJA 4AKIA 1X8JA 4IHQA 3QEJA 3MJHA 3O8DA 1UEIA 4BRWA 1OH5A 4TSFA 4Q02A 2ZE6A 1DAIA 3Q9LA 2DBYA 2R6CA 5FBRB 5HCIA 1UBFA 4DT1A 4GNKA 3CRMA 2GZAA 2MMCA 4AI6A 2LKDA 2WKRA 2H16A 1HY3A 1D2MA 3ADBA 3PFIA 3O8CA 5ELXA 4JVSB 3DMDA 1R5BA 5CIWA 3EPHA 5DGXA 2VHTA 1K6MA 1Z6AA 5FI0B 1MR3F 3A36A 3RDPA 2VSOA 3P32A 1FL9A 4GMXA 4OQNA 4LRWA 3K0EA 2JGNA 4D81A 1J90A 2XOKA 2ZRMA 3TVDA 3UG7A 2XZOA 3ZIAA 4QHYA 4Q4JB 2OFXA 1NMYA 1G3RA 2IYQA 1KSFX 3KFXA 5SZKB 2R65A 1N5LA 2FFAA 3LQQA 4TQUS 1IOZA 1KDOA 1KI1A 1Q1ZA 3P26A 2W6ID 3X1WA 1NBME 1AQYA 1JALA 4LPKA 2CK3D 2JJ8A 3CBQA 3IIJA 4LHWA 5FUVA 5HTKA 3B9QA 1P4SA 4Y0AA 1A1VA 1GG2A 1JEEA 4DVGA 1XZQA 2XNDA 3NH6A 1LF5A 2IYXA 4A8JB 1AZTA 3QPWA 2C2HA 3U3RA 4IDNA 4G01B 4GOKA 4DT1B 2A3RA 3WMEA 4O25A 3T5GA 2ZU6A 1M2OB 3DEFA 1W48A 2MSDB 4ZIRA 1EWQA 3GLGA 1UAAA 4LY6A 2EQBA 1Z0IA 2CNWD 2IT1A 3F8TA 2CVFA 4QBHA 1S9DA 4CZ2A 2RGAA 3R8FA 5FTNA 4LPSA 1P2VA 2RCNA 2P6UA 3CWZA 1Z0JA 3I62A 5F2EA 1JR3A 3QNUA 5KSPA 4XTRA 1W0JD 5GADl 5AUOB 4DXAA 3UIEA 5HZHA 3ZYCA 2BDTA 4AWXA 4TMXA 4EDHA 2DB3A 5LB4A 5KNBA 3PUYA 2ZRPA 1Z6YA 1V43A 4BASA 4XSGA 1DAEA 1FP7A 1IY2A 4PXAA 4BZXA 4DCVA 3CRRA 3DPUA 1RIFA 1SVLA 2ZI5A 1FPMA 2F1RA 3WNDA 2YV5A 4DUGA 4KFUA 4TLDA 4TWZA 4D4MA 3GLGE 1QZXA 5FUWA 2F9LA 4KLNA 4ZIRB 1QHGA 1SQ5A 1N6IA 3A1TA 1Q20A 2XXAA 5GJBA 3WNBA 5KYKA 5BYKA 1SZPA 2ZAMA 4CRWB 2A5JA 1ZNWA 5H70A 2BKUA 1JR3E 3Q5EA 4JLBA 4UNNA 1YR8A 1VPLA 1U98A 2EFDB 3EA0A 1JB1A 2AX4A 5KHOC 3PQCA 4DLTA 3X1ZA 1P9WA 1XB2A 1IY1A 4Q4HB 5KNCA 2OZEA 5TMPA 4X8LA 1HE8B 1BKDR 5J40A 4DHEA 5AJVB 1W1WA 5CB8A 1P62B 3MRSA 3OEHD 2VHJA 2YJTD 1GTVA 4MQBA 3KZ1E 1AKYA 3GEHA 3N70A 4W5HA 3IBGA 2QPOA 3MSXA 1RYFA 5CLLA 3PV0A 1E0KA 4C9BA 4CF7A 4WW0A 5E4FA 3CH5A 1T91A 3K0FB 1NVXQ 1EK0A 3ZQJA 121PA 1NNEA 1AGRA 1H8ED 3QKRA 4HAYA 3QF4B 4P4TA 5HR5A 3BK7A 4PZZA 1U0JA 3WRXC 2DFTA 3K8YA 4C0BA 2G77B 4N0EA 4YXWA 3SJBA 4D0GA 3KUCA 1SXJC 2GJSA 2PBRA 3QKSA 4GP6A 1T3SA 5FH9A 4HLUA 4KYIB 2CE2X 1PLJA 1US8A 2ZR0A 1VG1A 2X19A 2OBMA 3QBVA 5EXPA 1QHNA 2XXAB 4H9GA 1R8SA 1HT1E 3I5XA 3SJZA 2AKYA 4D4KA 4ZPXA 1M7BA 4ITRC 2GA8A 4PPFA 3SE0A 4AIIA 2CMKA 4HATA 4LV5B 2QNRA 5JSZA 3VMFA 2G1KA 3U7GA 3EPJA 3I8XA 3S1AA 4JSYA 2O8FA 3VKGA 5L3SA 3IO5A 3QKUA 2V1XA 3THYB 2O8DA 2CLSA 2GETA 3BH6A 3LXRA 4TL7A 1XD8A 3K9GA 2QRNA 1YRAA 3LQRA 5J4LA 2PCLA 1EFRD 1H65A 2ZI9A 1JXOA 2QP9X 5HE9A 2IXGA 4XD7A 2WWYA 1FQKA 3QXHA 2B6HA 3QXSA 1E2JA 2D2EA 2EFHB 4Q9KA 5JJKA 3K70C 2ZSAA 2QL6A 1OHHA 3B85A 4DCTA 3A37A 3QUSA 1ZYUA 3VFDA 4D6PA 3QKRB 3PJRA 5CB6A 1P73A 2ATXA 2GXSA 5DO9A 3REGA 1XTJA 4FMBB 2KSQA 2EYQA 2XZLA 1G7TA 3RANA 4LK2A 2QT1A 2AFIE 2NO0A 3QKSB 3GEIA 4C3ZA 2PMKA 3EC2A 4N3NA 3T15A 3CX6A 3AKEA 2R8RA 4B71A 1ZM2A 2ZSEA 4JLKA 4RKEA 1X8KA 3BAFA 4V02A 4AK9A 4GOJA 1GFIA 1KI6A 4OQXA 3TR0A 1N6NA 2FE4A 1NLZA 4PPNA 5EJEA 3BORA 2IEZA 1BIFA 4LJ5A 4NCJA 5JSZB 1YE8A 4B75A 1Z2CA 4AYXA 1AA9A 2JLRA 1MV5A 1CEEA 1OV4A 1ZUNB 2I1QA 5L3SB 2OBLA 2C04A 1KZ7B 1FFHA 4Z1MA 1ETUA 5J5CA 2O8DB 2GEDA 4OKSA 2BKEA 1NBMD 2GCNA 3OESA 2ZRNA 4TL9A 1SKYB 5J4KA 2WJHA 1H8HA 4ARZB 5LD2B 4BLSA 5JBQA 1HH4A 4JMPA 1PUJA 5KNDA 5TDHA 5CYOA 4HAWA 3CWQA 2GTPA 5L3VA 2EWWA 3N2IA 3AUXA 3EIEA 4RD6A 1KO1A 2FG5A 2HF8A 4RY2A 2ZTSA 3R7WB 2ZANA 5CK5A 1NN0A 1UBCA 3KKPA 2OCPA 4A8JC 5JWRA 1FUUA 4QBGB 2FSIA 2QM7A 2VF8A 4EKDA 1XBTA 2V6IA 2G0NA 5EE1A 1CS4C 2J7PA 2IUTA 4C0AC 3A58B 1YZGA 4NTZA 4EPYA 3I5YA 1OFIA 3NEJA 3QXJA 3BWDD 2J1LA 2WPDD 2NTYC 3EZ6A 1GZSA 5JECA 1P2UA 1C4OA 1EFUA 4IOJA 3R9WA 3T12A 2G9NA 4KV9A 1OT3A 2PCJA 5BN5A 1KK3A 1OB5A 1QHXA 1UADA 2OCAA 3WMGA 2NZJA 1E9RA 3GLFA 4P4UA 1K5GA 2GF9A 1CJKC 2OO7A 4PPGA 1DAFA 2ZJZA 3EARA 4G5RA 4RD1A 3K0CC 3OAAD 1S3GA 1E79D 2Q3HA 1E32A 3AVQA 1Z8FA 1Z06A 1CULC 2ZJ2A 4E07A 4D26A 4Q48A 2ORIA 2RGGA 4DLUA 4MA4A 3AVUA 2IUSA 2ZRIA 4PPQA 2BM1A 5EE3A 3V9PA 1RFLA 4XH9B 3B6EA 2BC9A 3RSLA 1G20E 1Z6TA 4OHWA 4EPVA 4IEIA 1X1RA 4B3DA 1CJVC 4GP7A 2RGCA 4AYTA 1G41A 4MYTA 1DARA 3UXMA 2CJWB 2EYUA 3FYHA 3KFVA 2ZVPX 4A6XA 2ZRAA 4EPRA 1KI3A 5FBVB 4L9SA 2PT5A 2Q3MA 1EESA 3CUEF 3PIRA 3X1DA 4PFSA 4B3FX 4Q4LA 4W5JA 2GHIA 4TYWA 5IHPA 1VCMA 2GXAA 1OFHA 3VTKA 3QY0A 3MJRA 1W44A 1GL7A 1IJFA 1NL3A 3GLFE 4PQYA 1ZNYA 3T61A 4TMVA 3CRVA 3LFUA 4P32A 3AVYA 2AL7A 1R10A 3I3SR 4UNPA 3EZFA 1XEWY 2VF7A 4HI0E 5FTLA 2WIAA 4JVMA 2B7CA 2O8BB 1HE1C 2WWWA 3C8UA 5EZ5A 1YZQA 4JLNA 4F38A 4XTCS 4DLXA 4LV6A 1DADA 2ZYUX 4NCHA 4QGGA 4BFUA 2B8TA 3FKQA 1NMZA 2A9KA 1KTVA 2RMKA 3LO5A 4HB3A 2JLXA 3EWSA 3SJCA 2PJRA 3NDBB 2BMDA 3BBPA 1NSFA 4UNQA 2AFHE 1XTIA 1Y63A 4GT1A 4PSKA 4Q1FA 3ZVRA 4OHXA 3KTAA 3CW2A 3GJ6A 1NF3A 2I1VB 1ZM7A 3WHLA 2W6IA 2OSBA 1LW7A 5G53C 2WWGA 5JWHA 1R4AA 1IAQA 2HDNB 2CK3A 3IQWA 4OI0A 4A9AA 1ZRHA 1KZGB 2QENA 4R7ZA 3T06B 1TAGA 1GRNA 1CR0A 3SJAA 1UPTA 4IXMA 4LYHA 4EPWA 5EXXA 3SN6A 5FBLB 1WB9A 4V0ME 1GNPA 1W36B 1NKSA 3ASZA 5SZJA 2NMVA 2OT3B 3TW8B 4W5WA 4QHTA 4QJ3A 3CLVA 2WKQA 1G19A 5DSZA 2AXNA 2FU5C 2N1BA 3FVQA 4F4JA 4DLYA 2ANCA 1RKBA 2QN6A 1LS6A 1AN0A 2UVQA 3AF0A 4LHYA 4W9MC 3HWSA 4P4SB 2JLUA 1BYIA 4G0NA 4YMWA 5JRZA 3WYAA 1VHLA 2CNWA 3TLXA 2ZJBA 4UJ5A 3VNVA 2N46A 2EW1A 2REXB 1J8MF 1LVGA 1Q1BA 1OJLA 2ERXA 4LWZA 3W6PA 2QBYB 4LDJA 5B64A 1KGDA 1ANKA 2ODEA 4HB2A 4S2EA 4YDHB 4P0TA 4BFTA 1JPJA 3ZJYA 4DDUA 4LHVA 4XOIA 1IXRC 1W0JA 1QHSA 5FUXA 3KTAB 1NJFA 1SVKA 4QGHA 2RB4A 1P60A 3IILA 3TSWA 2CHGA 1P9NA 4IDHA 1DE0A 1D2NA 2HYDA 2QROA 4BFYA 5C2JB 2QTHA 1ZW6A 3RRMA 4LJ8A 2GF0A 5FTKA 2E9SA 3AKYA 1K5DA 3C41J 4LV8B 2ZYVX 1V5WA 2GXUA 1NN3A 2Z4RA 5TARA 2H8KA 2QAJA 1Z29A 2CHVA 3AVVA 3NWJA 2L0XA 5AJZA 1KJWA 5BW8A 1X1SA 3EZ2A 1G5PA 2X2FA 3VX3A 2OEPA 3OFND 3EC1A 1GRQA 4US0R 2IA5A 2IHBA 4CEIB 4Q1CA 2JATA 1KI7A 3KKNA 1OB2A 1R5NA 1ZNZA 3FGNA 2JLQA 1GKYA 2GK6A 3QBTA 2P5TB 3C7KA 1F48A 1E0SA 2BMJA 3BJIC 2REOA 4AKEA 5LD2C 3U2QA 2C8VA 3NEYA 1ZD1A 1U0LA 3THOA 1AIPA 1P9RA 5DI3B 1X3SA 1F3OA 4MGZR 4M1YA 4XIGS 1MRNA 1G8PA 2FZ4A 3O47A 5FPSA 2FSHA 1UJ2A 3CIOA 2DY1A 2PX3A 1ZM4A 2CL0X 3H4MA 1F60A 1FOEB 4DC9A 1NG1A 1KKLA 2UZ3A 2F3TA 721PA 1HQYE 4II7A 2D7CA 1Z3IX 2Z83A 1H8EA 4JS0A 2QT0A 3ZH9B 1AM4D 1ZBDA 4UXJA 5KO2A 2YKGA 2IF0A 4US2R 1VCOA 2VBCA 5EUQB 2JAQA 4U5XA 2P6NA 1S0UA 4RFSA 2ZITA 4ESHA 5JMTA 3G0HA 5G40A 2ODNA 1DO0A 1ZAKA 4DLRA 5C4MA 3RNLA 4GBMA 2P5SA 3E1SA 4BFXA 2ZRHA 3VR2A 1SULA 1IONA 2IYWA 1XJCA 4LJ4A 5CITA 3W9YA 3HJNA 1P3JA 4DIEA 4KBGA 2D06A 4YMVA 4WXPA 2OILA 1NSTA 2AK2A 1Q12A 3ZVNA 3L0IB 4RD2A 3OIYA 2CCGA 4IOMA 1Z0DA 1XJ0A 1FNNA 5FTMA 1SVWA 1OIVA 4HLCA 2QY9A 2CLCX 2BEJA 6Q21A 4S35A 3SS8A 3PEVA 3IHLA 3RRZA 4RSGA 3GJ4A 3TUJC 4WAUA 4A92A 3EIQA 4D80A 1S1CA 5AUPB 3WY9A 3NIBA 1PZNA 4UNRA 4TZ6A 4FCWA 3AV0B 3ASYA 3KDSE 1U8ZA 2RGNA 3HP1A 2VH5R 2G3YA 4FWIB 4PAOA 2YOGA 4ZKEA 3B1VA 1U90A 3GJ7A 3H2YA 4YMUA 3T1TA 1T4GA 3TK1A 1QVAA 3TJZA 5EZ6B 1E2DA 2V8OA 1I2MA 1E99A 2OHFA 1KMHA 3I61A 2OCBA 1BOFA 3GFTA 4C0LA 1SVIA 4POAA 3SNHA 2OXCA 4JLOA 2V4ZA 4M8NE 2PZEA 2ZRKA 3TSOA 4Z8XA 3C14C 1E2IA 2QPAA 2WM9B 2DFLA 2FSFA 1NMXA 1ZC3A 3D3QA 3NC1C 1A2BA 2FA9A 1MH1A 4M2LA 2G88A 1U99A 2QM8A 1ESNA 2GZDA 3DZ8A 3Q7PA 1MT0A 4GPTA 4Q7MB 1NBMA 1G5RA 2QMOA 4A82A 1LY1A 2GWHA 3RS0A 2RHMA 4K81B 2VP5A 3DVLA 2WJVA 3MWJA 1N0UA 1R0WA 1J7KA 4B76A 1E0AA 3Q85A 2YVUA 3G82C 1XXHA 4UXIA 2UKDA 3LW8A 2VTKA 3WP0A 3DO6A 2ZRLA 3LRPA 2F7SA 1ZIPA 3TW4A 2BIFA 4LHZA 4YONB 3K1JA 1T8TA 3CNOA 4EJSA 4PAQA 2PZFA 3QVVA 3TRFA 4KI0A 4A2PA 1ELOA 5E3HA 1CTQA 2FF7A 1BH2A 3O8RA 3LDAA 2WV9A 2FGKA 3PVSA 2ECKA 5G3YA 1W36C 1G5TA 1QRAA 1XEWX 3I73A 1CR4A 4DIDA 4N0DA 5TB5A 1WCV1 3RS5A 1T6NA 5JCPA 2R44A 2PH1A 5E95A 2G6BA 2JJ2D 2WPDA 4XSHA 5AK0A 1E2NA 5KU1A 4WZBE 4EQ6A 1YVDA 3B1XA 1CRQA 1E9CA 5E7JA 2DYKA 3C4JA 3W8RA 4YDSA 1NIJA 4M9ZA 1XNJA 2WMOB 3VKHA 3HU2A 4DRZA 4IOKA 1E9FA 1YZTA 5E7MA 4QC2A 2XAUA 1W5SA 5D3QA 2F1HA 3A1SA 5P21A 521PA 1XXHE 3OAAA 1IN8A 2P3SA 1NG9A 3W34A 2F43A 1N6PA 2MSEB 5F9HA 3KKQA 2VIIA 3FTQA 3MLEA 5SZIA 2B92A 2O0KA 1WP9A 2DR3A 4QJ5A 1ZM9A 4BPBA 4URXR 4FD2A 3QSYA 3PITA 4FMDF 3SEAA 4DSOA 5JHGB 4E03A 4EUNA 3IUYA 4L5BA 1J99A 3H86A 4Q18A 1UDXA 2DPXA 1WMSA 4D2IA 4F93B 4B3XA 1PVOA 1HV8A 1T3LA 1VTKA 3T1OA 3EZ9A 2QRZA 3CZPA 1C1YA 4OHZA 1S3SA 1P7CA 3LX5A 3HU3A 2EU8A 4QGFA 3QG1A 4EAQA 1ZCAA 4JT4A 2ZSFA 5FPHA 2YNMA 2IW3A 4XVRA 1E2PA 1YQTA 1BS1A 1XZPA 3RC8A 4C0HA 2BBOA 3PG5A 5DHFA 3WP1B 1WE2A 1O87A 2ONKA 2GJKA 2OE2A 4ZCMA 1HURA 2GEVA 1CKEA 1DAGA 1Q3TA 3NH9A 3RRNA 4BLOA 2CXXA 4R71A 3U7HB 2J9RA 1NLFA 2RGEA 3GJ3A 4KFRA 4FINA 2GVDC 3RABA 4EIWA 3EASA 3K09A 3KJIA 4LBZA 3W6NA 2F43B 3GLIA 4URZR 1N5IA 2Z5FA 3B5JA 3DZDA 4JJKA 4Q5IA 3U4QA 5DHAA 4HZUA 1DG3A 3U3OA 3BERA 4IEEA 3PEYA 1YHNA 4PC1A 4QFMA 3CZQA 1R0ZA 1TQ6A 3TSZA 3GLGB 3ADKA 2ZU0C 3D7MA 4R9UC 1E4VA 1JQLB 2NPFA 1PV4A 2IXFA 3TR5A 4URUR 1JBKA 2GVZC 4KODA 3SZRA 4NDZA 4H1VA 2J0UA 3X1YA 1GNRA 4C2UA 3EG5A 2C5LA 2BCJQ 2IXEA 4WA7A 1GNQA 1MABA 1QBKC 3W5IA 4DEYA 3PEWA 4BLQA 1S8FA 5KDDA 1P2TA 3EWAA 5HPYB 1KO7A 2ZE8A 3VKWA 4KFTA 1II9A 5GJWC 4B48A 2OAQ1 4JL5A 1SKQA 3JZMA 4CYMA 2C9YA 1E2HA 2FV8A 2ZXUA 1TL7C 3GLIE 2VP2A 4LYJA 1SHKA 2C9OA 2VHQA 3FKSD 4KCGA 3PUVA 1PJRA 1TQDA 1E0JA 2RGDA 3HPRA 5BQ5A 2J59A 5KSOA 2PX0A 4WZ6A 1YJ5A 3QE0A 5IK2D 3DHWC 3U6KA 4HZUB 3ETLA 4D4LA 1D5CA 5DH9A 3HYRA 2CDNA 4QM7A 2YWEA 4DB4A 1SXJD 3HR8A 2ZJYA 4LYAA 5J4HA 1OE0A 2WSMA 4NE2A 2ASEA 1UKZA 1HQCA 4BZQA 2HXSA 3B78A 4M22A 2QAGA 5JCZA 1EX6A 2J0UB 1CIPA 4KLZA 4MYHA 5FUYA 3IKJA 2IBMA 1CBUA 2YC2C 3SYNA 4QGAA 5C18A 1LS1A 5KSZA 1HYQA 3DKVA 2Q3FA 3U3KA 3WRYC 5DE3A 1MABB 4M1MA 4Q9IA 1TMKA 3FMPB 2WTUA 1RRPA 3HPQA 1N2CE 1T5LA 1UDWA 3ZZTA 4MKHA 2CCKA 3I4LA 2CE7A 3NVAA 3L8ZA 3SI7A 4IOLA 1ZMXA 1G3QA 4LBVA 3NHAA 5FI1B 2C95A 1GDDA 3LV8A 3BIFA 1II8A 1N6LA 1YZKA 5JZVA 4OJQA 5F3WB 4MGKR 2WVJA 3OFNA 2W83A 2IUUA 4ZCIA 2W0SA 3K70D 2J0QA 4ERNA 3BFKA 1XPRA 1EFCA 4DLVA 4U00A 3IGFA 2P6RA 1QVRA 4FIDA 2Y8EA 3Q72A 1IN4A 2ZRJA 4I1VA 4TZ0A 4LOAA 2A30A 2WWXA 4TT3A 1US8B 4TMWA 1AK2A 3DOEA 2QEQA 4URWR 1NJGA 5HKKD 1RYHA 1UBGA 1VIAA 1R6BX 3QIAA 1DG1G 2BEKA 1Z6XA 1NI3A 2CCJA 3TE6A 1Z0AA 3E2IA 2Z0MA 1F6BA 4FCTA 1D2EA 3TNFA 3ADDA 2OM2A 3VHXA 1E3MA 2EFEB 3ZVMA 3S1AB 3SC3A 3E70C 4CT5A 4DZZA 2GBLC 4A1FA 4ZDJA 3AH8A 4QM6A 2O8FB 5KPDA 1EFTA 4Q9LA 2JLYA 3QVUA 3SFZA 3K53A 2BM0A 2YWFA 4Y0VA 3GCGA 3PR1A 1J70A 3O8BA 2JDIA 1W7AA 1Q3HA 3VR6A 4CDGA 1D8TA 1WF3A 4A4DA 2ZS7A 1KSHA 1UKVY 3EW9A 1WBDA 2JLVA 2DWPA 2BBWA 4B32A 2NO7A 1ZCBA 2HXYA 1I4LD 4HAUA 4RCYA 3QJYA 5EP4A 1QG2A 4Q1EA 4NYJR 3NBYC 4FWTA 2V3CC 4RD4A 2KWIA 4TYQA 1DVRA 2QMHA 5FOTA 1QHIA 4M1TA 3SDZA 2A7QA 1FMLA 2ZJOA 3LBNA 1NKTA 1T5IA 2Z43A 1U0HC 2R9VA 2FNAA 2VEDA 2OFWA 5F98A 1KK1A 4YMTA 3GJ5A 4NYJQ 5AUNB 2GDJA 3B1YA 3I92A 1O3YA 2C96A 5AJWA 1KI6B 3SHWA 3T34A 4IW3B 2HT6A 2F1JA 2DHRA 4RZ3A 1D9ZA 1YZUA 3LLUA 2XEXA 3RWMB 5G3ZA 5B58C 2QSZA 4D4JA 4DSUA 1L4UA 1Y3AA 3UK6A 2YOFA 4TQ9A 2CBZA 3P4YA 5EE5B 1N6RA 3ZS9A 4RJLA 3FPAA 3TKLA 1U9IA 2IK8A 1MO5A 3LY5A 5HE8A 1GKUB 3ZZ0A 5A0FA 2IHYA 5EP3A 1SGWA 1A4RA 1G8FA 4L16A 2AXPA 4OI1A 3WHKA 4M1WA 3RS7A 2FWRA 4DB2A 4G5GA 2BWJA 3UMFA 3L2OB 5FPKA 3W3AA 1Z0FA 2NO6A 1OW3B 1FX0A 5IF9A 1ZUHA 2W00A 1XD9A 3R20A 4EPXA 3ZLJA 2VO1A 3F5FA 4L4UA 1TUIA 2HJGA 2KB0A 4YLGA 4A2QA 3KQUA 1XEXA 1KK0A 1S9HA 2ZS8A 3B9PA 3VNUA 1P72A 1VECA 1OH7A 3PUZA 4QKQA 4IKEA 3MFYA 4LJ6A 3LWNA 4WBSA 3BB3A 2VPPA 2AR7A 3NBXX 1GIAA 3T35A 3BOSA 1RRFA 2CEAA 3FMIA 3TQCA 1TNDA 4B44A 3KUDA 4PAMA 4BLRA 4LBWA 4B34A 1XWIA 3A1VA 4IDOA 1IN5A 4CW7A 1YKSA 2W0MA 5EE9A 1XTKA 3CF6R 2R6FA 2PL3A 3GLFB 4HUQA 3V4FA 4V0MA 1XDBA 1S1MA 3CNNA 3TMKA 1ZIOA 4NHOA 1F2TA 4UXHA 2HJVA 1IM2A 4TTRA 2BBTA 2QE7D 4TLEA 1IN6A 1YR7A 2OXRA 1DAKA 3U6BA 4MKIA 2J0VA 2ZSDA 4C7OA 3C15C 1G6HA 5GJVC 821PA 1XCMA 4Q9HA 1A7JA 3BXZA 4B3GA 1FX0B 2QTFA 4I1OA 4PSAA 5JEDA 4PZYA 3JZAA 3K9NA 4HAXA 4KHZA 4M4SA 1G4AE 2JCSA 2D62A 2F1IA 3FFBA 3GD7A 1NVUQ 2JJ2A 4PC7A 3ZQ6A 3K09C 3ONWA 1R0YA 2QGZA 1Q22A 3J81k 1LV7A 4D82A 3NBFA 3IHWA 2ZE5A 1DPFA 3HDTA 3K9HA 5DYGA 4NCNA 3CPJB 1VHTA 4QXAA 1KK2A 2WAXA 4Q4AA 1TU4A 5JFGA 1DAMA 2OG2A 1XF9A 3GMTA 2I4IA 3AF1A 4WIAA 1GKIA 3RWOA 2AKAB 1KOFA 2ZVQX 3LAWA 4LJAA 5FOUA 5BN4A 5DNYB 3IEVA 4DKXA 3GJ0A 3N2EA 3OZXA 1HEIA 1EFHA 3OIWA 1M7HA 2YWHA 3DM9B 4OI2A 3PUWA 4A15A 4IDPA 4MRVA 4PSVA 3K0AA 2WWFA 4B74A 1FW6A 4KITB 3F0TA 2FEOA 1F2TB 2BJWA 3MUFA 4JL8A 1Q1EA 2SHKA 1W0KD
chains in the Genus database with same CATH superfamily
1SOMA 3LFHA 1A5AB 5TT1A 1EWVA 3H9QA 3ND7A 1FFGA 3OIVA 4I81A 4RZIA 1WJGA 2UYHA 2D74A 2Q4DA 1UXIA 1OWNA 2PZJA 3EISA 3EVFA 4M9SA 4N7BA 3USCS 5E2IA 4YQFA 4ZJZA 3EPLA 2EWMA 3ZU3A 3V4OA 3A6JA 4X1IA 2FUCA 1L3IA 4KIGA 3UMBA 3Q9NA 2EP5A 3WK8A 1TEVA 1IJEA 2BEVA 4PLGA 1USUA 5J1SB 2HT1A 4D25A 3KK0A 1OX4B 3TL2A 4DDHA 1E6CA 4MKGA 1XIVA 2YCLA 3DM5A 3U48A 5KREA 4Q3NA 3K2EA 5FBKA 1UOQA 1X8XA 2WNSA 3DXXA 2MWMA 3PPIA 5DHUA 2Z3VA 4B4OA 3KKMA 1OROA 1YE5A 2PXCA 3G79A 4H3SA 1J2TA 3C4VA 4KX5A 5IKPA 4HLDA 5ENVA 4LDNA 4G0MA 4YX9A 5IJ0B 1PWZA 3DTVB 4JJZA 4RM2A 2H11A 1W5FA 4JLMA 2QD1A 3SZGA 5K09A 4YUYA 1SD5A 3V00A 4HLUC 5G0WA 2ZM5A 1MD9A 1X39A 1FNMA 2NVOA 4W1PA 4R2HA 1TKBA 1GU0A 1VBFA 2ZDGA 4AN4A 4JGGA 4MS4A 3RVOA 4XVUA 3Q8LA 4KFSA 1GPDG 2VJBA 3B13B 3AYZB 3H2JA 3HUEA 3K0AB 1G16A 1UP7A 1VRCA 4HSGA 1T29A 3G1WA 4JYPA 1YR3A 5F1KA 1AZSC 1G8GA 3M4YA 4RZXA 2UZAA 4M0LA 1H4VB 4Z54A 4GWGA 5EJ4A 1AXGA 3TUIC 4UAJA 2DHDA 3FMFA 1ORTA 4JR0A 3UV7A 4V0OA 1TVMA 1Y1TA 5LXTF 3CJRA 4AS1A 1UXGA 1XPOA 4IJWA 4NS1A 4RENA 3S8YA 2VHYA 4JT9A 4X7BA 4D3FA 2HUPA 2JCYA 4ZVRA 2ZULA 2AYZA 3F49S 3T1VA 4MVJH 3LQ1A 1ZIDA 1R8XA 1G8HA 3RBZA 5FLEX 3DVAA 3V7NA 5E1MA 3GPLA 1XAHA 3FYUB 2JRCA 2QTNA 4Y2QA 1NHWA 1T4DA 2DY0A 2DRIA 3D2LA 2FEPA 1JAZA 3FLEA 5E7IA 5DN6D 5MN6A 4YACA 5CNKA 2DFDA 3H19A 3O1HB 3WJ7A 1UP6A 1QP8A 4BC0A 2XAAA 4O3FA 2CGEA 3B2QA 4FFRA 5HJ7A 1M72A 1BRTA 2YZKA 1RWKA 2CY0A 3C3WA 3OEHA 4EB3A 5A3RA 3AM1A 1JSRA 1P74A 2GILA 4GDFA 2XJ9A 1IJBA 2IP4A 1TM5E 2CVHA 2IGTA 3GAZA 3NTQA 2Q9CA 3QPUA 3TNDA 1FU8A 4XQ9A 5JH7A 2MYUA 4AY6A 3QVGA 3KYCB 5DIFA 1KMNA 4GKKB 4M7RA 2CXRA 4CG2A 4AMBA 4PHCA 3ELUA 4OAQA 1E1CB 3WYGA 3WQHA 4JU8A 4JXXA 1TM2A 3G9UA 3TAUA 4J1TC 3Q3CA 1QM5A 3U49A 3WO0A 4EATA 1JDZA 1T0HB 3DAFA 2IE0A 1L4FA 2CHEA 1Y3HA 5LQRA 1AGPA 2VJYA 3MJDA 4PSUA 1W5AA 3LZDA 3FUTA 4IFEA 4ASUD 4YPVA 5LVAA 1R8QA 1Y33E 2PLRA 5BYJA 2QX7A 4X8HA 3G7UA 1W4BA 2JVJA 3IUMA 4G09A 1G6Q1 3GGCA 1Z75A 4JCOA 4TS9A 1SK9A 1QONA 1XRLA 4I9UA 4NEHB 3BL6A 5DP1A 1CUCA 4MW6A 5FTJA 3W1WA 2NO5A 3T7JA 4ZI7A 1EA7A 4YYEA 2YIJA 1FPQA 1CEQA 2WFAA 1GRRA 3AEKA 2QLLA 3PGJA 4J07A 1NZJA 1ORDA 3H0EA 3UJHA 1OXUA 4FYMA 4RL4A 4W9NA 2WTEA 4QJIA 1YCHA 3WK7A 2P40A 2Z58A 4J90A 3JALA 3Q8MA 3MTQA 2B4RO 3ZY4A 1GTSA 1UMDA 1EFRA 4I14A 2AC7A 3A3PA 1CDZA 1RWBA 5K8JB 5C7OO 3AWIA 4OJYA 1GP2A 2H1LA 3UHJA 3P0HA 1L4EA 1XZJA 3OCCA 4LZJA 3CKLA 3CYFA 4F86A 3KPYA 2C03A 4P2BA 2YWGA 4MVJE 4QJ4A 4WZAE 3Q9SA 2O2SA 2DQKA 1RT9A 3LX8A 1YQDA 4RMIA 1N8KA 4G97A 4OU4A 4Q7JB 2IZ7A 1X87A 3V4VB 3HSSA 4CCWA 4ZAGA 4AZ0B 2REBA 3L0ZA 5FWYB 5I51A 5KWVA 5M34A 1E8NA 4DREA 4GPZA 4CGZA 4Z4EA 1DOAA 4FE3A 2QTMA 1CJSA 5B55A 3R6DA 3FZEA 4C43A 1TD9A 5DTMA 3G8AA 1WMDA 2CEKA 1G2IA 3DKPA 5EWJA 2ONJA 2BMVA 3VVCA 2GUWA 4E88A 2O48X 4ZQCB 5GZ6A 5HKKA 3V8PA 1CRLA 4QATA 3CF4A 5CLHA 3P9RA 4C2TA 3KVYA 4CKEB 4TTQA 2R6DA 4LCBA 1IXZA 1PLKA 3AQ4A 3Q2IA 1WRBA 4NYIR 3IP8A 1IBRA 2JZNA 2EFGA 2R60A 1QAMA 2NUTB 1YJQA 2WV7A 3AI7A 3H5RA 2MMGA 3NP9A 4HRYA 1FNCA 4LNAA 2NYAA 4BMOB 2Q6OA 3C39A 1GZ7A 1RYZA 1RZVA 1FDVA 4R4JA 4AD8A 1BWRA 2BV3A 4MKXA 4PZ9A 1AT1A 2AFVA 2WUGA 1C1HA 1JEDA 2G83A 3ISVA 3OU2A 1G59A 2V74B 1C7FA 5IJ9A 2YZ2A 4BP3A 1APBA 1TTTA 2JH3A 3GJQA 4NZPA 3WYFA 4AURA 1K5HA 3I2GA 1YGPA 4V1CA 1OJ7A 2ILVA 1I3OA 3U81A 4BDSA 2RAPA 2DPGA 1V9CA 2BLNA 3CUSA 3IXMA 1BGVA 1P4HA 3TD6A 4R05A 4TZKA 4PE5B 3HLTA 4GMGA 2KW5A 3X44A 1W4RA 2WJYA 3PUKA 2ZREA 1E2GA 3BZWA 3KZMA 3MAAC 3K1AB 4A27A 5MGNA 5BMVA 3ZZ1A 1CU1A 1PTKA 3ROKA 5EP2A 2DLDA 2XT0A 3TVYA 1L5GB 4IDDA 4B6EA 1RYYA 1FFAA 3BSYA 4ITVA 3A9VA 4RORA 5EGSA 3WOVA 1NRJB 2JGMA 2XYPA 3GCZA 4KBFA 4R8VA 3RJMA 5GM1A 3FG9A 5C31A 1EXMA 4GRDA 2G70A 4EK9A 1RR6A 1ZM3A 3BMXA 4MV1A 1G3UA 4NS4A 4RZQA 3A7DA 3BRWD 2Y71A 1EUCA 1KMHB 4I6JA 5K8LA 1ABFA 2UUOA 2I6XA 1G8SA 1WHSA 1UK9A 1FTYA 2YJ6A 3PNKA 2VP9A 3DTYA 3UBMA 4G0VA 3BTUA 1BE1A 4EBFA 3HXMA 2WWHA 1K75A 4FZ3A 5U4XA 1M2OA 1U8AA 4J0QA 3IQXA 2UVPA 3HBNA 4JY7A 4M38A 5BVHA 1M1NB 1G3MA 3B36A 4B6SA 3N5CA 3TZLA 3AKCA 5JNUA 2B34A 4WZBB 1X7DA 1ISJA 2XGGA 4GVPA 3TCXB 4F7WA 1JWLA 1ZPDA 1SQFA 4CQLB 1N36B 1XX6A 4CNQA 4XWOA 421PA 4D74A 3P9CA 3A0RB 1ZD2P 1VYTA 1QCYA 2YDYA 3JVUA 4UBMA 4ZT6A 1U3FA 3SOZA 3EF3A 3NB0A 2K2QB 3DZBA 3TSYA 1XCPA 4DSNA 3MEQA 2ZPTX 3I1YA 3I2FA 3FETA 3RCBA 3B7WA 5HBGA 1XXHB 4CV0A 1UXOA 2RHGB 3I34X 3E3MA 2J45A 2B1RA 1XLTA 2PZKA 3W90A 4YRLA 5C1BA 5CG2A 2NZUG 1RZUA 2BCGY 3PQFA 4NCIA 1XTPA 2A84A 1OI2A 1XVIA 2O52A 2W2TA 1Z5ZA 2GCPA 1RQGA 4B40A 1D07A 2HHJA 2NXEA 2QN7A 3AB3A 3OQHA 4G5HA 3BIWA 4GFDA 4RLFA 4K0KB 3D8SA 4MPPA 1L7DA 2B37A 2II6A 1NJ8A 2CXPA 2ODWA 5GJCA 3I2JA 4ZCLA 1FP6A 1KFJB 3MG9A 5I3ZA 1RZ3A 1VBKA 3T3DA 2R47A 3FVRA 1SKMA 1BHJA 5MFZA 4CODB 3R0IA 3C4QA 1AC5A 1KVRA 2CHUA 1XTVA 2ZCJA 4ND6A 3CLKA 3R5FA 2C7OA 5JU6A 3C3AA 1N33B 4OL9A 3N6VA 2PGNA 2GN9A 4I3HA 2C4NA 3MGGA 3QELA 1YCDA 5EESA 3LBHA 4P2GA 3NBAA 2BP7A 4BVEA 1ZGCA 2DKNA 4G81A 3OTOB 3UC5A 3PICA 4S04A 2COKA 2WUVA 3EOAI 3JXEA 3P27A 4OAPA 4R5HA 4PXYA 4J3NA 5AKLA 2VHWA 1X6VA 3QIVA 4OBEA 5GY7A 2EVWX 3ZVLA 1ZS9A 4BE7B 1P0CA 3BMNA 4IL5A 1OWOA 2WYWA 4PU0A 4D3SA 5CW1A 5A4FS 3RAEC 1QJCA 3JTEA 3F97A 5LXTA 1N34B 4ZAXA 3UENA 2D0IA 5EJ7A 4XJSA 5G4LA 4XEHA 4AS3A 1LLQA 3L7DA 5E4TA 1MX9A 1ZJZA 2RHRA 4HGPA 3RV4A 1COWD 3JWGA 3KQHA 2JF0A 3BFJA 4CHGA 3VC7A 1FY2A 2C9BA 4Q4HA 4OY3A 4YRRA 2WJ3A 2X0IA 3DG9A 1TF2A 5KC9A 2Y9PB 1L8AA 1YAHA 4RTMA 2C78A 2XA2A 4KXYA 1VZ3A 4AP5A 3D6TB 2CYCA 5HK8A 3TZCA 3E5HA 4GKJB 2XITA 2FPPB 4NCKA 2F62A 3G2QA 4LGCA 3EPKA 3KR0A 5CLJA 4BGDA 2XMDA 3BJEA 1DQSA 3EBLA 3IB6A 1LVUA 3QI2A 1DC8A 3FRHA 3NRJA 4KXFB 2H07A 3H97A 2XWJI 1RPAA 3VNRA 4A2WA 4C7VA 1EAMA 5CFOA 4ECAA 3NRCA 5H9VA 1HWYA 2CNOA 3CN7A 2YIDA 1KO4A 2F8MA 3AUYA 5T67A 4ZVLA 1SFRA 1I7LA 9LDBA 2OLKA 3NWBA 4MUEA 2HIGA 3ZNOA 4ND8B 4ESEA 4ZOCA 3H5VA 1YDHA 1IUKA 1YZ3A 4C07A 1L8OA 2BKLA 3BD7A 1GQYA 1SU4A 2GCIA 3LPNA 1AKNA 4KMSA 5KYGA 1ZK4A 2PSJA 4MA0A 3BH0A 1N2CA 2YWDA 3AB8A 5DXFA 3A4NA 1OLUA 3JVVA 4OOFA 4UE3S 4V39A 4WFKA 1X14A 4RV4A 4ZO4A 3V3TA 1JKJA 1I9GA 3NS7A 1J2UA 2HPZA 3IPYA 4QA9A 3NTVA 1N9GA 1P3Y1 1KDTA 1PEDA 2H1HA 4EX6A 5F2KA 4F9GA 4OQLA 2G76A 1PFGA 1O95C 2FXVA 3H5TA 1A1SA 3FVVA 4MX8A 4RS4A 4DDWA 3U61B 4KWHA 5MN5A 2XDYA 3WLFA 2L82A 2R6AA 2I3BA 5HEKA 4BKOA 4EI8A 4RADA 4MDEA 4UE6A 2PYZA 4QG7A 1ISHA 3U1VA 4RTOA 1GL3A 2QTGA 1RJ9A 5LUBA 4QBKA 3KVVA 1ULHA 3H6GA 4US1R 5HF8A 1ESMA 2OVBA 4PHHA 3VQTA 4RPKA 2FR8A 2NVBA 3SNKA 3AY3A 1B23P 3FRJA 1T3HA 1MXHA 2AWNA 5GVSA 3W5AA 1WY7A 2W6MA 3NORA 2RI1A 4Q01A 1EE9A 4NNOA 3RC3A 4LYDA 4DLSA 5EIWA 5HZKA 3CX7A 2PUBA 2B8EA 2NPIA 2PKQP 4H1HA 4YJ2B 4B6GA 2OQRA 5LN1A 4CEHB 4E21A 2ZZKA 3EAQA 3QRWA 4B7ZA 1KIMA 2DF8A 2WQZA 3A6GA 3SKVA 1P1HA 2J3JA 3IDQA 4MWEA 3V7YA 3G2NA 3WKAA 3H9UA 3L8YA 4XX0A 3B51X 3V8BA 3KTOA 3ZCVA 1KVTA 2FWAA 2QORA 5I47A 3AP1A 5FBZA 5DHQA 3COYA 4BHTA 1Q0TA 2GM3A 3QFRA 2AOXA 1OH8A 3PJGA 5C4IA 4IQ4A 2HQSA 1C80A 4WRRA 2EEZA 3HCWA 4IWXA 2EJUA 2JHGA 3TW0A 4HAOA 3UMYA 4OX9B 2ES4A 1CJTC 2DMRA 1EX1A 4IH4A 4UFOA 3Q6NA 1VPTA 1ZUNA 2TMGA 5BRAA 3QKTA 3SKYA 1UQTA 3IAHA 1L4KA 1MP0A 2WEKA 5HOEA 1L5OA 2V0CA 3RC2A 5JI2E 5KTYA 3HACA 5HZGA 1K06A 1X7ZB 1W59A 2I2FA 5KU7A 4JT8A 3GC6A 4LFAB 2R4UA 5ECDA 3DDOA 1PJBA 5FOWA 4C88A 1VKJA 2H00A 4G1CA 4BJ5A 1T8RA 2QZ9A 2OESA 4ARZA 3DLPX 1Q57A 3JQ7A 5DYYA 1H2EA 4KVZA 2VHCA 3QHAA 1GARA 1LFDB 4B7CA 1P9OA 3B1WA 4WWHA 4OK3A 3OE7A 3VR3D 3ZOZA 3FUUA 3DFZA 4BIMA 3IL2A 3K71B 4M1SA 1PV2A 1W85B 5IC6A 3B20A 4BUJA 4ZZ0A 4JXKA 2W9XA 2TMYA 5F9FA 1Q84A 1U5CA 3RTGA 4QUIA 2YN0A 1GJRA 1UJ4A 4ZQGA 2VCEA 2OBXA 3ZQKA 1WUYA 1OR8A 4KIJA 3T7IA 5KDLA 2QSYA 3MC1A 5L51A 1Z73A 3OIFA 4YDQA 3OEEA 5F5NA 3ZDQA 1R5OA 4KVAA 3A2KA 3ENZA 3NO4A 3QU4A 1RJGA 4OLBA 1PX0A 4MXDA 1FDSA 4ND5A 3KSDO 5B7QA 4X44A 1YB7A 2X9LA 5PGMA 4UZSA 5KOIA 1THGA 2FN7A 4WPGA 5EHIA 3TLGB 2R6GA 4ZDWA 4DSTA 2JW5A 1M75A 3ENWA 4PLHA 1T36B 4RA6B 1H94A 1TPZA 2FX3A 3OD5A 3RC9A 2W90A 3TAHA 4KTTE 3MWLA 1C5KA 4AO6A 5HCNA 3NWPA 1CQJA 2HADA 4Z9XA 3LCMA 4B3JA 3AMVA 2C3MA 1PUIA 3KO8A 1MIOB 3LYUA 2G9ZA 2ZJ3A 1NF9A 2JLAA 3C0KA 3P1JA 3C7TA 2ZR8A 3FROA 4WOKA 3SEZA 4JBLA 1XKXA 3V55A 3H5WA 1AQIA 1TFUA 1Z83A 2KI5A 1Z16A 3ZCSA 1PD0A 1KWGA 2QTZA 4R83A 5HTOA 3WAJA 2HV8A 2PZMA 2VQSA 1E9DA 2J5BA 1OXSC 1T2UA 4QVGA 1OASA 3V8MA 1VHDA 2XGMA 2FTKE 2E6UX 4HNHA 5F1YA 4EJSC 4E1AA 4UUQA 1QO9A 2Z2IA 4PGFA 4D97A 4H17A 3WB0A 1MRSA 3UAYA 2IS1A 3N0XA 5KTTA 4HEQA 2AQIA 4HF7A 1MV8A 1RQXA 1FTSA 2IYVA 1PDWA 1AKEA 5C52B 2IX3A 3ESRA 4WN9A 1T9BA 3G9QA 2B1JA 3HDJA 4INPA 5FOXA 2OBYA 4E5UA 3CPHA 2OXFA 1ODTC 5ANRB 3WIDA 4KXNA 5CVUA 1EUDA 1QTRA 2G4LA 5CDFA 3OZSA 4H15A 1XP8A 3IDSA 1GAJA 4KVGA 2P4QA 4QT0A 3HKDA 4DV0B 1QP0A 1DUSA 1WXQA 2JK0A 2WKSA 2G8LA 4J6EA 3GPCA 3LK6A 4Z4CA 1KMMA 1MAVA 1QG4A 1JYEA 1H9CA 4Q3DA 2HF9A 4M99A 2O0HA 4UM9D 4O3MA 1S8AA 3PUXA 1VLZA 2W8BA 4M53A 2V7BA 4UZFA 2RD2A 4QQRA 4V1CI 1KQ3A 1MA0A 3AK4A 2DQSA 1UJMA 2B7LA 3L1KA 1CQIB 2QTVB 4M89A 2XNDD 1EYZA 1QUEA 1XKQA 2PFKA 4OHKA 4PC6A 5SZHB 4A8HA 2A5FA 4R0MA 5KPJA 2X40A 5IT9A 4NMMA 2NT3A 1M5RA 3DDUA 4O29A 5A5DA 3JTMA 5LPNA 2PT7A 1HOTA 3P0JA 1Y7PA 4DLKA 4POOA 3QX7A 3EXIB 2KQUA 3RVDA 1FNBA 2XQVA 3ANYB 1F2DA 2K5UA 4NZYA 1UOOA 1KEPA 2I7VA 2Q1SA 5A3VA 1HTBA 1NKVA 1I2DA 5LNK1 2HRCA 1LSUA 4UBOA 4Q3CA 3LCJA 4F2DA 2IYFA 3ORRA 1A9XA 5I01A 3NONA 3GP8A 4CIVA 4WESB 5FHRA 1EVYA 5E6UB 1J8YF 3E18A 1VSVA 2VRBA 5L3QA 1BQ4A 1QFYA 1GCGA 2HLDA 2PQ6A 3TCKA 4EHJA 1LK7A 3B1ZA 2J3HA 5EZQA 1HRKA 1KPHA 5EQJB 3E9QA 4QU5A 4RMJA 2PQ2A 3OWXA 3L7OA 5AWFC 4B4UA 1P45A 3AY7A 1IZ8A 1SU8A 1Y6ZA 2VT7A 3IA7A 5SY4A 3LLCA 4E08A 2PGAA 4OMUA 1JR3D 3EZGA 1ZR4A 5LQDA 4GC5A 3Q88A 1EDEA 2BELA 1XTTA 2FP3A 2EP8A 1X77A 2IEGA 2RARA 4TV8F 5IYZB 2O8EB 4GOXA 2K6GA 2O1EA 1XXLA 5HIAA 4L5IA 4U3JA 1E7SA 1U7XA 4IRXA 4JDUA 5KNBD 2X7JA 3WLLA 3UO8B 1H3FA 4MDFA 3N87A 3ETEA 1IZ7A 3ABIA 3EOZA 3HL4A 3BTVA 4JP5A 3UV3A 2CFOA 2IH4A 2X8BA 1MO2A 3IAS1 1R4NB 1DG9A 4NHEA 1UKYA 5L6MB 3M5CA 1G7RA 1MLDA 3FCUB 4P4SA 5DCLA 3W8FA 2GCOB 3WKEA 4N5DA 3H84A 2NSJA 5EXTA 2H9IA 3SF8B 2X1MA 1LVHA 3NR2A 4Q1DA 5DLPA 1YZVA 2XY4A 5BUCA 5JBIA 1B6RA 1XMSA 4MW2A 4N5HX 4NAVA 3WZMA 1K2VN 5IP5A 1USWA 1ZD3A 2TS1A 2WZDA 3KHUA 1JVBA 1H3NA 4P34A 4MYCA 4AXBA 1FDRA 3EXEB 3KC2A 1RAGA 2E89A 4MWZA 4ZOEA 1B74A 5C8YF 1XVUA 5FR2A 4HUQB 2IU0A 1JX6A 2QG4A 4U7HA 1SD1A 2ZR7A 4TKLA 3UMVA 1F4LA 5ECYA 1Z4KA 3JVIA 5FQOA 1D2GA 3MTGA 5KSYA 2FKNA 2J6HA 1NJ2A 1IWBB 2NX2A 3HHPA 3UPUA 1O6ZA 4FB5A 4G2NA 1YNSA 1FS5A 4XKJA 3L7MA 5KNCD 2ZUBA 2PRYA 4OG2A 4C7OB 4DJJA 1XTSA 1I4TD 3ER8A 3CH4B 3L6DA 4EA6A 1NVKA 5A04A 3U1BA 3NBZC 1CJUC 2C2XA 2DTXA 3FDZA 1NVTA 3W4IA 4NNJA 1D2RA 1UMBB 4IIUA 3EQZA 2GBGA 2BGMA 2QVLA 3A32A 4IIBA 4MWSA 4YWJA 2NQ2C 2EKPA 2EBUA 1QKIA 1IUNA 4QOJA 4D5GA 4BB6A 4XJTA 4BVGA 2R8YA 4ZI2A 4TTPA 5IULC 5KYUB 4D9BA 2SECE 5LYJA 3I23A 1NATA 2F8LA 2V03A 5CM2Z 3F2VA 4FLFA 3P2IA 2OBNA 2JKVA 5K8VA 4C0KA 1P5ZB 1C0EA 4CEIA 3JD4A 2LCFA 2PGLA 3ENNA 5TT0A 3ZKAA 1QHYA 1OTHA 1WR8A 2W2KA 3QOWA 4G2TA 3WLOA 4HLQB 2C8KA 1GVNB 2D1QA 2ZDQA 4U5QA 4X8OA 5DYIA 2VR1A 3QTTA 4QQ8A 3VGJA 2PSEA 4ARUA 4CG1A 4NP6A 2QRMA 1KP2A 2DR0A 5AUQA 1UWKA 5J2TB 2QAGC 2JBHA 2QD2A 4AJ1A 4D79A 4IJ5A 5KYXB 1F2UB 4CR6A 5HF5A 4GI1A 4TXNA 4BFVA 1GUBA 3GJTA 4GI5A 4Y8VA 2WSSA 1IFXA 4GX1A 1RPTA 3IIMA 4X71A 3T99A 3W5SA 3SWWA 1XI2A 4NBSA 3LLSA 4LVNA 1P4AA 3HABA 1LSJA 1LWNA 1E2QA 1PWEA 2IU4A 4WOJA 4YJGB 3WNCA 3NJ4A 5I7HA 2C98A 1D0SA 1C1DB 4I2NA 3D3EA 2VHEA 3OJCA 1XZNA 4GOLD 1ZK1A 1MB9A 1TKRA 1P77A 2NW6A 3Q3JB 4LTNA 3WGKA 5KYTA 2RE8A 3FAZA 3IPLA 4JBWA 1N57A 3OPYA 3RVKA 3FX2A 4FDVA 1BKYA 4YJ3A 4V24A 3HK2A 4IFBA 3KJHA 2FN4A 3QM1A 5ESDA 2PZ8A 5EA2A 1ZXXA 3RSCA 2IH2A 4BXOA 1W29A 3DXFA 1OHHD 2P4SA 5D3MB 4A0RA 2XZDA 3ADOA 5A6SB 1BA3A 4F6LA 2C99A 2AV6A 4GZLA 5C34B 1ZVKA 3PC8C 2ZSIA 3AIMA 3O82A 2YWRA 5HMLA 3PWZA 4IICA 1RP7A 3LA6A 3V2GA 3N6XA 2Z95A 4AM8A 1VMKA 2VZ9A 5YASA 5G4KB 3R3HA 2RK6A 3K6RA 3RIHA 5H02A 2EJBA 1D4ZA 1WUHS 4H3VA 1VG8A 3OF3A 1QS0B 2W5UA 3HCEA 4JFAA 4XDGA 2VT2A 4B2PA 1NVFA 5GGXA 4RA9B 4WZAA 5IVKA 5DM70 2F64A 2WICA 4KWEA 5AOCA 4KYUA 1QDEA 4Y7DA 1RPZA 3KR9A 4XB1A 3D8TA 1PYOA 4ZTZB 3TEFA 3LG2A 1R6TA 5CVJA 2IS4A 2DUWA 5DBFA 2D2FA 1VLQA 2PVCA 3GLKA 1D4AA 1ZBQA 4IY1A 2CFTA 3BYZA 3KQVA 5B1YA 1SA0A 3WWPA 1VHQA 1GDTA 3QQ5A 1CS0B 3ZY6A 2PMWB 4ZVSA 3G59A 1HZZC 2BF7A 3G9TA 3U3DA 3UMRA 1B6SA 2JDID 2W4MA 3L9XA 1KZ9A 4NYMR 1T1IA 4EZEA 3M6AA 4G3XA 4KMOA 2B69A 1KJYA 2DX7A 2CDCA 2IRWA 4U2DA 4DUPA 4F92B 3CVUA 1E2MA 5ALXA 4I1YA 4C08A 3NAGA 1XQXA 3EXAA 3L5OA 3IOBA 1MVOA 1P0QA 3SM3A 4F1WA 1JQ3A 5JAOA 2GHTA 1KAOA 3DD1A 1JXAA 3MGCA 4XDYA 4TTAA 2ZAOA 3R7NA 3PENA 4ZYTA 2WZBA 1E1QA 4C6TA 3EGDB 4FMCF 4YAEA 3TLKA 2J7PD 1ZINA 1OIWA 1UEJA 2FR1A 3QNWA 2LWIA 3WGUA 2W6JA 2ST1A 2VP6A 2WWIA 4AY4A 3GD5A 3FWHA 2Q50A 4P6VF 4YFYA 3FN4A 3SHFA 5MGBA 1RXCA 5H3HA 3TLCA 3A3NA 2GEJA 3JATB 2VJOA 4R9SA 4RPLA 5JAQA 4Y2SA 3BE8A 5NULA 3N75A 2PLFA 5FLKA 1XLWA 5TRTA 1SXJB 4V03A 3ZWXA 4AJPA 1X3LA 4CT4B 2VPQA 3BJZA 5CNIA 1UJNA 2BR4A 3MLAA 1SJ9A 5HS4A 3TH5A 1U9IC 1V26A 2GCEA 1CXZA 2P9JA 3RS2A 2X23A 2BKXA 2ECQA 4BRSA 4K6OA 9LDTA 4XVQA 5F7XA 4FDTA 4PNZA 3PNYA 1FYXA 1WKBA 3J81A 2YC4C 4HN4B 3DP7A 4I8DA 4DR5B 4YRQA 4EFDA 3KYDA 2FPMA 4HB4A 1ONOA 1ZL2A 3FHTA 3R5HA 1HYBA 5EJ9A 2CJYA 3E7PA 1PR4A 2PRZA 1QV9A 2G1UA 1T4BA 5HILA 4FW9A 1CQPA 4GYKA 1BG6A 1P1RA 3D1VA 3T3EA 2ZSBA 1HM5A 1FMTA 4G63A 1L1QA 4HDRB 2XWQA 4RSHA 1QFMA 4RW0A 5L3ZA 4BKQA 3C6ZA 5BOVA 5KOJB 2VP4A 4LOLA 3T7TA 4B47A 3JQRA 4IRUB 4XWYA 5AI8A 4HPXB 1U7UA 4P4NA 1TQ4A 2AH5A 2FPIA 3GG9A 4W1SA 3UN1A 2Z6VA 3ZXUB 1DINA 1WXIA 4YC7A 2V8BA 2J5XA 4DA8A 3R9XA 3GLHB 4XYMA 4EKEA 4E12A 2ZTLA 1B1AA 3FTDA 3RS3A 3CVXA 1IZ9A 3BE6A 3C5WP 2DCUA 3CO5A 3OJXA 2PGOA 1TO6A 3VU8A 3K70B 3VR1A 3CPEA 2BJHA 3OCUA 3CRW1 3N6RA 5CVEA 3ZHSA 2NTVA 4WQMA 5J47A 1FLDA 4IHJB 3IOMA 1NNSA 4TVBA 5JQGF 1WETA 3ON5A 1YNOA 1ZRNA 1DT5A 2DUNA 1R15A 3L1HA 1QORA 3MJHA 4J9UE 5EWLB 1M2WA 3DHVA 4QO7A 4TSFA 5BWLA 3EOBI 2R1TB 1RQLA 3C3YA 4N3BA 4V1CB 4QOGA 4ZOLB 1UBFA 5G0SA 5HCIA 5EWMB 5COQA 1NI5A 3HCFA 4X61A 2MMCA 2YJGA 3NHUA 4AI6A 2XHZA 3DAPA 4S1OA 2WKRA 1T2DA 3SC2B 4ZQIA 4PFKA 3EQ8A 1XZEA 2OD7A 2TRSB 3KB6A 3PFIA 3DE2X 3QP9A 3AEQA 4PS1A 5CYGA 4JVSB 5ELXA 3DMDA 1R5BA 3FZNA 1YS9A 2ZT6A 3MINA 3NCHA 3PYLA 4XA8A 5CIWA 5JXWA 1CFZA 4HH4A 5DBIA 1B8PA 5AOAA 5FI0B 4TWRA 2IE8A 1E6UA 3P32A 2QQ5A 4DVJA 3GFBA 5EJ8A 1HDCA 3CEAA 3K0EA 4H6VA 4BX9A 3T9CA 1Q7CA 3OOHA 1LBQA 4QHYA 1GZ3A 4D3YA 2OFXA 1ULAA 1NMYA 4R1UA 5DWDA 1E5LA 1KSFX 2XRMA 4XIJA 2CLKB 4G1MB 2PMEA 5JYBA 3RYCA 3B1FA 3V34A 4CMCA 4I4IA 1E8DA 4TQUS 1Q1ZA 1KI1A 2X9VA 1IJKA 1YC2A 1TYDE 2KLHA 1ORRA 1VIMA 2OL4A 2R3SA 2VDMB 1CVRA 2W2NA 3IIIA 3IVXA 3R0VA 3R77A 3L8DA 4Y6OA 3SZOA 3FLBA 4JC5A 1ZMOA 4Y0AA 1NW5A 3DSRA 3NCTA 4WKCA 1BN6A 1JEEA 3LS2A 3TLZA 2BFMA 1VYHA 3L77A 2XRFA 1W87A 2CLIB 2Y05A 5AXBA 5CLFA 2VDWA 2OAGA 3QEBZ 4IDNA 2V4MA 4G01B 2NN3C 3HP4A 4GOKA 3HNOA 3L7KA 2C0QA 3KOZA 3PPXA 4O25A 4TXJA 4C7KA 2AMYA 2AZDA 1C0PA 5LMCA 1QP4A 3PC4A 1TDJA 3DEFA 5EIFA 4YP9A 4ZIRA 3O2JA 5LM3A 1F9AA 2IJGX 4EG4A 3GLGA 5FEMA 3RJ9A 1GR0A 5JAMA 1QIFA 1O6GA 4ENUA 1Z0IA 1FC0A 1EZ4A 2CNWD 2IT1A 3F8TA 4JOQA 5EGNA 3A6DA 2UUAB 2LRHA 2V9ZA 4JUBA 1J5EB 4YRDA 1YB1A 3C7DB 3CWZA 2E4VA 1Z13A 3O4IA 1Z0JA 4I9HA 5EN4A 3V2UA 5FAKA 1KOGA 3I62A 4JNCA 4GBJA 3FM9A 1A77A 1GXSB 2H4JA 4J03A 1Z4MA 3CG0A 4J7XA 4OXXA 1DXHA 1C2YA 4P7JA 4PX2A 5AKHA 1KS9A 3UIEA 1XRSB 3OQIB 2WFLA 3ZGOA 4GPAA 4NICA 2VRCD 5LB4A 4WK4B 5I8WA 4J9VA 1XAGA 3RTDA 1X7WA 1Z6YA 3WHPA 3MPOA 4GX0A 3KP1A 4O8CA 3VYTB 3ZBUA 4OSPA 1CUGA 1GVHA 1V37A 4KQ9A 4XSGA 3HCBA 1ZISA 2X0RA 4PXAA 3CCFA 1VL5A 3RIEA 3VYUB 3IE2A 3WICA 4R1MA 5DTJA 3DPUA 3G8YA 1U7WA 4OGKA 1YD7A 2A35A 1ITZA 4MEJA 4B0OA 4XDHA 4EY8A 3EXFB 4ND3A 16PKA 3UZUA 1FPMA 1BU8A 1I01A 5THKA 4DUGA 3H3JA 1OBFO 4KFUA 2VXCA 1RBMA 3K5WA 2W42A 1FXSA 3G1UA 5C8ZA 5CBKA 3IJRA 2HHCA 5DK4A 1DBPA 2YFYA 1GY8A 1YS2X 3NOVA 1QHGA 4P81A 1SQ5A 1N6IA 3G0IA 2F2TA 2OQ2A 4WJLA 2XXAA 1YIDA 5BOSB 5GJBA 3WNBA 5KYKA 1AKWA 1SZPA 3MYRA 2A5JA 1YC5A 2VAPA 3DAYA 4FEGA 1E5QA 1JWBB 3SHQA 4C03A 5JXIA 3FPCA 3DLTA 2BI8A 2CC2A 4JLBA 4JU9A 3PLRA 2GR9A 2FMFA 3FNHA 1YHYA 2AX4A 2ZJ4A 2FPWA 4P3XA 5KHOC 1O95D 1R6DA 3X1ZA 4LDQA 4XEUA 4ZQFA 1CY0A 1IY1A 1I6LA 5ARBA 3K4PA 2HWXA 2OWDA 5DRYA 2YY7A 2FQ1A 4U7GA 3IAFA 4W8HA 1E3EA 3W04A 4DHEA 4W5QA 1P62B 1UFOA 3EWNA 3MRSA 5DCYA 2CXOA 1ATZA 2QN2A 2VHJA 2YJTD 3G6KA 4NG5A 1CUDA 2C84A 3BMCA 2G80A 2PGDA 1QPBA 3D5TA 4W5HA 4KPEC 3TDMA 4S24A 4WNYA 2VYND 3LPCA 3PV0A 3ZWNA 2P8SA 2B35A 2C3PA 4XYLA 4BNTA 2J3IA 5E4FA 3CH5A 3SZ3A 1PU2A 1D5WA 1GAWA 1Z8NA 3ULKA 2HMWA 2ONZA 1EK0A 1AGRA 4COOA 3QKRA 1JDBB 5CVCA 2Q8QA 3AUSA 3S68A 1YMUA 3GIDA 4K9KA 4YXWA 3SJBA 1DIAA 5KMGA 3KUCA 1LPOA 1YRYE 1NWHA 2PSDA 4EOGA 1T3SA 5FH9A 4Y67A 2CE2X 4TTVA 3T0IA 4BL5A 5IBCA 3LGAA 2JFNA 2Z09A 1F7UA 5F73A 4X94A 5JNRA 4UEQA 3D7SA 1X7XA 2VJDA 3SJZA 3WX0A 3K5IA 4RK4A 4J4TA 3ZHCA 4OFWA 4JMLA 2J3MA 5HQJA 4L75A 1J33A 2G1KA 2E0IA 3GEPA 3GZNA 3LOPA 2DR2A 3PCXA 4BTLA 1QAQA 3A6KA 3IO5A 4W9NC 3THYB 4NJOA 3Q0TA 1YTUA 1Z5VA 2VTEA 4LOJA 2CLSA 1MGOA 3AHIA 1IBSA 1E7RA 4D02A 1QK4A 1RSZA 1XD8A 1H22A 3K9GA 2AMLA 4BO4A 3LQRA 5HFNA 2ZUEA 5ELMA 5CD1A 5TMBA 3BZUA 4FSHA 1H65A 3IQDB 2RHTA 2E1PA 1E5XA 2VHZA 4FFMA 1T5DX 3DCNA 2P6PA 3WG9A 4XVCA 5JAIA 4GWKA 3WLHA 1DC5A 1WAMA 2C7BA 2X5OA 3GU3A 2E82A 3M5PA 4HL6A 4IMPA 3ZHBA 3S81A 2B6HA 4PGMA 1E2JA 2D2EA 3L18A 2XA9A 3FOCA 4MICA 5GPBA 4GPEA 3UCEA 3B85A 3O73A 4DCTA 4ARVA 5A4KA 4B34A 4D6PA 4EGCB 1QIKA 1SAYA 4YR7A 3M4NA 1RLOA 1GFSA 3LL7A 2R7LA 2XVYA 3O3MB 1DTWB 4PWZA 3C6MA 2EYQA 4R81A 3VUFA 4PTYA 4EHIA 2XZLA 2W2LD 5I7FA 2XE8A 2AFIE 4UEOA 1N1GA 3PJDA 3GEIA 4TGLA 3ZXXA 1FFXB 5JD5A 4ZTUB 4OH7A 3DQQA 3CX6A 3IXLA 1UWVA 4QXQA 2FOXA 3E1KA 3T1YB 1ZM2A 3WWYA 2HK7A 2PN1A 4RKEA 4U9UA 4GOJA 1YOBA 1KI6A 4MWOA 5TQVA 1N6NA 1RC1A 2EBWA 4PQEA 1NLZA 3MIZA 4ZYXA 1NBEA 2V7TA 3BORA 1PL7A 1BIFA 4KN8A 1J1ZA 4LJ5A 4NCJA 5DN9A 4EKGA 4MW1A 5JSZB 4RU1A 2OQVA