4BLVA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylmethionine (adomet)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
280
structure length
280
Chain Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blvA00
4PCLA 4X1OA 5DTRA 5B1SA 1N7JA 1VBFA 3QOXA 3OPNA 1INLA 2XYRA 3THSA 3WSTA 5IKMA 2HR1A 2NYUA 3E23A 2IBTA 4ER6A 3KR2A 3HCCA 2OBFA 3R6TA 1D2GA 1JG1A 3O31A 1QAQA 5FUBA 1R8YA 5DSXA 4PGGA 5LQKA 1P39A 2P41A 1NW6A 3ELWA 3BWBA 3HVIA 2P3OA 2PVCA 4O29A 5ICEA 1P1CA 5CVVA 4AZVA 3GRZA 4AZWA 2B78A 3EVCA 5GWXA 4BP1A 5MHTA 2BR5A 3OZRA 3B3FA 2DULA 2O0LA 3BZBA 5GINE 2G71A 5GM2A 3EVEA 3FPEA 3BWYA 3DP7A 5EZQA 3B3JA 1KYZA 4CKEA 1D2HA 1JTFA 1EIZA 1UIRA 4PWYA 5LQNA 3FPFA 1WY7A 1WXWA 3A7EA 3R3HA 4LWPA 5E1BA 4ER0A 4IV8A 3GRUA 2P35A 3E8SA 5K8VA 1KR5A 2I62A 1KP9A 4LG1A 5E2AA 5K0JA 3DLCA 5EQJB 5CD1A 3LECA 4FS8A 2PLWA 2HMYB 2ZWVA 3ELUA 3R0QA 2Y1WA 4KVZA 4MIKA 4P7GA 5HOQA 2ZVJA 4RVDA 5FULA 4RX1A 1KPIA 3RW9A 5LQAA 5F2NA 3UJ9A 3GJYA 4WVLA 4RVHA 3G89A 1X19A 2ZIGA 3I58A 5CM2Z 3TOSA 4CXMA 3ELDA 5CCBA 3EVDA 2JHPA 1B42A 5F2OA 5GIOE 2OPBA 1IY9A 5EKXA 1JG2A 4RTRA 4PYLA 4X60A 3G7UA 2QRVB 3P9CA 3GGDA 4QQNA 4RVGA 4IWNA 2ESRA 3HEMA 4HTFB 1R6AA 4OQEA 2ZSUA 4POOA 4E2WA 3GCZA 3DTNA 2JHCA 2O05A 2JHAA 3KR0A 3MHTA 3AY0A 2YUIA 4P7FA 1SG9A 3I9FA 2PGXA 4OBXA 2ZLBA 5EG5A 3BT7A 1G55A 3B3GA 2ZWAA 3A26A 5GP1A 3EEOA 3M33A 2P8JA 3NDJA 5DSTA 5FADA 3FTEA 2CL5A 3G5TA 3TQSA 4DCGA 3ER9A 4CWAA 5LQCA 1F3LA 1VP3A 2YXDA 1NV9A 2A14A 5EIFA 2EJTA 4QDJA 3FPJA 3DMFA 1UWVA 3HVHA 4C4AA 3PFHA 2ORED 3V97A 3ME5A 3SVZA 2P1DA 3GU3A 4RTJA 2VDVE 3JWIA 1N7IA 4G56A 5CVUA 3CGGA 1WXXA 1G8SA 2V7EA 4RWZA 4KIFA 1BC5A 4X63A 2B25A 5DM2A 4ATNA 4KDCA 4E2ZA 3M70A 4QVGA 5BW4A 1XXLA 3G2MA 4RTPA 3OU2A 2UZ4A 3HCDA 4RTLA 3UJ8A 4KW7A 4QTTB 2B9EA 5D1NA 2IH5A 5JR3A 3OFJA 3KQOA 1EJ0A 1DL5A 1O9GA 4YV1A 3X0DA 5M5BA 3TRKA 2AS0A 2GPYA 4R6WA 5DM1A 5EMMA 4RTSA 2WA2A 5BXYA 2QY6A 4YV0A 2VP3A 4PGHA 4E2XA 1SUSA 3HA5A 3HP7A 2ZW9A 2AVNA 4HGZA 3NJRA 3EEYA 5K0BA 3MAGA 4HH4A 3NMUF 3G8BA 3P9KA 3DXYA 5C0OE 4DF3A 2XYVA 3P2EA 3PFGA 5EC8A 2XVAA 3BWMA 3FPGA 5GM1A 4FT4A 2UYQA 4MWZA 5BP7A 3OZTA 1JG4A 5HIMA 3C6KA 3T0IA 3NWEA 2QRVA 5EGSA 2GAFA 4PIMA 2DPMA 1KXZA 2OB1A 2PXXA 4HTFA 5EOVA 5K0EA 9MHTA 1MHTA 1XDUA 2ZZNA 3BWCA 1ZGAA 3C6MA 3RIEA 2O57A 2PV0A 3LGAA 3FPHA 1NV8A 1ZQ9A 4X41A 1P1BA 3CJRA 3KPYA 5KQSA 4M37A 1VP9A 2IDKA 3HCAA 3L8DA 3MB5A 3O7WA 5DTQA 3I64A 2I7CA 4PYMA 3DMGA 3FYCA 5C1IA 5FQOA 5HILA 4A6EA 1T43A 3CJQA 2OXTA 3LBFA 4LWOA 1FP1D 1QZZA 3LKZA 3MCTA 4OBWA 5ERGB 5FA8A 3R24A 5HIIA 1HNNA 1YZHA 4GC5A 1JR4A 3TKYA 4C06A 4M7RA 3CKKA 3LDGA 2IPXA 5DRTA 3TFWA 1L3BA 5LQUA 3M6UA 3BXOA 3NWBA 4Y2HA 1EJ6A 4XCXA 1NBIA 2H11A 2NNWB 3NDIA 2GA9A 3IV6A 5CVEA 3UJDA 1JSZA 4CTJA 1VPTA 1L3CA 5FWAA 1M0EA 4FZVA 1SUIA 2IGTA 4E31A 3EVBA 3DULA 3T7TA 2FK8A 3EMBA 1NT2A 3IEIA 3KQSA 1JQEA 3M6XA 4R8SA 3PVCA 4EK9A 3B89A 4DQ0A 3TR6A 5JUWA 4YMHA 2ZIFA 4YUZA 4AUKA 2BH2A 3ANXA 5EEHA 5EMKA 2ZBQA 3MTEA 1ZGJA 1X1AA 1N2XA 3NW9A 4LECA 4GEKA 2ERCA 3M6WA 2WA1A 4RSRA 5DWQA 3SSMA 3IHTA 2PJDA 3G8AA 3GXOA 2FCAA 3DLIA 3MCZA 4K6MA 5U4XA 3SXJA 3THRA 4ER3A 3DOUA 5FTWA 1JQDA 3P9NA 3HCFA 3CCFA 4FT2A 4GF5A 5CVDA 4EVIA 1BOOA 1XCLA 1IXKA 2NXCA 1FPQA 5T67A 3KQTA 5DX1A 2ZZMA 1BKYA 2IBSA 2ZFUA 4YV2A 2YR0A 4BLWA 1NKVA 3ORHA 2BM9A 3EGIA 4FP9A 5H02A 2P3LA 3KR1A 3FUTA 5BW5A 4RTNA 3MGGA 3S68A 2G8NA 2V74B 1SVUA 4E33A 2PXAA 1NW7A 1Q0SA 3G2OA 4MHTA 1G8AA 1L1EA 1QYRA 1ZKDA 3VYWA 5EEGA 5P8WA 3G2PA 5IH3A 1O54A 5KS2A 3H2BA 1P91A 1QAMA 1G6Q1 3BUSA 2IH4A 5FHRA 5DXAA 4KIGA 5LR6A 2PX5A 5HFJA 3T7SA 1I1NA 1U2ZA 3K6RA 2AOTB 4Y30A 3DUWA 2OB2A 1XJ5A 4HSGA 1EG2A 3KQYA 3SMQA 4YUWA 2FYTA 4RYLA 2PWPA 3KPUA 1RJGA 4R8RA 5EPEA 4PYQA 1QANA 4HG2A 3SX0A 4YUVA 4GOND 2CMHA 2OY0A 3HNRA 4DA4A 1RI3A 2QM3A 4KDRA 3OE4A 4C05A 3FRIA 3R9XB 1JG3A 3Q7EA 4BP3A 3OCJA 1ORIA 4OA5A 3GRYA 3PS9A 4XUCA 3KKZA 4HGYA 4ISCA 5T6BA 1RI1A 1KPHA 3P2KA 5E8RA 3C3YA 3UZUA 3P71T 3BGIA 5EHIA 3HTXA 1G60A 4P7KA 2YTZA 5KQRA 3KQPA 4M38A 4U7TB 3KQMA 2UYCA 4QDKA 3IYLW 1TW3A 1X1CA 1XCJA 2PT6A 2ZTHA 4CKCA 3UWPA 1R00A 3NVMB 2KW5A 2QYOA 4FSDA 4DZRA 1ZG3A 3EPPA 1NE2A 2C7RA 2YX1A 3LKDA 2QE6A 3KQWA 5E9WA 2CWWA 4XUDA 1I4WA 3GNLA 2AN4A 3PX3A 5LQRA 2YXLA 2YXEA 3DR5A 2VDUE 4KRGA 3SM3A 1G38A 2Z6UA 3FTCA 2YVLA 4C08A 3TPZA 4MQ4A 3PTAA 4V0RA 3UA3A 4L7VA 1FJXA 2F8LA 2ZBRA 3GDHA 5E8JA 4QQKA 4PCAA 3HVKA 1L3IA 4EQZA 1VQ1A 3BGVA 3P97A 2BM8A 4E30A 1D2CA 3UFBA 2NXNA 3PX2A 5CVJA 1VLMA 5E9JA 1NW8A 1DUSA 3I5UA 1BHJA 4Z2YA 2H1RA 2PKWA 2JH9A 4YUYA 3BKXA 2EFJA 3LCVB 3JWGA 5D1HA 3ER8A 4F84A 3TM5A 3SSNA 3HA3A 4ZTBA 1DCTA 3P2IA 3DXXA 2UYOA 2GH1A 4GOLD 4AZSA 4R6XA 5HZMA 2PWYA 4PYIA 4EKGA 3C3PA 1PRYA 2ZIEA 3EGEA 1XDZA 3O4FA 4C04A 3TKAA 3ELYA 1EAMA 1XDSA 2PX8A 2G70A 1VIDA 5DPMA 2OYRA 5FQNA 4FGZA 2Q41A 2AOTA 2O07A 2ONZA 2O06A 4NECA 3T7RA 2Y1XA 4BLUA 5ICGA 2N47A 1RI5A 4JXJA 5DLYA 3FUWA 3RODA 1M6EX 4GOOD 2B2CA 3KHKA 5EMLA 5G02A 5K0CA 1YFJA 5DT2A 1JSXA 4GBED 2P3QA 1JTEA 3MTIA 1HMYA 3OFKA 2CKDA 5EZSA 3ERCA 4C07A 1KHHA 7MHTA 5EHGA 1SQGA 4IV0A 4UOEA 2EG5A 1KIAA 3QOWA 2FHPA 4QVKA 5CIYA 1V39A 3SR4A 2AOXA 2HWKA 4QTUB 3PT9A 2G72A 4PINA 1WS6A 2NXEA 3D2LA 5E9QA 3HCBA 3I53A 3G88A 1PJZA 5ICCA 3LHDA 2AOUB 3TMAA 5K0FA 4U7PB 4E2YA 2AN3A 4EMSA 1NW5A 3SGLA 1SQFA 3JWHA 3OZSA 2BR3A 2PX2A 2IIPA 3MQ2A 2AZTA 2Z6QA 2IFTA 2HTEA 5E1DA 3KQVA 2GLUA 5GOZA 3TM4A 1RI4A 2HNKA 3A7DA 4AX8A 2WK1A 4RVFA 1X1BA 4P7JA 1RJEA 3HVJA 2PX4A 1YB2A 1ORHA 3AWIA 2P40A 3U81A 1XTPA 2OO3A 5FHQA 3DH0A 3KQQA 5E1MA 2VZ9A 3BGDA 2FK7A 2I6GA 3A27A 1RJFA 1YFLA 1TPYA 1YF3A 2BR4A 2VS1A 2R6ZA 5DRYA 5KVAA 4V0QA 5E2BA 3MERA 3LPMA 5CUQA 2C7QA 4YMGA 3LX6A 4GOMD 3E05A 4PYOA 2LD4A 4HC4A 3CC8A 3LBYA 3FUXA 3REOA 3NTVA 4OA8A 5K09A 2UYHA 3GIWA 1R8XA 3B7PA 4QPPA 3SSOA 1AQJA 3PLAE 2BZGA 3UJ6A 2H00A 2IDJA 3DMHA 1R18A 3G5LA 3LDFA 3FUUA 2AOVA 2C7PA 1VL5A 3OU6A 3FUVA 4DM3A 1WZNA 1NBHA 4RTMA 1MJFA 2JJQA 3JWJA 3VC1A 2I9KA 3UJBA 5DX0A 4BY9E 1AV6A 4ER7A 1Q0TA 1QAOA 3QV2A 2AR0A 2YQZA 5K0LA 3DXZA 3A4TA 3EGVA 1KYWA 2PBFA 2AVDA 3A25A 1NW3A 5EKUA 5KYGA 2K4MA 5HIKA 4R05A 1F38A 4GQBA 3PB3A 4PYNA 2GS9A 3TLJA 2EX4A 2R3SA 4MTLA 4A6DA 4EKIA 3M6VA 2G1PA 2OZVA 2JG3A 1R74A 1WG8A 5K0NA 5EVJA 2NP7A 2IH2A 3GRRA 3VC2A 3V8VA 5FCDA 1X1DA 2VDWA 3K0BA 4DKJA 10MHA 3OU7A 4FR0A 2CMGA 2AN5A 3KU1A 3UA4A 4C03A 5ICFA 3BKWA 1AF7A 4H0NA 3C0KA 3LL7A 4BLVA 4RV9A 2PY6A 5K05A 5GIPE 2AOUA 2EJUA 3UJAA 4OQDA 2PXCA 1M6YA 5FA5A 1L9KA 3LDUA 3Q87B 3LCUA 3UJ7A 4FSXA 3FYDA 1JQ3A 3UJCA 4PNEA 1UFKA 2ZBPA 4CKBA 3KPJA 4F86A 4RTQA 1OR8A 5DM4A 3KPWA 4HRAA 3UBTA 2XVMA 5F2KA 3OE5A 4AZTA 1YUBA 3EMDA 3GRVA 4RTOA 2JH8A 2AOWA 4X61A 3CVOA 4P58A 3FZGA 3NVKI 4CTKA 8MHTA 2FPOA 3GO4A 1Y8CA 3G2QA 4ER5A 1EQAA 1Z3CA 5HIJA 3E7PA 3EVFA 1TW2A 2Z6AA 1YZ3A 4KWCA 2P7HA 4WXHA 5DX8A 3HM2A 4OX9Y 1SKMA 5K0GA 3P9IA 3F4KA 4QPNA 3ID6C 3HCEA 1XVAA 1IM8A 1RJDA 5DTMA 5DM0A 1RI2A 4YUXA 1AQIA 4F85A 3FRHA 2ADMA 2ZULA 3B5IA 4B17A 5CCXA 2NP6A 3GWZA 2GB4A 2IP2A 2E5WA 4M36A 3VSEA 4GC9A 2ONYA 1KPGA 1FBNA 2NXJA 5T64A 4DMGA 5LSAA 3LCCA 5EMJA 3FTFA 2PT9A 3EVGA 2XYQA 3KR9A 4E32A 5HEKA 1I9GA 3AJDA 4DCMA 2ZCJA 4PYKA 3CBGA 2P7IA 3FTDA 5K03A 3P8ZA 1H1DA 2FRXA 3EVZA 4PONA 5EIWA 3EVAA 3LSTA 2B3TA 2OKCA 3AXTA 2ZZKA 3HA7A 3KPVA 4PIPA 2C7OA 5K01A 5C9ZA 1FP2A 4GUAA 4XUEA 5E1OA 5LQJA 1VE3A 3CJTA 2HV9A 4PYJA 2PSSA 3M4XA 4IKPA 5DXJA 1ZHFA 5FWDA 4E70A 1O9HA 4RTKA 2XBMA 3AXSA
chains in the Genus database with same CATH superfamily
1JGTA 3HB0A 2IYOA 1R88A 4FNMA 4X1OA 5K2MA 1XTRA 3WSTA 2HNAA 1I5OA 1VE5A 2FDRA 3E23A 4X3OA 1ZK2A 2X0EA 4LQDA 5B4TA 1N8SA 2MMCA 3KR2A 3KU4A 2VYNA 4MKGA 2ORIA 3UXEA 4DCCA 5DSXA 4E5KA 4Z4QA 3KSRA 3VO2A 1ODFA 1ARZA 2W22A 1Z62A 5CVVA 4D4GA 4DANA 5LU9A 1WCIA 1X1SA 2X8AA 6LDHA 1N5OX 2IYUA 2Q6OA 3B6IA 1WCV1 1X3LA 3DHNA 5JC1A 3RROA 5BSGA 3FNHA 3LXMA 3ZBUA 5FUYA 1CEXA 4D1YA 4ME6A 1PJLA 1YU9A 5JVDA 4MRAA 3CNQS 2IEDA 2DPGA 1WY7A 1X1RA 2ODBA 4O5AA 1N0WA 2X9NA 5LBIA 3W7BA 2EARA 2LVBA 4YNBA 5FL3A 4Y1FA 4MJ3A 2H59A 4RJLA 3HL0A 3TVYA 5A3SA 2AKEA 3DB2A 4G5RA 4EW2A 1PSWA 5C8ZA 2VRBA 3Q8XB 3WK9A 4AS2A 2JCXA 1CZHA 5JDCA 1ZC4A 4BQIA 1TFUA 4RVHA 7YASA 1UMDB 1EXDA 1NWHA 4Q1BA 1B42A 3SZOA 4IHJA 3Q9UA 4JP2A 1M6WA 1IC6A 4E4TA 4HV4A 4HEJA 3DL0A 4RTRA 2OYCA 1S1CA 4FC7A 4HYTA 3K2EA 3P9CA 4ARAA 4R1SA 1RWWA 4LDQA 5EY5B 3LXUX 3M0EA 5JJIA 2ZRKA 2DRIA 3D31A 3LVQE 1U7HA 4HTFB 3TOCA 4JBNA 1GZVA 3ND7A 2YC4C 4IDNA 3PYLA 3B7WA 4LVOA 3PFNA 1I1OA 3JALB 5JSHA 2FHSA 1A8SA 2YUIA 2OYSA 5IBCA 5K8JB 2NZUG 1ZH6A 1IUKA 2ZJ5A 4TYNA 3D8NA 3WY9A 3RWMB 5ALUA 3RKRA 1CUZA 3BIOA 3EQ9A 3KJIA 3D8SA 2GOYA 3QMMA 2XMPA 3UV7A 6REQA 2XMDA 1JIIA 1SHLA 3CW9A 3NGLA 3BMXA 3H2SA 5C1BA 3DBHB 3GJ7A 4EB6B 1J99A 4O25A 5FPSA 3HI4A 3I12A 4P33A 2EJTA 2B0CA 2OLKA 2XYHA 3VPBA 3ZU5A 2PKQP 5F7OA 4MGHA 4W99A 3U80A 2FY8A 2RONA 3TUJC 2Q9UA 3GU3A 3CTMA 1GXSA 4O4JF 5C4GB 1P19A 4FHZA 3RVJA 3NANA 4ZVLA 3KB1A 1IUOA 5CK4A 5TQ0A 2JKZA 1WCXA 1EX9A 3FSGD 3OZIA 3RASA 5IPFA 1PYDA 4N3AA 1YFZA 2QUIA 1ISHA 3SKXA 4KNYA 4OQNA 4HDQB 1K8QA 3M8KA 3KL2A 3JARB 4Q9AA 1SD5A 3UANA 1R12A 2Y3IA 1GT91 5A03A 3TH5A 3ZUGA 1L7PA 1AM4D 1N5LA 2H4XA 2PLFA 2V65A 3ANNA 3PC8C 1OVMA 2OCIA 3NVAA 1IOLA 4X20A 4MIEA 2DCUA 3ZS9A 2GPYA 1T2UA 5HGJA 1UCFA 2JGNA 1W0KA 4OJYA 4E2XA 1S1MA 1KMIY 1CERA 1NVBA 1NRIA 2QLNA 4AJ9A 4EG4A 4XQ9A 4Q9DA 1HE2A 3BXZA 2W2LA 2IWRA 3SD7A 2BEVA 1A9QA 2PMWB 2QDKA 2OAQ1 2OGWA 2X8WA 3FIUA 1BA2A 4HNQA 5AM4A 3ZWNA 6Q21A 2O3QA 3ZNOA 1JP7A 3SYMA 1DRUA 3T0IA 3WLEA 2GSDA 1YASA 4YO8A 5EJ6A 3CLUC 4LF5B 4W5QA 1B16A 1BWQA 5DOVA 3TVDA 4XVUA 1A76A 3DZBA 1QVWA 1OHHA 3IAXA 4UMDA 3TVTA 1ZGAA 1K4MA 3C6MA 3T3HA 2WKQA 4DJAA 1DIGA 3GAMA 1TLLA 3PEUA 3FPHA 4ZT6A 1DO0A 1F20A 2H0QA 4M6WA 4X41A 1KBQA 5H80A 3ZWOA 1VL2A 2VG8A 5CFRA 2HR1A 2RHHA 1BFUA 5C1IA 3GWGA 1HKHA 1E32A 3TTUA 1W75A 3JAKA 2IELA 2WFLB 3N07A 1YZFA 4A6EA 4Y6GB 4HFNA 3TECE 1VLZA 1ID1A 3L1UA 1BKDR 4GX0A 4I4CA 4JI8B 2JBHA 2RBKA 4WN9A 1X9HA 3A9VA 1I1QB 2Z43A 1RPNA 4BEBA 4LV8B 2XNCA 3FCUB 3TWOA 5AESA 2UU9B 5I8PA 4WN3A 4ZO9A 3EARA 1K68A 3QBTA 2VH1A 2YS7A 3NUGA 2ZRDA 4KLCA 3OT1A 3N2NA 4JX8A 4TTSA 1XVLA 2YIDA 1E62A 3TX6A 2DHCA 2UUPA 4L74A 1JSZA 5L95A 1X42A 3NIWA 4H0FA 1L3CA 3WIOA 1BEUB 4B9EA 3E9RA 5F35A 3CKMA 2BGMA 3GV0A 3OZBA 3DULA 3IELA 3R8XA 4BV8A 2FKAA 3JQDA 5D6NA 1NM5C 1VB5A 2JASA 3IAS6 4DZTA 2XY4A 4BRSA 2W70A 3T4XA 3ZIDA 1RRKA 3A1WA 5L3RA 3W3AH 2UYQA 2ZBQA 1XZNA 4Y6QA 4CR6A 1Q0PA 5FFFA 3H2YA 1EM6A 4HFMA 2JGFA 4BQRA 4UTXA 5IKPA 2AG8A 3O2SB 4KK3A 5H4HA 3U4DA 4F46A 4RBNA 5FTWA 3QE0A 3AC0A 4MINA 2CHFA 2FMUA 2X0DA 3HCFA 3MILA 4GF5A 3ZK7A 3HYRA 2CJWA 1SZPA 2PL5A 3CUKA 1KFBB 2GTPA 2C58A 1VIAA 4R41A 2BVNA 1T26A 4CDMA 3OQHA 2QAGC 1DTSA 2D59A 2PQ6A 1XTUA 3HDTA 1RPAA 3OBIA 4IIUA 3TPCA 3H5RA 3AUFA 1BIFA 4OI0A 2WF5A 2ZUWA 2GBPA 4KVGA 2CFCA 2WUWE 1OI4A 3ONNA 1AKWA 3EZNA 3KOUA 4IX9A 4WK2B 3Q6MA 1DAPA 1QP7A 1SUEA 1GTVA 1FTWA 3CRW1 3CZ9A 3KCQA 1JAYA 1AXRA 1E61A 2VAPA 1VMKA 1XHLA 5FHRA 3UM9A 4D42A 2FA9A 4RGQA 1NRXA 1T6NA 1UMBA 4YH1A 1Z7GA 2IIQA 2GO7A 1JJBA 3ZWKA 1OIWA 2HA5A 3MWFA 4WLFA 1R5JA 2DSTA 4UZSA 3FNQA 2TMDA 1HG1A 3X1DA 3VTFA 3KWFA 1UBFA 5JALA 3ABZA 4N9WA 1HE4A 1XZMA 3NAZA 5EUMA 1NF2A 2B99A 3PC2A 2C94A 3Q7EA 3OCJA 1IDN1 5CVCA 3VPGA 2CNWA 1A9YA 4QXRA 3ZHSA 1XN4A 1P4RA 1WUTA 4Q05A 4CN9A 1GAQA 3KJFA 2EERA 3OY7A 1UADA 4MUNA 4O8ZA 4AJKA 2NM0A 2HYDA 1MG0A 1RJ9B 1SCNE 1E2NA 4NMLA 4IP0A 3MNFA 4HFRA 3UWPA 3NVMB 2QYOA 2ZTLA 3G8YA 3M1IA 1PT9A 1T9GS 2H52A 1C7RA 4RJKA 5AJZA 5DYTA 2WJAA 2GXAA 3EXFA 2QE6A 1GUFA 3WA7A 2VHZA 2OFFA 4XUDA 2IIVA 4DR1B 3GUHA 2Z6VA 1COWD 2HPVA 4HX5A 4U9IS 4JI3B 4ZU1X 3K35A 4YP0A 4ARIA 5BO5A 1YC5A 4LXYA 3W4JA 1AIPA 3EZ2A 4H6PA 3KBOA 4JITA 3U09A 4C08A 1DFHA 3IOEA 3L4BA 3IQEA 4M1YA 1TA4A 1PS9A 1Z0FA 1GR0A 2ZI4A 4NOMA 4QQKA 1UJ4A 1P9RA 9LDTA 1F5NA 5LZ8A 3W9YA 1ZCBA 4JAVC 1CLUA 5E6SB 1UP7A 1RYFA 4G1VA 4CMHA 5A5GA 2FQWA 4XGQA 1I2BA 3PICA 3E4DA 1AHNA 2O9JA 4ZCSA 2EFJA 1JMYA 2J5BA 1GQRA 2EGHA 2BGKA 2Q4OA 3H8VA 2H29A 1KFJB 4OP1A 5PGMA 4F84A 1M7GA 1CNFA 1DPFA 1U2PA 3NKFA 3RAPR 4AWAA 5BYJA 5CXQA 3SF8A 1CX9B 3U1VA 4F3KA 5KTYA 3GFVA 1J9GA 4LISA 2ZYIA 4QIHA 2UXBB 2PGIA 3GFTA 3K9FC 4YXWD 4MA5A 1RHKA 2KBEA 4GOXA 2AJDA 1UKVY 1QH1A 4LDNA 1VE7A 2PKRA 1D09A 1LX6A 1VBKA 5AJWA 3VHXB 2ZIZA 2GAJA 4GOOD 5GJCA 1USGA 1QK4A 1GNVA 1O4WA 4HYYA 1UBHS 2ZUFA 4LV5B 4BVAA 2GK4A 1NLZA 4BVLA 1Y8RB 2JAUA 4RKEA 2M9MA 2GF9A 2Z9CA 3JAMA 3J81A 1OZGA 1J06A 1KHHA 2J9XB 3FNRA 3SXUB 2Z8ZA 4PHGA 3WL3A 5HOEA 5I7SA 4BAZA 3JWPA 3VUEA 3W4KA 1J1UA 2O52A 2GFIA 1AU9A 1BYUA 3HKBB 1Y5IA 3DL7A 3PT9A 4NZPA 2BEJA 3ES9A 4KO2S 1UBNA 1DRKA 3ISTA 4PN3A 2H6EA 2F7SA 2ZAMA 2OM6A 3W6PA 3BD6A 3K0AB 1QS0A 2D0DA 3BXEA 3WK5A 4G84A 3SGLA 1SQFA 1UBUS 2I33A 1RWBA 3JWHA 3FLMA 4I4NA 5JBIA 2XCSB 1MB2A 1UOEA 4XX1A 2V6BA 1WSWA 1FMTA 1Y33E 1GZ7A 2GILA 4ZQBA 3E3OA 3TIXB 5EUQB 1RU3A 3ZQKA 1TAUA 1RRVA 3UY4A 4NZOA 4ZJPA 2A4MA 1AKYA 2GAAA 2WK1A 3O4VA 4EM6A 3KUKA 1BVYF 2PPLA 5IJWA 1Y3FE 4XGNA 4JV5B 1U4SA 1VJTA 2IE8A 2E4WA 4KGXA 5CFNA 2OO3A 5FHQA 5DBEX 3R75A 3RIYA 3V8NA 3WLHA 3K2QA 4WRRA 3BL6A 5DMXA 1ZL2A 3U7JA 1DQYA 4I4LA 4MUMA 4X71A 3V33A 1TPYA 1OAOA 4YRLA 5KVAA 1BVRA 5KBYA 2CSXA 1B0ZA 5L4LA 3O8BA 3OWHA 2WHYA 4LBVA 1YCGA 4LZNA 5K3SA 4DREA 3GEIA 1PQ4A 3JZAA 3JZDA 1M0WA 4PYJA 1PCXA 3K9HA 3FUXA 2O8DA 4RU1A 2NTEA 2BKAA 3E1KA 4J9VA 3NUQA 4MWBA 1E2IA 1IBRA 3DZIA 4DS3A 1K1EA 4IIGA 5A4JA 3UK0A 1X7XB 3V4VB 4JLVA 5IJ0B 2C4WA 1GRQA 1Z7EA 1K6EA 2YQ4A 3OECA 3PHJA 4UEQA 3NT4A 1V5IA 1G6KA 2HV8A 3CRVA 1ISIA 1EFCA 4KI7A 4YCBA 3UJBA 2WQZA 4X5OA 2BEUA 4KE7A 5KWJA 4Q3NA 3AR3A 3COPA 3CX7A 4IUDS 3TIFA 1V7PC 4NONA 4E1AA 1DT5A 4OXRA 5BSWA 5C5EA 3STTA 1RLIA 3S2FA 1KYXA 4B8YA 4EKIA 2QJWA 3B1YA 3BREA 4ESVA 1IZZA 1LS6A 1F9EA 2PSDA 1Q7TA 1FLDA 1WG8A 1P8AA 1GV1A 5FOTA 4I6JA 1L7QA 3G2JA 5DLPA 3LYHA 2NLOA 1KAQA 1JNYA 1SXJC 2JAQA 1O6GA 3U2QA 5CG2A 10MHA 1P7CA 2AV6A 3CVXA 4GYJA 1JAZA 2RARA 3UA4A 1I3OA 1UBRS 2ODQA 4PC6A 1AF7A 1ZOIA 1WB4A 4LJ8A 2UAGA 4BLVA 5JRZA 5TVKA 4L5AA 5C1DA 4OQYA 2QAGB 4EW3A 2ZJAA 3HU3A 3B9QA 3QKRA 3DCJA 1S9DA 1M2HA 5C18A 2D0OB 3NORA 3NXKA 2YNMD 4BO8A 4YCSA 1PVVA 1E96A 4PZLA 3HWWA 4C2BA 3N74A 4PGFA 5DM4A 5F21A 3ZI4A 1A71A 2XVMA 3AINA 4UNSA 1XMXA 4JI0B 3PRKE 1YUBA 4N3CA 1Q0RA 4M1EA 4YJ3A 4UVHA 2O8BB 3UWKA 1TUEA 3QMPA 1NFFA 4GS5A 2BM0A 2FPOA 5COBA 4NNJA 1I94B 3RYIB 1NJFA 1YE5A 3UJPA 5CB0A 1LQTA 3WDSA 5JRJA 1YZ3A 2BFEA 1M1YE 1NQWA 2NTYC 2WNIA 2YJ6A 3O8CA 1GSOA 1KVSA 2H85A 1BFKA 2HWYA 3TCNA 3G82C 1G21B 4INOA 3FOWA 3EIFA 4O2AA 3ZCPA 1G3UA 1WRBA 3WWCA 4BEWA 1P75A 3FRHA 3T1TA 1FYEA 4OVKA 2YFKA 4A92A 2XOXA 2G4LA 4FQ5A 1UUFA 2PH7A 2R48A 4UTZA 4YCJA 4KQIA 5J3JA 2W9XA 2IF2A 1T6ZA 2JEOA 1M34B 3E1GA 4P3OA 1T25A 1ZH8A 4RK7A 2FEAA 2H9IA 2IYYA 4ENTA 1MAUA 1W9HA 3HFSA 1VGRA 1CE8B 2PDAA 1XZPA 2P7IA 5ES3A 5IT5A 4D56A 5KDOA 3K32A 3CH6A 1I3LA 5ITSA 2HMAA 3BF7A 4KZKA 4RY9A 3TX2A 2RSLA 3LSTA 1R16A 3CRZA 4UD2A 1C81A 3GJZA 3OZXA 4GUDA 4M8LA 4US0R 2H4FA 3PC6A 5K01A 1CUXA 1IXRC 2V97A 4D57A 5C80A 3VSCA 5FBZA 4C87A 1B6GA 3KOXA 4N5NA 3NU1A 1K9VF 3ANSA 5DSZA 3X2EA 3SQMA 3FZQA 1SKUA 1ZITA 3LOQA 4EY3A 4EL5A 1BE0A 1QHHA 2GRJA 1XTQA 2WG0A 3FNBA 2C5BA 4KQXA 4B4DA 1XCBA 2VSFA 1HDYA 4PCLA 1JAHA 3VKUA 2QRLA 3U1TA 4W5WA 1RC8A 2XGOA 3GJ0A 2IX9A 1C9YA 2YOGA 4EVSA 5EWMA 3V4RA 3D5TA 3ETCA 4ARSA 3T7EA 1G2IA 4BLPA 3AEYA 2BHNA 3GH1A 1XP5A 4WZBA 3UUEA 4EATA 4F97A 4Q7QA 4Z3KA 1PQWA 2WP0A 3DBIA 4D9GA 1E1QA 5BYAA 3KEMA 1G4AE 4OBBA 5ICEA 3LT2A 2AG1A 2Q4EA 1LQUA 2XHEA 3EVCA 1NAIA 4BP1A 1SCUB 4UREA 4CQMB 3DW3X 3THYA 2KQUA 3IR5A 4DMRA 4OI2A 2QD1A 4I6GA 3BWYA 3ZX5A 4ZI3A 3CZAA 4DNPA 3PD1A 2QZPA 3A2NA 4GRDA 5F7ZA 4MRMB 3SQXA 2X1HA 4TXHA 4JEHA 3KHSA 1KJNA 4GE0A 4J1TA 2DBYA 2W98A 3BSWA 4LZOA 1F2TA 1PV4A 3R09A 2Q50A 4HNAA 4KX3A 4DZZA 5FWYB 3UPTA 2ZWVA 3OLZA 3KQUA 4P7GA 2I2DA 4N0MA 4DV6B 3AM1A 1B0PA 1EFRD 1FCJA 2IOFA 2SNIE 3LF1A 3WNZA 5LQAA 4EYGA 1TI7A 1P29A 4PR3A 4OH7A 3AQ4A 5BVHB 1E6KA 1RHJA 5FYQA 1OBVA 1BZYA 2PJUA 2QA5A 3FPAA 5EUBA 3H4VA 1ESMA 3G7UA 1OIVA 3I8SA 3IDQA 2WMYA 3DCIA 3WYEA 1F2DA 4ACBA 2Z08A 2Z4SA 3O1IC 4CV1A 4D41A 5CB4B 2ESRA 5KOJA 1PG5A 1N2EA 3L0DA 3A1TA 3OOSA 4B82A 4QM6A 1W4CA 3FKJA 2FSGA 2O05A 4TMWA 4PRKA 1KWKA 3IIKA 1PUJA 1IN4A 2PGOA 4KDEA 5ALJA 5J23A 4LJRA 1DFIA 1T9BA 5LMUB 3B3GA 3HJGA 1DC6A 2QVGA 3M33A 1CEYA 2FRDA 2J9ZB 5DSTA 5FADA 4LNAA 4AYXA 1KI2A 4ROTA 3HDGA 4BGUA 2Q2OA 2HJWA 1A4IA 4NOLA 5JVDF 2GN9A 3AF5A 4K1XA 2BD0A 4YQEA 2ASEA 1VP3A 2CZQA 2CXSA 3ZLTA 2QTBA 1J0DA 2WLTA 3WGZA 3HVHA 3ZE1B 2OE2A 5TMDA 1LDGA 2BI7A 3L1VA 4NH4A 1T2NA 2CUKA 4ZZ0A 1FIUA 4F3CA 1J5EB 2C5AA 4K6OA 3GJ3A 1L5NA 3RTDA 4PTYA 1IOWA 2V7EA 5AMXA 3NJ4A 2I80A 2XQGA 1FSZA 3U40A 3DQQA 2Q99A 1BDMA 1TNDA 5A4DA 4Z53A 1G9XA 4AUMA 2NTNA 4U7HA 1H5UA 2UZ4A 2QT0A 2WF9A 2FVXA 4BN0A 4MVJI 5JZ9A 5KMGB 5FD8A 1V3VA 4YCCA 2IH5A 4TMTA 3WRXC 3OFJA 4HGRA 4CN8A 3AKCA 3V9AA 2ETVA 1JSRA 3ZE0B 2Q5QA 3LRTA 5LA6A 4E11A 4FYHA 2EJVA 3ADCA 1T91A 2PD4A 2RHCA 2ZBFA 3CISA 4RD2A 4Q3KA 2HU5A 3R9IA 3LUPA 4CCYB 2HF9A 3TTTA 4R8KA 4OY3A 1I3NA 1Y37A 4QSMA 4BL5A 4P98A 1H2AS 4D45A 2G0NA 1YA6A 1P74A 5TSDA 4AAYA 4D6XA 3EZ9A 4YR9A 3S8YA 4O4HA 4KBFA 2MINB 4JP8A 1GUYA 2FFJA 2CDBA 2VF4X 3FDIA 2FZVA 2GCNA 1DCKA 1GQOA 2IPOA 3D4OA 3IKJA 3N0XA 3SEAA 4E3ZA 4S0ZA 7GPBA 2VJMA 4L9WA 1JG4A 4KGZA 1Z17A 5IVPA 2FR8C 1KRHA 3DVAA 1ZS9A 2ZIWB 4DLSA 5C8YF 3EQ7A 5BWMA 4DNOA 5NULA 3ZZNA 2A2ZA 4HS9A 3IOCA 1CFJA 4JR0A 3DD1A 4X66B 2QMYA 4YMLA 1WP9A 1CZUA 4KPUB 1RXEA 4BMPB 2RDMA 2EATA 1OH7A 3LUGA 2HSDA 2YICA 3PSHA 3W8NA 4RKRA 4NHOA 2F9FA 3MB5A 2CLKB 3ABIA 4QRHA 4BP9A 1SC9A 2BTOA 2YIMA 4LSZA 1ZD9A 3WJAA 5KNBD 2VSYA 4JB2A 1X0VA 1JS1X 4LWOA 4BECA 4HBZA 4CMAA 2A9FA 3F4BA 1K06A 3TZEA 2VWGA 2WSBA 4Q4JB 3WLLA 3IQXA 1ZK4A 1W6RA 5DP1A 1EA7A 2SECE 1QG6A 3RR2A 2G08A 4PC1A 1WABA 4F2PA 4DA9A 1L9XA 3NWBA 3P26A 1EJ6A 3H1EA 3W2HA 1AHPA 3FNEA 1QHXA 1V6AA 1Y4ZA 2GA9A 4DMLA 2QZJA 2HA0A 1FYDA 4UJ3A 4BX0A 5CVEA 3V1YA 1NOJA 2OOSA 1YBAA 3CUTA 3QFHA 4Z99A 4DBLC 4NV1A 2CSUA 2VBGA 2WG1A 3CVJA 3GZ4A 5C8DA 4N82A 3W6ZA 4F4DA 2HEIA 4MWTA 2FK8A 4Y2JA 1KE1A 1TM2A 2G1JA 4BP8A 4ZVMA 1SUFA 5L45A 2O2GA 3O0TA 3WLIA 5KQMA 3V7FA 5DNYB 5JSQA 3TLGA 1FMCA 3JQEA 1WDKA 5D87A 3QE4A 4YMHA 4JOCA 5EXXA 2ILVA 2JLZA 2ZIFA 2QVXX 2B5OA 1T13A 4DUGD 3BQMB 4Q24A 1HFEL 2DBZA 4U2CA 1Z2DA 1E2JA 4BEJA 3M6WA 2WA1A 1Z6QA 2ONCA 3FX2A 4KAJA 3UA3A 5B6IA 3MCZA 1MJ5A 4K2HA 2ENWA 1E9SA 3ESDA 2PBLA 4D9KA 4PG5A 3BB1A 1MGPA 1DLIA 3ZU3A 3CZRA 5KHAA 1FRZA 4HXEB 3BEDA 3L93A 1FRNA 3AVOA 3BF8A 1FPQA 5EE3A 4Z8XA 1ZUHA 4IPTA 3VMFA 4BNGA 1QV9A 1YZKA 3G2KA 4WOPA 3H2KA 1UPXA 4BATA 4KWEA 1PNVA 2P3LA 1JDVA 4FMDF 2W0MA 1XI2A 4FUTA 4AC9A 2XCTB 3RSLA 3PYMA 2XT6A 3CU5A 2AUMA 1UANA 3ZDBA 2O3SA 3FZNA 3C6XA 5AJVB 1GCIA 2BMJA 3LQKA 4AMZA 2XTAA 4OXXA 3I9KA 3V2UA 4TROA 1TF5A 1O54A 2NT4A 2WKSA 5TY0A 1P91A 3HZRA 1T3SA 5TVGA 3VJKA 2JARA 3S5UA 1PL6A 1CEEA 1M1NB 3IQDB 1U2ZA 3K6RA 4Y30A 3MT9A 1XJ5A 1IPEA 1GQYA 1KO7A 2FN7A 1RYHA 1Y5LA 2X5JO 2EHDA 1H22A 1YHZA 3KPUA 4DCUA 3RH0A 5AVTA 3MT8A 2ZTVA 1JJFA 1YCDA 1Z56C 2FUEA 4RA9A 4OJMX 3F5SA 1Q84A 2RHGB 3N2YA 1RZRD 4KDRA 3PRJA 2G1UA 1YI8A 4MI3A 2NSDA 2HNBA 1IG0A 4OFBA 1O5IA 4KVFA 4OA5A 2IODA 5CTJA 2IHNA 5EXEA 3DE1X 1KFCB 5M2QA 2YZ7A 3KL4A 4BMVA 1CYEA 4OHFA 4HDRB 3S6JA 4AQYB 1Y3HA 5M04A 1LJ8A 4FDVA 4QDKA 1YJBA 2UYCA 3WNCA 2J9GA 3FYUC 3SJ7A 5LD2C 2F59A 1TJYA 3RV4A 3VPHA 2PZMA 4Q16A 3T5CA 3CPJB 3HN7A 1E1MA 3AHHA 4URVR 3KQWA 2W4IA 1NMXA 2CWWA 5AM0A 5IANA 2GZAA 4B5LA 4FN5A 4RQUA 4FZ3A 1PS0A 2FFQA 2YXEA 1WW3A 3AP2A 4TKUB 4AB1A 1ONBA 2YJ3A 4ARVA 1EJBA 5LWHA 3BZWA 2UYYA 2XHZA 4MDYA 2PL9A 1ONOA 1P77A 1A2BA 2HW8A 2FXIA 2R1VA 1L3IA 2YFYA 1K3UB 4F4HA 1RWNA 4YY3B 2VQDA 4EHLA 1YQDA 5U1PA 2BSAA 3JQAD 4LJ4A 1KI6A 1VG0B 2CHUA 3AKZA 4JFAA 3FSGA 4GMDA 1JHZA 3JWGA 3LPNA 4MNTA 4QTYA 2B2XA 1UJMA 1OYWA 5ADHA 1ZZGA 3LT4A 4C4XA 4Z49A 3B48A 3A6LA 2VLIA 2CFTA 3AERA 4BYGA 2C59A 2YL2A 5BSKA 1D03A 3Q8LA 2CMDA 2QVLA 1PRYA 3IOMA 3PLNA 2J6HA 2Q8PA 2RGGA 3EGEA 3M6AA 3AM3A 3H3FA 1QRAA 1UJNA 4NBTA 3BWVA 5LLTA 4UBMA 1UQUA 1KEUA 4D4MA 1GKUB 2G70A 4RZIA 1XLTA 1K92A 4AFNA 4D3XA 5KOYA 2C4UA 1HNXB 2AOTA 3UMBA 4BLUA 3T7RA 4P3KA 1UZMA 3LPCA 2FEMA 1FXSA 5H7XA 4TSFD 3KSAC 1ECCA 3N28A 3C6YA 1JHQA 3B7GA 3DZJA 2P3QA 3SHVA 5GTDA 5JEEA 4WZ6A 2WW8A 4QWWA 4GPAA 3TTXA 4RHTA 1OD6A 5LZ7A 3GUZA 3NYWA 2H2IA 2CVOA 2N42A 3U6KA 4JI2B 1OROA 1YRWA 4QTUB 1BGWA 4YDHB 2AWNA 2F3SA 4IOLA 1PSZA 4MV6A 1NR5A 3IURA 5F1KA 3TSOA 1JVBA 4QBFA 1RXCA 5HF6A 3BE4A 4FQ7A 1G21E 2HLPA 3CRQA 3PFIA 4XWKA 2B35A 2X41A 3OKPA 3Q72A 2AZTA 5I7OA 1WDMA 4I3HA 2AYYA 1RM0A 4IY1A 4AJLA 3R3YA 4NBKA 3T5GA 1Z39A 5D5QA 4EW6A 3BERA 5I48A 2COUA 1T3HA 3A7DA 3F1KA 4DIEA 1T5SA 1HYEA 1S3SA 4P7JA 2XGGA 2I76A 4MB0A 3VUFA 4CUZA 1THTA 5C37A 3Q0TA 3GT7A 4ND4A 4ECEA 4B33A 2NZYA 4OOFA 3AVUA 5DWDA 1M7HA 4DY6A 1L4KA 2FLVA 3H86A 3ZDZB 2VZ9A 4DEVA 2KHZA 4LF7B 1J2EA 2I6GA 3URKA 2WWTA 1TQ4A 2QRKA 3O4HA 5DRYA 3M6IA 1JFRA 3IALA 4YMGA 2R85A 1EESA 1XXHA 4HKTA 1DKMA 1LWOA 4BWFB 4QC2A 1XZKA 3P5BA 4NTZA 1OXVA 3EZYA 4NS1A 1V35A 4XR9A 4JBIA 4FI3C 4JQYA 5DHTA 1EXNA 3GIWA 3I2IA 4IOMA 4B6JA 5CDUA 1VA5A 4ZYYA 1IB0A 1TYEB 2C4NA 2R6R1 1TQ8A 2ZRIA 3EDYA 4HF7A 5FEMA 5ILQA 4QBKA 4TKVA 4UTVA 2XD9A 2DECA 4GVLA 1VKJA 3CWZA 2BGGA 2BBWA 1APBA 4E5PA 2I9KA 1QR2A 1TD9A 2QTAA 3GJ4A 1U9YA 4RK4A 1CQZA 3K0KA 2AVDA 1L2TA 4I9NA 1XZAA 1PFGA 3OMLA 2JIRA 4FCWA 3ZK9A 3BMOB 2D6FA 1FQKA 2NU7A 5ELMA 2IEGA 2YV5A 3OPYA 5ALHA 2MYPA 4YWJA 4H0CA 3ENVA 3EG9A 1BRTA 3IMCA 2WOOA 2VDWA 4YBZA 1GIAA 2WWWA 3QV1A 3T9DA 1MNQA 2RHMA 3GFGA 1CF9A 4GMFA 1QF9A 3GA5A 4J16A 1LBEA 3RABA 2HK9A 2P9HA 4ABYA 4JI6B 2XCUA 4BFVA 5IUKC 4BDTA 2XX3A 3HR4A 2E4VA 2N9UA 4H18A 4HLDA 4N65A 3SHWA 2Y6UA 2B34A 4IMJB 4QLBA 5HDQA 4N47A 2ZBPA 4XIFA 4CKBA 1I32A 1K8RA 2I6QA 3FIJA 1RLOA 2ACEA 3K3PA 3RB8A 4ZDIA 1QFZA 1GAWA 3WLKX 1Z4MA 1UWLA 2ERXA 2DQSA 4FMCB 4HQOA 2VJCA 3K53A 5JXHA 1UQRA 4GZMA 4K0KB 3MFYA 4JLBA 2XH8A 3IEUA 4WDRA 4UJ5A 3KAJA 1Z3CA 3WLOA 2LGJA 3E7XA 3EVFA 1TUBB 2H9AA 2PX6A 1Q12A 1J21A 4FFRA 3VNSA 3IV9A 5REQA 2IZ1A 2ANCA 3BM5A 3UGJA 1ZN7A 1E7SA 3I9V1 4D9FA 2D2EA 1AQIA 1KYVA 1GA4A 3QVLA 4HQ6A 1WBJB 1B41A 4NU5A 1M8JA 3KQLA 2CV1A 3F73A 4JKIA 1BX1A 4H4EA 3SKYA 2OZLA 5FLYA 1DC4A 2C0PA 1JA9A 1FBNA 1YZQA 3KJGA 4E22A 1NN3A 2O2XA 3EVGA 3FUCA 3L9XA 3ZWPA 2XYQA 5K9ZA 3LCJA 3TGPA 4A0HA 3LV8A 1VXRA 4MKXA 4YJ2A 3ZV6A 1SZCA 3GJRA 3ZCUA 3MTQA 4EPVA 3FPKA 5L3SB 1R6BX 3G0GA 3FYUB 3HFRA 5JBQA 1ZOSA 5LD2B 5J40A 4OI1A 3EVZA 4R40A 5ARBA 4O2BA 5A3VA 4ON9A 4F5WA 5B1EA 3LU1A 3KPVA 1I0ZA 3PWSA 2POQX 2VPYA 3A9UA 3PQFA 5E7QA 1AH2A 2R5NA 3A6ZA 1Q17A 2KBFA 4FW8A 4E5SA 3AF6A 2C98A 3WB9A 3LQQA 1H2FA 4Z7QB 1XFDA 3O26A 5H70A 4YJ3F 4BNFA 4HN2A 3CMCO 1KH3A 3OPNA 3THSA 1JIVA 3WX0A 5IKMA 3I1IA 5CA0B 4W8GA 2O1SA 3NIDB 4RPHA 4WBSA 5BN3A 4LA4A 1HEIA 4G24A 4WASA 3ZWWA 5E3HA 1EFLA 2IY9A 5FUBA 3UAZA 1R0CA 4L73A 3WYDA 4GEGA 4EFLA 2QUZA 3E9EA 4LW8A 4O2AF 3WXBA 3GHYA 1XV5A 1P1CA 2PQ2A 2IEAA 1ULUA 1RM4A 4TLEA 4JNKA 4YXWA 4MQEB 5HBGA 3WOHA 3MG9A 4CL3A 5A6VA 4DUYB 1V11B 1OLUB 1R9GA 4R69A 2OCGA 2CV2A 3CN9A 4B4OA 2W11A 4MW5A 5I9LA 4TZKA 1U8YA 1QQTA 2Q62A 1VSVA 4CLXA 4G0NA 5KEIA 5JS1A 1M2VA 2B1JA 4OGLA 3TOVA 1UIRA 3G2NA 4BNNA 4OI4A 3P2JA 4JEUA 1EDOA 5E2AA 1RNLA 2KS6A 5AOBA 3ZLVA 1NI3A 3QEBZ 4ND7A 4QUGA 1KK3A 1T8PA 1XYVA 1VFNA 1QC5A 4MIKA 4R1LA 4RVDA 3CO5A 1PYOA 2PU5A 3KAQA 4CVNA 4FR2A 4CG3A 4RW0A 4WMLA 4XIYA 1IEVA 2PH5A 3C24A 1VCNA 4S12A 2PRIA 4ZVSA 5F5LA 2WAMA 4BMNA 5ADWA 2VJNA 3K9LA 1TOAA 3O38A 3UMSA 2CCGA 5LZ9A 1SXHA 5BN5A 2R2AA 2RI1A 1PGQA 4IQ8A 1J0BA 4Q03A 2IEBA 4L78A 3DKKA 4DC9A 4IVQA 2FUG1 1JDPA 1ICEA 1E2DA 1VSTA 1XEFA 4DMFA 3GT4A 1S9HA 4GYYA 3VR5H 4YCMA 1CY7A 1PEYA 2QLBA 3AOGA 2NX2A 3DTVB 3IAM6 1BYIA 3LD9A 2IW3A 3M5WA 4LDPA 1DAOA 3T94A 2VF2A 2GZDA 2PX0A 2WKPA 3TAXA 1P4AA 5EE5B 1PJAA 4BNTA 2ZDGA 3J7TA 3JQGA 3GLFB 1M6NA 5IZ4A 1WUHS 3K8OE 1QGZA 3L4EA 4DCSA 1E5TA 3A70A 2O6HA 2BBSA 1XEAA 2PZBA 2J30A 4TRRA 3OTWA 5KVQA 3RSFA 4WCFC 4XWOA 1MQAA 3QX3A 5EIEA 4HATA 5DKFA 1H6DA 1JR3D 4CI0B 4D2IA 5CFZA 3FPJA 1JL3A 4TZ0A 1ZVVA 4MQUA 4G9GA 4IGIA 3T5TA 1Y9JA 2HQ1A 4KAXA 3L6RA 2VHWA 4G2NA 1DO8A 4O4LA 3T1VA 2BTEA 5AXCA 3MJFA 4FIZA 2FSVA 1YR7A 1THMA 3IP6A 3I6YA 1QH8A 5DYWA 1RXWA 4RKFA 4X8OA 5IT4A 4KW7A 1WXFA 4MPRA 2VJDA 2W8BB 3KO8A 3HYLA 2QR3A 1PJ2A 3FDFA 4BNUA 1E2UA 2UDPA 5DLEA 1VCOA 2O6LA 4DM7A 4P86A 1Y63A 5JHGB 3WGVA 4XA8A 2JLBA 2ORYA 2CHVA 3QP9A 2ODEA 3BFVA 4NJEA 3DE3X 4CIAA 2BFAA 1SVLA 1M74A 4REQA 4DADA 2QOEA 4X44A 2L2QA 4O1HA 1Y8ZA 2HRBA 4KXLA 4OJTA 4D92A 4F38A 4HB0A 3FPLA 4H3KB 3GUUA 4J49A 3RTAA 3ZWVA 2JAOA 2VWPA 1OT5A 4W1QA 4MYTA 4ZOQI 1Z8HA 4OHKA 1EGQA 1Q3KA 2KJQA 1DEKA 1ISRA 1E6LA 2BL4A 2FZ5A 2L82A 1XMIA 1YL7A 3EIWA 3NHJA 4I55A 3I62A 3K9WA 1ELOA 3B6MA 2YNMA 3VSAA 4KWIA 1OXMA 1TF7A 5ULLA 1SIWA 2JFUA 4I1VA 5HUJA 4E21A 4P8RA 1FNNA 4EUHA 3K09A 5BMOA 3U3XA 4BWGA 5AVQA 4GD3Q 5AK4A 5AUPB 4KK4A 5H59A 4Z4IA 5HTOA 2NT3A 3Q8WA 5KQSA 2XWQA 1A5ZA 3CUYA 3O7WA 5I7UA 1A7UA 4RHYA 1NE7A 4GX5A 1T35A 1T9AA 3IBSA 4JJ8A 1T43A 5CPBA 5FQOA 1E3SA 4AS1A 1HYGA 2ZYTX 3HACA 4FYYA 4KQWA 3X1XA 1AZWA 1YGPA 3HRIA 4MR7A 5FPHA 3V3KA 3JQ9C 4DV1B 3C4VA 5FA8A 3UCXA 1SHZA 4UUNA 3L92A 5LA6F 3TKYA 1N6OA 3MAAC 1AQUA 1E3MA 1XU9A 3IC5A 1YO6A 2QLFA 2ZI5A 3K9BA 4GO1A 4NH0A 2JKVA 2FX3A 4GPZA 1H8ED 1XEWY 2H11A 3HR7A 5U4QA 3SFZA 2VNSA 4X95A 3GDFA 4Q4DA 4C7JA 4Z4HA 3ZJVA 3W34A 1CJKC 4KHZA 4BHTA 2PA3A 1I2CA 3FFAA 2G0TA 3IPRA 2XTNA 5TGTA 1HQDA 3L7LA 1M0EA 3EW9A 2EW2A 4CKCB 4F5EA 5FR2A 2PRYA 4BNXA 1XQYA 3GDGA 1OI7A 3KE8A 4LTDA 2PQ0A 2GKGA 1MZVA 1U6JA 2UVPA 1H9CA 1Z74A 4Y0AA 2V7UA 2TECE 2YOHA 4DG9A 2HI0A 5FPQA 2JK1A 3G5UA 3QH4A 1XZ8A 4YUZA 1EP1B 4GBMA 5EEHA 3AONB 5KTPA 1G64A 1CRLA 1O0SA 1N2XA 2V45A 1V8DA 4HS4A 2F00A 4XM1A 2XV1A 4DB4A 3HDQA 1XU7A 4D98A 1TKRA 1PWEA 2F8TA 2PJDA 3G8AA 4J2OA 1I6LA 4OHUA 2HHCA 4AP6A 3BTSA 3OX3A 5E0OA 3O82A 2WB4A 3W79A 1MENA 2R8EA 2ZAYA 5HMLA 3PE4A 4HAIA 2ZJ6A 1LK5A 3T5MA 1IXKA 2IZ5A 4CKXA 5KSZA 1SH7A 4AI6A 3CNLA 4URFA 4B6FA 5ECDA 2BM9A 4D02A 1F8UA 3NJ8A 4RK6A 1CSEE 2WF6A 2XRMA 4WXRA 2CXPA 2IYZA 5AIAA 1T0HB 3CPHA 1RYEA 2Q5IA 1PSDA 4TUYB 4X1KB 1WM1A 3ZGOA 3VKVA 1H0HA 1U9CA 4L3OA 1E9CA 2PXAA 1DBPA 3LC0A 2Z9DA 4S1PA 5CGQB 1HPLA 2ID9A 1OTHA 1CD5A 1XCPA 1UAGA 3IP3A 3H97A 3O95A 5P8WA 2PMEA 3O3CA 4ZIRA 2J3MA 1OILA 1K27A 2C4TA 3P7MA 3EC1A 4MR8B 5DW3A 1E9AA 4QULA 5LZ5A 4ANFA 3FHJA 4QOIA 3TTVA 4F4JA 1TYAE 2PX5A 3WIUA 5JXJA 3PRYA 3WLMA 4ZYXA 1WSDA 3QTBA 1UM9A 1EG2A 5A1JA 3IJ5A 1DX9A 4P35A 3Q1LA 4XYBA 5F73A 3RTBA 3R0VA 3FBWA 4XDGA 2J67A 3A06A 3V1UA 1EFRA 1LD3A 2CMHA 3VYRB 3IIJA 4DR2B 2HDOA 1ZJWA 1ESEA 1C0KA 3MJDA 2Q1WA 1XZIA 1E2LA 1K88A 2XB4A 1ORIA 1Q2UA 2Z5GA 2HBRA 3AUKA 3JRXA 4V0ME 1L7EA 1U2DA 4EG3A 2G9QA 4EI7A 1PR0A 1UT6A 3K1TA 3I2YX 3QPWA 4E08A 1Z6GA 3PPXA 1QPZA 4U2FA 1IHUA 3JVUA 3HZZA 1QBGA 1XC7A 3IYLW 1Z0KA 4R1TA 2FRVA 1U0RA 4R2KA 4CTMA 2Q07A 3ET5A 4OXYA 1NE2A 2PZLA 3QBDA 3WA6A 3LKDA 2OORC 4CZ2A 1YXMA 2P0EA 5E9WA 1NBMD 3KB6A 4P0QB 3VU3A 4W4TA 2B5WA 1P3Y1 2NW6A 2QAIA 3FLAA 4LZWA 4PTZA 1XNRB 3G79A 1RQPA 1GKLA 4JROA 3I01M 1H2HA 4KRGA 5F4ZA 5FNVF 3DT6A 3OLQA 4AYWA 4M54A 5E4JA 2PNJA 4COOA 5JARA 3LYLA 4LC1A 3TPZA 4NJMB 4JVMA 3EOBI 1WCWA 2PJZA 4L5JA 4MVJD 3VR4H 1TAQA 2CDNA 3RUIA 4J8PA 1E8DA 5B2ZA 4F3TA 3AJRA 3NHFA 3GH3A 2RJ3A 4OHXA 5C31A 5KPDA 2MOKA 4HNHA 1ZYUA 2IITA 3K6KA 2HHAA 3L7CA 3FVRA 3P0FA 4WCFB 4EP1A 2DFPA 1HGXA 2JGIA 4G8BA 1VRWA 4CM8A 1MW9X 2ETXA 5B1HA 2UXCB 1PJBA 2GEKA 4BNLA 4XPIA 5JDIA 4RLQA 4N54A 1TEHA 1YS2X 4O59O 3ROQA 1KZ9A 3OQIB 1MIHA 1NSYA 2IF0A 1HYBA 1B0AA 2NG1A 2AFRA 2YZMA 3AUXA 3MBKA 2WJGA 4L9SA 3ELYA 4YO7A 2PX8A 1UMBB 4DQXA 1X2EA 2QLMA 2O2SA 5FQNA 5T41A 1UFRA 2EU8A 1DBIA 1I5RA 4HQNA 2Q5EA 5FPTA 1N36B 2IVFA 2AG5A 4O33A 4C6TB 1XP8A 4B79A 1C0LA 3KUUA 1UZUA 1GZHB 4ALKA 1HV8A 4BO1A 4IIBA 3TW8B 1H8HD 1PZMA 5BPHA 1IBKB 4MVCA 1N3IA 1J33A 3H9QA 3HA2A 1X7WA 4TWZA 1IVSA 1SR8A 2PO7A 3H83A 2P9ZA 3RS3A 2P11A 3NP7A 1AUPA 5I7EA 1MVOA 1OXBB 1RS0A 4CF3A 1G5QA 4BKPA 4K0RA 5CYFA 3ETGA 4BO4A 5CK5A 1K2VN 3VHLB 4RH1A 2PAFA 3RG8A 3WRVA 4DDKA 5KNDD 3L8ZA 2XT0A 4X3PA 4NV0A 3Q1KA 1JE1A 1OOEA 4DSZA 5L3QA 2G9VA 2MYNA 2XVYA 2NUPB 3ECAA 4PN7A 1YB6A 4HMQA 3DW1X 1G6HA 1GNQA 1W8IA 4OQFA 4A0QA 4DGQA 4NU6A 1SKBA 2C84A 2FX2A 4TMVA 3ZNNA 5CB4F 4WL0A 1J9ZA 2HIMA 2IIPA 2X3YA 2Z3ZA 1ZRSA 5D7BA 5EWLA 5KNBA 2BBTA 2JRCA 3C85A 2Q3EA 2ZBEA 3KQVA 2IBMA 4M0DA 3DYBA 4OKNA 4PLPA 1WOYA 1EXWA 1F4LA 1LNSA 3H5IA 3IR6A 4EG6A 1AQ6A 4MUHA 4Q3AA 5IBQA 1UKAA 2C2XA 4DNQA 5JEDA 1EUCB 3RYFA 1S8OA 5JD3A 3VZRA 1JHRA 4GM4A 1KEKA 5I9BA 3FGPA 3OKAA 5IVHA 2QQEA 5DIZA 1VSUA 5JXWA 1B1AA 3AESB 1UBCA 1CS4C 1Z37A 2YS6A 4JC0A 4ECAA 1OWLA 3NNSA 4DA7A 3DWEX 2PGJA 4LXUA 3QWFA 1BDIA 3FR7A 5HMMA 5DBIA 1N0IA 1HRDA 4YDRA 2ZREA 1OW3B 1YRHA 3DPUA 4NI5A 4TYPA 4ETMA 1VCHA 1SUPA 2VQSA 3BBPA 1KJYA 4A5OA 3CY6A 3KFLA 4J2HA 5FLEX 2WYHA 3NO4A 4QPPA 4UEWA 4CQLB 1Z0JA 2BZGA 4C4TA 1OQAA 1D4AA 1JEAA 2P6UA 2JLUA 4Q9IA 3LDFA 2HA3A 2C5HA 4I99A 4MP8A 3WBKA 4DUGA 3DSRA 4WNYA 2ZSAA 4V1CI 2JJQA 3IX7A 2BHRA 4X7BA 1AV7A 2WTMA 5TXGA 2Q7DA 3QV2A 2CVFA 4PS0A 4BTLA 2R8OA 1UPBA 3A4TA 2ZYAA 4AQ7A 4ZI7B 4TQAA 2KSQA 3UK7A 4G86A 3D6VA 2FW8A 2XXBA 3AEQB 3OQJA 4R0MA 5H1YA 3LUKA 1JHVA 3VZBA 4FFLA 5FT9A 2Y05A 1SXGA 2BDTA 1UXOA 4QJ4A 5AW9A 1OMOA 1KZ7B 3OZDA 4TLAA 5G0SA 4CV3A 5BV1A 5AVSA 1TTHA 5AI6A 2Q3HA 3V1MA 3VO8A 1N2BA 3NHSA 4H0NA 1ZESA 3WK6A 1ZUD1 2JHGA 3ZC3A 4RV9A 3CB4A 1O94D 3QHPA 1KO4A 2HMSA 2V8BA 2H9YA 1BQEA 3UTCA 4B7AA 1U2GA 5U9CA 3N5KA 3VJLA 5J58A 3WHKA 1BCRA 4S05A 2PEZA 5FF9A 2XUIA 5G4KB 1CW2B 4B34A 5TIIA 2IV2X 1RACA 3TGLA 4M60A 3GFBA 3RRZA 1HA3A 2VSNA 2G6TA 2WJPA 4O4IA 3DT8A 2HK7A 2KPOA 1L5MA 4Q18A 3OE5A 2ZRAA 5EIBD 2ZJBA 1OC4A 2WUDA 1B00A 4AMBA 1GGEA 2JH8A 3JATA 3QUCA 4BEVA 3TE6A 4CKEB 1L7VC 2BGTA 3BDAA 2IYQA 1R50A 2JEZA 1BJRE 1QE5A 3OC0A 4CTKA 3BMNB 3OURA 2H7XA 3WL4A 5JNRA 1JHDA 3HB1A 3LS2A 4LF4B 4OHVA 2RGRA 2A9RA 3IJRA 2DT5A 2V7GA 3PFBA 2EQ5A 4NDNE 1E3WB 2R7KA 3F4KA 3KOZA 4P0TA 3HCEA 4XM2A 5BW8A 2O8DB 1H2YA 3PE3A 3GLFE 1B6SA 2ADMA 2ZETA 3N2GB 4XVRA 5D3MA 2W71A 1M75A 3EG5A 5DYYA 1BEZA 1DBSA 4KIUA 4KN6A 3K2IA 4ZGBA 4LCBA 3Q6IA 3FTFA 1Y1QA 3P2OA 1DMSA 3R6DA 5IBRA 4KODA 3TB6A 3VOAA 4H7KA 2JFVA 3BJZA 3OY2A 3EEBA 3S81A 3FFXA 4OFWA 4RD0A 1L8AA 2A67A 4WIAA 4Q48A 4A26A 2IGBA 4B47A 3EVAA 1UODA 5DV9A 4WGGA 3BULA 3ZGZA 2AXPA 3OFVA 1U3WA 4AP9A 2TSYB 3DAOA 1S2IA 4NMMA 1Z7WA 4RDCA 1PKXA 3AVWA 3RWBA 5KTSA 2J0EA 1N3YA 2CEAA 1BVHA 2FEXA 3NH9A 1KETA 3BWDD 1T9KA 3AW8A 1ADYA 3GLRA 1YV9A 3UYKA 1KA9H 2XMBA 3LOUA 4QJ3A 2O7SA 3CEAA 4KE6A 4QGHA 1C9MA 3EPJA 4K9MA 2ASVA 4HNTA 3JYQA 3R6TA 4XDZA 1JG1A 1I2AA 5JO0A 4YCLA 4MO2A 4YLEA 1MAAA 3T9EA 1X74A 2IRWA 1TJ5A 1UR5A 2P41A 2P6OA 4HQFA 4LCEA 1O97D 3AEZA 3BWBA 2FETA 4HEA6 4O29A 4EZEA 4ZXPA 3GGGA 3LLCA 1RW4A 1SHJA 3LQ1A 4V24A 1SA0A 4C2AA 3KK0A 4IH1A 4JMPA 3WWZA 4YT4A 4RIGA 1KDYA 1MCZA 2VSQA 4TSFA 5GM2A 3O4RA 5CFOA 2CZGA 3SHTA 1IIBA 5EYPA 4HPWA 2RG1A 1QX4A 4RK0A 5CITA 3FPFA 3HV2A 3E03A 4KE8A 4UKDA 3QBJA 5K8VA 4A4DA 3DBRA 5HRCA 1J49A 4UBJA 4H77A 4MGKR 5K0JA 2IEYA 1ZGCA 5FOUA 4FS8A 2Z3WA 3QLUA 4O2BF 3V9PA 2HMYB 1RZUA 2Y1WA 3EYAA 1CK4A 1YRBA 1RQLA 3FWNA 3P0IA 3BDVA 4LY9A 3SIPA 3CKLA 3LCMA 2JJYA 2J5RA 1CIPA 1PL0A 2WUVA 4ZQEA 3RAGA 3JQ7B 5A4AA 3R9WA 3CR8A 4GICA 4L2IB 2X9LA 3ELDA 4BVHA 1BDHA 2FAXA 1WXQA 1Z45A 3ZKAA 1JG2A 1SQSA 2ZJ7A 4HZUA 1MB4A 1ATZA 2KI5A 1BWPA 4LPSA 5FBQB 2B69A 3EWAA 3GVHA 3V1LA 1VE1A 5HCUA 3LP5A 3ROXA 2C5LA 4RVSA 3VDQA 1KDOA 2DUMA 4NQRA 4OQEA 4JI7B 3FBTA 1FUYB 3GCZA 4GI1A 1FDRA 5B37A 3TNDA 1N8KA 1PL8A 2IX3A 3DCNA 1NKSA 4EDFA 4FEYA 3LYUA 5GQSA 5DWVA 4CLRB 1X94A 1JHUA 4HVLA 5FXMA 1LCIA 1Z7YA 2P8JA 4TL7A 1Z15A 4U9UA 5I7AA 3YASA 4DCGA 2MYUA 4DRYA 2CFSA 2HQBA 3ML1A 2X4GA 5B57C 5BRAA 4CLDA 1KAMA 4R2JA 4UHJA 4UPVA 4HZGA 3HL4A 1WDTA 1H93A 3QVUA 2CHQA 1T9CA 4ZT2A 3DC2A 2OQRA 5FAXA 5FOWA 2ORED 3VVLA 4M0LA 5CYOA 2W6ID 1OI3A 3S2ZA 1BW9B 1CRZA 2YYAA 3DUFB 2BLLA 3EK2A 4KIFA 3IT1A 5DM2A 4Z9BA 4F6CA 2X22A 3QU4A 3NG1A 1VL6A 4ND1A 3RHSA 4KX5A 5HKKD 1JFFA 2HXYA 4JA2A 3ZW7A 3HSKA 4OHCA 4RCYA 2EF1A 4QAJA 5HZHA 4DIOA 3IJPA 3LKVA 5JPCA 5CM9C 1BAPA 1OT3A 2QZ4A 4HNSA 3O5AA 2QRGA 2TYSB 2BMDA 3OX4A 4PBTA 4E09A 1WUYA 3FCXA 2E18A 3NOQA 3RYCB 1EVKA 2DQKA 4PHCA 4AF7A 1GADO 2JJ1A 2OR3A 4ZOCA 3VPDA 2PKXA 2RGUA 3MIIA 4Q21A 3H42B 5CHEA 4JI5B 3HP7A 3OJFA 5J4YA 2JATA 2AVNA 1CJSA 1KL7A 2C57A 1Z6YA 3G0OA 2A57A 5LJIA 1HEUA 1RWQA 2GD2A 4NPAA 3L8MA 4P3XA 4KPYA 1MOPA 3N7AA 9ATCA 2HH9A 1U94A 1I6MA 2Q28A 4I9GA 4PX9A 4Y6LA 4D9CA 2AJBA 2O0JA 2P9EA 5HRAA 5KYUB 2D8AA 3CLHA 2OMKA 4DG5A 1HE1C 2E48A 1GPBA 2PANA 3QEMA 1UXHA 2ZSHA 4WKBA 4YRPA 3WWDA 4HEQA 2WRZA 4MJ7A 3KYJB 4KBYA 5AM3A 2AI3A 3WK8A 4XDHA 2QM8A 3NI2A 4O4LF 4IDEA 1YUMA 5I5EA 1WBBA 5CT6A 3LPDA 3QQPA 2WHEA 4B3CA 2ORWA 1NVUQ 1P9OA 1TZ2A 1DOHA 4UXJA 3X1MA 1D8AA 1HNWB 1KMNA 1W44A 2VLBA 4JUAA 3ONDA 1H6BA 3LBFA 4FOSA 3S29A 2ZXUA 3IESA 5BNZA 2QJFA 5BMVB 2FJPA 3OFSA 3PGA1 5KCMA 1JR4A 1U7DA 3FDJA 4A91A 3CINA 4M7RA 3CKKA 1SBIA 4ZVPA 2H5IA 1F6WA 3AF4A 3RV3A 2OFPA 3B8HA 3A0UA 3ZI7A 5DGDA 4XZ3A 4WXPA 4S1WA 3WMGA 1C9DB 1J07A 4LXQA 2B92A 4PXSA 4ZCRA 1EWTA 2ODTX 4D96A 2I34A 3STVA 4H7HA 3UMVA 2A7XA 1CRQA 3MB8A 5EPOA 3SOZA 3ZQJA 4DQDA 2ZI6A 4XYLA 1GGFA 4LZAA 4OV6B 1QM5A 3F5FA 1R1DA 3E9MA 3NRJA 3FZYA 3H8JA 3IEIA 3BL8A 4I55F 1UXGA 2ZAOA 1KMCA 1OX5A 3HWX1 3MJ4A 2D4AA 1G6OA 2X0JA 4INAA 4N9QA 1XAIA 2E21A 4L4RA 5ALQA 3ANXA 4RLFA 5KKAA 4IOKA 3VAAA 5C51B 4QQRA 4LHZA 2DUWA 4DPLA 4TRNA 1YVUA 3EHDA 1RCFA 2GCGA 5DWQA 2FMTA 1M2GA 4LX0A 4A2QA 1E1NA 1L5SA 3KVVA 5AJTA 4ZRNA 5M34A 3WFJA 1GGMA 1JQDA 1HURA 2A0WA 4J4HA 5IM5A 5TQVA 3UPUA 4BFLA 1TTQB 3ABOB 3QITA 3H7IA 1NYRA 3DOFA 5DCWA 4H7DA 4MGEA 1E99A 2WVHA 3CUUA 1DU4A 1NONA 4EHBA 2IBSA 1EU1A 4PNPA 4BMSA 1RABA 3IGFA 1T1RA 2C9ZA 2D13A 4HD8A 2GARA 4N5LA 3WJ2A 4B4KA 2VJPA 3GNSA 5L8VA 4NMHA 4IUBS 1PGPA 1V43A 2GTIA 4ZVKA 4CFYA 5IAAA 1B3BA 3EPKA 2UZ3A 1QRRA 4RLSA 3ACCA 1UM8A 3HKDB 3TO5A 4UHEA 1JKIA 1U7PA 3WDKA 4FHFA 1U0JA 4G9BA 3HXTA 1PKEA 4WNCA 5AM1A 3CVUA 2J48A 3W5VA 1IHYA 3A0RB 5JI3E 2P30A 1Z2NX 3G0CA 3S2SA 2AX3A 1P0FA 4G0WA 2EV9A 1SQ5A 1ZZEA 3IP5A 3M9WA 1SMKA 1K86A 1TKCA 3C7TA 1ZJZA 1TIBA 3KB2A 4KXYA 3LBIA 1U8EA 3HABA 1N6RA 1OA0A 1QGUB 1H05A 2Q1YA 3TNJA 4DAOA 3HM9A 1GU0A 2D5CA 4BNDB 2J3QA 3WGYA 1LS1A 3AF0A 4FCVA 4ACAA 3W7AA 2R5FA 2ACWA 4U6NA 5ITWA 4WEOA 4Z4GA 3GARA 1YB5A 1P31A 3MF4A 2Q21A 4D4HA 5JZOA 1Y7LA 1Z6TA 3D02A 4LC9A 4U02A 3K1AB 2XOKD 1IHDA 1WVGA 3FSRA 4QYIA 1O0BA 2Z1DA 5J2TF 2G9ZA 2X8JB 5B6PA 2JPDA 3IUNA 3OQBA 3EZXA 2ECPA 4GZ5A 4UAJA 2XF8A 3KQMA 1QO0D 3FROA 4J9UE 1XEXA 3G49A 4Y6OA 3ZE9A 4CCWA 1G3IA 4DZRA 1IJBA 2XDQB 3CX8A 4XTCS 4YJGB 2YINC 1KOFA 2OFWA 1E3EA 2VTEA 4BIIA 3PITA 1CR1A 1L7AA 1LU9A 2W6CX 4FKZA 1GRNA 1SC1A 3FMOB 2A1UB 3KTDA 2V7QD 4B4UA 2EYUA 2LP4Y 5LB4A 3LXRA 2W2XA 2LUOA 3R3ZA 1MC1A 3EGXB 5F52A 3O8OB 5I7FA 2B6NA 4QXPA 4D4JA 1FJHA 3HVKA 3TNLA 2NU6A 3ZXYA 1UK9A 1MV5A 3QYPA 2ISCA 3A6HA 1Y34E 3PX2A 3A11A 4C01A 3BHMA 5J1TB 1ECPA 2XMGA 3BIJA 4LSMA 4RA6A 3OEHD 2Z5VA 3KAPA 5AW7A 1NUTA 3A1VA 3RU7A 5LUAA 3AFNA 3ORSA 5CA0F 3DEHA 4BGEA 3ILSA 3N75A 1ITZA 1JKMA 3LT1A 4A2PA 5LKRA 1BCSB 3X3HA 3AUAA 4I3GA 3NB0A 4ZICA 4QOSA 5FI0B 1U81A 4YPVA 4JLSA 2RC5A 4E46A 4KN8A 3QE3A 4B6RA 1A7AA 3PUXA 1N5MA 4GQAA 3X43A 1XLUA 5LMCA 1ZD5A 4DILA 5K99A 1J09A 2HM7A 1KMHB 2ZRHA 5F64A 2HX1A 4ENRA 2K7FA 3AL0C 3GY0A 2XTJA 1XAHA 4XD2A 3AHCA 4JXJA 1IXYA 3G9TA 3DKPA 4FOPA 5CH3A 3GGSA 4WY8A 4JEIA 3NEAA 1YFKA 1YQWA 5AQEA 1KS9A 2ZPAA 4QXOA 3R7SA 5I7WA 1DG3A 4EH1A 3WWYA 2VRWA 5EZSA 2XT9A 3QOYA 4G37A 1Z0UA 1Z5PA 2I65A 2R60A 1GRVA 4UOEA 4EA7A 3KXDA 3OO0A 5H5JA 3TZ6A 4M53A 2AOXA 3ACBA 4X6YA 2G72A 1HQYE 3TCKA 4J0HA 2P2ZA 1JEDA 4JLMA 2VPWA 4EY5A 1EFVA 4IGFA 2EG9A 4Q93A 3WLQA 2AOUB 3MFQA 4QDXA 3H04A 1JEQA 4P38A 1M1ZA 1YMUA 1M9NA 2ZR8A 4G41A 4XRRA 3TMYA 1EUZA 5DU2A 5AW3A 4BN4A 2AC4A 4P2GA 3SFTA 3CG0A 1YS9A 3H9UA 4KQCA 3N0VA 5DGCA 5JATA 2B37A 2H2FA 3EZLA 4I9UA 5GONA 3KTAA 3SNHA 2GLUA 1DDIA 2V55B 4W7HA 1PX0A 1E60A 2QW0X 3JVDA 4YRRA 3I5YA 2C3YA 3PNPA 3NHWA 1H3FA 3WGKA 2DOKA 1O1YA 3MPUA 1HBJA 1UDBA 4YJKA 3JTMA 3OSZA 1Z2PX 4M87A 4TV9A 3U61B 1UMCA 2BFFB 4P3YA 3WMFA 1E7MA 1KI6B 2KM1A 3BGDA 3DE2X 1X1EA 1H8EA 1U3FA 2FZWA 2ZWPA 3LY7A 5FWDA 2WJJA 5CUQA 2YRWA 3K20A 5EIHA 1V6CA 3E05A 3EDQA 4P80A 3FMGA 1E58A 3KJXA 2LD4A 1G7TA 1GTG1 5FO1A 2IHVA 1J42A 2WE8A 3CUWA 3HYTA 3NDPA 4FZ5A 4FHDA 1WB6A 4WZAB 5BURA 3AKDA 1QNLA 5KQLA 1Q95A 3TDKA 1E8NA 3CLRC 1PS8A 2H8GA 3PIDA 2VIIA 4EW1A 1QDUA 4LOHA 4QGFA 3O1JC 2P5TB 3GI1A 3PEVA 1YKGA 5CIWA 3UJ6A 2ZJOA 3WXMA 4BGDA 2R6DA 4FI3F 3N70A 2AQKA 4HDAA 1YBMA 3UHOA 1QRUA 1BXKA 1DBQA 4MKRA 2PYDA 3TL3A 4DM3A 5BSMA 3AY7A 1BROA 4DL9A 1ZM4A 4BY9E 5ILGA 5DX0A 5DHUA 4EFNA 3A25A 1MO3A 2AFHA 3FPSA 3NBKA 3IA2A 5E95A 1VLVA 2O1WA 2J41A 4FR5A 2OD7A 1LVHA 4KO4S 2CLSA 4L8FA 5ADUS 1CP3A 2QTZA 1HK7A 3AFHA 1PR5A 1W93A 3BZUA 4M0EA 4U6SA 3V8VA 3JWEA 4ALNA 5THXA 4F96A 4YV7A 4ZJUA 2QXTA 1KK1A 4S04A 2YVUA 2FW0A 4C5BA 1I10A 3PQ8A 1GPLA 2G36A 5EJ4A 2C9CA 5JNLA 2X8BA 1XJCA 4LWZA 3ZDXB 3ITNA 4OQDA 1KI3A 5DCYA 2PHZA 3LCUA 3RHFA 1T0JB 1Y1RA 4HRYA 4L4YA 4WK4B 3KP1A 1CY0A 1Y5RA 2I4OA 4HAUA 4PBRA 3WMEA 5B2EA 1Z34A 1F0PA 3C3BA 5FWXA 1YIAA 3BC1A 4MPPA 4WPGA 3RUDA 4Y1GA 3R44A 1LI4A 1KIMA 1SEPA 4WKCA 5JG7A 3ZHVA 5FB3A 2SKEA 3DJYA 3OLVA 1NI5A 4Q12A 1DAKA 2EZ4A 1V3TA 2IHKA 4R2LA 3T3GA 3E7PA 3BXXA 1EK6A 3IRUA 2B83A 3L7KA 4H7PA 4KWCA 3JAWA 1V9LA 4GP6A 1PTJC 4QXMA 1P7VA 1GPMA 2X4IA 1HG0A 3G2HA 3PD0A 3SWWA 1IM8A 1BJKA 1CNMA 1YF3A 1QCCA 1IZ0A 1PVDA 1WCYA 1K5PA 3GWZA 4DWOA 2OZPA 4ED9A 5F9FA 3KD2A 2IXAA 3W05A 4Q7LA 1KDZA 1KH1A 1X13A 4DSUA 4F1KA 4PM4A 1F48A 1GPJA 4M0CA 1NYLA 1J2TA 3ZKWA 1NBMA 4TKVB 3P9RA 1IN6A 1MAVA 4Z54A 4IXMA 1U02A 3R7NA 5JCOA 3SXPA 4B3BA 4EYSA 1UKCA 2W2VA 1PE0A 2FWIA 1R66A 2HN9A 5BN4B 2KLBA 3NFYA 2VZLA 4TVSA 1KAOA 4PONA 1GCOA 4GSKA 4M3NA 4C0JA 3PI7A 4L5IA 4YJHA 5D85A 4ERNA 1A1VA 4EENA 4GLOA 3O8DA 3TS1A 2NU7B 1TB4A 3D6NB 2VRCA 4GUAA 5E1OA 3CJTA 4NZMA 4P0PB 5JAHA 2BGRA 5TQJA 1CUCA 4O4IF 5F4BA 2NYVA 2OG2A 4UTOA 3HEMA 4WNAA 3COJA 1OZ0A 3L40A 3UK2A 2GCOB 2X5KO 3FOAA 4UD6A 4YXFA 1UOPA 2DU8A 2WWXA 3JTEA 1T8TA 3TUIC 1HRKA 3WO1A 5EHZA 1Q50A 1GQQA 1NF9A 4DJJA 4NXMB 4F5ZA 5AFSA 2I54A 1P7WA 3TFOA 3A4LA 3ELWA 1EHIA 2FPPB 2VYVD 1L7NA 4URZR 2W2KA 4Y2TA 3AEUB 4ZARA 2P4HX 4LOLA 5GWXA 2VHVA 4ONEA 3V5NA 2BR5A 3EXIA 3OP4A 1H6CA 1F8GA 2G77B 1P9LA 3EA4A 3L7YA 4IICA 2W2MA 4K6KA 3LC2O 4XWAA 5AH0A 3WNVA 4CPDA 1E2KA 1OTXA 3DOOA 3LA8A 1H8HA 4FXOA 2J3IA 3SQOA 1LRJA 3R3HA 4LGVA 1NMYA 2F1OA 4QO8A 1WUKS 3GQBA 2BUAA 4XQEA 1KR5A 1TK9A 2BF4A 1AOXA 3PHHA 4GRIA 4GP7A 4XGRA 1HM5A 2WUEA 2XJ4A 3TRIA 4AQDA 1N25A 4TN5A 4D3YA 4RESA 3KZKA 3OZEA 4IF4A 5TDHA 1QE0A 3RFFA 1J23A 3OHPA 4B5KA 1JI0A 2V9ZA 2XBUA 4ZZIA 5KNDA 3ZD6A 2A9KA 4UAGA 4JLNA 3OTHA 1JLKA 4ZYWA 3LUFA 2ZIGA 5KSPA 3ZBTA 3V1NA 1B2LA 2OP1A 3EVDA 2JAXA 4JWKA 3IBTA 4TSKA 1IY9A 5EKXA 1WV1A 2IHZA 2W6OA 1JECA 4NSNA 3VR3A 4E07A 2EW1A 3GX1A 2QRVB 3MYYA 1S2NA 4P81A 3Q98A 4WD3A 5AJUA 5AM5A 4D79A 3GGDA 4KEAA 4M0PA 4OSPA 4XUGB 4AULA 5EQDA 1QQ7A 4Y6SA 1JU3A 1NQAO 2CUNA 2ZI3A 3B3AA 1VPLA 3T9BA 1XN1A 2HJVA 3K16A 1U7TA 1OFUX 3OA2A 4A6XA 2B7BA 1G55A 2HT6A 3GCWA 3E53A 5HUHA 1T2AA 4B35A 1JDZA 1OCEA 2A1IA 2Q2VA 5IZCC 4IDFA 1I6WA 2ZUSA 1QQ6A 3KKNA 4C76A 4IIDA 5TPZD 4EEXA 2XBLA 1FQJA 3I30X 4N3NA 4HN9A 4C7MA 4CCSA 4ABTA 4IJMA 2C3PA 3JQ8A 5ARDA 4LBYA 5IUJC 1F3LA 4QOJA 4EQ6B 3LFTA 3KXLA 2A14A 2NO7A 2PZ8A 1JQJC 1T8UA 5JPIA 4KPEC 2FKNA 1MC8A 2GPBA 1ZIDA 3W7VA 2RGYA 3FGOA 3PFHA 5CTAA 3GRFA 1RAHA 3RGWS 4B9AA 1MR3F 3FB4A 2CJYA 4IWXA 3SVZA 4RTJA 2PXHA 3PV0A 1C3EA 2HZ7A 5AOCA 4RABA 1JLRA 1L4GA 4TVKA 3V34A 3FOEC 5TJHA 2CJFA 4EHDA 4WXYB 2PFSA 1WKBA 2W42A 5IC5A 7ADHA 1LUAA 2SCUB 2BMEA 2AQIA 5K8LA 3AFOA 2A0FA 2QD4A 4I5IA 2Q9CA 1LBHA 1A3CA 3I34X 5CGZA 1I7LA 3OPMA 1NOIA 5SYMA 1CUHA 1U9IC 1CQIB 5KSYA 2PS9A 3C3DA 4A73A 1W0JD 4MYHA 4C5AA 4S1VA 1U28C 2C9BA 2VP4A 3TNYA 4RMGA 3EZ6A 4X54A 4PGHA 4CFZA 2PSFA 4MO9A 2FR0A 1X7ZB 4OGGA 3CE9A 1NDQA 2UVQA 1V5GA 4TMZA 1Q0QA 5DFAA 2VYFA 4QL3A 2R00A 3MAGA 2ZYVX 3OZGA 2BFCA 2I7XA 3G8BA 5F5XA 1F0NA 2ZUDA 3UKDA 4DF3A 1O94A 2RGDA 3TDNA 1NN5A 3HEBA 2WSLA 4FT4A 4EFDA 2REXB 1U5BB 1AGPA 2FPLA 6GPBA 2O2DA 1JDTA 3ZDAA 3ZE6A 1SVNA 2GEUA 3QI2A 3LY5A 1Q1NA 3D64A 2PH1A 4MAFA 4R3UC 4XM0A 1FYFA 2K2QB 1DKRA 3NBQA 5IC4A 4ZOLA 1VDZA 3C7DB 1YULA 5ALXA 4CIWA 5LMZA 4JYMA 1W85B 1I80A 1E1LA 3AF1A 2WOJA 2GN0A 3C3XA 3PFKA 5EP3A 1GSHA 3L8DA 2W6NA 3KXKA 3I64A 1LV8A 2D2VA 3EQ8A 3H65A 1I4EB 4YROA 3TEJA 2V1XA 2DH6A 3KQKA 5KOIA 1GNTA 4KFRA 2VCEA 3VJRA 4KOAA 4D8XA 1SIUA 1RYZA 2WVJA 2YV1A 3K5PA 1XROA 5F12A 3OH8A 1KQFA 1E6UA 2YIJA 4DXDA 3LMKA 1X7YA 1ZNXA 3R9XA 3NNDA 1F06A 1FFBA 3Q7IA 4PRLA 3UMRA 2FP4A 3LZCA 3VBEA 1TQDA 5FP0A