4BLUA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
279
structure length
279
Chain Sequence
LSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
total genus 93
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4bluA00
1RI2A 2ORED 2JH8A 3C0KA 3B3JA 1YZHA 2DPMA 5FCDA 3PFHA 4M38A 2FK8A 1TW2A 4PYLA 2V7EA 3CJRA 3HM2A 3ME5A 3SMQA 4NECA 2IPXA 5ICEA 2V74B 3BGDA 5BW5A 5C0OE 1QAQA 1R18A 4OBWA 2ZCJA 3PS9A 3KR1A 3UJDA 3DMFA 1I1NA 3P9IA 2Z6UA 1M6EX 5FUBA 3JWGA 2B3TA 4RVGA 5ICCA 5ICGA 1O9HA 2ZULA 3KHKA 1R8YA 1N7JA 1JSXA 5LQUA 9MHTA 3C6KA 2NXEA 4JXJA 2Y1WA 4IKPA 1IY9A 1RJGA 3OE5A 3HA5A 3LDGA 5E2BA 1YB2A 3GJYA 2ONYA 2NXNA 5DXJA 3UZUA 4PYJA 3KPUA 5JR3A 2Y1XA 4GOOD 5GINE 4X61A 2GB4A 3PFGA 1RJEA 1NBHA 5GP1A 3EVFA 5K0CA 3GGDA 5E8JA 4ER5A 4E2ZA 5CCBA 3P97A 3FTFA 3FYDA 5CVDA 3LKDA 2I9KA 1XXLA 4ZTBA 3O7WA 1ORIA 3PX3A 2GS9A 1UIRA 3R9XB 2C7RA 3NDIA 2ZSUA 4O29A 1X19A 3SGLA 5T6BA 2LD4A 3HCCA 1L3IA 3KR9A 1NKVA 1KPHA 5HIJA 2HR1A 3KPVA 2ZFUA 4GEKA 3MAGA 2P7IA 3ER8A 3S68A 4PYOA 4MIKA 4Y2HA 2C7OA 3SSMA 1B42A 3MTIA 4IWNA 1YF3A 1FJXA 3GCZA 4WXHA 4K6MA 4AZTA 3FPJA 4YMHA 5E9JA 3IYLW 4DCGA 1QZZA 2IP2A 2NXCA 1VIDA 2ZIFA 5LR6A 3HVJA 3IHTA 5FA8A 3R6TA 2JHPA 2B78A 4YV1A 3ELYA 3MTEA 4P7KA 4X60A 4DZRA 3SSNA 1P1BA 2AOWA 5DRYA 3KQTA 4QDJA 3NTVA 2GLUA 5EEHA 1EAMA 1JR4A 1SQGA 3TKAA 3LECA 4YV0A 4KVZA 4RWZA 1KYZA 4HSGA 1MJFA 4DKJA 3BKXA 1AV6A 1XJ5A 3EPPA 2WA1A 3FUUA 3BXOA 2NNWB 5K09A 2N47A 1FBNA 3EEYA 2AN4A 5E1BA 5HEKA 2CMHA 4QPPA 5KS2A 5EMLA 5D1NA 3UJCA 1HNNA 2ADMA 4CTKA 5BW4A 1PRYA 3KQMA 2PV0A 1M6YA 3GO4A 4CKEA 2R3SA 3P2EA 1XDUA 4PWYA 3CKKA 1JTFA 3VSEA 2OB1A 3I53A 4C03A 4E33A 4QTUB 3M6WA 4OX9Y 3ERCA 5K0GA 3BGIA 4OA8A 10MHA 1XCLA 4QTTB 3DTNA 3HCAA 3DP7A 3LL7A 5CVEA 4AUKA 4R6WA 1YFLA 3VYWA 3DUWA 2YR0A 3UJ8A 2AOVA 5DSTA 2GPYA 3GRUA 2XYQA 4V0QA 1YFJA 4G56A 3VC1A 2P1DA 3B3FA 3FRIA 5FHRA 1G55A 1QAMA 2ZW9A 3OFKA 1UFKA 5CVUA 2ZZKA 1U2ZA 2G8NA 5FTWA 2NP7A 3BKWA 3TM5A 2QRVA 4RTPA 2A14A 2H11A 3LBYA 3G89A 1R74A 5EOVA 1FP2A 5CIYA 2IBSA 1R00A 2YVLA 3BGVA 2Z6QA 5ICFA 1L3CA 4FZVA 3M4XA 4E2YA 3GXOA 4Z2YA 3T7TA 4ATNA 5LQKA 1Q0TA 5EPEA 2BR4A 3EEOA 4OQDA 3NJRA 4RTNA 4RYLA 2OPBA 3Q7EA 1X1AA 5EQJB 2QM3A 1EJ6A 4KDCA 3M6VA 4H0NA 4PYNA 5LQJA 2JG3A 3KPYA 4YMGA 2ZIGA 4R8RA 2P35A 3RIEA 3TLJA 2GH1A 1INLA 1JSZA 3MQ2A 4HGYA 3A27A 2Q41A 2PWYA 4FSXA 5LQCA 2UZ4A 3TFWA 1VP3A 4XUEA 5EKXA 2VS1A 2AOXA 1JG2A 1DUSA 2ERCA 2BR5A 2ZBQA 3BWMA 3CCFA 4PIMA 5K0LA 4OQEA 4MTLA 3HVHA 1OR8A 3SVZA 4E70A 3EVAA 2O06A 1P1CA 3ORHA 4PGGA 3LCVB 2OY0A 4V0RA 4BY9E 8MHTA 5BP7A 4YUZA 2BM8A 2P3QA 2JH9A 3E7PA 1FPQA 5M5BA 4C08A 4R8SA 3ER9A 5BXYA 2ZVJA 3JWJA 3MERA 1VL5A 3EGEA 2AVNA 3G2OA 5KQSA 1RI4A 5LQRA 2I6GA 3PTAA 4RTOA 3G2MA 4LWPA 3KQSA 5E1DA 1IM8A 3UFBA 2PSSA 1L9KA 4RTRA 3HVKA 3HTXA 3SXJA 3EVZA 4P7JA 2B9EA 3DXZA 1DCTA 3SSOA 3EVDA 4M37A 1TPYA 2G71A 1X1BA 1ZQ9A 3B89A 3GRRA 4FT2A 4CWAA 3EVCA 4E2XA 2ZBRA 3I9FA 1O9GA 5DX1A 5K0NA 4A6EA 4EMSA 1H1DA 5DSXA 3NWEA 1NW3A 5GWXA 5EZQA 1XCJA 3C3YA 3I5UA 2G1PA 4IV8A 1YZ3A 3BZBA 4GF5A 1D2CA 1NE2A 1T43A 5HZMA 4LECA 3GIWA 5EMJA 5FWAA 3AXTA 2PY6A 3LCCA 2ZIEA 3TKYA 2O57A 2G72A 5DTQA 5C9ZA 4CXMA 1NBIA 4E32A 5CVJA 4AZVA 2C7QA 4RV9A 2AOUB 3HCBA 3CJTA 4CTJA 3R24A 1L3BA 2GA9A 2XYVA 1VP9A 2YTZA 2YXEA 3EGIA 3FPEA 3KQVA 5EIWA 5GIPE 2E5WA 4YUVA 1NW7A 4L7VA 2B2CA 1G8AA 3FPHA 5EHGA 1BC5A 2JJQA 2VDVE 3G2PA 3LCUA 4PCAA 5F2KA 3EGVA 3K0BA 1EG2A 1XDZA 1VLMA 3A26A 3LHDA 3NVMB 1VBFA 2PT9A 1Z3CA 5F2OA 2HTEA 5CD1A 3I64A 2P7HA 2AR0A 5DRTA 3OU2A 5HOQA 5HIIA 5FWDA 3FRHA 1SVUA 1P91A 3DR5A 5K0JA 3G7UA 4GUAA 3KQWA 5HILA 3K6RA 3OZRA 2YX1A 1F38A 2IH5A 1JG4A 3PX2A 4BP3A 3P9NA 1WXXA 4R05A 5EVJA 3NDJA 2JHCA 2PX4A 4ER7A 3LDUA 2QRVB 2O0LA 5EIFA 1FP1D 5GIOE 3HP7A 3P71T 2EG5A 1R6AA 3GNLA 1SQFA 4KRGA 2OB2A 3FUWA 3TR6A 3P9CA 4C06A 2PWPA 3THSA 5C1IA 2WK1A 2ZWAA 2ONZA 3FPFA 4FP9A 4QQKA 2EJUA 2CWWA 4RX1A 4CKBA 4F84A 5EZSA 2UYQA 2AOTA 3H2BA 2VZ9A 5B1SA 4C05A 4RTSA 2PKWA 3FPGA 1WZNA 3KR0A 5FA5A 4PINA 1EQAA 5HIMA 3UA3A 2ZBPA 3FTCA 1TW3A 4KIFA 5DM4A 3ELUA 4GC9A 4AZWA 3TPZA 3DULA 3GU3A 5E1MA 3AWIA 1KHHA 4DQ0A 4EK9A 3UJ7A 2FK7A 3TM4A 1X1DA 4FS8A 2JHAA 3C3PA 2WA2A 1SKMA 4F86A 3CVOA 5DPMA 4DA4A 3TRKA 4F85A 5E2AA 3M6UA 5DTMA 4RTMA 3MHTA 4X1OA 2OZVA 2VDUE 1R8XA 2PT6A 3DXYA 3KQPA 4RVHA 2XYRA 4PONA 3LDFA 4BLUA 2G70A 2P3LA 5F2NA 1ORHA 3UJAA 3V97A 5EEGA 1O54A 5H02A 1N2XA 3EMBA 5K0FA 1ZG3A 3V8VA 3NW9A 5CCXA 2VDWA 3P2KA 3O4FA 2FYTA 4QPNA 3FUVA 4XUCA 2AN3A 4RTJA 3EMDA 1KIAA 3F4KA 3KPJA 2HWKA 3M70A 2I7CA 2YXLA 4ER0A 3HNRA 2IDKA 4AX8A 1PJZA 1QANA 1WY7A 5FHQA 3P9KA 3NWBA 4KWCA 2AS0A 2KW5A 1ZGJA 1JTEA 4BLWA 4RVDA 2O07A 5EG5A 1JG3A 4C04A 3OZTA 2F8LA 5DM0A 5E9WA 1X1CA 3KQYA 4UOEA 5FADA 4P7FA 4QVGA 3ANXA 3FTDA 3AJDA 2OO3A 3KPWA 3Q87B 4OBXA 5EKUA 4DM3A 4RTKA 2BH2A 4QVKA 4R6XA 3U81A 3G5LA 2FHPA 5D1HA 4C07A 3G2QA 1ZKDA 2I62A 2GAFA 2NXJA 3A7DA 2QE6A 3UWPA 3WSTA 3KR2A 3LKZA 3LPMA 4EKGA 2C7PA 3TMAA 3TQSA 3I58A 2AOUA 4A6DA 2BM9A 3B5IA 3HVIA 3QOWA 5LQAA 2FCAA 1F3LA 5IKMA 3LX6A 5GM2A 2YQZA 1NT2A 3JWIA 2PGXA 4HGZA 1P39A 5EMKA 2IIPA 4P7GA 1V39A 3OFJA 1KPIA 2P41A 3E23A 1IXKA 4PIPA 1HMYA 5DTRA 3AXSA 4OA5A 2PXAA 4QQNA 2IGTA 3KKZA 4GOLD 4EVIA 1Y8CA 1JQEA 4MWZA 3KU1A 5K01A 3R3HA 4EKIA 3OE4A 1M0EA 3OU6A 4E30A 2CMGA 2R6ZA 4KIGA 3FTEA 3PB3A 2UYCA 3CGGA 4DF3A 3ELWA 1BOOA 1BHJA 5ERGB 4WVLA 5FULA 3HA3A 1RJDA 3HA7A 5K0BA 5P8WA 5LSAA 3BWYA 4GOMD 1JG1A 3UA4A 3BT7A 3A4TA 2ZLBA 3MCZA 4B17A 5K05A 1AQJA 2AN5A 2PVCA 1NV8A 2NP6A 2AZTA 5K8VA 4HC4A 2PX2A 5DM1A 1WXWA 1NW6A 4IV0A 3FUTA 1QYRA 5E9QA 3SX0A 2AVDA 3MCTA 4BP1A 2ZWVA 2AOTB 3M6XA 3KQQA 1RJFA 2IBTA 1NV9A 3O31A 3OPNA 3PT9A 4KW7A 1YUBA 3IV6A 4GQBA 3G5TA 4BLVA 4YUWA 1G6Q1 3HEMA 2IDJA 4U7PB 2FRXA 1KXZA 2PX5A 3THRA 2XBMA 1UWVA 1BKYA 2EX4A 2P3OA 5DXAA 3X0DA 1D2HA 1EIZA 2UYHA 5FQOA 2BZGA 5CUQA 3G88A 2FPOA 4M36A 2UYOA 2PXCA 3L8DA 3UJ6A 3OZSA 1JQ3A 2OKCA 4U7TB 5DWQA 5GM1A 3GWZA 3LSTA 4XUDA 2QYOA 5E1OA 3LBFA 1AF7A 3HCEA 3P8ZA 3GRYA 4RVFA 4C4AA 4YUXA 1XVAA 3CJQA 1WS6A 4DCMA 4E31A 3OCJA 5EMMA 5MHTA 1NW5A 3UJBA 3CC8A 2VP3A 4RTQA 2ZZMA 4LG1A 4MHTA 4PYKA 4QDKA 5T67A 3DXXA 3E8SA 2EFJA 5DX0A 3JWHA 3AY0A 4PNEA 3FUXA 3P2IA 5K03A 5T64A 3C6MA 3IEIA 3QOXA 4EQZA 2PXXA 5CM2Z 4HRAA 3BWBA 1N7IA 3FZGA 5DT2A 3PVCA 4FR0A 2OBFA 3RW9A 1VQ1A 2IH4A 1I9GA 1KR5A 4MQ4A 2Z6AA 7MHTA 3NMUF 3SR4A 5HFJA 3GRVA 1NW8A 2QY6A 3FYCA 1Q0SA 4P58A 5KVAA 1G38A 1VPTA 3HCFA 5EC8A 4CKCA 3NVKI 4PYMA 5U4XA 3QV2A 3E05A 3ELDA 5JUWA 2HV9A 3ID6C 4DMGA 1DL5A 3UJ9A 3G8BA 3BWCA 1EJ0A 4XCXA 4PGHA 2YXDA 3REOA 4Y30A 2ZZNA 4HG2A 1XDSA 4HH4A 4AZSA 2B25A 5DM2A 4ISCA 3SM3A 4PCLA 1JQDA 1D2GA 1AQIA 1KYWA 3DMHA 1G8SA 2P8JA 2CKDA 5FQNA 3G8AA 3M33A 2YUIA 5IH3A 4GC5A 1G60A 2O05A 3MB5A 4FT4A 3MGGA 3T0IA 3VC2A 3OU7A 5LQNA 5EHIA 4M7RA 3DLIA 3TOSA 1RI5A 3DOUA 4X63A 3DMGA 1KPGA 1SUIA 1SG9A 4FGZA 3D2LA 1XTPA 3A25A 3B7PA 3GDHA 3HCDA 2NYUA 3A7EA 4YV2A 1ZHFA 4KDRA 1SUSA 3DLCA 5DX8A 3DH0A 2H1RA 2OYRA 2H00A 4RSRA 5K0EA 5G02A 2BR3A 5KYGA 4FSDA 1RI3A 2CL5A 4PYQA 2XVAA 4POOA 1MHTA 4X41A 1QAOA 4E2WA 3EVEA 2HNKA 4HTFB 4ER6A 5CVVA 5DLYA 3PLAE 4LWOA 2XVMA 3GRZA 5E8RA 1VE3A 2OXTA 1RI1A 4ER3A 4HTFA 3T7RA 2PX8A 3UBTA 1KP9A 1L1EA 2DULA 2HMYB 1I4WA 3KQOA 5EGSA 2PLWA 2PBFA 3EVGA 3R0QA 4PYIA 4RTLA 5HIKA 2PJDA 2P40A 4GOND 3T7SA 5KQRA 2EJTA 2ESRA 2IFTA 3B3GA 3BUSA 3CBGA 5GOZA 3RODA 4YUYA 2IH2A 3EVBA 2K4MA 1ZGAA 3LGAA 2ZTHA 4GBED 1WG8A
chains in the Genus database with same CATH superfamily
2BEWB 2IYSA 2ORED 4JKYA 1OY1A 1UDRA 4U2EA 3VTAA 1ABBA 2HSDA 1G2PA 2I55A 3D0KA 4TKUA 3IILA 3CJRA 4L1KA 3IHWA 5EXPA 4YREA 5SYNA 4UXJA 1OFGA 5KNDH 1W4BA 4O3MA 1U7TA 3DE7X 1MQ9A 4ZRNA 3NBAA 3O7MA 3CS3A 5HHTA 2H9IA 4J91A 4M76B 4FFRA 2PQ0A 5EQFA 4I5DA 1W6UA 3GUZA 5KJEA 2KE5A 1Z2PX 4A36A 2Z83A 1YCGA 3ROQA 1TU0A 1E18A 1F12A 1SUPA 2HMSA 4NXNB 3NHZA 4I99A 4M8SA 1XQXA 4HBZA 1PZEA 3WGNA 4XA8A 1E2FA 1GA4A 2FQYA 3O3CA 2BKEA 1V1JA 2FWIA 2XRMA 3UXMA 5B64A 3IS3A 1IXSB 5IN5A 4MB2A 3JYPA 4WN9A 3BRWA 1QE3A 2X1MA 4LPKA 4CNQA 4OQMA 4MV9A 2GLXA 1MW9X 1S3IA 4WSOA 3VMFA 3VU8A 4GQIA 3PE3A 1KZ9A 4INOA 2I2BA 2PWBA 5FPHA 5H3CA 1U2TA 3I0MA 3R7DA 3VPHA 4ZHQB 3OZUA 3V2GA 4V02A 2WZDA 4U5QA 1GD1O 1OWNA 4YAEA 3I05A 5ITVA 4HNAB 5C8YF 2IU6A 3B2NA 1TZ2A 2ZFUA 3SOPA 3F6SA 2OOKA 2OQRA 3AK4A 3E3NA 3EPHA 2B6HA 4D1YA 4MIKA 1QHNA 3BDVA 1GYPA 2Y0DA 3IOMA 1FX0A 2I4OA 2WDPA 3FMVA 1YHZA 2BFBB 1LBSA 4I4NA 2ZRCA 3MLBA 3UANA 3C1AA 3H8VA 4M9UA 5DN6A 1FX0B 4UEKA 4X65B 4RHYA 1Z07A 2FOLA 2PUVA 3FUCA 1D0IA 4ZRDA 1C4KA 1T5BA 3K70D 2B78A 2WHQA 2VCEA 2JI9A 3UENA 4A4DA 2XUQA 4RD3A 4GRDA 2V3CC 4WERA 1YVPA 2IV7A 2HRZA 4CE6A 3L7IA 1YL6A 1KWGA 4RK0A 3ZDZB 3GPDG 4JNKA 421PA 5JO0A 1WDKA 4KEAA 2JJYA 1QZTA 2NNWB 3NB0A 3PKIA 4B6EA 5HEKA 3FB1A 3N2EA 2XT0A 3R7SA 1YVEI 2XD9A 2G76A 3CZQA 1HNNA 1GU1A 3HGTA 2OXRA 3R6WA 5IDVA 1OW3B 1M72A 5BW4A 5F51A 3RG8A 2AH5A 1GITA 2PMFA 2G6BA 3GAZA 3ZH2A 3B1YA 1RBMA 1GAEO 4MCJA 1IK6A 5K1ZA 4OX9Y 4QTUB 1E9AA 3IP8A 3RS9A 4BV9A 1NNEA 4B3RB 2ZU0C 3BGIA 1T1GA 5JFOA 4KIWA 2ZWOA 1P4GA 1FVOA 4DILA 3RVSA 1PTJA 3VYWA 1P18A 4OATA 2Q1WA 1XZNA 4PXSA 4HN9A 1K97A 1G4AE 3MTDA 3STUA 4A10A 4ARAA 3Q7SA 4E94A 1QIGA 5IFKA 3JW8A 1ISRA 3UWDA 4Q7JB 5CFNA 1WW2A 3IPRA 2GEBA 3NCTA 2Q2QA 1WOYA 1XROA 3NCHA 4G4SP 4Z0PA 4C21A 1CY0A 1SELA 1ZZEA 4JBXA 3TZQA 1L9XA 1XE3A 1G3QA 3C3JA 5E3JA 1SGWA 2GPBA 2OZLA 2QN1A 1ESMA 3RRNA 2O8FB 2BGJA 3A9WA 1VJDA 1YZLA 2G8NA 2QB5A 3L7OA 4CMKA 1Z2AA 2IIVA 2Y2UA 4UVIA 3AESA 4PZUA 4IJ6A 1A71A 2YVLA 2ZRHA 3VPXA 2HSZA 2GA8A 1L7XA 1SCKA 5CFRA 2BTEA 1EESA 5IG2A 3GP5A 5F4BA 3OWOA 1IDN1 4O4LF 4X44A 5JZ9A 1AN9A 1VPDA 4WDRA 2WTMA 3WLQA 2W2NA 3EZGA 4W6QA 4DQXA 4DSOA 4HFRA 4Q1CA 1SCNE 3U62A 1XVLA 4R2XA 5EQJB 4DIFA 2VPTA 1JR3A 5C8XA 4DZZA 2VUTA 2O5RA 4J0GA 1MC5A 4BJHB 2ZIGA 4HADA 4GLLA 4C2AA 4QLBA 1U7PA 4RMIA 5L7TA 2FPWA 4RDIA 1ZW6A 1ZBQA 1ZP6A 1VP3A 5LYJA 1M2HA 2ID9A 2QRHA 3M3DA 5IKXA 5BNIA 3ZHRA 5CMLA 4RM3A 1SXJA 2YWEA 4OQEA 1JAXA 2J8ZA 3QPVA 4HGNA 4E70A 4WL0A 1USWA 1JP7A 4MGKR 4DMFA 4YQYA 5ESDA 1GTVA 2BKXA 4KYUA 1NUSA 3R7FA 3DP9A 2E87A 5BR1A 1XP5A 3A6EA 2IXEA 3E22B 2J3LA 2C2GA 3H4IA 1KVSA 1U2QA 1US8A 4GZ3A 3IC5A 4OJMX 1EGVB 5LOVF 3WLFA 4OXNA 5AM5A 3BZWA 1GT91 1IN4A 521PA 4H15A 2PZ8A 2P1ZA 4IXMA 3C16C 4K2AA 5IUKC 1RCFA 1OU0A 1L5SA 3GRRA 4IVNA 2Q29A 4YC7A 3ANLA 1QOPB 3MWDA 1QHFA 2GM3A 2V65A 1OLUA 1C3LA 1TDJA 1HLDA 3BBLA 3IQWA 2Y1OA 4BQSA 5C5CA 3ZS8A 3DUFB 3A4YA 4M83A 4UAVA 4CXMA 2X42A 3I5MA 3JQ9C 4EI8A 5AESA 1VC2A 3FNIA 3Q11A 3MJCA 2VOEA 3Q5EA 4OY3A 1M9NA 4RLQA 4V2IA 1VG8A 2H63A 4L4XA 1KP3A 1MR3F 3P5SA 5GIPE 2F55A 2IYVA 3IR6A 5KJ6A 2RJOA 1O7JA 3CPJB 4B2YA 4EY3A 2X8JA 3LZDA 5CHYA 4Y2UA 1LRJA 1JVSA 1GRCA 4QGFA 4XGIA 3FWKA 1VMDA 4B3IA 1UMBB 3UF0A 4KAJA 4OHFA 1VBFA 1YULA 4L02A 4UNNA 3M0EA 2IHYA 2I7TA 1VIMA 4Q1BA 2P7HA 1OWMA 3CFYA 3J81A 4MZXA 2ZRIA 3QVSA 3SN6A 1SVUA 4D9GA 4XWOA 5IJWA 3GLIA 1JZTA 2FRVA 3P27A 2XKKA 4P35A 4AUNA 2IODA 4Z7QB 1DFGA 5KVVA 3A1TA 3DHYA 4DV7B 1NU6A 3CU5A 5DOVA 5HILA 1DQYA 4KGVA 1VCOA 1JG4A 1QG4A 1V8ZA 3GLHE 2Y2VA 4KRYA 2RGGA 3KXPA 2JHCA 3F6PA 4HWPA 4XJTA 4ZEMA 2ASEA 3R6LA 2WAYA 3LDUA 3ADKA 5J4KA 1UBLS 3PV0A 5DYYA 3KSUA 1V7PC 3PNMA 1CB0A 4TL9A 4WA7A 4YJ2A 3TR6A 3QX8A 2V7WA 5KKNB 3LW7A 1WA5A 2GEKA 3AY3A 1I7DA 4QQKA 3AETB 4G5SA 1VYUA 3CB2A 1CR4A 1ZH8A 2OWEA 3K2BA 4YJ2B 5E4FA 5G53C 5B1SA 3RS7A 1QB8A 2XIQA 1WZNA 3NQ41 1IN7A 3IRVA 4RJLA 4V39A 5HIMA 3EUEA 3K20A 3QFHA 4EEXA 3I3OA 1VJRA 1X42A 2Q49A 3AEUA 4HRVA 1NUUA 3O1LA 1WPXA 4EKDA 1AMNA 2GAOA 4ZYTA 1PJLA 1RKXA 1X0XA 5BMVF 3NKVA 4M9ZA 1QPZA 3L4JA 1MRSA 5A5GA 3HACA 3QLUA 5TARA 4TLBA 1ODSA 3O47A 2EZ9A 3EXFA 3OJOA 2R25B 5FTNA 4M21A 5IVPA 3IOYA 1UIMA 2HWXA 4GVPA 2H4XA 3OO0A 2OZVA 1TVEA 4GYYA 4JEUA 4Q0MA 2PT6A 3T5BA 2XXAA 1ENZA 1O6ZA 1N3IA 4RGVA 4KPYA 4C20A 2ZRNA 2EX0A 1DZIA 2WNSA 4JVOA 3RWMB 3ZXUB 3KQLA 1EGHA 2B8EA 1W52X 1O54A 2YJGA 3KXLA 1SCBA 3QPDA 4K7JA 4CCSA 4KZKA 2YDXA 4WOJA 5DI3B 1ZJZA 1OZ0A 3OQIB 4MIEA 5BNTA 2V8BA 2ZJ4A 4URYR 2PT5A 5IVIA 5KTYA 4LNAA 3F4KA 3OP1A 3M70A 1Z2EA 1NN5A 5DW0A 3RJ9A 2RGYA 4UREA 4O8ZA 1H6DA 1MORA 1W9MA 3D3QA 1U3DA 1X8KA 2J5XA 1E2GA 2J9ZB 5FHQA 1DAEA 2VHEA 4Z4QA 1UT8A 4RY8A 1VGRA 3NTOA 3RVPA 1QFZA 2IPLA 4OGFA 2ZM5A 1AUOA 3TTWA 5KC9A 5J1TB 5IAJA 3PIDA 1XRJA 2CHQA 1U9IC 3HU1A 1U8FO 3E9ZA 4FFSA 5AHKA 3GW8A 3DZCA 3D6AA 3GG2A 1HEYA 2C42A 1DG9A 2Z2KA 3G5LA 1ZW1A 4O4JF 3KV3O 2GEUA 2VLIA 4K9NA 4ZC8A 3UWPA 3HPRA 2NXJA 3GLFB 1E20A 4KYTA 5L40A 3IIMA 2BTQA 5GZ3A 3ZJVA 3BJRA 4YAJA 3G1WA 4MUFA 1OGIA 2ZUTA 5ALJA 4FIDA 4EHFA 1XT6A 2RHHA 3AF3A 3R3YA 1XXHE 2QMQA 2FN3A 2WKWA 2R11A 3EIFA 1ONBA 2ID7A 5FKJA 1NJ2A 2ZZMA 5DHAA 1T4CA 3LK6A 4MOWA 2GDZA 5DTRA 3M5DA 1TCUA 1ST3A 1Z5PA 4MR8A 1T6NA 3EXEA 4YFVA 5AKZA 3TBHA 5JWRA 2WWRA 1T4CB 4HMPA 3IMCA 1EFTA 2XRFA 3BREA 1Z5VA 4KB5A 4LDNA 4QPJC 2CFCA 1UH5A 4UUNA 1AB5A 4KK3A 3VDQA 4BNDA 3NWOA 1HE1C 4KLRA 1HT2E 2VRNA 3TTXA 3BSWA 2XE8A 1MJGA 2WJYA 1CQXA 1NM5C 4K9KA 4NFYA 3FTEA 3PB3A 4FIZA 2PTGA 4Q18A 1N2GA 1AUPA 1WDWB 1ZY2A 2XTMA 4HCJA 4QDTA 3MT9A 4WVLA 3D3EA 5ERGB 1UKCA 5I7EA 4INPA 3FJYA 5MN6A 1UPXA 5AKEA 3AZPA 3BWYA 3MFQA 3NNSA 3NT4A 4WFQA 2H8GA 1QFXA 5DASA 3GJ5A 4BIMA 4KPGA 2H5LA 1FS5A 1UJ5A 4J7CA 3N0RA 4AIRA 1DBVO 3R3UA 2ZWIA 4IV0A 4CLRA 2GN0A 3RT9A 3DEAA 3PFCA 3FHJA 3FXAA 1MENA 1JPNA 3FI9A 2LIPA 3I3SR 3AVXA 4MRPA 4YUWA 1KYXA 2W5UA 1R0SA 2HU7A 3ZZTA 2YDYA 3T1NA 1VM6A 3K0AA 3THRA 1O8BA 1U0JA 2ECOA 1ILEA 1NQ5A 1AKTA 1KO1A 4YBRA 5BVHB 4I36A 2ENUA 1P2TA 4YS6A 1NMEA 4O4IB 1PSZA 5FJJA 1WPRA 2G08A 3GWZA 4XUDA 5E1OA 1USKA 5EZYB 5KKAA 2CVHA 1DTSA 3EXG1 1XVAA 1SB9A 2IXBA 1P33A 3JD2A 2Q6KA 1PJ8A 3JRXA 4CMEC 3OLQA 2QVBA 3QELB 3IT3A 1DNPA 2XWJI 1ZAYA 1Y6JA 3ZY6A 1Y3AA 4D0RA 4RFSB 2ZU6A 1TO1E 1S7CA 2G25A 4L6IA 4PNZA 3QELA 4Y2PA 3QSGA 4R1OA 3RWBA 3ZTWA 3ZOZA 2A5LA 2R5FA 3NEJA 4GM1A 3ICQB 1KKUA 2ZREA 3BWBA 4IRXA 3VV3A 5JNLA 1U1CA 3TZLA 2VXOA 1G21B 2G09A 2H18A 1D0VA 1Z4JA 4RNDB 3TX6A 1FRFS 3HZZA 2FX5A 3UT6A 4AICA 5HRCA 4D25A 3VOAA 1UBTS 1YIOA 2WHYA 3GRVA 4HD8A 4C2BA 1UFRA 5CBPA 6ADHA 3BIJA 2VSOA 3K5IA 4R9SA 5FV4A 1NBAA 2NU6B 3E05A 1ODIA 1G291 3FNFA 4IHAA 2VDRB 4WH0A 3LPCA 2BJWA 1QGUA 4R8MA 5DSZA 3S29A 4C3OB 3SHWA 3RHZA 4HNUA 2NLOA 4PG5A 2NO7A 4LMAA 1PR2A 4J0DA 1EVKA 3RYIA 3K5PA 2AUMA 4ZYWA 13PKA 1IRXA 1YDFA 4IP0A 4CZ2A 1Q3TA 4OFZA 4DCOA 3ZZUA 3DVAB 2VZ8A 1YAHA 4QAQA 4DR5B 3M1IA 3D5EA 5FQNA 1VKNA 4AJ1A 3SDSA 2ODAA 2D59A 3GUYA 1IRIA 5JYDA 2ATVA 4ITVA 3BC1A 1M34B 3USZA 2WJIA 4L4UA 3V6LA 1H4QA 4MUYA 4OPMA 4CL2A 3AM4A 4NCIA 2FWAA 2AYXA 5L3RA 2C2XA 3W8DA 5M34A 5HDQA 2QTFA 1KPGA 1K6XA 4E5DA 1NW4A 4B6OA 4RS4A 4WFIA 3SF8A 1IONA 3M9XA 1N1GA 1RWWA 5JS1A 1IHOA 5I9SA 1NJ8A 4PC6A 4RSRA 4ZT3A 3IEMA 2JEOA 4UCFA 3U1BA 3H2IA 1UKYA 4AJPA 4POOA 1P7ZA 2J5BA 2VQSA 3C14C 3JQQA 3MS7A 4IDNA 4B46A 1J07A 2AUTA 3B1JA 4ER6A 5L4LA 1CE8B 4NZ9A 4KOEC 5TIIA 4A8PA 1I7LA 2HEGA 2J9FB 2Y1CA 5BN4B 2OXTA 4CF6A 2IYOA 1ZITA 3GZJA 3BOSA 2OQ2A 2TS1A 2AJBA 1WSDA 4IG9A 5BN4A 3UAVA 3DTYA 3V3TA 4GL4A 5HIKA 3EEIA 1N6KA 2ZJOA 4BNKA 1J1UA 2EYQA 2IFTA 4AKIA 1R12A 1QYIA 4D2IA 1E6MA 3G1UA 3M4ZA 3FVTA 3L7LA 4JBHA 2QM0A 1DAPA 5CNMA 3FIUA 4RSMA 3I9V1 1VLVA 4A8TA 3KL4A 3IIKA 3LQYA 2PX0A 3BD8A 2CL7X 2R86A 1CBUA 5I6DA 4P53A 3FDZB 1SKUA 1K6EA 2X23A 3NHRA 3H0EA 1R66A 1R18A 3P9QA 3TQIA 1O95A 3DMFA 4QJ3A 5AQ1A 4H7DA 2IYPA 3PNOA 4FBLA 4OKIA 3TQHA 1YQWA 2CUTA 3IPAA 1ZESA 2VF2A 4O5OA 4RVGA 5H81A 3RWOA 3P5BA 3VC3A 1ZM9A 1WHTB 2AK3A 1A8HA 1OJLA 3H99A 4IO0A 1C3OB 4X95A 3DBLB 1VECA 2XTAA 3WIEA 4B44A 2WF5A 1K5DA 3F5DA 3F96A 3QMPA 4GP6A 3KSBC 3ESRA 2EFYA 2W2KA 1YQXA 5FTKA 5DMHA 3GJYA 2PS9A 3REGA 2DUMA 2BM0A 3QZUA 2KBFA 3T5MA 4DARA 1WNFA 1TYBE 2WG2A 5ELMA 4EX6A 3C3EA 4Q6BA 1RKUA 4H08A 2GB4A 4EZBA 4QREA 5CURA 5JNUA 1DIOB 3PR1A 3I1YA 4DBLE 1G3RA 4ER5A 2VHXA 3R3SA 4F6RA 4LF5B 1E3JA 4QGAA 1UK6A 4IOJA 2J9GA 3JQ8B 3H7IA 5JWOA 5EUCA 1M83A 2QP9X 3NDIA 2Q5LA 2I2XB 4Q1FA 2O5VA 3IDOA 4XVHA 1WMEA 2O2ZA 2DCMA 5L4NA 3CH4B 3PK0A 3VM6A 1L4NA 4LGYA 4QG7A 2OD2A 4OFXA 4MNTA 1O08A 3CLSC 4FE4A 2ZPAA 3AB8A 4O2BB 4WADA 3WB9A 1B42A 3WLAA 5BN1A 4URWR 3T0FA 5BQFA 3R3VA 2XDQB 3CNNA 2ZGVA 3ZCPA 5IJXA 3KU4A 3WYAA 4KXXA 2DFLA 4FK8A 4ZV7A 1HLFA 5ALTA 3W34A 2C88A 3WJ1A 3A4NA 1WF6A 3NGXA 3ELYA 4RGYA 1N2CE 1T1SA 5ECDA 3CURA 4P7KA 3RCBA 1IPFA 3H4VA 4HXFB 3TJRA 4EBBA 3SSNA 4QWMA 2P9CA 1O3YA 2MSKA 1NUAA 3KO8A 5DNWA 2QMEA 1Z0UA 4BU0A 1BN6A 2AZ4A 3RKRA 1JBQA 4J0JA 1FDTA 1Q1BA 1KYZA 2DETA 5JAMA 4M9CA 3H2YA 3OF2A 3I12A 3DWGA 1A2OA 1E1NA 1EXNA 2DQ4A 1OJ7A 3GFFA 4HEHA 4CW7A 1KAMA 1NLUA 3U7EB 1PW7A 2VA8A 2ZRAA 4RK1A 4HZIA 4QUEA 4CKEA 4XD7D 3CKKA 3ND8A 4RLFA 1NA5A 4WJKB 1O94C 3UH1A 4D81A 3ERCA 2ATCA 2J5KA 3J7TA 3NGMA 3OLYA 1OROA 1SIUA 10MHA 1GGMA 3C74A 5ES3A 2MSCB 2OHVA 3FWHA 5FI1B 3LL7A 5CVEA 4G0YA 1B6GA 3ETNA 3IDAA 4NAHA 5FOUA 1P9NA 3DUWA 4YV7A 3PXCX 4PO3X 1RPTA 2I4TA 4EB6B 4JJZA 1NI3A 2XYQA 1BYIA 3LQKA 4BGVA 2GAAA 4TVBA 2YV1A 1CHDA 4B34A 1PX2A 1RMYA 4DHEA 2FN4A 3E1KA 4WLNA 3ETCA 1P81A 5AVRA 5I9MA 4DUPA 5CB8A 1WMFA 1EVYA 2IUEA 2QRVA 3MPUA 2A14A 3MTJA 3I2JA 1USGA 3RTDA 2CVQA 3H1TA 1FTYA 3QX9A 4M1TA 4GO1A 4B8YA 2JLZA 3BGVA 1EDOA 3RT7A 4ZVKA 5FEUA 1FVHA 4NF2A 3JAWB 3PTLA 5K8JB 3JASB 3MVEA 1VTKA 3EEFA 3LC1O 5DLDA 4FILA 1FA9A 1UZLA 2DUUA 1T91A 4B2LA 1CNMA 1A2BA 1PG5A 5C8ZA 1L8OA 3L6BA 2NO0A 3PNSA 3NJ4A 2R0QC 1U8CB 4II2A 1G64A 2FWMX 1GYQA 3JS5A 1L5VA 2ZYRA 4MS1A 4X8HA 2DTDA 3I83A 1RZRA 4R8RA 1E4VA 5HA5A 5IUNC 1YJXA 3ZIAA 4DY4A 4RLHA 3FRJA 1S3SA 4MS1B 1RWVA 3FVQA 3V2UA 5AK3A 1N6NA 3L43A 3K53A 1N0IA 4CM7A 4WBNF 3W1VA 3HUFA 2GM5A 4XX0A 5EXDA 4ND8A 3RJZA 3ZHOA 2XCTB 2D1FA 1O8CA 3WK5A 3D2AA 3FPLA 5T57A 2OC4A 3T54A 1PNRA 1NBWB 1T4GA 1JBEA 1JTVA 1L7EA 3W77A 5FNVB 5BP7A 1QO9A 2QZSA 1SVKA 3S40A 3SMVA 2GVZC 3LBAA 1NHGA 3HJBA 3GFBA 5CD9A 4M9SA 2CK3A 1JHXA 3PYXA 3MERA 3PBKA 2I80A 1VL5A 2ZVQX 3WYNA 3ER9A 1QG0A 2D5AA 4EW3A 3DBVO 4LJ4A 3UK0A 1FMCA 3FDFA 1CVIA 2EQAA 3B60A 3GVIA 4X7MA 1OBCA 3ZV5A 5E1DA 1V1RB 2MSWA 4LXUA 4UQPA 1EVQA 4AJ2A 4C01A 5THQA 3SXJA 1Y9ZA 5F1OA 2PU5A 4YAKA 2W2VA 3D8BA 3RIYA 3EVDA 1N5DA 3NV9A 1RAIA 3BQMB 5E7IA 1HNWB 4I7EA 1HO3A 3LCRA 3WBKA 1E96A 1EB8A 1YE8A 1IN1A 4QU9A 3ENWA 3WWZA 4E2XA 1V5IA 4EJMA 4EMSA 3CX3A 1T9BA 3EZ7A 5SY9A 4AKTA 5C3MA 3LOPA 1XRRA 4LVCA 4BQIA 1KDYA 2DKNA 1W73A 4LK2A 3RV3A 1HQCA 1T43A 1TQ2A 5DE3A 5AHOA 3P2YA 2HRBA 4MJLA 2GF2A 5EWJA 4QXOA 4Z0TA 2FF7A 5CDFA 5KX5F 1PG2A 3E48A 3OTIA 4Y0NA 4ZCLA 3RU9A 4K0RA 1QYVA 4NDAA 4PAWA 5REQB 1NVFA 5TB5A 1TMKA 3F8TA 2OT3B 4JJIA 5TGTA 5AVWA 3VISA 4UEQA 2W0SA 4LDRA 4MWGA 3AB3A 2PNFA 5EE0A 5KBYA 4LOAA 4R1MA 4EJ6A 1D7AA 1EEXB 1TLFA 3DE4X 4QXRA 1E99A 4ARVA 2FJ0A 4EGAA 3OY2A 2MTBA 3I64A 3KQHA 5CIQA 3F7TA 4N6NA 4BMSA 3ZLTA 5ALDA 3K3PA 1P73A 2P5YA 4REQB 4UDNA 5BV2P 4AM8A 1W93A 1WXQA 4RHTA 1QCYA 3DLTA 3IO5A 4M8IA 3SZOA 5EHXA 2V0GA 4ALLA 2OAGA 2EERA 1DFIA 2ZBGA 1UQUA 2P91A 5BUQA 3RASA 3VOTA 5JVDF 4NCHA 1DTWA 3LA6A 1FMFA 2IX3A 1R15A 1YXMA 5JCJA 5D85A 1Q6ZA 5CLQA 1HEUA 4CFZA 1RTKA 2X58A 5EZ6B 5KNCD 1C2YA 1QE0A 4J76A 2BY4A 1TC2A 3BFPA 4JXKA 4RA6B 2YIVX 4ZVSA 3TD9A 2XECA 4PBRA 3H2BA 5EZSA 5ALRA 5LZ4A 1S8NA 1FFXB 3IKLA 4YDSA 3FTCA 1LPSA 1TW3A 3KSMA 1Q0ZA 3OCXA 1Z34A 1LUAA 4AW9A 3WAGA 4NCBA 2EJWA 3DULA 3WIBA 3GU3A 1JLSA 3LYAA 5I4IA 2PUAA 5E1MA 1GN9A 3MWJA 3C5CA 1P7VA 4D9CA 4G0UA 1N2CA 3E2IA 4DB4A 3ADBA 2VNKA 2DHCA 5CXXA 2Y68A 2YVAA 4D44A 1GTMA 2QGNA 5KWEA 1G0OA 2IYNA 2GK3A 2JAWA 2JHAA 4XB1A 4CU5A 1LX7A 5CTJA 4I55B 1QGDA 4LZPA 1JXMA 4QJ5A 2VHUA 3S70A 3IELA 1M2OA 3QHAA 5H68A 1DB3A 3P2OA 4UUBA 4E6EA 1VSBA 2F2TA 3R9WA 3Q3JB 1OPXA 3DXYA 3PQ7A 5HMLA 2I1VB 1XQ6A 5AKHA 4BNNA 1RSZA 1E60A 3AR5A 5B7GA 1RM4A 5AUQA 1GDTA 1XTTA 1WZEA 2NPIA 2WJJA 1O97D 2GBLA 5TNXA 3HS3A 3NW9A 3AFGA 3F7OA 3O4FA 4PZDA 3TTVA 3TR5A 4HPWA 1R6DA 6YASA 1VJ5A 2FVYA 2O8VA 4MR7B 1NPDA 4N8EA 3VO9A 2WB2A 2ZTLA 1JDUA 3HL0A 3H4MA 2HZ7A 3J7AC 1AQYA 1MJ5A 3GL9A 3D6UA 1O5TA 2R5WA 4M0LA 1OC4A 4Q3OA 1XKLA 2G88A 2IP4A 3EFOB 3K0FA 4S35A 5DXFA 4L07A 5FOWA 3RSZA 1VSQA 1JTEA 1KFEB 1CFJA 2HH9A 5FX2A 3KZVA 5KINB 5LVAA 2TRSB 5E9WA 1YI0A 4CEHA 5BSWA 1GY8A 3KQYA 3IA7A 3NOXA 4CM6A 3R3JA 3LGXA 4K1LA 4W9RA 3ZXXA 3K96A 3AUYA 3Q3HA 1XK6A 5EKUA 4DM3A 4W5RA 3U81A 2ZVPX 4BTEA 2HTFA 1D8TA 4MUJA 3E7DA 2FEMA 2FJUA 4C07A 2GAFA 2ICAA 1BU5A 2MDTA 2AMVA 1XZCA 2FFJA 1DAFA 4FYIA 1Z5UA 4JVNA 4B76A 2XSZA 4WNCA 5JH7B 4QQ8A 2O4UX 2IIPA 4K8RB 1UAAA 3DL2A 3JATB 1F60A 4MYDA 4BAGA 1ZVKA 3E6AA 1Y7HA 1FQKA 2JFZA 1U28C 4EY5A 3MJDA 4L16A 3MT7A 4YRQA 3KKZA 2GPSA 4C6TB 2PE5A 4G0WA 3OCZA 3PLNA 5HSGA 2ETXA 2Q3MA 4LV8B 4YK7A 4DYVA 4DBVO 1TM2A 4EKIA 4M8NE 2F9FA 2QN9A 4OXXA 3RBXA 4Q19A 4MKIA 1X2BA 2PEYA 3THWB 2N9UA 1CUWA 2Z3ZA 1AXRA 2PRZA 1ADFA 2B61A 2UYCA 2FPIB 2KMLA 3JQ7B 3N0TA 4IBOA 5KAMA 1ABFA 1DEXA 1UC5B 3LP8A 2HMAA 2XB6A 4I1OA 5LP6F 4KACA 5K4GA 2BBTA 3UA4A 4ENWA 3QVXA 4A82A 2E2WA 2VWQA 4UJ5A 1QZ3A 1XJWA 3WBFA 3U31A 1Z4KA 2DPGA 3OMLA 4HC4A 4Q00A 4TZTA 3TLKA 4TVKA 1K7EB 1V7ZA 1PJTA 4RHUA 3HR7A 3ZWOA 2WM9B 3SX0A 4UBJA 3ODPA 4MB0A 4MGYR 2ZIWB 4EM6A 1Y3HA 4WBXC 1IXYA 2ZJ7A 1HH4A 3CZ4A 3TBKA 3EZ2A 3QOFA 4IIDA 3OWXA 3SJCA 2IPAB 4OQYA 3M6MD 4E5UA 1A69A 1D2HA 3RVOA 4YCSA 2J08A 1PW5A 5KX5A 3ZN2A 3IX7A 4G9BA 3UICA 4BLSA 1X86B 2FPOA 2XMZA 3ICOA 4RK4A 3VNAA 3GPLA 4BN4A 1T6XA 1P62B 3CEAA 3JD1A 3SF0A 3UEOA 4ZWNA 2WF6A 5DWQA 1U1EA 5EJIA 5B7PA 2GEFA 3OC0A 2UXDB 4YRKA 3UC5A 1FDVA 3TGLA 4Z7JA 4MS3B 1D1PA 4QNRA 1WS6A 3DZBA 1KWKA 1SM4A 5AWFC 2UUAB 3EXG2 2NOAA 4U7DA 1DOZA 5C1DA 3NRCA 5IBRA 4TTJA 1HG1A 1PZXA 2PQMA 3BTVA 3GEHA 5IAKA 4UTNA 3LUHA 4D7AA 1IDOA 1CNFA 5LZ7A 2CXSA 1XVIA 1NGSA 2AZDA 2O20A 3UMCA 3QF4B 3LF1A 4HGPA 5K03A 2WU1A 2YC4C 5JJBA 5ITWA 4JIGA 1XZKA 2FSUA 3IQHX 4DEVA 3NG1A 3U61B 2RGRA 3TLMA 3Q2IA 1Q7RA 2NG1A 2RI0A 5K45A 1GJRA 1EUYA 3TPCA 2BMDA 2A9QA 3IXLA 3OKPA 4CJXA 1M2FA 1O2DA 4L3WA 1UDXA 2WYUA 1NW8A 2GX6A 2WSSD 4IL5A 1A5SB 5DWDA 3ZZNA 3TECE 1G3IA 3NTLA 2PKCA 3OLVA 3QGMA 3TN7A 3Q3GE 5CTAA 4PYMA 2Q5HA 4B4OA 4XSGA 5JUWA 3DTVA 4GMDA 4KIJA 5EYPB 1ISIA 4DMGA 4U9UA 2IJGX 2OM6A 3JQCA 4N3BA 2YV2A 4RJTA 2ZUBA 5FT9A 2GZ1A 4BX0A 4KQMA 4HH4A 2ZXEA 1QO7A 1CWUA 5BSKA 1JQDA 3WA7A 2DC1A 2VRWA 4FHDA 4YP7A 1F5NA 2CKDA 2XCUA 1AG9A 1P2DA 2DSTA 3C8ZA 3O74A 2A0FA 1KDVA 1W8IA 4DADA 1FNBA 2ZJFA 4R31A 1DC4A 4GC5A 1LVGA 1W76A 5FUMA 5JYBA 3U4QB 5HUJA 3WRXA 1W581 3I9NA 4MYCA 5K4HA 4NNJA 3ZVKA 3MCAA 5MF6A 2OCAA 3BL5A 3H8JA 1MOSA 2VZLA 3O95A 4LIPD 3R7LA 4E5PA 5L3VA 1RQXA 2ZQ5A 3GFQA 2JJ2D 2VJPA 1K75A 1U5CA 4CQLA 4OREX 2H0QA 5L3SA 4I4TB 3E84A 4BX2A 5DI9A 3HM9A 3UMFA 2I1QA 3I4CA 3QPUA 4HAVA 3PGMA 1YR3A 1UXGA 1MQSA 4LRYA 3VKUA 4YIHA 4CETA 1JQKA 2F90A 3H6HA 1N5LA 3TLEA 3O8OB 4L27A 3BWXA 3HUDA 5E4YA 1QHEA 2W2TA 4MHOA 4LJYA 5IT4A 3NOOA 5HKOA 1NP7A 3OEEA 5DLYA 3GLGA 3GRZA 1DWUA 1T5SA 4E5KA 3JVVA 2PGDA 2EFGA 3B7WA 3LY9A 3RC8A 5LA6A 5EE9A 721PA 1T9ZA 1PT5A 2HQBA 3J80A 1P0MA 4RTLA 3TKLA 4JBYA 3DA8A 3WIVA 1YCDA 5B2EA 3FKJA 3JR7A 2W6MA 3N8IA 3OE7D 4TKLA 3B3GA 5DNVA 4EJSA 1CQIA 3AJRA 3CBGA 4D41A 4LY6A 1BEEA 2ZTHA 3QW4B 3ZDCA 1B6SA 3BK7A 3TRJA 4B4DA 3KPUA 1RI2A 4MARA 1KMHA 4P5EA 3QPWA 1Q3KA 4LBZA 2DPMA 5HKBA 5IJ9A 1TZCA 1VB5A 3UGJA 3KT8A 3IQGX 5F52A 1KMHB 3H3XA 3HYLA 3ME5A 1GU7A 4XH9B 3EARA 1LBIA 3D7KA 2WJ4A 3BJMA 3GT0A 4TWZA 1ISMA 1BX0A 1JN0A 1QAQA 3BA1A 2OFPA 2Y93A 3KVRA 4G24A 1CSEE 5IVDA 5H7XA 5B4UA 5TVGA 1BROA 3ETLA 1BKSB 2GWHA 4S05A 1U4SA 2ZRLA 3ZWBA 4EYKA 2QU7A 4JOCA 3T95A 5AUPB 5SYMA 5LQUA 1JSXA 2C00A 9MHTA 3CNEA 4ERXA 1DMRA 3N2KB 3FF1A 3D0OA 3LIPA 1MMFB 5TGDA 2CXOA 2WFLA 4NCJA 3BDAA 3KZXA 3GZNA 2WMOB 5AM1A 4F3RA 3PFGA 2ZT5A 3FKSD 3RIGA 5BNWA 4LA4A 2HQSA 3VR6A 1Z56C 1KAGA 4LSGA 5I4KA 3BB4A 1PKEA 5CVDA 4LJAA 3QVVA 1Z4LA 1QUEA 5JSKA 4HNAA 2YMQA 4IVQA 5AKLA 4HVTA 4CHTA 3PX3A 4PN3A 3CCBA 2UUCB 1T3TA 1YK1A 2W6IA 3GJ0A 3PR2B 4WZZA 1X19A 1GILA 3C41J 3OQ1A 5KOHA 4AX4A 5FO0A 3N2IA 2QXYA 1TZJA 4WCVA 2QBYA 2BFOA 1Q20A 1RW4A 1BX1A 2DYKA 3G79A 3OJCA 4S1TA 4YNBA 1CVRA 1E9EA 2PD6A 3BCSA 5DW3A 5AW7A 1BE8A 2G83A 3A6PC 3X1DA 3MTIA 1REQA 4WY8A 4YAOA 3EQ6A 4K6MA 4RK7A 3ANSA 1T9HA 4FI3C 1WCXA 2F1HA 4DCGA 1MC4A 1FRQA 2NXCA 4UHBA 3KVOA 1ZHOA 2IC5A 4MUGA 3BXZA 1DIBA 2WWWA 3KXIA 3SC3A 2X8BA 3NYIA 5BV7A 4HDSA 1N2EA 4YCJA 3DE5X 3KKPA 1GGJA 4MKFA 4U2BA 1R50A 1R3UA 1SQGA 3LD9A 2NUPB 1U7HA 1UKZA 3FH0A 4RW0A 4ZT2A 3C3WA 3BKXA 3O94A 5B55A 2AF4C 5E6UB 1XJ5A 1POWA 1GZUA 3GEIA 5A0VA 4JAVC 2AN4A 1PGNA 1YRLA 3D7MA 3WTBA 3CSUA 1ISFA 5E6RA 5C18A 4X8MA 1JE1A 3SQWA 2C58A 4BVLA 3HUEA 5J2UA 1ZO8A 4RZQA 4M1QA 1W75A 4YAUA 2Q0SA 7YASA 4CM4A 1U0NA 4TYQA 1NE7A 3P2JA 5JI2E 4JP2A 1CKEA 2D7JA 2JDIA 5K3BA 3HB9A 4YRZA 3TG8A 3QVKA 4HDQB 4XJSA 4CM4B 4DAOA 3QKUA 3R5SA 5I7RA 4AZ0A 1M6VA 5JMWA 5D3MA 5CU7A 5KHAA 3WMEA 3CVYA 3D8SA 4G5YA 1I6KA 3KJXA 2ZBFA 1ZGZA 2G9UA 1TEVA 2WB4A 3KUKA 4FW8A 4G56A 1GPBA 1ZK1A 1G55A 3LC0A 3VVBA 3LM8A 3E7WA 4YFYA 3FPSA 1I2DA 1L4BA 2YHBA 1QKIA 5D51S 2VSFA 3TM5A 4D6YA 2V97A 1LBQA 2VF4X 1K8RA 2W6OA 4K46A 2XBLA 4LCEA 2QN6A 4DR3B 3FLMA 2V9PA 3UHPA 2QSUA 3R5FA 4GR4A 4BO9A 1ZM3A 4JR2A 1ST2A 3KFVA 3M1YA 3M4JA 4EPRA 3OEWA 3OZCA 1E2HA 1GA1A 4LDPA 3BRQA 4NYJR 1C3EA 1BJRE 1Y4AE 5DGDA 1WTCA 1YS2X 2ZRFA 5C4GB 4A8JB 1JWAB 1Z15A 2IIQA 2QJTA 1SBIA 4MROA 2BR4A 3EEOA 4OQDA 4ID9A 1KI9A 4JL8A 4Z9AA 1V3QE 5JADA 3D8HA 4FFOA 4FDLA 5IDWA 1MHPA 3MG9A 3IQZA 5IAOA 1EU1A 2J6BA 2OL4A 2X0KA 1ZNQO 1SQ0A 2PSDA 1G3MA 2R44A 1V4VA 5IAEA 1U5BB 4EGJA 5BMVB 1CF2O 5K3EA 4R3NA 5H5JA 1DDGA 2VUUA 4GBMA 3OFVA 5NLLA 4DLRA 3B1VA 5A6SB 2CEAA 3UG7A 1STOA 1Z0SA 5SY6A 2E48A 3RBAA 1TT5B 1B43A 4UBOA 1QH1B 3DMRA 2ERCA 4L2IA 3PUJA 3DHEA 3NBMA 1JAYA 3W8FA 2VJAA 4NE7A 4NC9A 3KQUA 2V7XA 4F8JA 1EWRA 2VYND 1NX6A 3JY6A 2TYSB 3M4YA 4OXIA 3PEEA 3RUIA 2QX6A 1IC6A 2CN1A 3DAFA 1EM6A 2JAPA 1N8SA 2JFBA 3KLMX 4IIEA 1KEEA 3UJNA 4LCJA 2BYTA 1N6RA 1JE0A 4IZIA 2FKAA 3SP1A 3ZBUA 1BVRA 3CF2A 2GCPA 3WDSA 5LN1A 3PTAA 2G1KA 2C7GA 1RHQA 1KDTA 5LP6B 3Q7QA 4Z6KA 4RTRA 2FVXA 1A7JA 5HK9A 4DV4B 3ZW8A 3U4HA 1KO4A 3CRRA 3M6LA 4K5QA 1C9YA 3I2IA 5HTKA 3ZQ4A 2WKSA 1U7WA 3EGWA 4FT2A 2ODQA 2V03A 3DO8A 5JJ5A 2GUWA 4M1SA 1J49A 4JI7B 1E94E 3USCS 2D0OB 2GVNA 1LLDA 1M3SA 3FETA 1EUDB 3H9QA 4DCJA 3DHVA 3K9CA 2FTKE 3WGKA 1Z4PX 5L95A 1YZ3A 4LYJA 1PR3A 3ABRB 2FCRA 4HMQA 4LECA 1P60A 5CK5A 2GOYA 2E0IA 4NESA 4A2CA 4FPXA 4N7BA 3TLXA 3AFOA 3K09C 1DLJA 1Y80A 3O4GA 3OICA 2XQGA 2R85A 4L73A 4RH1A 5C32A 1SVNA 1TUIA 1X7HA 2AR7A 4TXLA 3JQFC 1UPUA 1QHGA 2FSIA 4YT4A 3OJXA 1OC2A 2W4MA 1DINA 2B2CA 2I22A 1GQOA 2ZK7A 4DT1B 5CH8A 3QE0A 3I01M 4IGKA 5E38A 5DV9A 4BO4A 4BGIA 2X1VA 2Q5IA 4YRGA 2IYYA 4JLBA 4ZALA 3IJPA 3GPIA 3WOHA 3ZIDA 5CD1A 1N6IA 2P4UA 2ZBEA 4WESA 3A3NA 4AG3A 3DZJA 4FX2A 1KL7A 5LYYA 4AQDA 1Z3IX 2NTVA 5KOJA 1H1TA 3RR2A 3DEFA 3V33A 1FW8A 1QP0A 1XCMA 1CP3A 2AI1A 2HUPA 2BKLA 4LNHA 4M86A 4WNAA 4XJXA 2OQVA 3WB2A 4CIWA 2A30A 1E89A 3ZHSA 2I8AA 2DAPA 4KG7A 4AQYB 4DKXA 5GIOE 4PPFA 3ZPXA 4IDCA 2WHRA 2BD0A 2VC2B 2YRXA 2Q0XA 4C4ZA 3KYCA 1PJCA 5HS4A 2HM7A 4GPTA 1B93A 1BMFD 3THSA 2BZ1A 1A9ZA 3FMGA 3FPFA 3G5UA 5HG0A 3LXMA 3OE7A 3PRJA 2H5EA 5GVSA 2AOTA 1QWOA 3I23A 3W7AA 2WF7A 1EQAA 3LWNA 1RPJA 1SMKA 3EXIB 3UA3A 3CNLA 2VBIA 1VFNA 1C4XA 1U1FA 3M82A 3S6JA 4ZOLA 4YONB 3T7IA 3FNBA 4M22A 1PEAA 2VJOA 3BE5A 2HJGA 2YV4A 2OD7A 3L84A 2VP9A 2R2AA 4QICA 4NBVA 2NO1A 4ZOLB 3OF5A 1JQ5A 1H9BA 5H4GA 2AKAB 2ODTX 4MCHA 4ZCPA 2NV6A 4GXQA 4XASA 4FLMA 5KYWB 4GMKA 5DGIA 2GYVA 4LGVA 1XDWA 4NYMR 2VAWA 5DTMA 3AM5A 1NAHA 2O8BB 3EUFA 3UV3A 1KK2A 1A5AB 2QL5A 2CNBA 3CQ9A 5U9CA 2P3LA 3CLUD 1FK8A 4JODA 1XU9A 3MPOA 3V97A 1D8AA 3TINA 3ZWNA 4CEIB 4TYWA 2ECPA 3OEHD 4WGFA 1LPAB 2O23A 2XZDA 3IUNA 3UT5B 5CCDA 5J47A 3AOGA 4PWZA 2Q6TA 1Z0KA 4P4SA 2ZRGA 5JVDB 3UT5A 2YIMA 4BPRA 3VDRA 1GDDA 1QHSA 3QYFA 2IDKA 4AX8A 4PR3A 4LE2A 4ZEVA 3STYA 3RTEA 5TS3A 2CVOA 1J56A 1L6RA 2AS0A 2BEUB 3NETA 1ZGJA 2ZB8A 3N2NA 4G0XA 5CP8A 1CEYA 2CCJA 2C4UA 5CLIA 2X2EA 1MX1A 5DI3A 1ZXLA 3L0YA 2CXXA 3RC3A 5DHPA 1E6UA 4QXQA 1T5TA 2Q6LA 2V1XA 5EIBC 1TPZA 4GOXA 3SFZA 3VNRA 2QA5A 3OKCA 3GLFA 3DC7A 4OI2A 4R6XA 4QSHA 2HT1A 1ZRSA 2IY9A 1G8YA 3WGHA 1HFEL 2HU2A 3IHKA 3G2QA 2G0TA 2K87A 5E3IA 2CLDX 1J8DA 1IPEA 4F6CA 3DOEA 3WZMA 4XVCA 3BXHA 2CEKA 3B5EA 4A6DA 1TUEA 5BUZA 3QOWA 3O8DA 1UDAA 4K05A 4XM2A 2BTOA 5JATA 5HRUA 3LX6A 5FD8A 1I7PA 3ELBA 4N0MA 5A06A 1ULUA 4NLLA 1ZISA 3N7AA 4OEHA 5ES4B 1GWNA 2ISQA 2Q3JA 3R9IA 3ZU4A 2IDZA 2IEAA 4PCVA 5CB4B 3ADCA 4F6LA 5G2OA 1JQEA 1SCDA 4JLPA 1GL7A 3KLPX 3OZFA 1CYEA 1HI9A 3ZW9A 1QG2A 5KDDA 4M88A 3IIEA 2HBYA 2Y92A 2Y76A 3OE4A 4MUBA 4BMDA 4LHSA 4TV9F 1N32B 5EIHA 3OPVA 4EARA 1X39A 4PPYA 2UZ1B 4AJNA 4JDPA 6LDHA 1QF6A 3FY4A 4WZAE 2QUZA 5K6TA 2E21A 2W2LD 1JQJC 3WNVA 3K6SA 2JDID 5M04A 4HXEB 1NVEA 5CFOA 4G4IA 2NP6A 1IZ7A 1E9VA 1GUZA 1K27A 3AB7A 3AHHA 4JLDA 1KO8A 4ZI3A 4TKVA 2VWHA 221PA 4O0LA 5AW1A 4ZOLF 5A5EA 3L6CA 2QSYA 1MT0A 1D3AA 1YONA 1JL3A 3V42A 4DXAA 3V1NA 3O3MB 3OPYA 1H8HA 2A88A 2ENWA 4D43A 2VJMB 3CVWA 5A4MS 1A8SA 4ESVA 2W6QA 4F8EA 3CE6A 4OH7A 2WNHA 4C5BA 5BO5A 1V37A 4BX8A 1TZMA 3LO8A 3FM9A 3R23A 4J49A 1BEUB 2WICA 3IQIX 4V38A 4BNFA 3OZSA 2XQKA 1JQ3A 1KAQA 4PSKA 4A0GA 5GM1A 3VPDA 3HCEA 4LSZA 1DU4A 5HJ7A 5A3RA 1E3WA 2DBRA 1X7ZB 1HE3A 1Z6QA 2DT5A 2PRIA 3EDRA 3I9LA 1FUUA 3PI7A 1AUVA 4KR9A 3WMWA 5MHTA 4PU0A 1A82A 1MXHA 2V96A 4KH1A 4NZPA 1YB1A 2KHZA 3A1NA 5FUVA 4CF5A 2WVJA 1UJNA 1NY5A 3AKZA 4MV5A 1KJJA 3WGJA 4EA7A 1P80A 3LRPA 1RYBA 4JNCA 4RF4A 1VHDA 1PU2A 2A78A 3GY0A 2PLRA 5FPKA 2BN4A 3CUVA 4AWBA 4GMFA 4F11A 4CQNA 4RLSA 5HJ2A 4MKHA 2FZLA 2CLHB 3OX2A 2FMKA 3ODGA 1XMPA 4P22A 1GTRA 1OVMA 2NU6A 2V7UA 3H1GA 4OHOA 1B4DA 4PX2A 4Y9RA 3A04A 4WLVA 5U4XA 3EIHA 5ESWA 3ANNA 2FH5B 2HI0A 4B81A 4FLFA 3WB0A 3BWCA 5KWIA 2GHIA 3QOYA 1TA0A 2R6GA 2PD3A 3W4JA 4B79A 1H4SA 5A4IS 5HTOA 3O75A 4Z4IA 1QDUA 4TTTS 4DG9A 5CCEA 1UBOS 1YQUA 4IUCS 3PDJA 1EP9A 3RFFA 3OCYA 3E27A 5EY5B 5CA0F 3VDNB 3LT4A 1ZCAA 3MWEB 2FETA 3N74A 3EEQA 1CJMA 5D87A 4ZT6A 4MVJF 2HUNA 5IH3A 3LUPA 3MB5A 3OFNA 2I87A 4CL0A 2WT4A 5I9TA 2W00A 3DLIA 5I9IA 3DTVD 3PNLA 1TKCA 2V0CA 3LH5A 1MABA 3HWWA 3KKMA 3BORA 5CH3A 1PGJA 1XTPA 3C8DA 4NBRA 3I73A 1UXJA 3PUHA 4AYXA 1MABB 1PV4A 4YV2A 2CJXA 3K2IA 4Y1RB 1RKQA 4Y2YA 5DX8A 1JIKA 3NPMA 2X7XA 3UHAA 3ETDA 2J7PD 3VPAA 4CF7A 3U44A 2CL5A 4DJDC 2DG2A 2J9FA 2IE8A 4HTFB 2P30A 2PMWB 3A2MA 3ITKA 3NM4A 2QTHA 4MLDA 3PQDA 3AF2A 3ZK9A 1E7RA 1D03A 1D0SA 5TMPA 3AUTA 3GUCA 2BE9A 1Z7GA 5JAZA 1CY7A 2HMYB 1NYLA 2O2CA 3TW4A 3TLYA 3A2LA 4YAFA 4Y2VA 2YKGA 4HNSA 1JT9A 2C03A 3NH6A 4ZQBA 4OCZA 3HHEA 4IDPA 4IXDA 5I8PA 4YY3B 3WDMA 2QVCA 1FCJA 4LGMA 4TQ9A 5EFOA 4CCYA 4IG4A 5AM3A 3O38A 1WG8A 1EQUA 4JLMA 1XMQB 3N6RA 3MJTA 2NU7B 3MMXA 2VATA 2VTKA 1IHUA 4DC9A 2R00C 3H2GA 3K73O 1CP2A 1FDUA 1Z68A 3PD1A 1AXEA 3QLVA 3EDCA 3W6UA 2JAHA 3NHMA 3H13A 5JYCA 2FXIA 4L76A 4TL7A 1OOEA 3SC6A 3UJDA 1QBKC 1ZUHA 3IMEA 3F1KA 4L4RA 3ZI7A 5T7BA 2JKVA 3FGNA 4KLCA 4DAEA 1DXYA 2CC2A 2I76A 3GLKA 3JWGA 7AT1A 2B3TA 4QDUA 1RXIA 3KXDA 1T5OA 3EJ6A 3NHBA 2P62A 3N7UA 4NJEB 5ICCA 2ZUFA 1JEDA 3FJ1A 2HGSA 2GJSA 4KQXA 3ZY2A 4F3KA 3MHPA 3HA5A 4YMLA 2ETVA 2IBMA 5FR1A 1EUZA 4MH0R 3NZEA 5DXJA 3VVMA 2Y1XA 5KTPA 2YY6A 4K40A 1K5PA 5FPTA 1EZZA 5LB4A 2AJTA 3PNYA 4JQOA 4ZDJA 1ORDA 1TZKA 2XWBF 3FR7A 3KAPA 2A1UB 2YJ3A 3OIGA 4B82A 3QU5A 1JNYA 4B9EA 3A9RA 1DEHA 3OQNA 4YRCA 3S1AA 4PAGA 4TV8B 1COWA 2DFTA 4XYBA 3WQRA 4ENRA 2Z57A 3M81A 1Z75A 1TVKB 2XY4A 4PQRA 1KOJA 3L0ZA 5CITA 4H7EA 3WKBA 1B8PA 1C1XB 1DC5A 3O4VA 3WKDA 3ASVA 1Z0IA 1QPBA 2M6RA 4M55A 4O2BA 3KK0A 1W0CA 4PLYA 2C96A 4DCSA 3FHLA 4JENA 3ENZA 3KSZO 4N1AA 4R0NA 1T36B 1E1RA 1YDMA 2OHIA 2DCUA 1PK7A 1QP8A 3WYCA 1XDGA 2H1OA 4XOIA 3CZMA 3ICPA 3UKJA 5CDUA 1W30A 1UM9A 1C50A 1X9GA 1CR0A 3IYLW 5K3DA 2VJQA 3GRCA 4ALJA 3Q7IA 1TYDE 4IUBS 1KE1A 1TE2A 3FF4A 3DDWA 4OUDB 3TTUA 3PC6A 1AZSC 1U8UA 5EAIA 5CA0A 5AKJA 2MU1A 3MWDB 5CT5A 4BBAA 3MTEA 4TSFD 4X60A 1JALA 2X1HA 4DZRA 1JDNA 3HU3A 4IY1A 3NTVA 1SY7A 4PGMA 5SV2A 1UMKA 3TUZC 1DEKA 5EJGA 1LZLA 1MPXA 4OM7A 4ZAYA 3K70B 2AD5A 1K2WA 1YJBA 3V4ZA 2PKRA 3GBSA 4BFLA 4PVDA 1LY1A 2ZVDA 3HMQA 5K09A 1PT9A 2ILVA 3X44A 1TM4E 2N42A 1G8PA 2ADMA 1O0SA 1LLCA 4CI9A 2H92A 2JLAA 2HLDD 2QGFA 3Q5DA 5BSGA 1PL6A 1ZONA 1RHUA 3GO4A 2C99A 3DNFA 4NMLA 5KCMA 1CTQA 5JALA 5HNKA 4R41A 2EHJA 1ZPDA 1XZQA 2CZCA 3C5HA 2UZIR 3H9EO 4KNWA 2LXNA 1AVTA 3GJ8A 1SHTX 1Z28A 4QTTB 2Q7OE 4MRMA 5DYTA 4JV5B 4IGFA 2H1FA 4I8XA 5IANA 2RBKA 1E77A 5LLSA 3ZJUA 4F3TA 1QUFA 4OMFG 3AVOA 4UAUA 2HHAA 3KEOA 1O94A 3B3FA 2X8AA 3FRIA 4FZJA 4LRXA 4OSEA 2ZW9A 4B6SA 2FEWB 3IKVA 3BRWD 1W36B 1JHAA 1P1JA 1J09A 1U2ZA 3IEKA 1YZNA 5TJ9A 3A4VA 1SPXA 4NG4A 4TKUB 4J0FA 1V7QA 1WETA 2J0UB 4TTRA 1U0TA 3BIOA 3O21A 1U98A 3IOCA 4GYKA 3PC2A 4ALNA 3GXOA 4L4SA 2Z56A 5LQKA 2EFCB 2OAQ1 3P45A 3D2BA 4XM0A 5EPEA 5CAEB 3ZCXA 5L7WA 2C4VA 3VZSA 2LWIA 5B2FA 5EZYF 2OPBA 4GPZA 3AEUB 3TG2A 5TXGA 2QTRA 1NXVA 1AV7A 3V7UA 3WDLA 3V1TC 3ITDA 1OFUX 3ESQA 4MGHA 3DLPX 5BWLA 1NMSA 4EZIA 2IPMA 5C53B 2CLSA 1NAIA 3FZNA 2ON6A 3IVMA 1INLA 1JSZA 2CDRA 3DBRB 2Q3BA 4GZLA 4Q03A 4MP3A 3N8HA 1QORA 4RZXA 2LGJA 2VS1A 1X7DA 1JG2A 1PSWA 3E1GA 3KV1A 3U4IA 4TTIA 5K0LA 5AW6A 1SC3A 3WJ7A 2PEZA 3CPEA 1PUJA 4S0ZA 1OR8A 3L1KA 5CM8B 3ZV3A 5IYZF 3SWWA 1P1CA 3PUVA 2QOEA 3HCRA 4AJ4A 2NAFA 3CHYA 1CUZA 2VT2A 1AKNA 1T8YA 4ESHA 2QI9F 3EWIA 3T4PA 2CHUA 2ZI4A 1JAZA 2JJMA 4BMVA 4HVAA 1QTIA 4XZ3A 5TPWA 3U3OA 3CUSA 1JHQA 1I3OA 1P5RA 3RF6A 3DGEC 3HMKA 4FD2A 1J2TA 1EH5A 2A5DA 2Q27A 1A1SA 1EBUA 2D8MA 4TVOA 4JEIA 2XUZA 1TQHA 3NYWA 1B73A 4D8UA 4LRTB 4L8YA 1QYDA 3FWPA 3KALA 4S1NA 3GFRA 5KNBA 2VDMB 4EPYA 4GLJA 2XB8A 1OHHD 1O9GA 4DXHA 5DSXA 3BFKA 4KMRA 4LHVA 5LIRA 3MT0A 4UU7A 1BGVA 3C3YA 4IV8A 4KGZA 3VOSA 3OCCA 2BGUA 1W49A 1D2CA 4GF5A 1DJPA 2ADFA 1KQPA 3O90A 1RVDA 1EGMB 3W79A 1AHIA 3FMOB 3L06A 3OT4A 4E32A 1Y4SA 2JB9A 2WSIA 5CVJA 2AWOA 3I39X 1AS0A 3PQ8A 4L7QA 1ML3A 2XYVA 2WJ6A 4M1ZA 5EIWA 4N82A 4J6FA 1QQ7A 2BFCB 2E5WA 3WHPA 4NS4A 2OFOA 3DFFA 2PZJA 2PS3A 1BC5A 2JJQA 3EY4A 2OXIA 1SVMA 3PUYA 2BJVA 1RPNA 3ZV6A 3AVYA 4OLFA 1RP1A 1M2WA 3FHCB 3RQSA 2P9GA 1XGKA 1MP0A 2AR0A 3LFHA 1K66A 4GYJA 2ZT8A 4LZLA 2E55A 3IURA 2O7VA 4B3TB 5HF9A 3CIFA 4WK6A 4Z5XA 1RJ9A 5BSHA 3B51X 1J6UA 1Q7BA 2HJ9A 4E2FA 3WIUA 3A2KA 3ONVA 5I01A 2FUCA 2C8KA 5AFSA 2OBXA 1OX4B 3G02A 4D46A 3UAGA 4E2WA 4F7DA 3DV9A 5C81A 1IWOA 2G4VA 5JHGB 1TJ3A 4FC6A 1ZC3A 3HZOA 4QHTA 2IHTA 3S81A 2X6TA 4UHDA 5BWOA 3OAAA 4H1VA 4G41A 4N48A 4UE3S 4JASB 4HH0A 1S9DA 2GNPA 2XEDA 1LFDB 5I7VA 1HOTA 4BLQA 2WWTA 4TTSA 4KBFA 4L08A 4F2WA 3WI7A 1C9DB 4GKKB 2KS6A 1QV6A 2PZEA 1XEFA 5EUBA 4IJWA 2R8PA 5IHPA 3ZCUA 2CUNA 5B3JA 2Q0QA 4JJ7A 2PMCA 5EHNA 4DPMA 1YGYA 2G7MC 2D3TA 4CMBA 5G3ZA 4YHHB 5CFLA 1EJBA 4F4UA 3VO8A 2X9QA 1L7PA 5H1YA 1UKBA 5DEOA 3K0AB 4AWAA 5HKKD 1N7GA 1KI6B 2Q62A 5CNKA 2C5SA 3DE2X 5CPFA 5BUSA 3AINA 4GKJB 6AT1A 1Q0HA 1LF5A 3SHTA 2HAEA 4M8KA 1CXZA 2HPVA 3HLKA 3PE4A 4O1IA 5JSZA 5A2GA 2XUGA 3JQAB 1CUYA 3K1JA 4LYDA 4MI9A 4PRKA 2PUFA 4JMLA 3QXGA 1DUVG 1HQYE 1ZU5A 1F1BA 3AV0B 4FJ0A 3HDYA 3K31A 3LPLA 4V24A 4R69A 1U8EA 2Q7XA 3U4CA 4AN4A 4FE3A 1LPBB 4RL6A 1BDBA 3S2FA 4OP1A 4ZYZA 1U7DA 2YN4A 4D8XA 1YCHA 2HWKA 2VKTA 3KVYA 3NJ8A 1JXQA 1TIPA 3JZMA 3O0TA 1G5TA 1F8FA 2KI5A 1HOXA 4EOGA 1THTA 2F4NA 1KTIA 1NXTA 1PR5A 3P9YA 4PZPA 2O07A 3HXMA 3SEQA 2O0MA 1EA7A 1L6IA 1IWBB 2OVBA 1FLVA 3DMDA 1NF8A 3WAKA 4UOEA 4HWKA 3E3LA 4LZWA 5FADA 4BMZA 4YJ3B 1P7YA 5GY7A 4J16A 2ZI5A 1MXFA 3OMWA 2DECA 1DPGA 4UATA 4WKNA 4EG7A 5A7FA 2GEJA 4WKCA 2G0AA 4HQFA 4ZAVA 4YJ3A 2AFRA 1QK4A 2I62A 1W1UA 2YVKA 4LHWA 1KZHA 3SBDA 5JZVA 1T8RA 2G28A 4CEHB 1XYVA 1BVHA 4RVCA 3RYIB 3I58A 4D6XA 4OJYA 2JBWA 4NMMA 4MA0A 4U00A 2CUZA 2O2HA 2I8LA 4Y6PA 2H08A 4DDHA 4W5NA 3BWVA 1MV8A 3D6VA 1BVYF 3F67A 4P7GA 2OEPA 5TX7A 1T1IA 4HQNA 1I3NA 2HFKA 3RD5A 2BP7A 3E23A 3V6MA 3JD3A 1HMYA 1XKXA 3VFDA 3CRVA 3JCZA 1CUFA 2Z3WA 2C5LA 1E2QA 4P38A 1DBSA 2AK2A 1PEKE 3ICWA 3QJ5A 1RXCA 3KL2A 2E89A 3IAM1 4FDVA 1UK7A 4E7OA 4I08A 4CUKA 4XI9A 1PJBA 1SN7A 2HHCA 1PG0A 3JARB 4PE5B 5DNUA 5DU2A 4MVJG 5ECGC 5F5NA 2Q50A 3ANTA 4NZNA 5CLJA 2QP3A 1CUIA 1ZDMA 2ZI6A 4K6KA 1XNGA 3T3HA 5FOTA 2AQKA 2EDAA 1RJDA 3H1EA 4LZOA 4ZVPA 4BNUA 5JMTA 1LSOA 4F8YA 3K9GA 3GX1A 4GOMD 1JG1A 1OI7A 2ODBA 3QEKA 4DLZA 2PGAA 3VNUA 3MN1A 4OOFA 4K9QA 2PSJA 2PVCA 2F3PA 2QTLA 3SEAA 4DLBA 5TE9A 3TNDA 5JHHB 1D1TA 1HPLA 1LX6A 1WSWA 2VHQA 2JCYA 4FHEA 2GQ0A 1Q11A 1YWGO 4W4TA 2A9PA 3OPNA 5CLLA 3IV6A 4Q9DA 1WP9A 3T6KA 2E7ZA 4QYMA 2HOQA 5C34B 4BEBA 1LDBA 3DAHA 4GMGA 2FRXA 1OT3A 4K6OA 4I3HA 1KYYA 4EPXA 1KXZA 4GS5A 3U7HB 2JJ1A 2GESA 6Q21A 4QQRA 4OLAA 5ELLA 5J4YA 1YZYA 2HSGA 3DKRA 3MRVA 4KE7A 3HSKA 1WMDA 3GNQA 4JLUA 5TSDA 4HN2A 4UEOA 4OXKA 1GVNB 1JHZA 2AE1A 5E7QA 3G7SA 3X1YA 5K0TA 4C4AA 4D4MA 4RVFA 3VNVA 3GAMA 3EQ7A 3U3MA 1JFFB 3BEDA 4MMZB 3T3DA 3U40A 4DMHA 4E31A 1SC6A 1EP3B 4H3KB 1DAGA 5JDIC 2H4ZA 2G7ZA 4PSAA 5IN4A 3DXXA 3NT2A 2FXVA 1J8QA 3M6IA 4J2OA 3D3JA 2YXNA 4I1UA 1GTSA 5KQLA 3DQPA 2IXFA 3AY0A 4WY2A 1L5MA 3Q12A 3FOWA 2VYVD 3V1YA 2XNJA 3K72B 5C1BA 3DTTA 5F7OA 1Z6AA 2AR9A 4TYMA 1VBNA 1NG1A 1OFHA 2FW8A 2CVZA 1M33A 1TNDA 5I7WA 1NZDA 3IV9A 1WMSA 4B31A 2CYBA 1CZNA 3JAKA 1ZNWA 4EITA 4G5XA 1ZIYA 2P2SA 4CKCA 2AGVA 2B82A 4EMUA 4EUNA 4RULA 1U8AA 4RH0A 1NF9A 1F2UA 1S6YA 2H2IA 4HBGA 4YROA 1BNCA 1GR1A 4JL6A 5AJYA 1D5WA 2EQBA 3HH8A 1E2JA 4RDCA 4XPIB 5ALHA 3SYNA 1FP6A 4C5AA 4QUAA 2P9BA 4JROA 1Q1ZA 3EB9A 1NSYA 1X9HA 1AUXA 2BTQB 2XDQA 4ITUA 4BB6A 3VU9A 4BX3A 2G1JA 4KFUA 5IDXA 1SIWA 3UWOA 1IM5A 1F48A 4OKNA 1AZLA 2WAAA 1ZN2A 3WLJA 1EXWA 1G8SA 1IB6A 3WAJA 2WD9A 1KO5A 4G5QA 2IZ5A 4FFMA 5JZOA 4RUKA 3PJDA 4PG6A 4BFSA 3KKKA 1GM5A 3BIFA 2PZMA 3IEXA 1AKYA 2JD0A 1PL7A 4NNOA 4DJAA 1IYZA 3KSDO 1K3FA 1V8PA 4XARA 1JKJA 4F1WA 1J2UA 1N57A 1OWLA 1T6BY 1L8AA 3PFBA 3ROPA 1N5OX 2RHDA 4F5EA 1E4OA 1U0RA 1VHQA 4MEAA 4LFCB 6PFKA 2B8WA 1L4UA 2I4IA 4K9SA 2H1RA 4DLUA 3TZBA 4WUVA 4DLSA 4IOLA 2HDOA 1U0LA 4RENA 3WLPA 1UCFA 1I5OA 5G4KB 1HEIA 2Q46A 3E7XA 4FSDA 4LXGA 2AG1A 2UKDA 2TMDA 3L8GA 4YI5A 2JLQA 2OR3A 2YWGA 3G49A 3G82C 3KTAA 4FOTA 5G4KA 1X15A 3QHPA 4U9HS 1WQ3A 1H3FA 3RDPA 1D2AA 1GUDA 3FN4A 3ROFA 1ISGA 1WDMA 2QVZX 2HK6A 1UR5A 2PX8A 3EG9B 4FMPA 4RKQA 2JGNA 1ZLXA 1YZVA 3VMMA 3EVGA 5HM6A 1Y3CE 2IZZA 4PX9A 1GCGA 5CH5A 3QVTA 2ID8A 1CRLA 4Q9KA 3CG0A 1LFAA 3U3KA 4YUYA 4JI4B 1JPUA 5D2CA 3OJFA 3C6YA 4WCFA 3GLUA 5JPCA 1LQTA 4ONEA 2DR3A 3UO8B 1QC5A 3B3JA 1NUPA 2ZRMA 4F5YA 1B0AA 1U28A 2WFMA 2Y3IA 2G9QA 2D5IA 4L5JA 3C7DB 2OLKA 3BGDA 4V0OA 4ZA2A 5C0OE 1ZD9A 4FCVA 4P54A 2ZCJA 3KLNA 1K06A 4QGBA 1R0CA 2HLNA 2ZJ0A 3K05A 3W9BA 2YY7A 3ORRA 4S2EA 1KSGA 4AN1A 2QYTA 4Z9FA 4EG4A 1YQTA 4F2DA 1FU7A 3GV0A 4TXHA 3ABIA 2FPPB 1KZ4A 1YS7A 1O9HA 2ATEA 2ID4A 2XTZA 3NBZC 4QPCA 3C6KA 1RRGA 2IPOA 2OM2A 2GSDA 4YP1A 2Y1WA 2Y99A 3MILA 1SOVA 1ZOPA 1RJGA 1FDWA 2QN7A 1MX5A 3LFTA 3SHVA 1ACJA 2AQIA 4YJDA 3TRIA 1H5UA 3M49A 1J7JA 2CV0A 1NJ6A 4B4KA 1YB7A 1E7WA 1VLLA 3O2QB 5K6AA 4JWKA 1YT5A 3R0IA 3OQMA 2K5UA 1DC6A 4ZJZA 1P3DA 1N6PA 3D6JA 4RY2A 5AJUA 3FTFA 1LBHA 2XUAA 4F3YA 3GMDA 3P19A 3DHWC 4Y6LA 3O92A 4C7OA 4JK3A 5E9AA 4L6AA 2HDNB 3SCZA 3QWBA 4OU4A 3UIEA 4JC0A 2DR2A 3LU1A 1E1RD 4HK4A 5D3QA 5BSTA 2PJRA 3GGPA 3URMA 1D5CA 2JI4A 2G9RA 1T6YA 3KPVA 3VGJA 1VMIA 2V7BA 2PANA 3ER8A 3HGMA 1M8FA 4IGEA 4Y2HA 2YS6A 4NKRA 4V03A 2H4WA 2I7XA 3JR3A 3SE0A 1RAEA 5C51B 2VNSA 4BQRA 2FWPA 4H3VA 4TSFA 4HMOA 3BA6A 4HFJA 3WWCA 2RGWA 5KTOA 1AJEA 4YMTA 2M1ZA 1ZGGA 4NIMA 4D4IA 2AEFA 5JTTA 1LDNA 3A1SA 4HX5A 5EIAA 3V1MA 1TEHA 3WLRA 4KN8A 4EW6A 1EAMA 2XJ9A 4HKTA 3TFOA 4YRJA 2E4UA 2AXNA 1WP4A 3VR2D 2BGTA 4GKAA 4LNUB 1OLSB 2YJZA 2YOGA 4FOPA 4KU4A 1RRMA 4EG6A 5ITZB 5A6VA 3CYFA 4LNUA 4S24A 3P0HA 3AVWA 1TOAA 1HF3A 3FZYA 1YS6A 4FUQA 3V32A 2J4DA 2JFPA 5JARA 1QOQB 1DRVA 4PTZA 1HQKA 1FTSA 2OV3A 1BA2A 1SA0B 3FZEA 2JLXA 1JTFA 1S2NA 6REQB 4HX9A 2WOJA 1MN6A 2HU5A 4TMZA 2F00A 2MJLA 2CF6A 1ULAA 2H4JA 5CFZA 2VTVA 3MMZA 3O9ZA 5DGHA 4DGSA 3FBWA 5FWNA 4CT0A 1K98A 1QFMA 1Y9EA 2QNRA 4IICA 5K3CA 3DPUA 4KSBA 1OV4A 4CQJA 1BAPA 3RU3A 5KYXB 1C9KA 4MA5A 3QBEA 1OFIA 4RPHA 3CMCO 1N5KA 3VC1A 4GI7A 3BSSA 3UAXA 1NXQA 4E88A 4OHXA 4OHPA 2P4HX 4OV6B 2ZZKA 4UTVA 4OK3A 3OVMA 4XCVA 5HK8A 1V3TA 1K6IA 1I13A 3QUAA 4I46A 2CJWA 1R74A 3R0JA 4TWIA 3VZQA 5JLJA 3V7NA 3WRXC 3WGVA 1H2ZA 2X0JA 3M3PA 1UADA 4NFHA 4EGQA 3WYBA 2X8LA 2AXPA 4BVHA 3ORSA 3BSFA 1IWPB 1U3CA 2QV7A 1P2GA 2VZ0A 3G8DA 4P9NA 1TJPB 4KBYA 2GCIA 4R1SA 4RESA 2VPZA 1UZAA 4WK2B 3SJZA 2YWJA 2HX1A 2K2WA 3I30X 3IT1A 2WEKA 1PGOA 1BFUA 2P78A 3QV1A 5LD2C 4QOSA 5MN5A 3ZK7A 4DLAA 1RLUA 1C8VB 1C7RA 5DNAA 2VSQA 1E98A 4LTNA 4X20A 5JZSA 1JXAA 2F6RA 3NC1C 3PDWA 3VKGA 1U4OA 2Z3VA 2HIGA 3CUTA 1N1EA 1O6GA 4DRZA 4AIIA 4AXBA 2FZCA 1LU9A 2CD9A 3D8TA 2HJSA 3AG6A 3HVHA 3BXPA 3R0ZA 2DE0X 1N4AA 3SVZA 4Z4HA 3GMSA 1I1OA 5CT6A 3SC4A 3TOVA 4BXOB 2UV8A 3VXKA 4LEIA 3DDUA 2V8OA 1T1EA 4O8CA 5FWYA 2XUOA 1NYTA 5LD2B 2AFHA 5DH9A 3VR6H 3DE6X 3ZD6A 1G0NA 3GDGA 3D1LA 1DJMA 2AFHB