4BLUA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
279
structure length
279
Chain Sequence
b'LSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
molecule tags Transferase
source organism Escherichia coli
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
total genus 93
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4bluA00
4FSXA 3KR1A 5HILA 1G8SA 5FUBA 4POOA 5ICCA 5EIFA 3MCTA 1Q0SA 3R6TA 5DT2A 3LDFA 4FS8A 2H1RA 3M4XA 4M36A 2FYTA 4OX9Y 3R9XB 1WXXA 2Q41A 2B78A 1M0EA 3C0KA 3B3FA 4PYLA 2IPXA 4RWZA 1ORIA 3A25A 5ERGB 2NXJA 4CKEA 2AOTB 2C7PA 4DA4A 3PS9A 1XDUA 3FZGA 3DMFA 1T43A 3FUTA 2FRXA 5CD1A 4RTJA 5KS2A 2ZZNA 5FHQA 3U81A 1NW8A 2CMHA 4QDJA 5K0EA 2XYRA 2QM3A 3LL7A 4E31A 2AZTA 3ELYA 3PB3A 2IFTA 3G2OA 4P58A 1R8XA 1XJ5A 4PYNA 3NW9A 2ZZMA 2HTEA 2H11A 3B7PA 2G70A 3E05A 5HFJA 1MJFA 4GOND 1SQFA 1FBNA 4RYLA 1R00A 4YUWA 3NMUF 3AY0A 3LKZA 1L3IA 3ELUA 4FR0A 2IH5A 2EX4A 2DULA 1VIDA 4BY9E 1G60A 5DM0A 2YUIA 2V74B 1VL5A 2QRVA 4P7KA 4QVKA 3V97A 3LDUA 2AR0A 1QAOA 1G6Q1 5HZMA 2ZBRA 3I58A 4M7RA 4RSRA 4PYKA 4HSGA 2PXAA 4PNEA 2Z6UA 4PYJA 2UYCA 2PT9A 3K0BA 1VQ1A 3UJ8A 3SGLA 1G38A 4ER7A 4E32A 4KIFA 3BWCA 5E1MA 2PXCA 5K03A 3CJQA 1DL5A 3TQSA 3H2BA 2BH2A 5DM1A 1AF7A 3G5LA 3HVIA 4FZVA 4OQDA 4RX1A 4YUVA 3PVCA 2WK1A 1RJEA 3LPMA 5E8RA 2GA9A 4AZVA 5DTMA 3P9NA 5KYGA 4DMGA 1UFKA 1JSXA 3EVFA 1XDZA 5LQAA 2E5WA 3LKDA 2O05A 4P7JA 5D1NA 3KR9A 3B5IA 2GAFA 3O4FA 3FTCA 3PT9A 4HTFA 4PGGA 2AOWA 3G89A 1EQAA 5EKUA 1N7JA 2BZGA 3P71T 2VZ9A 2PT6A 3KPWA 4CKBA 1NV9A 1NW6A 2O07A 4RTPA 3FTEA 3NVKI 3FYCA 3DP7A 4XUEA 3THRA 4EKGA 5BXYA 1M6EX 2NXEA 3UWPA 4DKJA 3M70A 1Y8CA 5EOVA 1KYWA 2VDWA 5GIPE 2V7EA 4ER3A 2I9KA 1VP3A 2O57A 3DXXA 2EJUA 2B9EA 3HP7A 5LQCA 1X1BA 5M5BA 2OBFA 1P91A 1NW5A 5D1HA 1UWVA 5EMJA 2ESRA 3OFKA 5LQKA 3LHDA 4HRAA 7MHTA 2P3QA 3BGDA 1X1CA 3DXYA 3BGVA 3JWJA 4YUXA 2KW5A 3G2MA 1IY9A 4PYMA 2C7QA 3QOWA 4PIPA 1ZG3A 5GM1A 1BKYA 1P1BA 1XDSA 2IDJA 2QE6A 2ONZA 1EJ6A 4HTFB 4K6MA 5KQRA 1B42A 1AV6A 3FPJA 1I1NA 2ZIEA 3HM2A 2YR0A 4RTNA 5F2KA 4BP1A 1PRYA 3OZSA 4BLWA 3DLIA 2EJTA 3FYDA 5EQJB 4IV0A 3TM5A 3GRUA 4MTLA 4MIKA 5GM2A 2P1DA 2DPMA 1WY7A 1VLMA 2P3OA 3LECA 5ICFA 3KQWA 5DSTA 5HIMA 3SX0A 2PKWA 5E2AA 3TRKA 5K8VA 2EFJA 4GEKA 4EVIA 1SQGA 1P39A 2CWWA 2YXEA 3I53A 3RIEA 3WSTA 4QQNA 4CTJA 3CJTA 3NVMB 3BT7A 3KQMA 5GINE 3FPHA 3C3YA 5E1OA 2K4MA 1RJDA 3A27A 2PSSA 2BM9A 2EG5A 3EPPA 3ER9A 4KRGA 4M38A 4KWCA 2AOUB 4P7FA 2GB4A 4KDCA 4RTMA 3LSTA 4RTKA 3LDGA 4LG1A 4YV0A 1PJZA 3OZRA 1DUSA 2HWKA 3RW9A 3THSA 1BC5A 1O54A 3MERA 1KYZA 2PWPA 3T7RA 1KPGA 5MHTA 1O9HA 2JJQA 3C3PA 5CCXA 1YB2A 3OPNA 3ER8A 3UA3A 3CJRA 4OA5A 5K0JA 4QDKA 2I6GA 3GJYA 2ZBPA 3FUXA 2OXTA 2WA2A 1NKVA 2ZCJA 5LR6A 3AWIA 4E2ZA 4MWZA 5IKMA 5FWAA 3HCFA 3G2QA 1SUSA 3MCZA 5K0LA 5E2BA 1BOOA 2AOTA 3P8ZA 2GS9A 5K0GA 3HTXA 1YZ3A 3CVOA 5DM2A 1I4WA 3HCBA 5DXJA 1RJFA 3E7PA 1ZQ9A 4E70A 1JTEA 3SM3A 3MHTA 2YQZA 5EC8A 4QPNA 5U4XA 4EQZA 5HIJA 3NTVA 3HVJA 4KIGA 5EHIA 1YFLA 1WS6A 3M6WA 1AQJA 2LD4A 5DPMA 2CL5A 3TKAA 4A6DA 4RVGA 2ADMA 3BKWA 2HV9A 3FUUA 3HVHA 3BUSA 4QVGA 4XUCA 5EMLA 2AOXA 1XTPA 1N2XA 3KPJA 3KPVA 3S68A 1NW7A 3O7WA 2IH2A 1U2ZA 4IKPA 3GIWA 1Q0TA 4HH4A 4L7VA 4E30A 3GRVA 5DX0A 1KIAA 2NP6A 3EEYA 2N47A 5FULA 4V0RA 3V8VA 5DLYA 2PBFA 3A7DA 4C06A 3DOUA 3TLJA 2GLUA 2NYUA 4PGHA 3HVKA 5HEKA 5T64A 5EG5A 3M33A 2PX5A 1X1AA 3SMQA 4FT2A 3SVZA 4R8RA 4HG2A 3UA4A 5F2NA 2Z6AA 5FQNA 3I5UA 3PFHA 3PLAE 2G72A 5DM4A 1JG1A 4GQBA 5FQOA 4RTSA 1VPTA 3B3JA 3IEIA 3KKZA 5EVJA 2O06A 5EEGA 3KU1A 3A26A 4QPPA 1P1CA 1Z3CA 4PONA 2JG3A 3PX3A 4AZWA 3GNLA 4LWOA 2XVMA 1FP2A 2NNWB 1YZHA 3FPEA 4LWPA 3DR5A 4R8SA 5LQNA 1M6YA 4H0NA 1L3CA 4X63A 2ZWAA 3HNRA 3EEOA 1WZNA 2IP2A 3KPUA 2GPYA 1JG4A 3AXTA 4X41A 3ELDA 3UJDA 1I9GA 3VC1A 4YUYA 3T0IA 1NBIA 2G71A 3VYWA 3TOSA 4HC4A 5CM2Z 2OO3A 3KQVA 1YUBA 2PLWA 5HOQA 3FUVA 1F3LA 4FGZA 5K0BA 5LQJA 5CVEA 4R6XA 5HIKA 2C7OA 1OR8A 4PCLA 4U7TB 4QTTB 5C1IA 2ZLBA 4GOMD 2P7HA 3G8AA 3GRZA 5CVJA 3HA5A 1D2GA 2BR4A 2YVLA 1KPHA 3BWYA 3FUWA 1L9KA 1RI4A 4GC5A 5FA5A 4CXMA 3R24A 2O0LA 4E2WA 1QANA 2AN3A 2UYQA 3EVDA 3M6VA 3TM4A 2AOUA 3LCCA 5GIOE 5DSXA 4HGYA 4OBXA 5E8JA 5KVAA 2PX2A 3EVEA 1SKMA 3R0QA 4OA8A 2IH4A 4R05A 3GCZA 5DTRA 1KP9A 3MTEA 2AS0A 3O31A 1AQIA 1D2CA 1R8YA 1XXLA 2ZIFA 5F2OA 4E2XA 3K6RA 2OPBA 2P40A 3NJRA 1G55A 2VDUE 4C04A 5EMKA 4BLUA 2B3TA 1H1DA 5CVDA 5GWXA 1NE2A 3DMGA 3KQSA 2ZVJA 4F85A 2YXLA 1KR5A 2JH9A 5JR3A 2AN5A 2ZW9A 3EMDA 3FRHA 2HR1A 2NXNA 3X0DA 4R6WA 1R6AA 3GDHA 4OQEA 3UFBA 3FTDA 2VP3A 3KQQA 3OU7A 4RVDA 2PX4A 4KVZA 5FCDA 4DM3A 3BXOA 3EVZA 5IH3A 2IBSA 1ZGAA 3P2IA 3Q7EA 5E9QA 2IGTA 2VS1A 4IV8A 1X19A 3DUWA 4XUDA 5KQSA 4PWYA 3P97A 3P9IA 3T7TA 4YMGA 2G1PA 2ZIGA 5CVUA 1MHTA 4M37A 3KQOA 3GRRA 5T67A 1JQDA 3AXSA 3SSNA 1EIZA 4GF5A 1L3BA 4CWAA 2BR5A 1O9GA 5HIIA 2YXDA 3FTFA 1R74A 5E9JA 5DRTA 1SUIA 4P7GA 3C6MA 5EKXA 3HCEA 4OBWA 2G8NA 3P2KA 5EPEA 4QTUB 3KR0A 3MAGA 3KHKA 5FTWA 1TW3A 3D2LA 5EGSA 2CMGA 3G88A 3MQ2A 3SSOA 2JHAA 4XCXA 2ZULA 2PX8A 3LCUA 4CTKA 3DH0A 3G8BA 3KPYA 3TPZA 4PINA 4Z2YA 1NV8A 3BZBA 4DCGA 2OZVA 2B2CA 4AZSA 2FPOA 4U7PB 2PY6A 3CBGA 4RVFA 3HCCA 5EIWA 3TMAA 2CKDA 2F8LA 4GOLD 3TR6A 2XVAA 4C08A 3ELWA 2OKCA 4YMHA 2XBMA 4ER6A 3A4TA 2Z6QA 2A14A 2FK8A 2YX1A 4GBED 2PJDA 3C6KA 5DXAA 1D2HA 4E2YA 5EEHA 4F84A 4PYIA 4FT4A 5BW5A 2UYHA 5DX1A 5BW4A 2IBTA 4ER5A 2AVNA 5K05A 4AUKA 3VC2A 3UBTA 5H02A 1RJGA 3GU3A 2P41A 10MHA 9MHTA 3B89A 2P35A 4PYQA 2ZFUA 3IHTA 3UJCA 3LBFA 2P7IA 2ZSUA 3EGIA 5CUQA 3SXJA 3DULA 3EVBA 2OYRA 2QRVB 1ZGJA 5EMMA 2P3LA 5DX8A 3EMBA 2I7CA 2NXCA 3UJ7A 2Y1XA 5FADA 4C4AA 1INLA 1SVUA 4BLVA 4EK9A 2NP7A 3L8DA 2WA1A 3FPGA 2PV0A 4V0QA 3UJAA 3HA7A 3NWEA 1EAMA 3ORHA 1X1DA 5C0OE 4YV1A 2XYQA 2PVCA 4PIMA 4PYOA 3B3GA 3I64A 1ZKDA 4RTLA 3P9KA 5K0CA 3JWGA 3IYLW 1NBHA 1WXWA 3HCDA 5ICEA 4MQ4A 1RI1A 2HNKA 4AZTA 2YTZA 4GOOD 5K0FA 4PCAA 3SR4A 4C05A 2AN4A 4RTQA 2QY6A 5EZSA 3SSMA 4ATNA 3KQYA 1QZZA 4YUZA 1JG3A 2ZWVA 4EKIA 2XYVA 3FPFA 1R18A 3EVGA 2BM8A 3HEMA 2JHPA 2IIPA 4G56A 4WVLA 3BGIA 4DCMA 5CCBA 1IXKA 2ZZKA 3UJ9A 2B25A 4FP9A 1JSZA 2JH8A 5E1BA 3PTAA 4Y2HA 1QAMA 4ZTBA 2H00A 5E9WA 2VDVE 2JHCA 3GRYA 4RVHA 3DLCA 8MHTA 3E23A 3JWHA 1UIRA 3VSEA 3G2PA 3ME5A 5K0NA 3G5TA 3LX6A 1EJ0A 5EHGA 4E33A 5G02A 3LGAA 2UZ4A 3GO4A 3LCVB 1JR4A 3E8SA 3KQPA 5ICGA 3EGEA 3P2EA 3R3HA 3HA3A 5C9ZA 1HMYA 3OE4A 4X60A 2I62A 3MTIA 5FHRA 1RI5A 3KR2A 5T6BA 4RV9A 3REOA 3DMHA 1XCJA 5JUWA 1F38A 4JXJA 3GXOA 4ER0A 2AOVA 1KPIA 3I9FA 3NDIA 1FPQA 4QQKA 2HMYB 3EGVA 2PWYA 2OB2A 1TW2A 4B17A 3ID6C 4GC9A 4UOEA 1JG2A 2FCAA 1JTFA 1RI3A 3KQTA 2FK7A 3OU2A 4EMSA 3M6XA 4ISCA 1BHJA 5DRYA 5DTQA 4KW7A 5LQUA 2ERCA 3EVAA 2OB1A 3P9CA 4DQ0A 5K01A 4MHTA 5CIYA 3BWBA 1IM8A 4A6EA 3UZUA 3UJBA 4X1OA 2FHPA 2UYOA 1FP1D 3QOXA 3UJ6A 1YF3A 3JWIA 2PXXA 3CKKA 1FJXA 5FA8A 1EG2A 2OY0A 5LSAA 3RODA 1L1EA 1N7IA 1HNNA 3MB5A 3T7SA 5GP1A 3NDJA 3NWBA 3QV2A 3BKXA 2C7RA 4O29A 3OE5A 3MGGA 3DXZA 2P8JA 5CVVA 4AX8A 1NW3A 1TPYA 4X61A 4DF3A 1DCTA 1VBFA 1VE3A 3OZTA 3OFJA 3ANXA 4WXHA 5FWDA 3A7EA 3TFWA 1XVAA 2GH1A 5B1SA 3IV6A 4C03A 1JQEA 3BWMA 1QAQA 2ZBQA 1ZHFA 1WG8A 3DTNA 1KHHA 3FRIA 3LBYA 3CC8A 4RTRA 2PGXA 1YFJA 1V39A 4IWNA 3EVCA 4HGZA 2ONYA 4C07A 4DZRA 4FSDA 3G7UA 2ZTHA 1JQ3A 1NT2A 1XCLA 3CGGA 1KXZA 3TKYA 2QYOA 1VP9A 3M6UA 5GOZA 4BP3A 3CCFA 1ORHA 3AJDA 4Y30A 3ERCA 2R6ZA 2AVDA 4GUAA 3PFGA 5K09A 4LECA 3F4KA 5E1DA 3Q87B 5EZQA 4KDRA 1SG9A 3GWZA 3OU6A 2ORED 4NECA 5P8WA 2IDKA 4YV2A 3PX2A 3OCJA 5LQRA 4F86A 4RTOA 2Y1WA 2R3SA 3HCAA 1RI2A 3GGDA 1QYRA 2BR3A 4CKCA 5DWQA 1G8AA 5BP7A
chains in the Genus database with same CATH superfamily
1BYUA 3OE7A 4PGFA 2PFGA 3BXZA 3S0JA 2IEDA 1LBTA 3OQNA 3N3BC 2O8NA 2HHJA 2RAVA 2WVAA 4MGHA 1JIQA 3F5QA 4R9SA 4M36A 2V7PA 1ORTA 1KSGA 4YT2A 3OSUA 5ILOA 2J87A 3QKSA 4G8BA 4BFXA 4YR9A 3TLEA 5E2IA 1NBMD 1U98A 3FNBA 4FDAA 3IMEA 4ZKDA 4F1KA 1OT5A 1USVA 3A6HA 2VYVA 4UOQA 3WLNA 4YDSA 2VATA 4F4DA 3QFRA 4XTRA 2HQBA 3DC7A 2HIAA 4KIUA 4TTQA 4B7UA 2YHIB 3MVEA 3PUWA 1CNFA 1H6AA 4QFDA 4BNNA 5LZ5A 1WUJS 3AZPA 3OIDA 4WBNA 3R7WA 3B12A 1XTUA 2A0YA 3KYDB 4XB6B 2J08A 1ISSA 2WU0A 1OBOA 1RWPA 4ZICA 1N2BA 1B00A 1NXSA 5CB0A 1RXCA 2WP0A 4TOIA 1F60A 1R00A 1XHLA 4D9NA 2B4QA 2O2GA 2G9ZA 5J2UB 3GWGA 3ZZ0A 5HUQA 1RZRD 4FR0A 4FMCB 1WBBA 1GD1O 2W2KA 1UBEA 1R6XA 1W0JD 3PI7A 4E5SA 4L8YA 2A9OA 2VJQA 3PGXA 2QRVA 4BY9E 1LV7A 5CRIA 4ENWA 4LXHA 2VAWA 5AKEA 1QR6A 4GDFA 4BV9A 3JYQA 4M7RA 3L1IA 3G8YA 4WW0A 2RAUA 1F4VA 1Y33E 2A92A 3FNEA 4J0EA 1GRVA 1PZHA 2Q3EA 2GEVA 2VEOA 1VQ1A 1T0PA 1ZNZA 2IPLA 3ZQKA 1QM5A 4HWPA 5J59A 1ZM4A 3WICA 5E1MA 1ZIPA 4ZEOA 3W8NA 3T3DA 3L1JA 2OV6A 3R6LA 3TIIA 1MQSA 3K6SA 4TWAA 3C3AA 2G3YA 1CW2B 1IUKA 4EFNA 2CUZA 2R60A 3D6FA 1G8YA 4R7ZA 3RVKA 3CX7A 1UZNA 4KI0A 1W2HA 4QE3A 5AI8A 1SOMA 5F33A 4NOMA 1RXEA 1XDZA 1PQYA 4A23A 5B7PA 3VNSA 2IUTA 3HUUA 2DSTA 2SECE 2WKSA 1L0BA 3AETA 3PUIA 1M2GA 4KQ6A 4ZGGA 2Z2YA 2Z8XA 4HCJA 2D1YA 3HY6A 4LQDA 3HP1A 4IG4A 3CNLA 4X8HA 3I32A 3UMSA 1AT1A 5KNDA 2IYTA 2WIBA 3PV0A 2WBLC 1W4BA 3MQ4A 1EKXA 1RYDA 2EBFX 1OLXB 4I55F 2JKYA 1NM5A 4PQGA 2BL4A 3F3KA 1EJ2A 1V1MA 3OPXA 4A6PA 4JIGA 4EHIA 2QTZA 3M89A 4LRQA 4KN8A 1PJAA 3F8SA 1IMOA 3NTUA 4KXNA 1MAAA 2HXYA 3GLHE 1R88A 5LP6F 1FX1A 5EHXA 2X8JB 3PQEA 5EMJA 4UNRA 3BHNA 5JNWA 3UOAB 2VRBA 2BGLA 1PSZA 3CO0S 2J6BA 2PKYX 1IY9A 3BBLA 3NC1C 2HA4A 2JANA 4D6PA 4IR7A 3OF5A 4IFBA 1DAOA 4QYTA 4F7WA 4IOLA 2GK7A 1XN4A 4N40A 5C8YF 2BISA 3LWBA 4LNUA 4WRRA 4AY5A 1BJTA 4C0WA 1QGZA 1I1NA 2NSHA 5EXDA 4FOPA 3QJ5A 1TD9A 1GO2A 3H86A 4Z7JA 2YV2A 3JQFA 3OZ7A 2ZJOA 1X86B 1FXWA 2Q8PA 4NHOA 4OM8A 3RHTA 3U17A 1G5QA 5HBGA 4DADA 2DAPA 3TLCA 4PRKA 1KKUA 5IVPA 4K03A 4ZD6A 3D6NB 1FA9A 2H85A 2W00A 3BICA 3LG2A 2A0WA 4IXTA 3H99A 1E5VA 4MUFA 4DV3B 4AAYA 3Q6MA 4RIFA 1OVGA 5E1OA 1UFQA 4AQYB 4PAOA 4LF9B 1RM5A 5K4HA 1SXPA 3R4CA 1EB8A 2R8OA 2ST1A 3OQ6A 3EG9B 4QU0A 3T7CA 3UG6A 3MT7A 4LXTA 3VNVA 1J49A 1GKYA 4BO6A 3MBOA 4LG1A 2ATCA 1A9QA 1PR9A 3R9IA 4AFNA 3SHWA 4EJSA 2ZSDA 3GEHA 1L4EA 4HX9A 1SZJG 1KYZA 3T7RA 3ZHTA 3LQ2A 1X70A 1PT7A 4ZTZB 2ERYA 4YFYA 1F2UB 1EM8B 4RJIA 3IIJA 1GPH1 4P53A 4WNIA 5EP2A 4EAQA 2R6R1 2WV9A 4HPWA 4ISBA 4BO3A 3IMKA 3MCWA 2HGZA 4MYHA 2A33A 3SG0A 1RVV1 1Z2DA 4ASUD 1R4NA 2XIJA 1CUHA 1DWUA 3MYRA 1E7WA 1ZICA 2HRRA 1JG7A 2NVUA 2UKDA 3PPWA 4GLFA 4JBWA 1VJTA 3TVDA 2B1GA 1EWTA 2E2WA 2X5KO 5ICMA 4C7MA 4Q4JB 1IN1A 4J0CA 1KMHB 1G5HA 1HMPA 1KH3A 1R15A 2EKZA 4G8JA 1RM3A 1M74A 5FBKA 3SXUB 3S99A 5EWMA 5CXUA 4KYUA 3LOUA 3UHJA 3B1JA 3IAHA 3L18A 4HGRA 4QGHA 1AGPA 1T2NA 2C2GA 2LD4A 4V0LA 2FN9A 4NCNA 2CL5A 4S35A 4M9XA 1FTQA 3GMIA 3HI4A 3S68A 2D59A 3R3WA 4XYBA 3L0OA 4M8KA 4E30A 3IT1A 2WJHA 3KDPA 2P2SA 5CR9A 1KQNA 2OAGA 3GDWA 4C89A 2JJMA 4DR4B 1P2SA 4HYQA 3DVLA 2HPVA 2CDNA 4NWIA 1QHEA 4MKRA 2PBFA 3T5AA 2J0SA 5E6SA 4FR2A 1PTJC 4FEYA 1CDOA 1JHUA 4EG3A 4BO4A 5LNK1 4LPSA 2IS6A 3BWDD 3T3OA 4MQBA 2ZSHA 1P9OA 4JYAB 5A04A 4HLUA 2V6IA 1M76A 1E2UA 3KV3O 1V96A 4FBLA 1HDZA 1R0WA 5BSVA 4JMPA 1F8FA 1EDZA 2NO1A 1C7RA 1SCBA 2PMFA 3BH0A 3G9XA 3VTKA 5BQ3A 4FYPA 3ICPA 3U7QA 3UJHA 1XG5A 5CT5A 4REOA 4XM0A 3LLUA 5ALVA 4O2LA 3AHIA 5HF6A 4FW8A 4B7CA 4UULA 2WYWA 2JBHA 4BO5A 4F45A 2XUGA 2KLHA 5E6UA 2R00C 3OURA 4JBLA 3ZXYA 2L42A 4EFDA 4PO3X 1XL1A 5FYDA 4WESB 4XSGA 1IK6A 1RAFA 1ZA2A 2ZI9A 4GMGA 1TZMA 3G0DA 1SURA 3PXUA 3U7JA 3RV3A 4Y2VA 4HDKA 2ZR7A 3ROQA 3AMVA 3Q7SA 4KAJA 3I9MA 3AVYA 4UM7A 4JC0A 1BE1A 1OXBB 1XOIA 1LKZA 1ST3A 4X84A 2WMOB 3P9PA 1UXGA 1G2QA 2OBMA 2QLLA 4DGQA 3I2FA 4JJGA 3LLMA 2HWWA 1W35A 3HXPA 2NAPA 3BDVA 3ORQA 2V96A 3RHZA 3ZEIA 5B1DA 2HRCA 3LCCA 4X5OA 5K45A 2WD8A 1EXVA 3IJRA 1EZ4A 1X9GA 3OVMA 5FBQB 5KNCD 4KREA 3QEOA 5EQDA 1Z08A 5EPOA 1TCBA 2XA1A 1EUZA 1UBTS 2J48A 4IDBA 1XCOA 1D2MA 4YFVA 4YB8A 4L1KA 1CP3A 4UBKA 5CJ2A 1RRVA 3FRJA 3NJRA 2ZKIA 3JZFA 3MWDB 2VQSA 2I4NA 5EMKA 4Q9NA 1RRCA 1J1UA 2YIJA 4C7OA 4A1FA 1F8XA 1IY2A 1QH9A 1EZ1A 4XW2A 3CB2A 5FPPA 4RS3A 3ZKWA 3EEQA 1KR5A 3QPUA 3ZGNA 1IN6A 4FFRA 4D6YA 1SBHA 5JR3A 2AN5A 4DIEA 2FQXA 3L46A 5AICA 1QLHA 5JLAA 4KQJA 3VR6H 1JSCA 3B52X 3TMYA 4EPRA 3KETA 4P6VF 1JU3A 5AI6A 2XD4A 3DL2A 5EQFA 3F4BA 5KAMA 4J0GA 1R0XA 3RH0A 4XVHA 4RPLA 1C9MA 1T9ZA 2X5NA 4V3CA 2BELA 5FCDA 3UF0A 3U1VA 4DM3A 1QO9A 2G5PA 1KZ6A 2OXCA 3O73A 1NR7A 2H31A 4PLCA 2G1PA 1MRNA 3QIAA 2C58A 4YIKA 4MKXA 1FVHA 2C9BA 1JLLB 4QPDA 1OX4A 1YQXA 3R6WA 3VR2A 5LMUB 3HY4A 4RZIA 5JAUA 3P2YA 3BMOB 3P96A 2CV0A 1BMQA 1O0SA 2NU8B 2WJ6A 3E9MA 4EI7A 5K4GA 2QP3A 1YZGA 3SD7A 2EIXA 1CNMA 3E3NA 1PQWA 1YKFA 2MDTA 1JPNA 2QRNA 4MVWA 5CYPA 1DTWA 3C7DB 4J4BA 3WYNA 5C1PA 1ZH4A 2CLOB 2CJWA 3R5KA 4F60A 1C9KA 4I9UA 5HX7A 2JHAA 2WT8A 4B7ZA 4M1KA 2IYVA 5AFSA 3RHSA 1DWOA 3QPDA 4U7PB 4MW5A 1NJ2A 1OYWA 3Q3EA 4R9UC 2Q5LA 4XJSA 4D79A 1I10A 2GHTA 1I3MA 2BHRA 2J3EA 3ZDYB 4UQLA 2HEIA 1VG8A 4DC0A 4PQRA 5AK0A 1OI4A 3MGKA 4JJIA 5IJWA 4FT4A 3NIWA 4LXGA 2C3OA 4JQCA 2UYHA 1E8NA 3UK0A 3HGMA 1G20E 2GRAA 3MMXA 1HL3A 2VF8A 3KCQA 3ZEAA 5EZYA 3FG9A 2BKVA 2QYHA 3S40A 1E9FA 1ZR2A 2QN8A 4UNSA 4JC4A 4V03A 1YB1A 2XUDA 4N3BA 2X41A 2LKDA 2LWIA 1SQ0A 2FI1A 4HFJA 4IJ6A 4GLBA 4M6WA 4O4IB 3RTDA 4X64B 4MYDA 2YYSA 2QRVB 3PQ7A 2Q28A 1C1XB 1HYQA 1ESNA 3QLUA 3HR7A 5B4VA 5T4HA 2QLMA 4YRBA 1NN1A 3UJAA 1AKEA 3EXEA 4UTXA 4YV1A 2PVCA 1W2GA 4G8CA 3NH9A 2HQ1A 3PE3A 4PYOA 4EJMA 1CS4C 4Q12A 3WGLA 1N9GB 3IYLW 4FCWA 3DR3A 3O26A 3KZNA 5ALYA 2PQ2A 3H9UA 2GCNA 4I08A 4C3OB 3KE9A 1REQB 1QTRA 1ZI8A 2DG2A 1XZMA 1EXWA 5HQTA 3LO5A 4GPD1 2FTKE 3P32A 4KFCA 3EWNA 3H5IA 4KVAA 2F90A 3M3PA 1T3HA 1KJQA 4HWOA 4DCMA 5C8YB 2EDAA 2P9CA 5EJ6A 4ZC1A 5D6OA 5DYGA 3RUPA 4PN3A 1YA8A 2JH8A 1JA9A 4HWSA 5H3CA 3MSCA 2DH5A 1OLUB 3UWKA 3W6NA 2WJYA 3QZUA 2ZT8A 1CJSA 5I4KA 2OQVA 1UMDB 3JWHA 2CXXA 4BHTA 1TTPB 1PR1A 1LPAB 2XVYA 4ND6A 3NNSA 3MEQA 1VKHA 2UZ4A 1JFRA 3FCAA 3L82B 4K6KA 4DWWA 4UPEA 1OGIA 1F2TA 4RHYA 1EVJA 2FFAA 2H17A 3HA3A 4QX6A 4D0SA 4EA7A 2UZIR 2IIBA 4L4XA 4UE6A 3WQQA 2C2ZA 2IEAA 5SZHB 5IAAA 1CXZA 1X0VA 3NV9A 4UZSA 2Q50A 4BMXA 1QIHA 1U28C 1H69A 5CNKA 4BECA 2NYAA 3WLOA 1ISPA 3GXOA 4IDQA 4ZOBA 1Z0FA 3SR0A 2AFHE 4TV9A 1W59A 3C14C 4FC6A 2RHOA 3ZHBA 1VCHA 4IEIA 4JI7B 1FB5A 2L17A 1E5QA 4IOKA 3AVPA 4GX0A 1Z4IA 3EB9A 4LZOA 2AFHA 1L5ZA 5FBVB 5C80A 1NVUQ 1NVBA 3ES9A 2OB1A 5KYYA 2QXTA 3NGXA 1FC0A 4WOBA 5IKOA 4B6OA 4MHTA 2O5CA 3RSFA 2QDKA 3JRXA 4OF4A 4F91B 2QNRA 4N41A 4DR6B 2QP9X 1ZJ5A 3S29A 4WIAA 4AULA 1V7ZA 2IQ5A 1JB1A 3CRZA 2XCIA 2CLIB 5AM4A 4B84A 3AEUB 3G68A 5IM4A 3S8YA 1P19A 2G0TA 4NSNA 1GEGA 3CTPA 1MC8A 2HV8A 4MB6A 5IN4A 4N01A 4O29A 4GNRA 5KTTA 3OM8A 5T5QA 1VL1A 1MW9X 1YHYA 3AB3A 4WESA 5JZ9A 4MRAA 5CTJA 4ZI2A 3IDZA 1JEOA 1A8QA 1KQPA 1SIUA 2YVQA 3LC2O 2VPXA 1KMIY 2C31A 3LGSA 1KI2A 4HS4A 3FWPA 4WXHA 5HMLA 4ZEWA 2GDZA 3BD8A 4CMBA 1G63A 1FNBA 3RYFB 3RAGA 1I2ZA 1LSUA 1VIAA 2ZBQA 5JS1A 3IRUA 2JJ8A 3RVRA 3OLZA 2IIQA 3TAUA 1IZ8A 3LDHA 2DUWA 4B3XA 1XVVA 3OZWA 1CE8B 4YJKA 1CB0A 1DAHA 3OEED 3VQTA 4DZRA 5ALFA 3H8VA 2Z3ZA 1XCLA 3WP0A 1UXJA 4GLLA 2L69A 4FIDA 1GZ7A 1QPBA 2R6ZA 1QDLB 3G1UA 2HO4A 4YAEA 3RSQA 1CUJA 3B1WA 3BRCA 4EPWA 4LECA 4A5SA 2WYUA 1F1JA 1Q77A 1FQWA 5J4VA 1M7BA 5IK2D 1ZM2A 4MIEA 1Y8ZA 4KQKA 4IVNA 1RLMA 1W87A 1EFLA 3L1UA 3MUNA 4KH0A 3I76A 9ATCA 1WZUA 5K9ZA 1PEYA 3K0AA 4NZOA 5K7SA 1QYRA 4GWLA 1J6UA 4JHLA 3TVTA 1JH9A 1UP4A 4XIGS 1FYWA 4X24A 4DIMA 3BHIA 4KTVE 1E89A 3FTQA 4TUYB 1Q0SA 1SBCA 4PX9A 4FPXA 1V1RA 2VPQA 4JR1A 4X1IA 3M4XA 3JARA 3BD6A 4B3HA 1AKVA 1E4YA 5JZMA 1CVIA 1RS0A 3B3FA 2DXIA 4PYLA 4FC7A 4RWZA 3E1KA 1VKNA 4LE2A 1A8UA 3RJZA 3GLFA 3EQ7A 1M3SA 4U02A 2OFFA 4ZT5A 1XDUA 2JATA 2B4KA 1PWHA 1T43A 2QMZA 2QVCA 3ABQB 4JT4A 4YY3B 3CR3C 4YP6A 4PLHA 1Q2XA 4AP9A 5I7RA 4Z9XA 1T1IA 2I3ZA 3K9LA 3CA8A 4PAWA 3PA6A 5DNEA 4TMYA 1Z75A 1I30A 1YJXA 3HDTA 3JZAA 5ARCA 4Q1VA 4W5OA 3AT1A 4UE3S 4B2YA 5BOSB 2ZYVX 2ZZMA 3ZI4A 3HFGA 2H11A 3UJ3X 1YK1A 2YZGA 3KKKA 3IQFA 4G1VA 5CMLA 2PKRA 1KBOA 3TGWA 2PZGA 1X9IA 2VWQA 4MVJH 3EXG2 4A8HA 4XIYA 1PLKA 2HPHA 1A5SB 2ZIZA 4MVJE 4TQUS 3QMWA 3ONFA 4YRPA 5JIBA 3IKLA 1FPMA 3RT7A 2FFJA 1XZEA 3EPKA 4E6EA 2C57A 4TMXA 3VR2D 2VCEA 3W5DA 4HQOA 5JV5A 2AR0A 1QAOA 1IBCA 4Z7NB 4S0ZA 5JRZA 3D7RA 3I58A 1CIJA 2PUBA 3ANNA 4ZT2A 4QUDA 5HVNA 5MN6A 4WZ6A 4K9RA 1LDYA 1YRHA 2XUQA 3G8CA 3SFTA 1GL9B 5I7WA 2XE8A 3SZLA 4YRIA 3AKDA 4ESHA 2WINI 2PXCA 3HE3A 3FNIA 2VJKA 2VYNA 1MVOA 3L40A 2QG4A 3R9XA 3L4JA 3H17A 2WE8A 4XX1A 1QOQB 4W5RA 1G21E 4PZEA 4RX1A 1D1QA 1F12A 5CT9A 5LMNB 4ZWNA 4RESA 4WHMA 3V1LA 3REGA 2GA9A 1T26A 4IGKA 4OHUA 3VXKA 4COOA 2EKQA 3P9NA 3C7CB 3TTUA 3WQSB 1UFKA 1SVOA 3I1IA 4FKBA 4U2GA 4IFEA 4K9QA 3SHFA 5HPYB 2PL3A 2LGJA 3I3SR 3Q7TA 2FEMA 4AMZA 2PZLA 3S55A 2YIVX 2F17A 3O7MA 2YFYA 2EWWA 1QNFA 4CLHA 5CBPA 3K1ZA 4UJ5A 4YJHA 2JJ1D 5JYEA 4QJ3A 3F67A 4JL8A 5TS3A 3HN6A 1NM5C 1YACA 3DZGA 1VFPA 3OJWA 3NVKI 2WF9A 3WFJA 4GECA 3CSSA 3W0LB 2FZVA 4OTZA 4RQAA 4EL5A 4ZDKA 4P8RA 5A02A 1F14A 3DB2A 3NXKA 1C9EA 4NDAA 1PR5A 5DBFA 4YAGA 3A2KA 1FCJA 1JF8A 4C6TA 2OXFA 3K71B 3IQEA 4B3JA 5EIOA 5LNK6 7MHTA 2C9DA 5ALIA 1H85A 1F0YA 4DTCA 3A4IA 3ADOA 4J9VA 4WINA 1E3EA 1IATA 5FI5A 1ZG3A 4FOTA 5BSUA 3JZDA 4W9RA 3W5AA 1ZO8A 4G63A 3WZLA 4XWGA 3FPJA 1QPGA 1UZAA 2EJWA 1VSBA 2YN4A 3GVHA 3I83A 3JQFC 2GNOA 4ABYA 5AT1A 2VDPB 3B1YA 3T1YB 1CS0A 1QVZA 4BXOA 2FJPA 2FUEA 1DKRA 5DTEA 2EJTA 1R6DA 1YTLA 2W2XA 3GRUA 1JW9B 3RYHA 3T3IA 7REQA 1FVOA 3LUBA 3AONB 4FMCF 5BPFA 1FRZA 3PIDA 2OZKA 4KE8A 4OLAA 2OHJA 2V6FA 3RIEA 3R09A 2HLPA 2JHGA 5FT9A 4ZPXA 3C5WP 4AJ1A 4B9EA 2WU4A 5JSFA 2QLBA 3GUUA 1NUAA 3K8OE 3QLVA 3OPVA 4WKCA 3UY4A 1NLZA 1OD6A 2HD4A 1DLJA 1ESEA 1ZMXA 2X77A 2YINC 3GFPA 5EXEA 3NCTA 4RTKA 4GWKA 1NDUA 2QL9A 4DR5B 1PL7A 3DF7A 3EG5A 1RBQA 2X13A 5KWJA 1QDEA 1THTA 3A3KA 2ZQ5A 3DJYA 1YCFA 5IBPA 4DCSA 1BD3A 2RJ3A 3QU4A 1JR6A 3MJRA 1PZFA 3VNQA 1M66A 5K0JA 2QVYX 4ALLA 3GG2A 2JGDB 1W4CA 1BCSB 4OHWA 2OXTA 3S2FA 1THZA 4GX2A 4TYYA 2I71A 3TTVA 4ZQEA 3I61A 2C88A 1U3VA 5AI9A 1GUAA 2V6BA 1X2BA 3KCNA 1BOOA 2PNJA 1CRQA 1KU6A 1VGRA 3HTXA 3R41A 2NGRA 2YHIA 5FR1A 2Q2WA 4J91A 4LYJA 2ZJ0A 1IBKB 1PP4A 2WIKA 3E7PA 3N75A 2ZE5A 1QB7A 4KR6A 5H9VA 3VO9A 4ARZB 1E1KA 1RXVA 3RYFA 1DJNA 1PI3A 2KB0A 4Z2AA 1LLQA 3QWFA 2YY7A 4TZKA 4OSPA 2VXYA 5KYUB 1JAHA 3F1KA 1P3Y1 3DEYX 3ACBA 3PR2B 5JQGF 4QVGA 3JD1A 2O8EA 2NV2B 2IH2A 1FUYB 1Q7EA 3CH7A 4OL0A 2H92A 4GMHA 2H59A 2I0FA 1S7GA 2PMWB 1I51A 2B0JA 4WAUA 1LFDB 2RONA 1T1JA 4LHVA 5E0OA 4ALIA 2C61A 2WTAA 3H6KA 5FBZA 4XDZA 3V2HA 3MTJA 1EFRD 3R3ZA 1PTJA 1MO6A 4C14A 4ALNA 5CA0A 1XVUA 2MYTA 3NHKA 3ANTA 1L4BA 4MW4A 5EG5A 2DY0A 4GBMA 1E1YA 1VMDA 2PX5A 4HLUC 4MULA 1SCDA 2OFXA 1HE2A 1X77A 1Z36A 2F3RA 3KLPX 1HTWA 4LTNA 4R8RA 2PGLA 1EESA 1PGPA 1WDKA 2P6NA 1U4SA 1UMBA 3MWEA 1WB9A 1YNSA 1JKIA 3FHLA 1M5RA 3ZTTA 2C8KA 4ARSA 2E82A 3IALA 4Q1AA 1QH1A 2VJMA 5AMXA 2V1XA 1PHPA 5GJVC 1IQRA 4YR7A 2VPYA 4MIYA 3PNVA 4R8SA 3TL6A 1ZJ6A 1M6YA 4H0NA 4RAQA 5B3JC 4GS5A 4X63A 2GN8A 1CZRA 3NUZA 4KXFB 5BWLA 5CM9C 3DDHA 1Z5UA 1XMSA 4JR2A 4L8GA 2O3JA 1TTTA 3JZIA 2P6UA 3GROA 1EVIA 4D81A 1AJEA 4I9GA 4JUFA 3VBEA 5IC6A 2GESA 5CLFA 4KRYA 4ZODA 1FEZA 3ET4A 3RYIB 3FUVA 5CFRA 4KAXA 1EM8A 1SU8A 1V7PC 3ETJA 2I1WA 3NM6B 3DTTA 4AMVA 3BIOA 4B6JA 1PFQA 3SF0A 1Z29A 3H5TA 121PA 3K15A 4LOJA 1WBJB 3ASYA 2FCRA 1K4YA 2QMEA 2RHLA 3IBTA 5B57C 3OEHA 4JI8B 1QWSA 4JP1A 2XWJI 5BORA 3ITNA 1WW8A 3T5BA 5C8YA 3V8NA 1PL8A 3WGGA 4CM1A 2FEPA 4L6IA 4MDYA 3T1NA 2DPGA 1H9CA 5BV0A 1W85B 4WGGA 3IIKA 1V9CA 1TKBA 3GLVA 3PT5A 1R8JA 4RV4A 3LX5A 3LQFA 3I5AA 5AJUA 2NO7A 3VJKA 4FU0A 3U3ZA 5JSHA 1W4LA 3IE2A 3SEAA 3RC2A 3F3SA 3VHXB 1N0HA 2K2QB 5FLKA 1JIVA 3ASVA 3E5MA 4LJAA 4Y0NA 2YYZA 4HAYA 4MA5A 1NE2A 4F71A 3KQSA 4QPJC 3I12A 5EJ2A 1EQUA 2XWPA 4EZIA 4P0QB 4I55A 3EEBA 1N0WA 3HB9A 1P2FA 4FHZA 3I23A 1QH0A 2XBUA 3GDHA 4Z3DA 1LLFA 4XE5A 2VBGA 4BP8A 1TECE 2PX4A 2YS6A 1Z82A 2O1EA 1OI7A 3AHFA 5FPHA 1G21B 2AZ4A 2CHQA 2QD2A 4ABTA 4YCLA 2P9BA 3BA6A 2WE7A 5HCUA 3W78A 5CVUA 3PUHA 3AUFA 3NTRA 1RTTA 2Q4OA 3DLTA 3EXFA 3C7KA 3GPLA 2BSQA 1L3BA 1XTTA 1RXSA 3IOMA 1R74A 3DZIA 3I3OA 3ROKA 4ECEA 1E2DA 3STHA 4MMXB 1H2RS 2ILVA 4ZANA 3VX3A 4HAUA 3P0RA 5FI3A 2P79A 1J39A 3D7NA 3PHBE 2CMGA 2QRMA 3L6BA 1M2WA 1DO2A 3QRWA 1PJSA 4XQEA 4UTRA 821PA 1HNWB 2ETVA 4TT3D 3H9QA 2O2JA 4A0SA 1EEXB 4IILA 4GG1A 2RSLA 3I2YX 2C84A 2PY6A 3KD3A 3PFNA 4F38A 2VT6A 3FI9A 1B0UA 1ZFNA 1RPNA 3MTBA 4GRIA 3GPIA 4WKGA 3WY9A 3EC1A 1P33A 3IO3A 2MU1A 4TS1A 4WLNA 3RVNA 3V32A 1SPXA 1IULA 1J4AA 2VSXA 1IJBA 1L8LA 1LI7A 1TEVA 4QYIB 5DWVA 5KYWA 3BSSA 2H7CA 4KPYA 4IGIA 4ENTA 2HQRA 1YIAA 3GU3A 1A71A 3RF7A 4JV5B 1U1FA 4BMNA 1N5KA 2ET6A 2GZHA 2LV8A 3ZGYA 5CT4A 1AHIA 2CXPA 5A5VA 1Y7IA 1IAQA 1ST2A 3I6IA 3PC8A 3VZRA 1UBUS 4MVJG 2F3PA 3F2VA 1ACJA 4J7AA 4DCVA 2GBPA 4BLVA 3FLBA 3L6CA 5BPHA 3MJVA 2ZRHA 1LNZA 3X1JA 3AVUA 1EFPA 1N1MA 3R3JA 1W73A 4MVJI 1M5UA 2IZ1A 4R8KA 3GPBA 1XLVA 1RE0A 2G7MC 5JAHA 3Q40A 4ME6A 1H3NA 1WUKS 3LLCA 4QELA 3FVWA 5LKAA 3KQHA 4WECA 4HUJA 1CDZA 4ZO7A 1XXHB 4UE2A 1PAUA 5A5EA 3CO5A 4LRXA 4FD2A 1FBTA 2X5JO 3KQYA 3CX3A 1TADA 521PA 5AVVA 3MWJA 1R18A 1QVRA 2O5RA 3FM9A 3L7NA 4ZCQA 1B16A 2R66A 5LZ9A 2WTUA 5DP2A 3AJAA 4O0LA 2GARA 4B8YA 5BURA 2O2IA 3FZNA 4JX9A 5BUZA 4EB8A 4ZQCB 2OILA 4UHHA 1JB9A 4XOIA 5CURA 4YUWA 4LJKA 4P32A 1AS2A 1HQYE 3GNQA 1B23P 5E9WA 1MTOA 4KLNA 1Z16A 2XWBF 3TX6A 1ZVJA 4X9XA 1BE8A 5ALNA 4CN8A 2LUOA 3A9UA 1GGMA 4N9QA 5JANA 3PFCA 5DGTA 4O1HA 2CY0A 1X7ZA 1PBTA 1XZDA 2ABWA 2Q1YA 4N82A 4TVKA 3OTWA 3W5IA 1NYQA 2EU8A 3GO4A 2FPWA 1YQUA 2O52A 4S1NA 2OCBA 4Q4HB 2I1LA 5KNBD 3MGCA 4HV4A 2HIMA 1UXOA 3WA7A 3ECAA 3VPGA 1C50A 2O8CB 1XCJA 1PT8A 1K0UA 5MFPA 3TXYA 2AEFA 3RVJA 1XYYA 3UNXA 2P9YA 3UXHA 3KYJB 3UB4A 1L4LA 1RPJA 3EQ9A 1L1RA 3PQFA 5G1PA 2FCAA 4JBHA 2PZ8A 1JKXA 3JD3A 4Z7OB 1GCAA 1CUCA 2AEMA 2ATVA 4L5YA 1QV7A 3A6FA 3LE8A 4KP7A 4R3WA 3WHLA 1GILA 2XQJA 2JFHA 2BKUA 3I6YA 2GUWA 3MLEA 2P2DA 3LXRA 3EXIB 2XMBA 3B1ZA 4X1OA 5E7JA 5JCOC 4CL0A 1ENZA 5FA8A 3TD2A 2OY0A 2C82A 3K3PA 4EI2A 4MQ6A 3T4UA 2RGAA 4O3FA 5ITSA 2GI4A 2BHSA 4L16A 3G85A 1A9SA 1J0EA 1J07A 1O96B 2Q1SA 3N7AA 1COWA 4FXPA 4KQMA 4PZLA 2W70A 4HWGA 4EW2A 2HLDA 1AXGA 1D7AA 3QWHA 4JC5A 5BYBA 2E7ZA 4M83A 3KFLA 1X13A 4C6HA 3JTEA 1P3DA 3OFJA 4PFKA 3ORFA 2ZJ1A 1BHSA 4OSOA 2XCSB 4ACAA 1T10A 5HR5A 3LFUA 2NM0A 2Z58A 2NIPA 4TTPA 4H1VA 4BLPA 1P77A 5EQJB 3F0TA 5DI3B 4RTRA 2PT5A 5IYZA 1DCKA 1GAQA 3CR8A 4TRRA 3BSYA 3BN3A 4DNPA 4RY9A 4HGZA 4EJ2A 1AU9A 1J33A 1S0UA 2HSJA 3O9MA 2B21A 4QHSA 3E8MA 1C3EA 3IQZA 4FKMA 5CDYA 1YB7A 3P4YA 3T9AA 3TKYA 4BQNA 3O8RA 1Y3DE 1MB9A 1UBJS 2FETA 3AC0A 3HNPA 1UFRA 5EAIA 5L4NA 1YVPA 3EFEA 3HZHA 2UZAA 4ASUA 3ISVA 1UPUA 2FN4A 4BRZA 4ZYYA 3OU6A 1DUIA 2G06A 4LSWA 4OYLA 5TJHA 1RQLA 4HOYA 1LBEA 1G3QA 1UBSB 1W5SA 3IR6A 4CV2A 2HYIC 2EATA 1NJSA 3U49A 1Z0JA 1K3FA 1XCGB 3GP5A 2GYUA 3L8EA 4FSXA 3HLTA 1NBAA 5ICCA 1TVEA 3A6PC 1BOFA 4J2TA 1TA0A 1IZ0A 1Y7HA 4G9GA 1SU7A 4NAVA 2HMSA 2RMKA 1ILWA 1UPAA 3DMNA 4X3OA 2UYYA 2W83A 1WXXA 4LCEA 3RVPA 3WGUA 3C0KA 3N87A 2RCNA 1YL7A 1L6RA 4FNOA 3G2KA 4EYQA 4MWSA 5KS2A 1W48A 1IOZA 1Z7BA 1Y6JA 4HMQA 1B6GA 3JRWA 3I04A 4FE7A 4MQFA 4LSZA 4DN6A 4Y2YA 2DERA 4WI1A 1ZJWA 1T2EA 1HEYA 2Y66A 1ZM9A 4PG5A 3RNOA 1YB5A 3DW3X 4QATA 2IFTA 4OAPA 5ALOA 3AGPA 3ZY6A 1SEVA 2Y1FA 4QHYA 3GVXA 4FCCA 2I4RA 1E18A 2ZG6A 4PX2A 4YAWA 4BWYA 5HFJA 2NX2A 3KP1A 4JYMA 4XQGA 3UGQA 2GKGA 3NHZA 1N92A 4RXTA 1R10A 2QMOA 2QAIA 5IK2A 5LOVB 3V8QA 1QZTA 1VG1A 1Z0UA 1Z6XA 1MB4A 4HGPA 5I9NA 1VLVA 4V38A 4F3TA 1DJPA 1J20A 1T1SA 3K1AB 3WIBA 3B6IA 1YI8A 3U3KA 3WIDA 4CQNA 1CF2O 1II9A 5HWSA 4C0SA 4RSRA 1LLCA 1DT3A 5DT9A 3QX3A 1Z28A 1E1NA 1GT6A 5AXDA 3COJA 4D0NA 3LBIA 1M1YA 1DV2A 4DHWA 2ZYSA 2RGXA 2PKQO 2EEPA 3PNLA 1JE1A 3U7IA 4AMUA 1DWPA 3WOHA 3GHYA 4NKRA 3MYYA 3HVIA 3GUHA 2C8VA 3PVCA 4CCYA 4EX6A 1OAAA 1QRSA 1DG9A 1KAEA 2VHWA 1QG2A 3FETA 4WV3A 1FX0B 5FI0B 1UKCA 1T4MA 3ZXIA 3MAAC 1O1YA 3GPCA 3PXAA 5KCZA 1XP8A 2WQZA 1PGJA 1RCFA 4M1TA 4PC3A 5DDIP 4M22A 4Y67A 5AUQA 4ZVVA 3GR6A 4MRSA 3TZKA 4RDIA 2OSBA 4D8UA 4EHJA 3I2HA 2Q2QA 3C6YA 2AH5A 2OLEA 1GITA 1Y6GA 1UMDA 3C5CA 1NV9A 1NW6A 2UZ3A 3DP7A 2DLCX 2FEKA 4KFSA 4TQGA 2XTZA 4ZQBA 2J7PD 2I80A 2EFYA 2O57A 1FDVA 4O4JF 1P2TA 3PEWA 3V00A 3ZHQA 5G0TA 5HF8A 2Y27A 3CRQA 1TVKA 3W3AD 3TSWA 2WPDA 3A1DA 3N5KA 1KRXA 3JQGA 4CG1A 3KQUA 1QVAA 1D4OA 1SOAA 3C41J 5LUBA 1QRUA 4X3PA 1TEZA 3K4QA 2X0KA 3AR8A 3G2MA 3OJXA 3O75A 4BQIA 5I7UA 5JLJA 1BKYA 1P1BA 1CPYA 2LRHA 2X40A 1Y5IA 3GJ5A 1XKXA 3HUFA 3OP4A 2BJWA 1H42A 2W6OA 4NENB 5DHAA 5EXXA 4B6RA 4U00A 1AV6A 4G3XA 1B26A 2BZ0A 4DDMA 5DYWA 4L8FA 5E7QA 2W7TA 4MVXA 2HU2A 3QU9A 3ZJYA 5CJPA 1IXYA 2B83A 4JROA 1Z33A 4D46A 1V3QE 3NWOA 1ZI6A 3B6MA 3WJ1A 2PBRA 1LUAA 4YAIA 1SBYA 2XXJA 3O84A 2I6TA 3KWMA 5CEJA 1XMPA 1MKYA 4JSYA 4TWZA 1ABEA 5FEMA 1SQGA 1IUNA 4TMFA 2XYPA 4CLRB 4J9UE 1Q50A 3KQMA 4DLTA 1OWNA 4MR9A 3NIDB 4M88A 3UAXA 3AJRA 3M34A 3AUAA 4G25A 3IAEA 4ENPA 4M87A 4D42A 4IFIA 1DUVG 1ZDMA 2IE8A 4RCVA 1C7QA 4YJFB 3MMZA 4HBZA 2CNOA 4QDOA 4YV0A 1VBKA 1GU1A 1PSWA 2IYUA 2QG9A 5DK6A 2OHVA 4TRMA 2OGZA 1PSDA 1JMVA 4UVGA 3KKMA 2SCUA 2R84A 4D3FA 1FSGA 2CDBA 3AHEA 4Q9JA 2BTQB 4QDKA 1FNNA 4WOKA 5IC5A 2BFFB 1DTWB 3ETLA 3PFIA 4C22A 1DC3A 4DAOA 1YVEI 3DW1X 4EW3A 2FJ0A 1YFZA 3P26A 4IXNA 2XOKA 5K0GA 1PL6A 3CONA 1C1HA 1TO2E 2XSZA 1B2LA 4MR8A 4PNHA 1PWXA 3DAPA 1JDSA 1JTEA 3VU3A 3JVEA 1IQUA 2QL5A 2RH8A 4JUBA 1BEZA 4MCHA 4DLZA 5GJBA 4BAZA 1PD1A 1IZ7A 5EJGA 1YFLA 1NUTA 4BQQA 3G17A 3R7WB 3TLMA 4BLOA 3LMKA 3IKTA 4QZVA 1J23A 1VI5A 3B5EA 2ADMA 3HVHA 2YHAA 3G5UA 5G0WA 4OXNA 1FJHA 1N2XA 4R4JA 4B3GA 3PEUA 4NG4A 1HLDA 1Q22A 3NHFA 3E22A 4UEOA 1XRNA 4F4IA 1FTYA 2ZE6A 4LJ4A 2WFLA 3T5MA 4QODA 2BCEA 1H9AA 1NPYA 4Z9AA 2FZEA 3S1AB 1VPEA 3BMQA 4CKWB 3D3WA 3GFRA 3CM0A 1KTIA 3GFSA 2XOEA 4BB9A 2GXSA 2VEDA 1T6ZA 4Q4AB 4NU5A 1A3CA 4TN5A 3TO5A 5BR7A 4BJ6A 4BO2A 2ZS8A 2OCXA 3I5UA 2ILTA 2BFDB 2Q8QA 3OBIA 3QFFA 4N0EA 3PLAE 2CXTA 4WZAE 1NP7A 4J8PA 5EVJA 3IOBA 1ANKA 1KAOA 3AFMA 3C15C 3KU1A 3CEMA 5I9LA 3E81A 2JLVA 1UP6A 3HDQA 4E7OA 1CY6A 1KZHA 3H2SA 2JG3A 2FKAA 2TECE 5AHOA 1DRUA 3U5ZB 3V6LA 2F64A 1RQNA 1F2DA 2H2HA 3M83A 4N03A 1AQNA 2A5YB 4IDPA 5JAOA 3CPSA 2DHDA 3FHOA 1JG4A 1C8LA 3I8OA 3IEKA 5CLIA 3PR3A 1AMNA 4DR2B 3ZWWA 2W4IA 3FWZA 1OXSC 4PG7A 3HRKA 1ACLA 1N5RA 2OO3A 4LNUB 4XB1A 4ETNA 1YUBA 2B69A 2PLWA 4EAAA 4FGZA 4ZCSA 1L6IA 2FW0A 3DJFA 5T4EA 5HSGA 1NVAA 3HCNA 3K5HA 2D00A 3H5AA 5A05A 3DZBA 2ZAMA 2I2FA 3D6HA 2HK9A 3W5JA 2ZM5A 5HP4A 3GRZA 1E5XA 1P9RA 4G0XA 3B1KA 3BWYA 3K09A 1E9SA 4HQ0A 2XNDD 1TEHA 3CUUA 2FSGA 2W2MA 3F98A 5JVDB 2F8MA 2PYDA 1ZK1A 4X20B 2RIPA 2PUJA 3C6XA 4XEUA 1XWFA 2XGGA 1RABA 3HPRA 2R9VA 3OH8A 3RSLA 4ZGBA 1UH5A 1SKMA 2QR2A 5JBNA 3E4DA 1W5FA 3NRJA 1B8OA 4RZ2A 3AY6A 4PGMA 1N7GA 3DO8A 2H2WA 4TLCA 1CQXA 1HE8B 1F20A 1JYSA 5SICE 1EINA 5TNXA 3L04A 4HR7A 4R54A 1Z18A 3COVA 2FPXA 2WM2A 3RREA 3VPAA 4DCTA 1LVHA 1U63A 1NY6A 3N74A 3Q3IA 3Q9UA 3VTZA 3W6UA 2XE6A 1VCNA 4BMOB 1GG9A 1HWYA 3QG1A 4LTMA 1HOXA 1JEQB 3LX8A 4URVR 1HDEA 1PNQA 5F51A 3DZDA 1CU1A 2NT4A 3T15A 4XI9A 3QBDA 1CJCA 2M6LA 3OZIA 4J1TC 1T5IA 1CZUA 2WUGA 3BIJA 3KQQA 2FPMA 5C8XA 1WEHA 4UOZA 2UZ0A 3Q7QA 4FSHA 5BW6B 5DJ5A 5C52B 3UC5A 2COUA 2PS1A 2D1RA 2EQ5A 3P9YA 3F7MA 3NPMA 1X3SA 3ZE7A 2ZXUA 1PYDA 1KFEB 3B2EA 4G5QA 2QN6A 4WDQA 3IPRA 4CCSA 3DBLA 3E61A 4OHVA 3G9QA 2WVGA 1NPTO 1UXIA 3HYSA 2Q45A 1YULA 2WAXA 3H7IA 5IARA 4JAVC 4EHAA 2DWOA 2BP7B 1VSTA 4MEJA 5LB4A 1YS4A 3RT9A 5KTKA 5TY0A 1XMVA 3RRJA 3SC6A 3UK2A 4P33A 5LLTA 5AVTA 3K0HA 2BRUA 4EMTA 1P7WA 2B1JA 3G8BA 3UUFA 3BZBA 2QTFA 3OIYA 5EKDA 3AKEA 1TTQB 3HCCA 3U3RA 3KZCA 4YMHA 2XVAA 3COPA 3H4MA 2B7BA 3OFND 1PT6A 5ENDA 1J99A 1EH5A 1N8SA 3UGJA 3WMWA 4PPQA 5AKLA 1M8GA 1QBKC 4K2HA 1SOUA 3WOVA 3OJEA 3KM0A 2AVNA 3NQ41 3I1FA 5CFLA 4CR7A 1KWKA 4GYJA 4HAZA 3RS3A 4ZCLA 2EZ8A 2EIHA 1FJGB 4LVNA 2PN1A 1HZJA 2RC6A 4L95C 1AK1A 1PHRA 1YBHA 4WPGA 1YA4A 4F6CA 3KOWA 5KNDD 1NMXA 1TU3A 2I4MA 2OHXA 4HZGA 3EVBA 3SXJA 2KMLA 3NP7A 3RJMA 4EUNA 3QE3A 4AXXA 3ZIAD 2RHGB 5T8KC 3HJRA 1DQNA 1LW6E 5TPZD 4ND2A 1KY3A 1AKTA 2AZXA 1ARZA 2Y6VA 3OQVA 3PFBA 1YE3A 1XC7A 4UVDA 2FQWA 4WXRA 2EG9A 5JZVA 3TF5A 1OH8A 2CF6A 3ISJA 4RKRA 3WK8A 2GPWA 3ZNOA 1ZM7A 3ASUA 4TV8A 1KVTA 1U9YA 2QAGC 4GOXA 4W7SA 3AL2A 2DUJA 5FV4A 2GWRA 1XRPA 4DCUA 4PCAA 4ND5A 1YJQA 4MYTA 4UCFA 3AW9A 1GUBA 4DANA 2GQ0A 1TZKA 2J31A 2MINA 1U7UA 2DKOA 2QY6A 3AB8A 1TO6A 3MOSA 3RYTC 4YUZA 2H1OA 3UB2A 1HY3A 2OBNA 1POXA 2FWRA 4PQYA 1QP0A 4PICA 1G5PA 1V71A 3G02A 5B3JA 1RKUA 1T4CA 1XELA 2GJ8A 4Y9DA 5TRTA 2PSDA 3PTAA 4BMVA 1QAMA 4MA0A 4MCAA 1JPVA 1LTKA 2H00A 3ZLUA 2YFQA 2JHCA 3GDOA 3IDOA 4KC0A 4CKBB 3G7SA 1UOOA 5B6IA 2QLJA 3C3WA 1NAHA 4HDMB 1L7NA 2F43B 5MHTA 3NRCA 2G1AA 1P0MA 3M1LA 1D2NA 3SOZA 2OBLA 5BVHB 1OSNA 5HM8A 5K0SA 1FUIA 3LHFA 1Y63A 3K70B 4DRYA 4FN4A 2H08A 3F6BX 3PNSA 4PBTA 4UHFA 1Z0KA 5FI1B 2ODBA 3KSZO 1JHDA 4FNGA 3PGMA 1ZIDA 5FOUA 1PO7A 5KSOA 1OZHA 1RI5A 5EUQB 5G2OA 1BZYA 3R0XA 3REOA 4HN2A 4QFBA 2DFNA 2IPAB 1F38A 2RARA 5THXA 1KETA 1S3SA 3V4PB 3Q3GE 4QAQA 4F6RA 1II0A 4H3VA 1TW2A 1GPNA 1HA3A 1Z74A 3CS3A 4IKOA 2GERA 2PUVA 2YWGA 4WBSA 3KJIA 4WY8A 3JQBC 4I1OA 4KUHA 2RGNC 3BH6A 4DQ0A 3B9RA 2ASEA 2B8TA 4RBNA 1DAPA 1DKQA 2W6IA 1U7HA 3FHJA 4NS1A 1OXTA 5EJMA 4LE0A 4BDTA 1XNGA 4ZEMA 3L6EA 3LFTA 2OORA 5B6JA 1BS2A 4V0NA 4QDTA 3EFOA 3DXFA 4DVJA 2HX1A 4CTNA 3KHSA 4MARA 1AZWA 2JAHA 1JEQA 2JIPA 5IBRA 5FIUA 3H11B 2OKGA 4E94A 1GT91 2DLNA 1YOVA 4M53A 3FBWA 5BWNA 4MDHA 1WY5A 3UK7A 3AINA 1OYYA 3LY9A 2BKEA 4C5BA 5C3MA 4LF6B 4O4LA 3V33A 3C48A 3H1EA 4QBIA 3DC2A 3ZHRA 3C8ZA 3M6FA 2I33A 2WM3A 1VE6A 3QA3E 4RMIA 3T06B 1MIOB 3HKBB 4UJ3A 1U11A 1HRKA 3KZXA 4I1SA 3TRJA 4JVOA 5JNSA 3FOZA 1L7VC 2WC1A 4FGLA 3HB7A 3GARA 3KL2A 1HYGA 2QB5A 5CX4A 1G4AE 3PJEA 3AB7A 1YV9A 3ML1A 4TTIA 4OUDB 2V59A 2ZANA 1QBGA 2YRXA 3AIIA 3LBYA 4GGMX 4I0WB 1IU9A 4J16C 4TXLA 2ZUDA 4BATA 1NFFA 1PFVA 2W11A 5ERYA 1QH8B 5HHTA 5KTMA 4NTZA 3JD0A 3N8HA 4GWGA 4BCCA 3EVCA 3SQNA 2QN7A 2XCRB 1GQSA 1XDDA 3R5SA 2JEOA 4OU5A 3V8MA 2O23A 1AXRA 1NYLA 1OHHD 4W5WA 1PK9A 1KAGA 1UJ5A 1G21A 1JU9A 2V6GA 1RKBA 3SICE 5J58A 3JYOA 1CQIA 1C3OB 2IPNA 3FDIA 3NH6A 4IYRA 4ZDJA 1PT5A 2OC9A 3PFGA 2ECOA 4I5GA 4IHAA 3W5UA 3U09A 2J6CA 2XOXA 1EIWA 2PRZA 3H18A 4ZDIA 3ICEA 3ZDCA 1EP3B 2YVUA 2ORED 4NECA 1RD4A 1EWRA 1QIIA 4YCSA 4YV2A 3PX2A 3ZCTA 5L3ZA 3AX6A 1PWEA 2JK0A 1FRFS 2X2EA 3LC1O 5AJHA 4D9HA 3HKCA 1X7WA 3QVLA 3QE2A 3PITA 1T13A 2JBWA 4GSKA 3CZAA 3T9FA 5J4HA 2BE9A 1Z7EA 4MEAA 1H5NA 1YQWA 3NS7A 5JYCA 3HYTA 3H2YA 3RT1A 1FXSA 3ZKWB 4CMEC 4IVQA 1LQ2A 2VDLB 3CN9A 3P2OA 3NANA 3PRYA 1BW9B 1U90A 4FHFA 3PC8C 1XT6A 4AZ0B 5BSFA 1N7HA 1E9VA 3B13B 4MP8A 1ZUNA 4DA4A 4LHWA 2B6NA 2FRXA 4D3SA 5C5EA 2DETA 1W9HA 5I5EA 4ZT7A 2R62A 3C5VA 1PWZA 2G82A 2D8AA 1NF3A 2BD0A 3LWZA 1QONA 4PHHA 4RMNA 5EE5B 5JRJA 5IVHA 1WCWA 2Y8EA 2ZDHA 4MWEA 3FD8A 4JUIA 3KEOA 5TB5A 1E60A 3FTNA 3PB3A 5GONF 4BASA 3G2OA 1OB5A 1ZZEA 1AS0A 3CZ9A 2Z9BA 4J7UA 1F0KA 1ID8A 1TI7A 2G70A 2XMPA 3BJMA 3E05A 2H0AA 1PTKA 3NM5A 3IT2A 1J2EA 4AWXA 4YP0A 3CIFA 3KEQA 4MZXA 1ELOA 3ELUA 3MUFA 1B3RA 2NUTB 3PC3A 1MT0A 4U8HA 1VLHA 4BX2A 5JDIA 1QG6A 4AN0A 4EG5A 2O3RA 1GFZA 4QVKA 5AJXA 3SVTA 1GHTA 1V8BA 4IIJA 2BEWB 4LJ7A 5JCJA 2Q5OA 4OK6A 5B2FA 4F5EA 4R1UA 2FZCA 4N5IX 5M29A 3EDQA 3UOWA 1E8DA 3ZZTA 4G8DA 4GKJB 2XZTA 1RRPA 2QZJA 1FYDA 3DYIA 3ZWCA 4E32A 2NAFA 3EZNA 4MW1A 1THMA 3C85A 5J4KA 3TQSA 3H2BA 1OBFO 4GBJA 2XGMA 4ZAGA 5DM1A 5JVDF 2C00A 2BSAA 1CY7A 1QYWA 2VNJA 3A1CA 1SHLA 1BWRA 4MUYA 2REQA 5JXGA 2Q4TA 1MA0A 2G63A 1JSXA 3EVFA 5J1SB 5DTJA 1KEKA 4H7KA 2Y92A 3H9CA 1PUJA 4QA9A 3PT9A 4ARIA 3OEHD 1BG6A 3PSAA 4EECA 3TZEA 3DZFA 1PFGA 3U44A 1Y7LA 3IXQA 3WLPA 1UK6A 4L5IA 1Q3KA 1ZL2A 5BXYA 3ZIAA 1LK5A 2IZ7A 4M1YA 5FPSA 3ODGA 4PLZA 3U9SA 4CU5A 2XUAA 4CFSA 1QTQA 4RFSB 2MOKA 3E0XA 2B9EA 3HP7A 3I37X 1NRIA 4FDTA 4ZT4A 3W34A 1XL0A 2Q6KA 5AVKA 3J80A 5ALKA 3WWPA 5LIPA 2DFTA 1MQ9A 3LBHA 3VSBA 4LJ8A 1R9GA 1EGQA 2DTDA 4AM8A 2Y1KA 3WAGA 4Q3LA 2YN0A 3O9VA 1Z7GA 4XFJA 1RJ9A 2WSIA 2N75A 5DFAA 4E5MA 4PIPA 1CZHA 1EGHA 3H84A 4BP9A 2H1CA 2ONZA 4GZLA 4F2DA 2QI9F 4KH1A 2JI4A 1E94E 1KZ7B 3PQ4A 2Y76A 3E5RA 4FW9A 3UYKA 3KUCA 1KEPA 3ZD9A 5AKJA 1VFNA 1XFDA 2RGYA 1DXOA 1E3WB 2D5LA 2PWZA 2H16A 3UWSA 4B48A 2VUIB 2EAUA 2POQX 2MINB 2QX4A 3UYLA 2I5PO 4Q93A 3UXMA 2DPMA 3NXSA 1DGQA 4OP3A 1YDFA 4W9NA 5AWFC 2EX1A 4B6GA 3ZVMA 4UUAA 4GEKA 4GGOA 5EERA 1C3JA 3I6QA 1GM5A 4J3JA 4K6GA 1VIMA 1YDWA 2RGWA 2QYSA 3RUIA 1T3GA 3T3GA 2YN2A 3CJTA 3GJ3A 4BGUA 3IHKA 3FIUA 3NBYC 1U0BB 1FQOA 1CV2A 1OJLA 1K06A 4XSHA 5A1JA 5I8PA 3PD7A 5F9HA 2RI6A 3MJDA 2IELA 1RRFA 3GQBA 3U3JA 4H7FA 1XNRB 3IE1A 2HT1A 5TE9A 3O95A 3PIIA 1H2WA 4KYTA 2WICA 5T4BA 4PO9A 3V4ZA 4CKCB 2OXRA 3I9KA 5HKKA 2WZCA 2DCUA 1YB2A 2A88A 3C8DA 3E9YA 4X66B 3SQDA 3R20A 4GLJA 4D8WA 8GPBA 4NCJA 2DPHA 1Q1ZA 2Q3LA 3ZCSA 1C1DB 1MFZA 5LR6A 2XMZA 5I7HA 2JGMA 4H6VA 3K70D 1FNCA 2R1UA 3BZUA 5FWAA 5JCOA 4HFNA 1KBZA 2HGSA 2W71A 5E2BA 1A98A 3OX3A 4HT3B 5KHAA 3CVOA 1YKSA 4HATA 4KVFA 5ALPA 5BO5A 1RJFA 3ZGZA 1UT6A 4JKOA 3SYRA 4QPNA 3OCVA 4OBEA 2DR2A 2VOEA 5K8LA 1R64A 3VU9A 5HIJA 4Q9IA 4Y6OA 1M8KA 3PGLA 3WADA 3PYMA 4WFIA 3P9QA 4W1RA 3WGZA 4P3YA 1SJ9A 2K7ZA 3WHIA 3W8FA 3TSOA 1XTPA 4MKIA 3D1VA 1LRLA 2X1HA 2WZDA 5CH8A 4RF3A 4S05A 1YVDA 1ZOLA 2BTQA 2MSEB 3PCTA 2GKSA 4N5MA 3JYHA 1J22A 2N47A 5FULA 4DSAA 5CDTA 3WB1A 1K4KA 3V8VA 3VSDA 3PE4A 2B0CA 3A7DA 3GL9A 4L27A 2E49A 2C83A 1UCFA 1PQUA 2XRYA 4LGYA 2CDRA 4KITB 1PUXA 2GZ2A 3M3HA 1PN3A 1X1AA 3SQWA 3ROMA 3P94A 1VSVA 5FL7D 1D04A 5F4ZA 2AEJA 5LA6F 1U3CA 3CLHA 5FBWB 2VTKA 1P18A 2G72A 2R8YA 2ZT7A 2LBPA 4IX9A 4JNCA 1JNXX 2I6QA 3I2JA 2FWIA 3HDHA 3Q41A 2H7YA 1WMAA 4TVBA 3K6SB 2IE0A 5FDFA 3HJTA 3DYVA 3IAS6 1C8VB 1AB6A 4LZJA 2OV1A 3R0ZA 4L5AA 3M4JA 1YIDA 1YQQA 1RR6A 1QOZA 2XVMA 4LWOA 5LQNA 1ICEA 4LZWA 4Z5XA 2R7MA 3ANSA 3GJ6A 4G2NA 4RK6A 3DE7X 1G9XA 1L3CA 4ITUA 4PPGA 4DPMA 4JI2B 2R1VB 4L3OA 3L93A 1WZNA 2IP2A 5F12A 2V8OA 2GEBA 3TNDA 4X41A 2PA3A 4W5JA 1DRJA 3ZHCA 1V37A 3OMLA 4L4ZA 4Q1DA 1RKVA 1M8FA 1YR1A 3ND5A 5AW7A 1U2RA 4NJOA 3RDPA 1NAIA 4OMCA 1N5DA 1VBNA 4FFDA 4JVLA 5A4AA 5K0BA 2EV9A 3I01M 3GBPA 4TWJA 4DMKA 3ZCQA 4OEHA 4EB0A 5HIKA 2A2ZA 4ARCA 2QOEA 2JAUA 3R3SA 4JODA 5IT4A 3S7TA 1NBMA 1EFDN 3CISA 1KPHA 2LIVA 5A9SA 5ITVA 4G1CA 1C2YA 1WXEA 3RR2A 3S2EA 1IIRA 3CPHA 4G0ZA 3W5HA 4C2BA 3TM4A 2FPKA 2WSYB 2ECKA 2ODTX 3CG4A 2J85A 4XYGA 5A7HA 1V43A 3H5WA 3A1WA 4O5AA 2GCEA 4WFKA 5FTMA 2IY7A 5FAKA 1YTUA 1WUTA 4K88A 4HWRA 4HDNB 3LVQE 5IWAB 3AVOA 2HBQA 3OMWA 1G42A 3U4AA 3LI2A 3ILVA 4QGFA 3GLFE 1DTEA 4XASA 2PA0A 1OV4A 3FJ1A 4OO3A 2FSVC 4D8XA 1NN5A 3MT9A 4C7BA 1JDTA 2FF7A 3KK0A 4I3FA 5DW3A 2WB4A 5DHTA 4E3WA 3I2IA 1JKJA 1JS1X 2Q3CA 3IXMA 3RVOA 1RZRA 2X19A 4RFVA 4BO0A 4PVDA 5FL7A 5GWXA 5IDWA 1NUHA 1Z0ZA 3I6MA 4CCYB 4F85A 1EUDB 2W48A 4IDEA 1GWNA 3RRZA 2FE1A 4Z0PA 1TUEA 2NXNA 3EHDA 1OTYA 1R6AA 4LJ9A 2HBYA 2H54A 4B6SA 5AW1A 1G3RA 3SLRA 3X1MA 3UFBA 1SCKA 4TS3A 2C2KA 5FRDA 3WNBA 1I2CA 2DJ5A 2QRGA 4YXFA 3GI1A 3VPCA 4DDUA 1RMQA 1KQFA 3WJAA 4BNLA 3E5NA 1ENPA 1MHTA 4KO2S 1JRLA 1LVGA 1KMNA 5JSQA 4UBMA 5IT0A 3RO7A 1VE9A 4H4EA 1EZZA 3PTLA 3FA2A 4MTCA 1XX6A 621PA 2DOKA 2ZITA 3AUKA 1C0PA 4BUCA 3L8HA 4IJ5A 3FFXA 3TTTA 4P7GA 1OGJA 2JFVA 4L8VA 2OR3A 1IQ0A 1L4HA 1QS0B 5EKXA 4AUMA 3NJ8A 2XH8A 4HI0E 1XA0A 4JEHA 5EPEA 1UPTA 1WVGA 1BX0A 1HFKA 3PFWO 4E09A 1W36B 2O8CA 4X00A 2CNLA 3KHKA 2AL7A 2H4FA 3SZOA 1K7XB 5DBIA 3W2FA 5DU2A 2D1SA 1WKVA 5FB3A 4CTKA 4PR0A 3V5NA 1X0XA 1F17A 2VHJA 1P80A 2B2CA 2GK6A 4MR8B 3NGLA 2IYPA 2ZQZA 1TCAA 5DEIA 1UINA 2JCBA 3KS9A 4IDFA 4LMBA 2G9RA 4ZVMA 3OT5A 3TKLA 3N0WA 3KKOA 2A14A 3TQCA 1KL7A 2XZPA 1ZH6A 2ZJZA 3ZY4A 2GHQA 5JROA 2W8BA 1QE0A 3TUIC 4ZOQI 2ZM6B 2QSZA 5CH5A 1M8PA 4UUMA 2AYZA 3RV4A 1RJGA 4EY6A 3B6KA 5CX1B 2AI3A 4ZAYA 4NMMA 2ZI5A 4G41A 1LZLA 4GO1A 5FO0A 1WZ2A 4GZ6A 4J4HA 4JDPA 2HMAA 2REOA 4LF7B 5EMMA 1B15A 2CHFA 4KXXA 4JI3B 4IIUA 4LW8A 5A4IS 3KO8A 3R7DA 6REQA 4PTZA 1P29A 2OO5C 2ZU6A 2WJ3A 4B3TB 3SP1A 3JQEA 4ITVA 2OD9A 2DQKA 2LTAA 1G4UR 1QF7A 4FZ3A 4II2A 5E4YA 5I7AA 3H2GA 1L5LA 2K6GA 2GPJA 2BN4A 2EGHA 4NCAA 2NUAA 4E4YA 1JALA 1ZCFA 1YRQA 4CHTA 3GDFA 3OQOA 3FPFA 1Y8QA 2OCKA 5EXSA 2QD5A 2GK3A 2H2FA 2ZI4A 3SN6A 3UQZA 3OT1A 4UUPA 4OJYA 1JVSA 1G8KA 1NYRA 3L01A 1PDVA 2OT3B 3LXUX 4Y2HA 1JBQA 1GL7A 3IQDB 4A26A 3I52A 4C0QC 3B53X 3ESAA 3GLUA 3JQ9A 4NBKA 4DQXA 3D64A 3DSRA 5KKNB 1L5OA 2DWCA 5JCZA 4QNMA 3V3TA 2ZRMA 4JVMA 3QMVA 2WWVD 5KVSA 3JQDA 2AG8A 4Q19A 4EATA 3KJEA 2XXAA 3KXDA 3RTBA 1NVDA 1OKKD 2IOQA 1K8YB 3HKBA 1P7ZA 2CMDA 1W1WA 2JAXA 2Q6TA 3G8DA 4OQNA 1A96A 2NPIA 2XOKD 4HH0A 5ICGA 2E1PA 2JLXA 2PYIA 2GHRA 4LOAA 4GYWA 1E20A 4X60A 4KKVA 1DZ3A 3SNKA 3N0RA 1G0OA 1ECPA 5TX7A 2YDYA 3SJZA 3A1UA 4RADA 1TYAE 2KWIA 4E1BA 2ZB2A 3TL3A 1U8FO 2N0SA 1STOA 3EGDB 3W1VA 1MXFA 2PMCA 3FOAA 1H5UA 1DG1G 1YQ9A 1XRLA 2JGIA 2AIRA 3TVYA 4NU6A 4QEDA 3EWSA 3K0AB 1Z6PA 4TT8A 2QRPA 1KRWA 2MSDB 3E1SA 3Q5DA 1P4AA 2BFDA 5JATA 4MPTA 2Q07A 4WXYB 2V6JA 1X3LA 5AOAA 3AESA 3KV1A 1S8AA 1QX3A 1H2HA 1DSSG 2OORC 2RIRA 2YWDA 5TC4A 4PRLA 2IXEA 4QTXA 4FDVA 5KOIA 2FZLA 1T8RA 4ESEA 1Q2UA 1BQ4A 1XROA 4YT5A 5ABPA 1FSSA 3T61A 1QCDA 1XJ0A 4M99A 3ZU6A 2X2PA 3E70C 1JXAA 2FPPA 4XGNA 1TPYA 3N70A 3L8ZA 3L9WA 1ZSVA 1LVUA 3AIMA 1KAHA 2I4LA 3EJ6A 5DOZA 4TYNA 3H75A 2WT4A 3K16A 3G0HA 1GZ5A 2D2FA 2HPAA 3KXKA 1TM4E 3CLSD 4DDVA 4WBNF 1II8B 2HB6A 1DX9A 2FF5A 2ZTUA 5J2TA 1TLFA 1JQEA 2CBGA 1WR8A 2FMKA 3NKVA 3RIMA 3RUAA 5HIAA 1CZNA 3DEKA 1T4DA 5AVUA 1OW3B 1EAYA 4JVNA 4NJMB 1BYIA 4YCDA 1SZPA 1D9XA 3ZV3A 5CB4A 3SKYA 4R1MA 1JT9A 4FSDA 5ER6A 1RWOA 2CNKA 5FFFA 3C1AA 4BGEA 4PNPA 2YICA 3DV0B 1I0IA 1QC5A 1V8PA 1PZGA 1NVVR 2X4IA 3K09C 1WSBA 1M0TA 3CVYA 2VHCA 1PZNA 4G5HA 4N5HX 3USZA 1JPJA 1W88A 3D59A 3K9WA 4L73A 1M9NA 2QJFA 2X0NA 1WDLA 2QRKA 4F3CA 4KJZA 4Y9TA 5JY6A 2OWEA 4MUAA 3BX1A 5JARA 2B4AA 4YJ3A 4DJJA 1D2AA 3H4TA 3AF3A 2DM6A 1EUDA 2DHCA 1E5TA 3MCTA 1R0RE 1WBDA 4UZFA 1JJFA 4M76B 4CFZA 3ZWPA 3HFJA 3R9XB 1JX6A 3HXMA 2Q41A 2WQ6A 4FX5A 4YRRA 4ZK6A 3DO5A 3E9CA 1O87A 2IS2A 3K5WA 1ZRSA 2OTCA 5L40A 2H06A 5KKCA 4N54A 4O25A 2VTEA 1NJGA 1CULC 4RHTA 2AFIA 2WG1A 3JALB 3NBUA 4FXOA 2J0UA 1DQPA 2R79A 1CC1S 3MD9A 1O6CA 2XYRA 2QM3A 1J0DA 3ULKA 3KQLA 2PGAA 5G1OA 2H65A 3OLWA 4Q21A 5BNWA 2CHUA 2C5FA 2R96A 4YP7A 5H80A 1XJ5A 4KIWA 2G08A 4U39A 4EMSA 3RB8A 1X9HA 3OP1A 3VR3D 1J21A 2ZETA 4YRLA 2J3HA 1R9MA 2WNHA 3GCWA 2IU4A 5FFMA 2Q0XA 4GOND 1IVNA 1VKOA 3NX4A 2V65A 4N49A 3R75A 4Q15A 4QU9A 5TQ0A 5JBQA 4MUNA 3AR6A 1WA5A 3NEJA 5ALJA 3BHMA 4NBWA 5LN1A 2WSMA 1CY0A 4P7KA 5HDBB 1SC3A 3OIVA 2GRJA 4QBGB 5B4TA 3GGSA 1JI0A 4MITA 3E2IA 4NBVA 3T4EA 3GV0A 3ITEA 1A2OA 1GDHA 2I2BA 3HJBA 4R2MA 5HUHA 1DC4A 2XUZA 5JQGB 5A71A 1F3OA 4MV6A 2G4LA 4BFVA 3QTTA 4ZIRA 1JHYA 4KFRA 4MPRA 4RKFA 2VC2B 5IKPA 3M1IA 4DZZA 1BDJA 4GVLA 4CFYA 4BKRA 1ESCA 1HRDA 1XJCA 1XRRA 2GAOA 3OLQA 2FNAA 3CEPB 3VTAA 4D43A 4F92B 1J2YA 4KSYA 2WTMA 4UZEA 3CKYA 3D4LA 3DDUA 3RWOA 5CW2A 4BTLA 3ZWVA 3JZMA 3QY9A 5L3QB 3WGQA 4JLBA 2PUGA 1LF0A 1UEXC 2DFKB 2RHDA 3DBVO 1S1CA 2GK4A 3H7AA 3UQYS 1CUBA 2IZ6A 4S2UA 3EOAI 1FSFA 4JP3A 1POWA 1VJ0A 5FUMA 2WZBA 1Z68A 3DAGA 3FKQA 4E1AA 2XD9A 2VZ9A 4MGKR 2R48A 4BQEA 3EFHA 1K6IA 2H3HA 1YL5A 2J1LA 3AP3A 5BY2A 3WLKX 3NJ4A 2JLQA 5JZSA 1ZISA 1KH1A 1N2ZA 2NWQA 2XJ4A 3ANMA 3GOHA 5EJ5A 3AOEA 4M1OA 4UXHA 2GFHA 4B43A 4K8OA 1NW5A 5FPTA 4W9MC 2G6BA 3D8RA 5LQKA 3GLGA 1CQPA 2ZUEA 3LHSA 1BD4A 4ZYUA 3E8XA 5BYKA 4CKEB 4RZ3A 4OSEA 2CLMB 1AHPA 1M34E 1XPUA 1EVEA 4B5LA 3OKCA 4R0NA 4C0XA 1PK8A 4NYMR 3EAGA 3HEAA 2OECA 4PIVA 5DCWA 3TW8B 2IU3A 5BSMA 4AL4A 1YVUA 2G09A 3F3MA 4LPKA 1QS0A 4NZPA 4DMMA 4G86A 4TT3A 2FWBA 2JFOA 3TW8A 3HKDB 1MZPA 2V45A 3DEAA 3V1KA 3UAOA 3GRAA 2YOGA 4Q1CA 3WLSA 5JFGA 2VJMB 1I3LA 1LS1A 1Y3AA 4EL0A 5DNUA 5LMZA 4BVKA 2WU3A 4QUBA 4XXHA 5LB2A 2CEAA 3ZV4A 2C5GA 2PD6A 5I7OA 1DKLA 4QQNA 1X8LA 4JU9A 1CCWA 1FS6A 4K1XA 3W5BA 2EG5A 4CV0A 1F2VA 2QTRA 1S89A 1W5AA 4JDUA 1TVCA 1ZMBA 2PHZA 2FP4B 4EO4A 1J42A 1Q6ZA 2A5LA 4KPGA 4OJKA 9ABPA 3PRJA 3V6MA 4EYGA 4C3ZA 5IS2A 3ZTWA 1EVLA 5CBPB 2C96A 3MMPA 1GZDA 5LLSA 3BRWA 2Q7DA 4PGAA 2IK8A 2BEKA 3CVVA 3A10A 4R16A 1QG0A 2JLRA 1H65A 3ER8A 1JI3A 1BROA 3VH2A 3ELBA 1E7QA 3FPSA 4IP0A 2YYAA 3QXXA 3Q98A 3V80A 5KTOA 1TGVA 2WSSD 4BVAA 4YMSA 3NZEA 5G0VA 3NP9A 4JYPA 3O91A 3VISA 4KQHA 4F11A 3VR5H 1R8SA 2AXEA 4FNMA 4UHEA 5K0LA 3VDXA 3MRXA 1G291 2QUAA 1X7XA 2PZBA 3IB6A 5DXJA 4IMIB 4MUKA 2JEYA 4C0LA 3SM3A 3RSGA 4LF5B 2NZJA 3ROZA 1PJ3A 4RD2A 4HRXA 3PDWA 3WLAA 2HA5A 1WS6A 3K05A 3M6WA 3U16A 2B37A 5FFNA 4P5DA 4AN1A 4ZGWA 3LY5A 2O8EB 2JLBA 5JRDS 2AUTA 1UPCA 1SUWA 2W2OA 5ELLA 2WWYA 4PLPA 3T3PB 1SRRA 3NNDA 3OETA 4E5DA 2NG1A 3O7WA 2VDQB 4KOAA 4MA4A 3GIWA 4JOQA 4HH4A 3AYZB 3C5HA 4LUCA 4ZV9A 3ZBUA 4CUJA 4F1JA 5KDLA 1G8HA 5TQ2B 3DMPA 2CSXA 2ZREA 2PBLA 1SBQA 2JGEA 3KXLA 2DEUA 4MMZB 2UVDA 3MPOA 2N1MA 2J33A 5JSYA 4O1IA 1VHWA 3RKSA 1B41A 4OHXA 4Q7JB 1OFGA 4TKVB 4JL5A 5D3MB 4ANFA 4BLTA 2PRKA 3HB4X 5EUCA 4IGFA 3SVZA 4CLEA 4S2EA 2GEFA 2GD6A 4WLOA 1P81A 1LJ8A 1VPTA 1A4IA 2G07A 1WSAA 4JN6B 4OMDA 4C30A 2G76A 3Q4GA 1HTBA 4RKEA 3RYCA 1IY0A 3V42A 3BAFA