4BLVA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylmethionine (adomet)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
280
structure length
280
Chain Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 101
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blvA00
2K4MA 1M6EX 1N2XA 1RJGA 3E23A 5KS2A 4GOMD 2VP3A 5E1DA 2PSSA 3QOXA 1F38A 2HTEA 5HIIA 3SM3A 4E30A 3MCTA 3UBTA 2AOWA 3C3PA 5LQCA 5GINE 2V74B 4AUKA 2Z6UA 3ANXA 3IEIA 3KR9A 3ERCA 3LX6A 3E7PA 3FUXA 3KR0A 4EKIA 3NTVA 3VYWA 2FCAA 2OO3A 5K0NA 5FUBA 5D1NA 3SGLA 5LQAA 3EVBA 2PVCA 5FWAA 3PX2A 1T43A 2O57A 3E05A 5DTMA 2ESRA 1FJXA 2EJUA 3LKZA 4DM3A 4HC4A 3KQWA 1F3LA 5T6BA 4QPNA 4BP3A 5K01A 4P7JA 2C7PA 1YFLA 2I7CA 1JG1A 2AOUA 5EIWA 5EOVA 3TQSA 3ELYA 5E2BA 3KPVA 3FYDA 2JHPA 4XUDA 1AQIA 4CKCA 1JG2A 3I64A 3HTXA 3B5IA 2ZZKA 3I9FA 3I53A 4OQDA 4BP1A 1QZZA 4GOLD 2PLWA 3DTNA 4F85A 5HZMA 2G70A 3UJDA 4FP9A 2WA2A 5ICFA 3EVFA 3KHKA 4XUEA 4RTJA 2Z6QA 1G8AA 1ZGJA 2BR3A 3BWMA 3MQ2A 4BLUA 4E2XA 2CWWA 2G72A 2QM3A 3KPUA 5E1MA 5EMLA 2VDUE 1P39A 1L3CA 1NW5A 3KQMA 2JJQA 3LBYA 1FBNA 3LCUA 4ER3A 2ZZNA 4P7FA 2YX1A 2CMHA 3KQPA 5K0GA 2JH8A 3B3FA 3TMAA 4AX8A 3UJ9A 5JR3A 3HCEA 4C06A 3EVAA 4DMGA 1QAQA 5E9JA 4RVHA 2XYQA 3M6XA 5CVJA 3TFWA 3FTCA 3GRYA 3FUWA 4C03A 4KW7A 2F8LA 3B7PA 1R8YA 2N47A 3CJTA 2P35A 3FUTA 3M4XA 3SSMA 3UJ6A 3GDHA 3NMUF 1JTEA 2AN3A 2Q41A 3KQVA 1BKYA 4GF5A 4HSGA 5DX0A 4F84A 3CKKA 5CUQA 5CCXA 4E2ZA 1NV9A 1N7IA 1NBHA 4CTJA 5KVAA 4AZTA 2XBMA 1EJ0A 3A27A 2IDKA 4GC9A 4C04A 1X1DA 5E8RA 2AS0A 5DX1A 1EQAA 2C7OA 2A14A 3LSTA 3K6RA 3OFJA 3DULA 1TPYA 3L8DA 2EG5A 5C1IA 3M6WA 5DM4A 5HFJA 1DCTA 2Z6AA 1P91A 5EKUA 3A7DA 2WK1A 2R6ZA 4PONA 2PBFA 1OR8A 1XTPA 2E5WA 1INLA 2B9EA 2ONYA 2FK7A 4U7PB 2ZSUA 3DOUA 2ZWVA 2ORED 4QQNA 1I1NA 2PY6A 3NVMB 5EQJB 2ZBQA 3LPMA 3C6KA 3I58A 5IH3A 1SVUA 3ER9A 2YTZA 4MWZA 4KVZA 3THRA 3CGGA 3R9XB 4RVFA 5K8VA 3FRIA 3KKZA 2HV9A 1L3IA 4PINA 3BXOA 2AN5A 1G8SA 3BWCA 3HCCA 3JWHA 4PYQA 3OZTA 4RYLA 3M70A 3HA5A 4DKJA 4OX9Y 1VPTA 4KRGA 3G7UA 1WXXA 4HGZA 2CL5A 1WG8A 3OE5A 5EKXA 1FP1D 3FTEA 4HG2A 3V97A 1VLMA 1JQ3A 3EGEA 2BR4A 3HA7A 4FT2A 2ZBPA 4OBWA 3GO4A 5EZSA 1EIZA 3RODA 3DMGA 3T7RA 4YUYA 3C3YA 5HIKA 2ZZMA 2PJDA 3KQQA 1RJFA 2PWPA 3K0BA 3LCVB 4ZTBA 5HILA 5DM1A 3WSTA 4FSDA 1NW6A 3UJ8A 5FA8A 3C0KA 1NE2A 1Z3CA 4LWOA 4P58A 1XCLA 1Y8CA 2PKWA 2ZFUA 5FTWA 1TW2A 2P1DA 1U2ZA 2QY6A 5LSAA 4QTUB 2AOTB 5K03A 3BZBA 1ZGAA 3ME5A 4C4AA 3B89A 5LQRA 3ORHA 3A4TA 5EMJA 1ZKDA 5B1SA 3H2BA 1P1BA 4ER5A 5H02A 1D2CA 4KDRA 4DF3A 1QAOA 2IDJA 4CWAA 3M6UA 5GIOE 5LQKA 4HH4A 9MHTA 1NW3A 2YQZA 3GJYA 5EMKA 1B42A 5M5BA 1SQGA 5HEKA 1YZHA 7MHTA 1JTFA 3EPPA 2ZIGA 1YF3A 4CKBA 2YXEA 3OE4A 5DPMA 1X1BA 4AZWA 1ZG3A 2OBFA 5EG5A 2PXXA 4PWYA 3FPGA 2XYVA 4CKEA 1SKMA 2DPMA 2O06A 4V0QA 2NP6A 3EEYA 5DRYA 5ICEA 5ERGB 3EVCA 1N7JA 1V39A 4R8RA 2ZIFA 3SX0A 2IBSA 2GA9A 4RTMA 2ZW9A 5K09A 2OKCA 5ICGA 1L1EA 1G60A 1TW3A 3NJRA 1R6AA 1XDUA 4QTTB 4R05A 2GLUA 4PYNA 4YUVA 2QE6A 3PFGA 4RX1A 4EKGA 3LECA 1O9HA 5FHRA 4C08A 3AXTA 1XDSA 3EVDA 4QDKA 1ORIA 2B78A 1RI3A 1MJFA 4JXJA 5DLYA 4E31A 4AZSA 4PGGA 3P9IA 5HIMA 5GWXA 3VC2A 2IH2A 1ZQ9A 4X63A 2G71A 2VS1A 3CJQA 3MHTA 1FPQA 3P9NA 4FT4A 3LDGA 1BHJA 4GOND 3DH0A 3G5LA 4DCMA 3PTAA 4PYLA 2EFJA 4YV2A 2UZ4A 2XVMA 1X19A 5EGSA 3TKYA 3VC1A 3TM4A 2B25A 4RWZA 4X41A 3IYLW 4PYOA 2GAFA 3FTFA 5FWDA 4KIGA 2YXLA 3O7WA 2OZVA 1JR4A 1JSXA 3R24A 2PXAA 5E9QA 2GB4A 4E70A 3BT7A 1SUSA 3NDIA 4A6EA 2AOUB 5E2AA 3OCJA 1KP9A 3GGDA 4LWPA 4ER6A 4YUWA 5LQJA 2NNWB 3OZRA 3PB3A 2ZWAA 4YUZA 1UIRA 3R3HA 4MIKA 4MQ4A 4GBED 4GQBA 2FHPA 3P9CA 3LDUA 5DX8A 1ORHA 5K0CA 1G6Q1 3G2MA 4P7GA 3GU3A 4FGZA 5EC8A 5DXJA 3F4KA 2VDWA 2JHAA 2IFTA 4YUXA 3NWEA 3NDJA 2P7HA 3G5TA 3UA3A 2EX4A 2NP7A 5KQRA 1SQFA 1UFKA 3CC8A 3R0QA 1I4WA 2ZBRA 2AOXA 5F2KA 4WVLA 4ER0A 3OU7A 1R18A 5JUWA 1KPHA 2H1RA 3ELDA 1NBIA 4IV0A 3HCFA 3Q87B 4PIPA 3KQTA 3BKXA 4PCLA 3LCCA 5DSXA 1VBFA 2DULA 4X61A 3U81A 2BR5A 1QYRA 5CCBA 1QANA 5GM1A 1XVAA 5CM2Z 4BY9E 2P8JA 3CBGA 3PT9A 5FQOA 3SSNA 4PGHA 5BW5A 3MERA 1RI2A 1KPGA 2R3SA 2YR0A 3DXXA 4H0NA 3FPEA 3DXYA 4CXMA 4RTPA 3QOWA 4WXHA 2Y1WA 1AQJA 2NXJA 4M38A 2PV0A 1IY9A 3SVZA 4Y30A 3HVIA 2AOVA 4P7KA 5T64A 5K0EA 4U7TB 2ERCA 3TLJA 4M37A 4EVIA 3NW9A 4DCGA 3RIEA 2QYOA 4L7VA 4PIMA 3OU2A 4E2WA 2ZTHA 1M6YA 2NXEA 4QVGA 4PYJA 3EVEA 3MTIA 4QDJA 2UYCA 2P7IA 3DUWA 3REOA 3IHTA 1MHTA 3P2IA 4FSXA 4YMGA 5GIPE 3UJAA 4FZVA 2JG3A 2QRVA 3C6MA 4OA5A 2ONZA 1IXKA 5KQSA 4LG1A 1EG2A 4M36A 2GPYA 3TRKA 3CCFA 4Z2YA 1RI4A 4RTRA 2Y1XA 3KPYA 1R00A 3LGAA 1BOOA 4R8SA 5EEHA 3T7SA 5K0JA 3KPJA 1M0EA 4QQKA 4EMSA 3FUUA 3BWYA 2HMYB 1RJDA 1Q0SA 3FPFA 1KXZA 3GRUA 3G8BA 3HP7A 2V7EA 3LHDA 1X1AA 5EEGA 2B3TA 2UYOA 2AOTA 3HVKA 5HIJA 3BKWA 4HRAA 2I9KA 2AR0A 2G8NA 2ZLBA 1VP3A 1WZNA 2P41A 3HCDA 1SUIA 2VZ9A 1KIAA 2IP2A 4IV8A 3UJ7A 5K05A 3O4FA 4HTFA 4E33A 3O31A 5LQUA 2UYQA 1R8XA 3A26A 2YXDA 2I62A 3B3GA 3KQSA 3SXJA 4BLWA 3MCZA 4XCXA 4YMHA 4EK9A 1O54A 4GOOD 5CIYA 2G1PA 1R74A 1PRYA 2B2CA 3TM5A 2ADMA 1EJ6A 1JG3A 1NT2A 3P97A 2FPOA 1P1CA 1UWVA 5K0LA 4X60A 4KIFA 3TPZA 5KYGA 1XXLA 3T7TA 3PVCA 5EHGA 1NW8A 2O05A 2OPBA 4Y2HA 2HNKA 3DP7A 4RTNA 4CTKA 2XVAA 2XYRA 2ZIEA 2ZVJA 3HCBA 3DXZA 4GC5A 4UOEA 3FTDA 1KPIA 4KDCA 4DQ0A 2IBTA 2OB2A 3B3JA 3HEMA 3NVKI 1NW7A 1X1CA 3DLIA 2CMGA 4OQEA 3VSEA 5DT2A 4RTSA 2IPXA 2KW5A 1AF7A 3OPNA 3DLCA 3FYCA 4IKPA 1G38A 4C05A 2PT6A 3DR5A 1RI1A 3EVZA 4K6MA 4RTOA 2NXNA 3BGVA 2I6GA 1G55A 1RJEA 2YUIA 1WXWA 3AJDA 3EGIA 3G2QA 4V0RA 5CVEA 5DSTA 3A7EA 2C7QA 2PX8A 1QAMA 3GXOA 3PS9A 3RW9A 3ER8A 3ID6C 5MHTA 1D2GA 5FHQA 2AZTA 4RTLA 1VQ1A 2LD4A 1DUSA 2O07A 3EVGA 3I5UA 5FULA 5C0OE 3EEOA 3G2OA 5DWQA 4O29A 3UZUA 3EGVA 3LDFA 3UA4A 2H11A 3PX3A 4FS8A 3CJRA 4ISCA 4EQZA 3FZGA 4OBXA 2WA1A 1ZHFA 2AN4A 1KR5A 1YFJA 2PXCA 2EJTA 3UFBA 4PYKA 1NKVA 3X0DA 5C9ZA 3P8ZA 5G02A 3GRZA 3D2LA 2ZCJA 3E8SA 3QV2A 5E1OA 4AZVA 4YV1A 1SG9A 2BM8A 2PX2A 3KQOA 2CKDA 3G8AA 3IV6A 4A6DA 2C7RA 3OZSA 1DL5A 5BP7A 5K0FA 2OYRA 4MHTA 3SMQA 1JQEA 5CVDA 2FRXA 2UYHA 3DMHA 5EHIA 3R6TA 4LECA 5GOZA 5DM2A 3GRVA 4NECA 5EIFA 2PWYA 3GCZA 2HWKA 1WY7A 3P2EA 3P71T 2H00A 5E9WA 5EZQA 3GIWA 2PX4A 4OA8A 5DTRA 4YV0A 1Q0TA 1BC5A 3HA3A 1JQDA 1L9KA 3Q7EA 5DRTA 3LBFA 1YZ3A 3HVHA 4PYMA 4IWNA 3FRHA 3M6VA 3MTEA 3PLAE 1D2HA 4GEKA 4PYIA 5LR6A 5T67A 3BGIA 4RVGA 1HNNA 5EVJA 5CVVA 3TR6A 4R6XA 4E32A 3KPWA 5GM2A 1KHHA 5BXYA 2ZULA 3JWGA 1WS6A 1YUBA 3GRRA 4PCAA 5CD1A 5CVUA 3DMFA 3AWIA 2BH2A 5D1HA 2IH4A 1RI5A 5ICCA 3HVJA 4RTKA 3OU6A 3G88A 4FR0A 3JWJA 1L3BA 1FP2A 1I9GA 1XDZA 3GNLA 3UJBA 1IM8A 4G56A 2FYTA 3KR2A 8MHTA 2IIPA 3BGDA 2GH1A 3AY0A 4POOA 3FUVA 2HR1A 4M7RA 3BWBA 3JWIA 3G2PA 4PNEA 2VDVE 3HM2A 4MTLA 5IKMA 3GWZA 1PJZA 3G89A 5K0BA 3TKAA 5F2OA 2OY0A 3UJCA 3KU1A 4XUCA 3LKDA 4RV9A 2P3QA 2PX5A 5DTQA 2NYUA 2PT9A 3A25A 5DXAA 4ATNA 2BZGA 5EMMA 5FCDA 3EMDA 4DA4A 5F2NA 2O0LA 3HNRA 5FADA 3EMBA 4BLVA 3KQYA 3SSOA 1VL5A 1AV6A 2FK8A 2JH9A 5EPEA 1VIDA 3PFHA 3BUSA 4X1OA 5LQNA 3FPHA 10MHA 3CVOA 4KWCA 4HGYA 5E8JA 2IH5A 2P3LA 2YVLA 2OXTA 4QPPA 5DM0A 3P2KA 4DZRA 5BW4A 4RVDA 4RTQA 3FPJA 3TOSA 4E2YA 4B17A 1NV8A 1JSZA 2AVDA 5GP1A 3KR1A 2P40A 3MGGA 3P9KA 2QRVB 5U4XA 3MAGA 3THSA 3HCAA 3T0IA 2AVNA 3M33A 1KYWA 3NWBA 1XCJA 4ER7A 2OB1A 3ELWA 1O9GA 1VP9A 1JG4A 2BM9A 3ELUA 5FA5A 4R6WA 1VE3A 3SR4A 1KYZA 1HMYA 1XJ5A 3MB5A 3UWPA 3LL7A 2PGXA 2GS9A 5FQNA 5P8WA 1YB2A 3OFKA 2NXCA 4F86A 5E1BA 3AXSA 5HOQA 4C07A 3V8VA 1EAMA 4QVKA 4RSRA 4GUAA 2JHCA 2IGTA 3S68A 1H1DA 4HTFB 2P3OA
chains in the Genus database with same CATH superfamily
3DL4A 1XKXA 2XNSA 3IRUA 1Y5NA 4C9BA 4YO7A 1P45A 2ON6A 2QAGA 3T0FA 2Z4TA 4C89A 4W9MC 1BDHA 5E6SB 5HIIA 2OP0A 5AXAA 1VSUA 5GJWC 1J90A 4UDYX 2MSEB 2V74B 2QGFA 5HSGA 4KC0A 2HSJA 2Z6VA 5ITSA 2YWBA 2PVPA 3ZNQA 2NZWA 4MO9A 1CQJA 1J8YF 3ZS9A 1XTZA 1CP2A 1XAIA 2H5LA 3COVA 3HFGA 1G4HA 4RW0A 4EVQA 1H2HA 1HPLA 4H1TA 4EY7A 4N5NA 4IKOA 5K6AA 5CXUA 4ND1A 2VDKB 1Q7GA 2VJPA 1GILA 5L9AA 1PFWA 3GUVA 2CLLB 3WYFA 3O2JA 4QPNA 4B2PA 1DC4A 2X1HA 4DDVA 1JEYA 5EOVA 3WGKA 4EH1A 1TZCA 3QU7A 4UHHA 2WTMA 3P2JA 1QGUB 2P69A 2Q4DA 4II3A 4Z99A 3Q12A 2D2XA 3NJ4A 3B5IA 1XTUA 2OILA 1X1TA 2IZ6A 1KYIA 1VBKA 1QZZA 4L72A 3TDMA 3Q9UA 2ZVQX 4QLOA 4B31A 4DR2B 1P5FA 2ORYA 2WFMA 2WWWA 3JQFC 1QIFA 3NWPA 5ICFA 4N49A 3QXSA 4UE6A 4C4OA 3R0VA 1G16A 1BGXT 4GPAA 3PWZA 1CKEA 2QM8A 3GPBA 3OIFA 4YGYA 5AR1A 3WO0A 3PXBA 4YPFA 1PO7A 2OV2A 5B5SA 1T9KA 3H9UA 2B69A 3ASVA 3WFJA 5KYKA 2J0QA 1Q7RA 1BMDA 1IN7A 1KZ6A 2Q8QA 3BVPA 5JR3A 3FJOA 4TN1A 3H7IA 5FJIA 3FLEA 5LWHA 3RSZA 4NC9A 3VNUA 3LOUA 2QX9A 2FHSA 4N12A 1W36C 2CCKA 3UJ3X 1AQYA 4L0QA 1IZ7A 1U9JA 3SSMA 1UEXC 2AGVA 1ZD4A 1SUDA 2QTCA 2H1LA 5MFPA 1T9HA 3X1DA 3AUTA 4LCJA 4HSGA 1QH0A 4F84A 1E5DA 4DBVO 1YNSA 4OFWA 2JVJA 1L7VC 2R68A 3CKKA 4CI9A 2W2VA 4ZPJA 3HWSA 2FN3A 2WWGA 1NV9A 3G0GA 2PJZA 5J5CA 6YASA 5L40A 4INPA 2HO5A 5F4BA 1U8CB 3CRNA 1A98A 1F7VA 1I1QB 2G1UA 3G2KA 3K0CC 2X4DA 1V2HE 2AS0A 5DX1A 2FMUA 5AWFC 1P0MA 3O3CA 1NM5A 1NPTO 1ZVQA 3ZWQA 3VR6D 1TVCA 3RVQA 1U9IA 5ESDA 4N8SA 5ITVA 3M81A 4ND4A 4X65B 4RFSA 4DSOA 1Y7TA 3D3KA 2W0MA 3LCJA 4R5MA 1PEAA 1BO6A 3AUJB 4I5DA 3OF3A 4L73A 2WWHA 4D1YA 1FDTA 3HUEA 5FPSA 3PP8A 4ZGWA 3HJTA 4FFLA 1FDOA 1ZW1A 1SG0A 2B9EA 3OLVA 1JVNA 3N6RA 2ZE6A 4ZODA 4LF7B 3R5HA 1VCMA 3AVQA 4XYEA 3GEMA 5DGIA 1QF7A 1C7IA 1WZCA 5TGDA 3TLBA 4EG8A 4WXEA 4LOAA 5MFZA 4QUJA 3L6DA 4B7CA 5K8VA 3QJYA 5JTTA 2W42A 1U8AA 2IUUA 2GMWA 4IHKA 4UMDA 4ECAA 3ENKA 2FPUA 2ZIAA 3K9GA 4BFYA 5HK9A 3CB4A 4GI5A 5FTKA 4M0DA 2DQZA 3CNOA 5ALQA 4EUKA 4D3YA 3G7UA 3CINA 2W93A 3D1LA 3ONDA 4LTDA 2J9FB 4LX8A 1RJ9A 3AESA 1FSSA 1KETA 4JBLA 4B8YA 4DLWA 5BRJA 1XI2A 2ZT5A 4GKKB 3D8SA 3WAKA 4KR6A 1RJFA 3R40A 3WGHA 1TYAE 2WKSA 2O3QA 1ADBA 1U7XA 4TTQA 3D8BA 4K2HA 1UFQA 4ZVLA 2XEDA 2IT1A 4Q12A 1I6LA 4XCQA 3RO7A 1TCBA 1CZNA 3CF4G 3A3KA 3FB4A 4UNNA 1KTVA 1R0CA 5B1HA 1EXWA 3RAPR 4G1UC 5I47A 5JQGB 2PHZA 5CT8A 2GPJA 3ZE9A 1QK4A 3I9KA 4CZ2A 4XFDA 3PX7A 3E3LA 1UANA 5GIOE 2W6QA 3QVLA 1KRXA 2YQZA 3A9SA 1OF1A 1UDRA 2CJPA 4BZZA 3BRQA 1SXPA 1GUBA 2CSXA 1GAJA 2GRJA 2QTVA 2YS7A 1NNLA 2YWFA 4Q3DA 4Q48A 3CRRA 4E1BA 2ZIGA 5PNTA 4FN4A 4Y9UA 4Z8YA 3KEOA 4HQ6A 1HO3A 5GV7A 1K7EB 2F1HA 4DG9A 2DHCA 2X8BA 1FQJA 4MKIA 5DRYA 3G0BA 4AULA 4E0BA 5IVHA 5JJIA 3DMTC 4IX1A 4R8RA 3OZIA 1FLNA 4COOA 3PPXA 4Q03A 2X9GA 3IS3A 1X7ZA 3N0TA 3N39C 1ZUNB 2WP8J 1JN0A 2XYHA 3HHPA 4E6EA 3CSDA 4JFRA 4YCAA 4PYNA 4QRDA 2ZKIA 3LNCA 1AD2A 4P80A 4XQGA 3VTFA 2VR1A 3QTLA 1O9HA 3RYCA 1OLUB 3AXTA 3FNIA 3IIJA 1U7OA 3F8SA 4K6KA 5ELXA 3OO1A 1RI3A 4JASB 1CDDA 1O8CA 2ZTVA 1U8ZA 1FFYA 4KN9S 1Q92A 1X1SA 4G8CA 3W9BA 1TYCA 4LOLA 3AVVA 2QRKA 2VS1A 2ECOA 1WEKA 1GSOA 2QEQA 2PD6A 4OTZA 4WASA 1WM1A 1QHSA 2B5OA 3GQVA 1KMHA 4PYLA 5JALA 2F3TA 4QDOA 3PTAA 3PZRA 5CPBA 4BV3A 3VC1A 5D8DA 4QREA 4OXNA 1EUZA 3T6KA 4MPRA 3UNXA 4DG5A 2GJ8A 4KIGA 5HE9A 4YCCA 3N2LA 3E7XA 4HXEB 2E1RA 1JR2A 3CH7A 2H9YA 4UBKA 4AMGA 1D4AA 4NVRA 2GR9A 4Y2PA 3SS7X 1EFRD 5TRTA 2ZB8A 4ZQHA 3FW1A 1U3CA 4MQ4A 3GJQA 3ZH2A 1ZJJA 1E1QD 1EXDA 1EDEA 4WTOA 4M1SA 1OAAA 1TYDE 2Y2UA 1MD9A 2EYQA 2R8BA 4RAOA 4P7GA 5HCNA 4D6YA 4DC0A 4FGZA 5DXJA 3PTZA 5B3JA 1CQZA 1TM5E 2V65A 4NATA 1HT2E 4HUQB 3NP7A 5COBA 2EX4A 3WK9A 5F1KA 1QR2A 4LJRA 2O5CA 2DBZA 3CC8A 4FE4A 2F9MA 3PUIA 1XL0A 1G6OA 3B1JA 3KLNA 3P20A 4KTTE 1SBNE 2CFSA 3PVSA 1VHJA 9LDTA 2M2IA 3G49A 4KXLA 4P3XA 4PCLA 1HEUA 1VA5A 3U81A 4CRWB 1Y1SA 4G24A 1SEVA 1CETA 1EK1A 4B3JA 3K96A 4V03A 1NVTA 4UUOA 4MQEA 5KTYA 4TTJA 2N1MA 4R83A 5IC6A 2PQ0A 4PGHA 3RADC 3N2ZB 3NV7A 4P53A 1DC7A 3IA7A 4MDHA 3D0KA 4XQ9A 1BVYF 5DYWA 3T54A 2X7JA 4YJHA 1YIOA 2RARA 3GB9A 4GI7A 1OBFO 4LVOA 3FG9A 3L40A 2NTNA 4MCAA 2HJGA 3F6PA 5I5EA 4BQEA 5HHTA 4R1MA 5TEWA 4XRGA 2AFIA 3WV5A 5A2QA 4ZHSA 3TXYA 4AX4A 4AF8A 1TA9A 4RY0A 5C5CA 1M66A 2FF7A 1U1CA 3OU2A 3SU8A 1M6YA 1OXVA 3WIVA 2VUIB 2XCRB 1E3LA 5I7WA 4ZMRA 3ILHA 2B1RA 4KQ6A 4Y0VA 1OLXB 3LQFA 3C3EA 3MMPA 4CIXA 3GJ0A 4NOMA 4E3WA 2NAFA 1MV8A 4C76A 1O97D 1QYCA 1ZM7A 3EW7A 4XQCA 2ETXA 1G17A 2W22A 1Z07A 3I2IA 1ETHA 4S05A 1M0EA 3H0KA 1U90A 1PQWA 4YAJA 2MMCA 1H4QA 3WYDA 1KXZA 1Y7LA 1OI2A 3GRUA 2EJWA 3HB5X 5EHQA 2IA5A 4JT2A 2QMYA 2WM3A 3HVKA 5JAOA 4V0OA 3O4HA 4Q4DA 1SVKA 4BLTA 1QZXA 5IXSA 4B83A 4W5OA 1GCGA 2QRLA 4YRNA 3H19A 2Q5FA 4K03A 1T0IA 1ODTC 2E48A 4L5AA 1F51E 2IDMA 2NZVG 4N01A 1YH3A 4GVXA 3O31A 4LDJA 1SXJC 5KHLB 5LQSA 5DT9A 4CMIB 1JDZA 5I7UA 2O5EA 3DFIA 5LD2B 1I2ZA 1U2GA 1VMDA 1U31A 2IYQA 1EEHA 3K53A 2ADMA 3DTTA 5KYXB 3CZ4A 1EP1B 3MOSA 4JVOA 1P8JA 5F78A 5A6SA 5IXYA 2JLUA 4KR0A 4JJKA 3TPZA 1KS2A 1EFTA 3R9IA 1O5OA 5CVCA 1DIBA 5JZBA 1SEPA 1E0AA 3TJZA 1QCCA 2JGDA 4A10A 2HNKA 4RK7A 3ACBA 2E4AA 4YRRA 4JJZA 5FP0A 2CNNA 3HR7A 3IMGA 3TZLA 2WUDA 5C46F 1ZRSA 4V0LA 4DQ0A 4CLRB 3CW8X 3Q2KA 3B51X 4POAA 4QHSA 3UAWA 2X2OA 2YMQA 2PQ6A 3ZU3A 4FYYA 4A0FA 4D9GA 3KJGA 3MBIA 5JVDF 4KPYA 3DLIA 4M0KA 4TWRA 5K01A 2AEJA 2FX5A 4JMLA 1Q84A 4XPZA 1WCV1 1RHJA 5I4KA 1A4UA 1SULA 5KOIA 1GYRA 1RYDA 3CNBA 3LWBA 3BJZA 1W87A 4TTAA 1Y8RA 4RTOA 3JATA 3MZ0A 4B2IA 2Z3WA 3QXJA 1U7UA 4R81A 2H1CA 3ADCA 1LPMA 2PH3A 3R20A 4RHCA 1CULC 2COUA 1EPUA 4D79A 3PLNA 3P4UA 1D2GA 3UF0A 2WWRA 3NYWA 4HV4A 1K6MA 1X1EA 2LD4A 4OOFA 4WCFA 4J90A 3VU1A 4RTLA 5F7XA 3EEOA 2WWYA 3B8EA 2XB2A 4BPBA 4HWOA 2GHQA 1X77A 1KSGA 5DBGA 4HEA1 2CVPA 1KJQA 4K5QA 3D6JA 1EM8B 4IJVA 9GPBA 1UXGA 3OTOB 1GQFA 3DW3X 1JWLA 4P08A 4NMXB 4O5AA 2EJTA 1HQYE 2QTAA 5JTUA 1YQWA 4IWXA 1XKQA 1G18A 4HAIA 1Y0BA 2QT1A 5CEEA 2R66A 3D2LA 1GM5A 1XSEA 2DOKA 1RPJA 4BGEA 4BO7A 1G3MA 1UIMA 2BDEA 2ODPA 3D2AA 4YV1A 3LLCA 3SC4A 4BRSA 1Q1AA 2AJLI 3G8CA 1KE2A 3PUJA 4CQNA 1G6KA 1Q11A 1ZUIA 5EKSA 3QI7A 4G89A 4LCEA 3U4AA 4E14A 3AF6A 1TZKA 4U9IS 2E1PA 4DCSA 1VLVA 3U0BA 3N8KA 4NECA 3C8ZA 4KL8S 1KEKA 2Q9UA 4H7JA 1J5XA 5DYIA 4Z7QB 3P71T 1B3RA 1NP6A 3GIWA 3G1UA 4L2IB 2FA9A 1WPXA 4PLWA 2R6R1 3ETEA 4GLOA 2MSWA 1ULUA 1FFSA 1YB4A 2WY2D 3V7UA 1RYNA 4WNAB 1IHOA 5JXWA 2PN1A 5AUQA 5LZ2A 1PWXA 4YJ3B 1M5TA 3EQZA 3QKIA 1TU0A 4QSMA 4TS3A 1HLPA 5JWRA 3E15A 5GZ6A 5KWSA 1ADYA 2IU6A 4Q15A 2XWPA 4RCYA 2AH5A 5HCUA 4BJHB 1TO1E 5UKDA 2RG1A 4RA6A 2HHJA 4URVR 2O6HA 3SOZA 4CMGA 1C8LA 1TQHA 2AC2A 5D3KA 3U26A 1VRCA 2VZEA 4OHXA 3ZG6A 4C0QC 5B4UA 1Z4MA 5HS4A 1JJFA 2VCHA 3O4RA 1UAGA 3L6RA 4JU8A 3PR3A 3T95A 4WBNB 3G88A 4FR0A 4IMJB 3TWOA 2QSZA 3UJBA 1HLDA 1R27A 1QQBA 4NCJA 4XWAA 3UCFA 2A57A 3KZOA 3MILA 3REQA 1EUDB 1XEXB 3BDIA 4EKEA 3QFTA 3BGDA 3SQNA 5JSZB 4WPGA 2ZWPA 5IUJC 4IZIA 1XUOA 3HM2A 1P6UA 5CFNA 1JHUA 1P4JA 1ML4A 1Q1GA 1VJ1A 2QPLA 2GQ0A 3NM6B 4QFDA 3BMXA 4BJ3A 2OY0A 4WSOA 3O2SB 3FCCA 4WUVA 1U4SA 4IHJA 2RHCA 1KYTA 4JI7B 4G1VA 2X9LA 1OH8A 4ARAA 5AOCA 2WTUA 3TIVA 2OORA 1Z16A 3CONA 4BJ6A 2C4NA 2KJQA 4QXAA 1P72A 3Q3VA 3ZY5A 1HYBA 4EI2A 3GFFA 3KYDA 3HJHA 3OKFA 1T26A 1ENOA 1L4MA 5DB4A 4MICA 3K1TA 2GBGA 3T5GA 3WL8A 1PR3A 3A6GA 4CFZA 5B3LA 1HYQA 1L7NA 2XLCA 3T15A 3PFNA 1QFJA 5M04A 5CEJA 3TQIA 3WVNA 1YRHA 1J2EA 2HCFA 3BE4A 4YH1A 5F4ZA 1UT8A 2XDQB 3HJCA 1U8FO 3JZIA 4NYIR 4UHJA 3TZKA 1C3XA 2X76A 3F3YA 1S2LA 3LQYA 3C1UA 5ICMA 3QE4A 3P9KA 3ZIAD 1E58A 5I6DA 3N28A 2AVNA 5JCZA 1PJTA 2NO6A 3C39A 5FUWA 3UTDA 5EXTA 1M0WA 3W6PA 4DLBA 1DWQA 4RDCA 3LAWA 3UM9A 1EFDN 2PS9A 2WIAA 1UUFA 2PGXA 4L3OA 4Y98A 2LZ0A 1XC7A 2VHQA 4FFMA 1A9TA 5AD1A 2PX3A 2WWTA 3RVNA 2NXCA 5AK6A 4C1NA 4NHEA 3EXEB 4CTMA 5HOQA 5DM70 4HH3C 3KO8A 5BT8A 1LJUA 2VF2A 1PDOA 2CFRA 3ANNA 3UXYA 3QKSB 4OI1A 3FI9A 5IM4A 1RPZA 4ZRMA 2YH2A 2OCLA 4WVFA 4NCAA 2B2NA 4K8OA 4A92A 5K99A 3IMCA 1P74A 1TQ2A 1BDMA 1U7PA 2IYTA 2JATA 2YOGA 2ACWA 4LBZA 4O4JB 1K1EA 4Y7DA 3T94A 2JFZA 3ECSA 3I3OA 5EXPA 3MCTA 5BOVA 1EB8A 3C3PA 1W46A 3IPCA 4OXRA 5DVZA 4R1OA 4KOEC 3BCHA 1CE8A 3E22B 4C4PA 1KOGA 1N6PA 2QNIA 4ZV7A 4ETWA 3NTRA 4GZ5A 1AS3A 1RYBA 4WY8A 1P80A 4MS4B 1FNSA 4OKNA 3VR3A 1ABBA 3K6KA 1ADJA 3ENQA 3ZX4A 4ZPXA 3F73A 2O57A 3L01A 4RPIA 1G0NA 3LQQA 5DTMA 4EFNA 3LKZA 4YAGA 1HFKA 3ANTA 3BMQA 3GDGA 3MWGA 4WOCA 4PSAA 1N36B 1JG1A 1K89A 1ZD1A 1KDZA 2QQGA 4RSMA 3JRWA 2OK8A 1Z4QA 4KFSA 1E1MA 3ZVRA 2YXPX 1HDXA 4F2PA 4TV8F 2BGGA 1EE2A 1MQAA 5CW1A 4F71A 1T0JB 1B0ZA 2H5EA 2CLKB 3K8ZA 1JU4A 3ZXUB 4G0OA 4IW3B 1NLYA 2PMEA 1AKRA 2V45A 3LH5A 1MW9X 4YEDA 2LVBA 1LK7A 4II2A 4OHKA 4WZAB 1NYLA 1USGA 4Q7QA 2HK8A 3BQ9A 4RZHA 1T29A 3A9TA 3FSJX 5K0NA 1KE1A 2IEGA 2JJQA 3EC2A 2OZKA 4CUZA 1UJ5A 1E5XA 2DECA 1VE9A 2DT5A 1V16B 4CQLB 4DTIA 1N8NA 1E0KA 3RTGA 4DE5A 2Q7XA 3BF8A 3CKMA 3T52A 1A3CA 3EG9A 3ZK9A 2ZRKA 3SPXA 2JIZA 5B58T 1E6UA 1IN5A 3AGPA 4HDOB 4UCWA 2FAXA 4B44A 2BGTA 4C03A 1D2MA 4BFCA 1S8OA 4YP5A 1DRJA 3M4XA 2YN0A 4GKBA 3LLVA 2HEGA 3E9NA 3H5LA 4HDRA 5CBPB 2V3CC 1BWQA 3I1IA 5DX0A 3H18A 4IEFB 1RAGA 4CCYB 4CJXA 1PFVA 4K3UA 7GPBA 5ARCA 1TAUA 4YRPA 1GA1A 4CTJA 4N48A 1BN6A 2HQBA 1TEHA 2X14A 4URWR 1C3EA 2W2KB 1E1NA 4A2QA 2WPNA 5E3HA 2IHZA 3IQZA 3QKWA 4XFKA 1OIWA 1V4BA 1QP8A 1VRVA 2ZI5A 1CYEA 3U7HB 1ZH6A 1N2CB 3FCUB 3LSTA 3PUXA 4HS4A 3DM5A 2DRIA 4WECA 3I23A 3RE1A 2JDID 5JS6A 4GI1A 5F35A 2Y92A 3I04M 5IC4A 1IUOA 1JMKC 5BSHA 1T6XA 1G8MA 3WBBA 3QENA 4CNBA 4BNLA 3SKVA 3VNAA 1RC0A 4AJOA 1T9ZA 4PONA 3SZOA 3B9BA 1N8TA 2J0VA 3UKDA 1AOXA 1DO8A 2YFHA 3QMMA 4J1TA 2PS1A 1RXEA 1E3QA 2EL9A 2BKLA 2F48A 4GHWA 4KP7A 3OTWA 4EPRA 2A0YA 1IY2A 2ZBQA 4XIIA 4KQ1A 3ER9A 5IH3A 1O9BA 3ZVMA 1WMDA 3F97A 3D5EA 3DKIA 4KQFA 4F2HA 2GHRA 2ZIUB 1U5BB 1ZOPA 3H5OA 2J3DA 4O2AB 5U1PA 1KFEB 5JNTA 5F5LA 5JAHA 5L4LA 4ZP1A 4C7XA 1RE0A 3L0YA 3SKYA 1YQQA 2WFLA 4JUAA 3M70A 2DKOA 3SZUA 1E9EA 4AYTA 2RBKA 1TUEA 1H1LA 2H0AA 1PL7A 3NBQA 1EE9A 3C7AA 4LZAA 4C4XA 3EARA 2QVZX 5HPYB 4JL8A 2CNBA 4TUYF 1T0BA 1N5RA 3R77A 3B9RA 1GG2A 4D8VA 2D13A 4FNGA 1LDMA 2HA7A 2XCUA 3BXFA 3GO4A 3WL5A 4DSNA 3NO4A 3QFFA 2RE8A 2ZZMA 1GL7A 3AG6A 2H1WA 4HQKA 2JFYA 1WA5A 4W4TA 4DR4B 4OGFA 2WNHA 5CA0F 4KNWA 3MRXA 1XWWA 3SI7A 2GRAA 2YYYA 1V8DA 3BXGA 3GNTA 1Z3IX 3Q9NA 4WLVA 1XCLA 1XEFA 2DFDA 4ZAZA 5A7FA 2IEBA 3KQUA 5K03A 1G3UA 2REQA 3AOEA 3ME5A 1NR5A 1DXYA 1WABA 2BKAA 2R8EA 2OZLB 4M0PA 5BSEA 4LFCB 1T25A 4JC0A 2NG1A 1TMYA 2HPHA 4YRSA 1OFHA 4QXMA 3PA6A 5HK8A 4IJ5A 3NDRA 2O8DA 4R2HA 3VR6H 1R4NA 2EQAA 2H4FA 3L92A 3OTIA 2WIGA 4H3KB 2RHMA 3JR7A 4YCLA 1VC2A 1VXOA 4NYJR 4OQMA 3HGTA 4JVMA 3V8RA 4EGSA 5EG5A 1JKJA 2W4QA 1Y37A 1QTQA 2NP6A 5E7QA 2VTVA 2AKAB 1NDUA 2ZJFA 3A1CA 3H11A 4I50A 4KRXA 3COZA 1QE3A 4NAUA 4R8VA 2VYVD 3TJMA 2CDAA 4O1IA 3UICA 1QCDA 5A7HA 3H5RA 3RBXA 5HUJA 2VCEA 2H18A 2Q45A 4TRJA 1L8AA 1AKYA 1XDUA 4BZXA 4UE3S 2V4ZA 2J4CA 4RVNA 2PIDA 2Y1KA 2AFRA 2FG6C 4IQ4A 4LQ4A 1SXQA 4JJ7A 4C08A 5BRAA 4D8WA 4BEBA 4YQEA 1DKMA 1OWPA 4AZSA 1K7FB 2J87A 4RCVA 5DKFA 3BAFA 4TXHA 3ZKAA 5LZ4A 1NJ6A 2BSAA 3F71A 2J48A 1PZXA 3IEPA 1RC1A 4D9FA 4ZVTA 4AJ1A 2ZJ8A 4F46A 1WD5A 3BGOS 4P3OA 2WRZA 1W94A 1GPBA 2HOQA 4GLLA 4Q47A 4ZOLF 3RBAA 4PN7A 1QYDA 3BYZA 3ZR4B 4P5DA 1JHQA 5D3MA 1F2UB 3ZDAA 2GPAA 4J07A 3O1HB 1VIMA 4B34A 1JZTA 1KH2A 2GB4A 2DFVA 3NDIA 1RKBA 3MCWA 4TN5A 4EYEA 3I12A 3OHMA 5I4CA 3RC8A 2PUAA 1SIOA 2FH5B 3L1VA 5DNAA 3KKQA 2IWHA 1NLFA 3QPWA 2GJSA 4Z9YA 4UZSA 4F06A 3QOFA 3QVTA 3E9CA 2DH6A 3N6XA 1X7WA 2J3JA 3AONB 2P7HA 4Q3NA 2GCNA 3HCPA 3N59A 4NOLA 5KHAA 4KTVE 3UA3A 3O8CA 4TZ6A 1UKVY 1UFKA 4LKOA 4ES6A 3KDPA 1NXVA 3PUYA 4BN0A 2VYNA 1KI9A 2WJIA 3LWDA 4IILA 4PC1A 4JT8A 4ZV9A 4ZCRA 3ELDA 4AQ7A 1QYIA 3GD5A 4MAAA 1XLTA 3ACCA 4Q9IA 1ZL0A 5BN4A 4BRUA 1KAEA 4I3FA 1E9DA 1HDIA 4DJTA 5CM2Z 1AMNA 1FJ2A 1ZK3A 4M9QA 4BNGA 1FRQA 3G2NA 5ENDA 4ODIA 3CVJA 1J2JA 1WXEA 1P9LA 1NN0A 5EYPA 5BR1A 3F3SA 4HDSA 1R8SA 1S2GA 1US8B 3K8YA 4NFSA 4V0ME 2Q1TA 4JK3A 3QWIA 2HUNA 5DSZA 2PV0A 2IYAA 3RKSA 5G53C 2W71A 3TEJA 1Y82A 4XGKA 3OIDA 4I55B 1U98A 2WF9A 3I6MA 4J1NA 2EWMA 4C2BA 4FZJA 1Q0TA 4GL2A 4M37A 5IM5A 1KWGA 2ZVDA 1EHCA 4WKOA 4L7VA 3ESCA 2C9BA 3I30X 4WN9A 2ATCA 4GO1A 3QVVA 4M0EA 3PXGA 3STTA 2UYCA 5EE3A 4C7KA 3N6VA 2PR7A 3REOA 4BWGA 2M1ZA 4ZT6A 3ZD9A 1XZJA 3ZDYB 1CY8A 4DNOA 3IOMA 3IKVA 2MSLA 1JW9B 5L3ZA 5LXTF 3ZTWA 4WW0A 4N40A 4AB1A 5FNVB 3S1LA 5BNFA 1CUWA 4RTRA 2PMCA 4GZLA 4IJUA 4TXNA 2PT7A 3LGAA 3OEHD 4ME6A 5AW3A 5K0JA 1Z8DA 4UAVA 2VK4A 3GI1A 5IUNC 1XCMA 4LZPA 3QELB 4NI5A 1ECGA 2Q0QA 3IDFA 4OHCA 3TQOA 5BV1A 1SCKA 2J41A 4MEBA 4ZAFA 4TX1A 2W2QA 2Q3FA 3IBTA 1G5QA 1F60A 3V2GA 1QQTA 3AV0B 2PQMA 1Q7TA 2D4AA 1R10A 2FSHA 2R5FA 3HXPA 4HYQA 4NZMA 4WFIA 3EX7C 3QVUA 4IV8A 3BXHA 1EE1A 2WW8A 1T5HX 5JNUA 3QBJA 2BSQA 3A26A 1UBTS 1GPJA 2W48A 3B3GA 4PG5A 3LX4A 3VR6A 1P81A 4OSEA 1K5PA 1PJ4A 4LJ4A 4G5GA 4GOOD 1OBHA 1RSZA 5D01A 4CMKA 1T9DA 3CIFA 3ZWMA 4HXFB 1PWEA 4WQMA 1EJ6A 1LD3A 1JG3A 1TZBA 4DLPA 5H9WA 1UJBA 3TRFA 3R8FA 1APBA 1IMOA 2IP4A 2JLCA 1U7WA 2HXGA 1NVWQ 1R6UA 4MJLA 2E87A 4Q19A 3VNQA 2IW1A 3ZLBA 5J4LA 1IPFA 5B3AA 1XHLA 2Y3IA 3DP7A 3FCOA 1VCHA 2OM6A 1JRLA 2ISCA 3BRWD 4K6CA 5D00A 4A5SA 2AFHE 2AQIA 2NZ8A 1BDIA 5EAIA 2DERA 1BJTA 2QTMA 2X8JB 1CY1A 4FQ8A 4R4JA 2XMSA 2GAIA 3IUEA 4ZQIA 2JF0A 2QYTA 1II8A 1I7NA 4DJFC 3GT4A 4F4FA 1VKHA 1N33B 1OFIA 2GLXA 3HKEA 3RUEA 3U19A 1OOEA 4E11A 3EXIA 1EMDA 1XNJA 1ICIA 3LG2A 4HI0E 3DAOA 4NBUA 2OTCA 1K6JA 3EGIA 3SKXA 1KSFX 1MHPA 1NKSA 3N07A 3PHHA 1OXTA 1R0SA 4CKEB 4NICA 4PLHA 3RC9A 1OYYA 2HT6A 3DM9B 4Q1VA 3L7CA 5FR2A 3AVYA 2GZHA 2RIPA 4G41A 4FJ0A 1S89A 2WFZA 4MPDA 4NDAA 3NHWA 4PYRA 3DV9A 1EK5A 1NX9A 2GESA 1GL6A 3O93A 4GYWA 4A73A 3UA4A 3MK31 2RCYA 3MJVA 4RKQA 2NZYA 1T9CA 4ISCA 4YJ2B 3FZGA 2P6RA 2XQVA 1ZHFA 4FN5A 4ND8A 5CH3A 4ZU6X 3DT8A 3QFHA 3GGCA 4HVTA 4QFBA 2R97A 4O2RA 1P29A 1MIOB 5H81A 2PRSA 1EFPA 1CY6A 2QIPA 1L8LA 4NFHA 2CKDA 2GT1A 4R01A 3ZVKA 3OEYA 1OZHA 1SOMA 2FW1A 1DRVA 3M4JA 2I22A 1E8DA 1N3BA 1UP4A 2JD2A 4HLCA 2FEWB 1OILA 3SMQA 2CXQA 2OCXA 1OLSA 1HZZC 3HHEA 4P92A 5KX5F 4YAWA 3K9BA 4ZAYA 2YXNA 1QHFA 4E1AA 1WSWA 2BGKA 5CX1B 3K0KA 1R3DA 1Q1BA 3OG9A 5LLTA 1GU7A 3WL6A 1W4ZA 2QG6A 2X22A 4TYQA 1NC1A 4Z9BA 1W0KA 3OIYA 2CXTA 1D6JA 3C8DA 4ZRDA 3VR1A 1SKAA 4CUKA 4BB9A 5HYVA 1I6WA 2QVXX 5DRTA 4BL5A 4AI6A 1YZ3A 3QWAA 1CVRA 2Y6VA 4LK3A 3V32A 4PXAA 3LQRA 3ONWA 2A9OA 1ZEMA 4OXYA 4Q39A 1Q83A 4PYIA 2FG7C 4Z54A 5IULC 2BMFA 4PE5B 2FZ5A 3Q8LA 1ZCZA 3IQXA 3SF8B 2W6JA 3U48A 4WK4B 3WGLA 1AUPA 2MTBA 4BFTA 5IWAB 1G3QA 5CLFA 5T3YA 1HQKA 1XDDA 1ECCA 4MHTA 4CLDA 2QV7A 1YUBA 2QW0X 5GMOA 1ZJWA 1J22A 4UCXA 4UTXA 2E82A 5ES4B 1JIJA 4A8HA 1RI5A 2V0CA 4MEJA 5LNK6 1ECBA 2GO1A 1XDZA 1VPVA 4PSKA 4WOPA 1DRUA 2I3AA 3P2MA 4N82A 4N4AA 2PD3A 1UOEA 5LZ8A 2C9DA 3NBUA 1Q20A 4TL9A 3K94A 1T8YA 3ISTA 4JY7A 4O2LA 1WCWA 2P68A 2ZWMA 4RD6A 4YB8A 4B3RB 3TQCA 3UHAA 4CCAA 1EYZA 1JYFA 1HX7A 4FYVA 2PQ2A 2FLWA 3QHPA 4NJMA 1EFRA 1GPH1 1I51A 1ZN8A 2P3QA 4MGKR 3T7KA 2G9UA 3VA7A 1W36D 4JGIA 5EMMA 2UXCB 1GAEO 2V1UA 4HYEA 2O0LA 3AF3A 3E1KA 4PPNA 4KZKA 1SCUA 2HXYA 2H7YA 2XCIA 5T57A 3NKFA 3TPFA 2Y67A 1K5DA 2D6FA 2W11A 3CA8A 3RSCA 3PFHA 3GELA 4IAOA 1JI0A 5CXSA 1PW5A 2CDCA 4K9QA 4KWCA 4L85A 5E8JA 1B00A 4PQYA 2IH5A 2OXTA 2C8JA 1N5KA 2OEPA 3MQFA 4Y2RA 2OUIA 3U9TA 2YDYA 5H3CA 1RPNA 3W04A 4QAQA 4KEAA 4MW2A 4X90A 3I4LA 3I2JA 1WV0A 1ZL2A 1Y8QB 1WVIA 2FWJA 4OQZA 5GP1A 4B17A 3AVXA 4KQWA 3BZWA 2JFUA 1BFUA 1TYZA 4Q7JB 2XQIA 4M21A 3DD5A 3G5AA 1L7XA 4NAHA 4BB5A 1Q0ZA 3E8XA 3B6JA 4BLSA 4U63A 1VP9A 1IDN1 4CEJB 5HF6A 2ZB2A 1VE3A 3SR4A 1XJCA 1XTBA 2G5TA 3ZHZA 3JD4A 3TLMA 4B3XA 4L78A 1AJEA 1AHHA 3R0IA 1HG0A 5HUQA 4K05A 1XGKA 5KOHA 2A78A 3BN3A 2C5LA 3GIDA 5T5QA 1C4OA 2G0TA 1P8AA 2ZI6A 3Q3JB 5CDSA 1FUUA 3LFUA 4A27A 2J3KA 2MYNA 5BRNA 3TK1A 1IDOA 1MGPA 2YN4A 2R1UA 2I67A 1N6RA 3O4GA 2JGFA 3RAFC 4B79A 2GTHA 2HPZA 1AA9A 2XY4A 2BM0A 3A6LA 3IOEA 1YB5A 2QRUA 3TDKA 3H42B 3CY6A 3MNFA 3MW8A 2HTEA 1NBOA 2XUKA 3SM3A 5AVUA 4ENUA 2AOWA 4Q9DA 4Z53A 2OVFA 4MRMA 5IBPA 1OA1A 4UTRA 3FBGA 2SECE 3DUFA 2WBLC 5HJ7A 3H4VA 2O2GA 2D74A 3FUXA 1T5OA 1GTRA 3PQ3A 3FRJA 2QMHA 1GZDA 5EHXA 2J3IA 3SGLA 3U3KA 1FW6A 4PZYA 1EGHA 2SHKA 2BWJA 2AE2A 2FI1A 3DGEC 3KYIB 4J7CA 1PT7A 1I1HA 3TOVA 4ZEVA 2A5FA 1ZIYA 4X3PA 4QM6A 1U7HA 1J23A 1LDEA 4G37A 1QZ3A 4YJKA 2HW8A 2IS6A 2R1TB 2X8AA 2P0EA 3E1SA 3MMSA 4UUAA 5KYYA 1CEYA 4TL6A 3OY7A 5LCXA 3FZEA 1A1VA 1PJLA 1C7EA 1J7JA 1L0BA 1N75A 2O8VA 2XAAA 4K87A 1N8KA 2QHXA 1SXJB 1KRHA 4PGFA 3RLFA 5AW0A 5DHSA 1K6IA 3V1LA 3HXLA 3Q1LA 1V7QA 3SOPA 2NWQA 3RROA 3T12A 1QONA 2FRDC 3GT3A 3GN1A 1L6IA 3AUFA 5TPZD 1RC8A 5A3VA 2KE5A 1WSAA 3MQ2A 2ZEJA 3P9YA 3EWAA 1H3NA 2YDXA 3KQMA 3DKPA 5AIAA 2BOVA 2OBXA 5JCOA 4ZVRA 5DN6D 3VMFA 4PWZA 4OP1A 2RGNA 4ZFNA 2P67A 3LWZA 2Q0HA 4UBJA 4ZYZA 1NQAO 4RADA 3HUTA 1M75A 4Z4QA 4L0MA 4WUTA 1MO2A 1ZOLA 1MJGA 4MR9A 5JFOA 1XZBA 3S0JA 5AESA 3GRYA 1A7UA 3ABQB 5F1YA 3WHIA 2B5WA 4F0JA 5C37A 4HJRA 3H1AA 3TN7A 1UKZA 3GDHA 3ZNPA 4YQFA 1RXWA 1VRWA 3D2BA 1OH5A 4E09A 4WLEA 1JA1A 4RD2A 1LJLA 3HEBA 1TAHA 121PA 1N2BA 4MARA 1WOYA 3BMOA 3OTGA 2Q1SA 5EQFA 1ZD5A 3CRQA 1G2IA 2QMZA 3QYPA 4DMUB 1U28A 2ZJ4A 5AXDA 5LN1A 1AZLA 4OQ4A 4Z3DA 3PNQA 4RXTA 5H4GA 1KAOA 1FFHA 3EXG2 3NNSA 4M7WA 2YMMA 3F67A 1B8PA 1LV8A 3ICOA 4BFUA 3K6RA 2NO7A 2O4UX 3HS3A 4YRJA 1U3WA 4C2TA 4JT4A 5JC1A 3UMVA 3EJWA 1IYZA 4FB4A 4OATA 3RV4A 4ENVA 5EKUA 2C5AA 4GLFA 1CY7A 2ET6A 3TCKA 1XTPA 4WXMA 3WIEA 3WLAA 2OHVA 2OAEA 2ZRLA 4BFZA 3BK1A 4EDHA 3BXPA 2OMEA 2VKQA 1BWSA 3W5BA 1SD1A 4YN3A 5E6UB 4ALMA 4Q4AA 3F74A 5AT1A 2CVQA 2WNSA 1IMJA 1Q3HA 4M98A 3CX4A 3V34A 4EY5A 4LV6A 1MABA 3GVPA 4RJKA 3HCCA 3HB7A 1W49A 1SZCA 3EAFA 2C4KA 4RHTA 4PLZA 4DKJA 3T3DA 1B16A 1Z5WA 4PIVA 2O2DA 3DEFA 2VNHA 3BULA 1LJ8A 2EWVA 1N6IA 3N0VA 4CV0A 2F8TA 2AZDA 4DY4A 1DWUA 3BB4A 2XYGA 3EAQA 1L1RA 2NU9A 4ZAWA 4A6XA 4YCSA 3VR2A 1VE5A 3TLKA 1U0JA 1NUQA 1Q91A 1O95D 2PBZA 3E58A 3KUUA 4IDEA 3EN0A 4OYRA 4UFOA 2V0GA 3Q72A 4BU0A 2VAMA 1PN3A 4BQRA 4R40A 3QX8A 1WHSA 1T9GR 1N8SA 1XZCA 3KVNA 3JVEA 3B3AA 2JCSA 3OKPA 2P4QA 1WCIB 5FAKA 1F7UA 4ABTA 3ZXXA 1TW2A 2BKEA 2VYCA 5TMBA 2XBUA 2AK2A 3T7EA 3RG8A 1ZH4A 4XPIB 1XDBA 3L1UA 2AB0A 3NBYC 3IBYA 4HK4A 5JSHA 5JY6A 3RU2A 2QXYA 3O03A 4KCGA 1PZFA 4PLPA 1JFVA 4XGNA 2PUDA 3F7TA 5CU7A 2YHIA 4ZU1X 1COZA 2QLNA 5E6SA 4BKOA 2HYDA 3MJSA 3BFKA 2LP4Y 2OD2A 4OK6A 4WNIA 4RJLA 3OE4A 1P4HA 1W9HA 1EDDA 3VO9A 1O4WA 4EO9A 3QLVC 4HZUB 1QIMA 4PG6A 3I83A 3RTDA 1FUKA 4K9OA 2ZYRA 4TV9A 1KQOA 1F17A 1ZITA 1RE1A 2W9XA 4MJXA 2ZIFA 5B6PA 4OXXA 5IS2A 1Z6QA 2GA9A 3OT5A 1D04A 1B3BA 4PAWA 3O3NB 4FWBA 4RD1A 4DLSA 1Z6TA 5KTNA 2G76A 1CBUA 1OT5A 1R6AA 1SU7A 1WSBA 1Z4LA 4OAPA 5KNBA 1SC6A 3W1EA 4D6PA 3WADA 1D3AA 4L9WA 4JBNA 2JJYA 5C5IA 3K71B 4N9QA 1HDYA 3BK7A 2DJIA 3ENZA 1ORIA 3PDIB 3PQDA 4NYMQ 5DDIP 5C7OO 5DLYA 1FX1A 3GLHB 4RVSA 3I2FA 3NETA 4B6SA 5TGTA 4W5QA 4HX5A 3KJZA 1OWOA 4H4EA 1LVGA 5C1OA 2C5SA 3FLAA 2XMQA 2WMDA 4JQZA 5M2QA 1EX6A 3ZIAA 2DQYA 3IQFA 3W06A 5I7HA 4U2GA 1LNQA 1BWRA 4FGUA 1X19A 4C7MA 1RHRA 2R5WA 1S1MA 3JZFA 1IJFA 3QVXA 4L76A 1JIUA 1JECA 3F49S 1BH6A 2CVHA 3OZWA 1P2VA 1XR3A 4NCIA 1IXRC 4BEJA 3FTFA 1G59A 2FSUA 3T38A 4JD5A 4L0DA 4RK4A 2Y1GA 1NPYA 3CZCA 3N2YA 4MW0A 4A6EA 3A6HA 5AHXA 6PFKA 5KU7A 3IQWA 5LQJA 1NG1A 1MX1A 3EY4A 4EA7A 1D6MA 3QU5A 3A0RB 4G0VA 4GPZA 2FHPA 4NLLA 2CXXA 4XWOA 1Y9EA 4JB0A 2HF2A 3QHAA 2A88A 2A2ZA 4G8JA 3VQTA 3LT1A 2IFTA 2C2MA 1TADA 3DB2A 3MRTA 1LGYA 2EFHB 4I9GA 5E0OA 1FSZA 3BIFA 4TRMA 2IHVA 4R1SA 1I4WA 2JANA 3JPWA 3C2QA 4XCXA 2I7XA 4L8FA 3F6BX 4JJFA 3UXEA 3WO1A 2R6FA 2AC4A 4L22A 3CEPB 3K4PA 2JHGA 4C4SA 3FOCA 4I46A 4G1MB 5AI5A 1NQXA 4B6PA 3NNDA 3PHBE 1SU4A 1F14A 2HEIA 4ENPA 5KTKA 2OV8A 4JC8A 2ADFA 2M1XA 3IDZA 3R6DA 3SF0A 1UPCA 4Y67A 4ZO9A 5AJTA 3Q5DA 4FFSA 4JQOA 4Y0AA 4D45A 2BEWB 2Y1WA 2O8CA 2XUAA 5B6JA 2ECPA 5H82A 4F60A 1IY9A 3D3WA 1JEQA 2H1IA 4HEA6 4N6NA 4P7KA 4KHZA 2ZREA 2GN0A 2B35A 4CNQA 1BU5A 3DMDA 4HMQA 4GGOA 5J2UB 3D7MA 5C2JB 2VF5X 2IYFA 2AF4C 4H7DA 4R2IA 4F7DA 4C3VA 1H2ZA 2NXEA 3LM8A 1MO6A 3VPGA 3N7TA 1S4QA 3GUZA 1N92A 2FEOA 2QDKA 4IH1A 1HL3A 2VP2A 3KUCA 3ZHUA 5K7SA 4TMWA 1KZ7B 3BB3A 2D5AA 3IAUA 4PW0A 4FZVA 5DASA 4ARVA 1VHTA 3ZLJA 2BELA 4N7MA 4KWHA 4BASA 1L4BA 5KNLA 2WVAA 3BIXA 3CN9A 1NZJA 2BEUB 3NHPA 3VOTA 1ZK1A 4ZI3A 2XWBF 1D6SA 3FFAA 4PG7A 5AJXA 2LBPA 3ZC3A 2O9JA 2CL6X 3QMVA 1H65A 2BFCB 4BNYA 3JRXA 2A6PA 2O1EA 3TW8B 3JWPA 2BGWA 3VHLB 1VI5A 2NZ2A 3LTNC 3S2FA 2UYOA 1GFZA 5LP6F 2AXQA 2H5IA 3L7KA 3FGOA 2G8NA 3KOXA 2QI9F 1A9YA 5A3SA 3UHFA 3S28A 2AXPA 2ZXUA 4E33A 2PKQO 2D62A 5CXQA 2DHDA 2W6ZA 3NM5A 5IMSA 1R8XA 1X70A 4IIJA 3JS5A 4U3JA 1FTNA 3DCIA 4Y2QA 3RS3A 1XZNA 1ZK4A 1I7SB 3GLRA 4XASA 1BVRA 5CIYA 3K6SA 3DR3A 3FJYA 2A5YB 3AF1A 3ZWYA 1PFYA 3V8PA 4L9SA 3EPHA 1WZEA 3KM0A 1LF5A 1XTSA 2QE7A 1UWVA 5FPHA 3RFTA 2H0RA 3LZ6A 2ZR0A 2ECQA 3OT4A 3ZCQA 4KBFA 7ADHA 1IHYA 1T35A 3U9LA 4EX7A 3QVGB 2CLCX 3RUFA 2XOEA 4PZUA 1W76A 5DNYB 5IN4A 4F9EA 1ZUNA 3PEWA 1QS0A 1OUMA 2ZVJA 5HP4A 1GJRA 4JI8B 4MMXB 4MLDA 2CUNA 2QV0A 2IBTA 3JQEA 2YZNA 3HSYA 4WKPA 3G9XA 3L0SA 1PD1A 5B1EA 4AF7A 5E0KB 1PJ3A 4P6VF 2OCDA 2YJTD 2OCBA 1ZRMA 2QA5A 2OQ2A 3W2EA 4NJEA 4J6EA 2JGEA 4UHBA 3C98A 1RAHA 1V8FA 3BGVA 1IONA 1PV2A 1QPZA 1XWFA 4C6HA 4YXWA 5CDGA 3O4JA 3NRJA 4JEUA 5D6OA 3V8MA 3ER8A 3RVSA 4P1ZA 1FS5A 1JEOA 4CIBA 4LHEA 4JUFA 2B4AA 1K4MA 1DUSA 3GEGA 1RR6A 3HCOA 1FNBA 4O4IF 2AEMA 2QZPA 3ROQA 3OQ1A 4JL5A 3SFVA 4A1FA 4N3NA 4Q1BA 3HU3A 3G85A 5JDIA 3CFYA 2X40A 4FVTA 2HPVA 1R50A 3QNMA 4DPLA 2OBYA 3PJDA 4OX9B 1KR5A 1T36A 2HMSA 1R5OA 1XRSB 4Q9AA 5F5XA 5C9ZA 1JHOA 2ZU6A 1KBOA 1S9HA 1MR3F 3CUWA 4ITVA 1JQJC 2C58A 2W98A 4WA7A 2X3UA 4JKIA 4HUQA 5BSUA 4PZPA 1EFCA 3IV6A 1WPRA 3KB1A 4DDMA 1O57A 5F76A 1SELA 3C4QA 3KOZA 3H1GA 3RC7A 4DMHA 3LUAA 4NL4H 4AG6A 4WESA 3GP5A 3HO1A 3DMHA 4QOIA 3ZDXB 1UK9A 2VBIA 3TUIC 3IE1A 2Q2VA 2CW5A 3AP1A 4MQUA 3NHBA 3TL2A 3DEKA 5A4DA 4YI3A 2I3DA 4YS6A 4XB1A 4RSHA 2QL5A 4MR7B 3BGSA 3U80A 2CXPA 4HNTA 3DZFA 5JAPA 1M6VA 4KXVA 4FTWA 5REQB 2X0EA 5A9TA 3M6VA 1BROA 4KJXA 3PLAE 4KO1S 4QTYA 4XKJA 4ZKDA 1N2SA 3DLPX 2KWIA 3GGSA 3L84A 3ORRA 4BX3A 3RV3A 4DV2B 1E9SA 1B15A 1YKGA 3TR6A 1M6WA 1T2UA 4C7OB 6ADHA 4AW9A 5MN5A 3JWGA 4KGVA 1OX6A 2B8TA 3TI7A 4CMEC 1BFKA 2RAFA 2ZSHA 4RWEA 5CVUA 1D7OA 4Y8VA 4UQLA 4FFOA 4JI2B 1UBSB 3M6LA 1QGAA 2IH4A 2KM1A 2E55A 4QPJC 1NBAA 3JQBC 3JQ7A 1RYZA 1L3BA 1MAAA 1MB9A 5EXDA 4CMBA 1QOQB 5A4AA 1OZAA 5KWJA 1QP7A 3O2QB 4QXOA 3WY9A 1E92A 3KBBA 2K2QB 4CU2A 4LXTA 4UJ3A 2IEAA 5IYZF 5D87A 4KPUA 4ARSA 3MT0A 5LYYA 4HNRA 3I9NA 4CU5A 3L1JA 4QUAA 5FLEX 2DLDA 2JIOA 2WHQA 2XRYA 4J76A 4KQKA 3MJHA 3HDTA 5TJ9A 2MHCA 1Y9DA 4LBWA 4ZZ2A 4A0SA 4J49A 1IZYA 4EA6A 3QE0A 3K2BA 2PX5A 1FPMA 3H99A 3NT5A 2O3SA 1F20A 4KV9A 1IZZA 1MPXA 3CR8A 3T5MA 2JGLA 1ZK0A 1ORWA 3M9XA 2O20A 5DWDA 3L0PA 3ZCXA 4J4HA 1VIDA 3E4CA 4KQEA 4XE5A 1WXDA 3AM1A 1DQYA 1RZVA 4HGYA 4DL9A 4HGQA 2P3LA 4OM8A 3MS7A 4XRRA 3JVIA 2QAGC 2C9ZA 3JAWA 4I5EA 1BU8A 4E2YA 1E98A 1JSZA 5C5EA 1LWNA 1YFKA 2YV4A 1NZFA 2IHTA 4ALJA 3B1WA 1QORA 4BTVA 4G0YA 3ST7A 1ULHA 4G6ZA 3GDWA 3UT5A 4ZYWA 3DVRX 2GD6A 2BM9A 2XUGA 3IULA 1EXNA 2GWRA 4XOIA 1Z45A 2W6PA 2YCBA 2XOXA 4CM4A 4D81A 5K6AC 2ZUTA 2HZBA 4KVFA 4AN1A 2PTGA 1M7GA 2R6HA 4CLRA 1X7GA 2NTEA 4NXMB 4HT3B 4MW4A 3H1PA 3LNTA 5FWNA 1O6FA 3UB4A 2Q7DA 2Q3LA 3RJMA 2H17A 1M9NA 2J5QA 3ZCUA 5HF5A 3AJRA 4J0HA 3KQNA 4C7JA 2VDOB 4LE2A 2FSVC 3NV9A 5E3JA 1YZLA 4W5RA 3NHAA 4QHTA 4BIMA 1XN4A 4L07A 2ZROA 3TX2A 1R4AA 2HDWA 4OLHA 1D9XA 1NONA 3H83A 4U2EA 5JNVA 3UO8B 4CKBB 1TK3A 2Q9AA 1DADA 4ID3A 4DKXA 3WJ2A 3GBSA 4B09A 3R4CA 1DKRA 1R12A 1Z88A 4WNYA 3EDMA 5D85A 4U2BA 1NVKA 3VYWA 1UAYA 4B3DA 2EKBA 1XA4A 5HVNA 2G9QA 2FFQA 1YACA 2GEUA 2V5UA 4Q7EA 4K6GA 5JZMA 2YY5A 3EFOA 1AF4A 1Y1PA 4GMKA 1N4DA 2OCKA 2EP5A 3SSAA 3UB2A 4DM3A 2PU5A 3H3JA 2DYKA 2IC5A 2YYSA 4P7JA 4BAUA 4OJNA 1P2SA 3NALA 1CC1S 1KZ1A 2D5LA 2IHJA 2OBMA 5DXFA 2FUG6 3OEEA 3OD1A 2BIFA 2CD9A 4PPYA 4ZARA 5AIBA 1NQ5A 3LA6A 4JLNA 3RS2A 2VTEA 2A92A 3HPQA 3HZRA 3TQRA 4FFVA 3IP1A 4I4TF 1K3FA 3DDSA 4RQBA 3AR8A 1SVNA 1Q6YA 4DIDA 4F85A 5C1PA 4NEGA 2GM3A 3KJFA 5AJVB 4ZVPA 2VHXA 4UMFA 1OFGA 2FW9A 2WICA 2WIFA 3Q2OA 1XMOB 1G8FA 2E89A 3N0XA 1QTIA 3RIMA 3ZV5A 1FFDA 1SO8A 2SKEA 5JHGB 2Z6QA 1V4NA 1ZD3A 5T4HA 1U3GA 1NW5A 3ODGA 2KS6A 1GUYA 4JC4A 4F04A 4ZK2A 2YX1A 2CMHA 1YS9A 1DP4A 2HDHA 3HYRA 1Y81A 1NM5C 4M9RA 4S1TA 1YJQA 2FUEA 1T4CB 1WNTA 3LUFA 1L4FA 3QLUA 4G8BA 4Q24A 4UVEA 4ZVKA 4C06A 4E5UA 2R1VA 3BRWA 4YJ3A 2P8SA 2VRBA 4ZICA 1DQNA 1OBVA 3F5MA 1TKCA 5HGXA 1WY5A 1EJ2A 2PPLA 2ATIA 2RBGA 5FWYB 5IK2D 2IXGA 2N47A 2XE8A 3KCNA 1Z4PX 4GX2A 3V1UA 1T9AA 2D4HA 2XTJA 4ZVQA 1LX7A 1PTKA 4GXTA 5K3FB 4DIKA 1CNFA 5E38A 2V7QA 4B9EA 1HT3A 1NATA 2QLBA 3RSGA 3SD7A 1MB4A 4XJTA 1DC8A 3AZQA 2BGLA 1CJCA 4BFWA 1HFJA 5KVAA 1U99A 2GAAA 3A27A 4GAEA 3W79A 5JI3E 4WBNA 1W35A 5H3HA 2B9VA 1LDYA 4XZ3A 3SQLA 1M2HA 3OHPA 1QG6A 2WM2A 2ZR9A 3L49A 4ZA2A 2G09A 3ABRB 1EVIA 3AEKB 1EUDA 1XEXA 3H0EA 2QRHA 3KSDO 4KWIA 2XTMA 5JSZA 4MPTA 2X8WA 2WT9A 4R1PA 5FTMA 4LSZA 1CUAA 3B2EA 1QO0A 3NYRA 1NTOA 3NT4A 2VTDA 3GUUA 3LOPA 3T9BA 1JEJA 1JAXA 3EMVA 2VQ6A 4Q1AA 4BS9A 1J1UA 3RLIA 3CZMA 3AI3A 3IAS6 4LRTB 5LKAA 1VLZA 1DO0A 3RF7A 2C96A 4YACA 3R7FA 2RBEA 2VHUA 1H2YA 3DC2A 3RD5A 1TTPB 4OU4A 4Q05A 1QMPA 3B5JA 3RVBA 1U1GA 2IE0A 1EZ4A 4RHUA 4DT1B 2VHZA 4KVZA 2AEFA 4MWZA 4JQSA 2ZT8A 1CUBA 1JHDA 1MIHA 3QUTA 4F12A 5CFPA 5IVKA 2IGBA 1EBBA 3VZPA 1BHQ1 3R0ZA 4PYQA 1E3IA 4FDLA 1JHMA 1WSDA 1I24A 4KIWA 3X1ZA 2O50A 4KIUA 1PJBA 5LDDC 5K4HA 5ERYA 2QU7A 5DCYA 4IMRA 3T4UA 3FZNA 3X2EA 3K31A 1YIDA 1Z8HA 3C3YA 4UQOA 2QL9A 3U7JA 4QUEA 5DULA 1I32A 1YE8A 3K0BA 4GX0A 4UFNA 2D1TA 1SBCA 2AWNA 5HILA 4IGAA 1J49A 3QVJA 4IIEA 4P22A 5FI3A 3GBVA 5EE9A 1Z3CA 1Q14A 2Z1DA 2PKWA 3EXEA 1Y80A 1F3OA 1X2EA 2AOTB 4OHBA 4RESA 4B4VA 3M9LA 3QKSA 1JEAA 1XXHA 4BN4A 4FHGA 2YZ2A 4HGNA 5A71A 2A94A 3ICPA 4XAQA 3AV3A 4QRHA 3ZX5A 2IDJA 2E7ZA 1BHO1 3DHYA 3M6UA 3PCRB 4UM8B 4B35A 2QRPA 1NW3A 3NHYA 4XD7D 5P21A 4O4JA 3FCAA 4LOHA 5YASA 4E4RA 3J80A 1I36A 1Z6YA 4W9NA 4A8JA 2ZJOA 1FYXA 1RXSA 1FZQA 4PZZA 4TKUB 4LYJA 2LWIA 3SIWA 3ESRA 4AK9A 4KBYA 3TRHA 2II6A 4YY3B 4OJYA 4AP5A 3EQ9A 4MS4A 1ZOSA 1M33A 2JAXA 1CG6A 2ZITA 3WMGA 5I7VA 2ANBA 4AKTA 4AXBA 1RQPA 4QLBA 2GGSA 5AKHA 5DGCA 3OCZA 4EBFA 5HX7A 4QYXA 2CK3D 2DMRA 4KODA 5ALSA 3IEXA 3BA6A 3VTZA 3IBCA 3LPNA 1V5FA 4AUNA 3N70A 3UFXA 1Y8AA 1R5JA 1Q3TA 1GTG1 2RJ3A 4FQ5A 1RAFA 3BAZA 4TTRA 1X9GA 3C3DA 4F38A 1FS6A 3L02A 3IC5A 4KX5A 4DA0A 1PZMA 3P9IA 4DVJA 2JARA 5GWXA 3CNNA 4OB6A 3FNHA 3E03A 3UUFA 2OCAA 3VC2A 3A9CA 5B3JC 4HLQB 3KC2A 4RZ3A 4WJZA 5A06A 2GVNA 2EFJA 2AX4A 2R7AA 4L6IA 3NQ41 4O59O 4WIAA 3AR9A 1ZN9A 1AMOA 1ULZA 2WAOA 1D6NA 2WPDD 1WUYA 2Q4TA 3ND6A 3PL1A 1DG9A 2YXLA 1ZVKA 5DHUA 1SB9A 1TVKB 2QN7A 2AN1A 5IMBA 4YPOA 4BVFA 1UT5A 4RY2A 5EJ2A 1B23P 1IEWA 1NGSA 3PXDA 1DMSA 3KYJB 2DF8A 2XT9A 2I2WA 3P9CA 3W6UA 3CLKA 1C2YA 1Y3IA 2H65A 2NVWA 1K4YA 5K0CA 5JQWA 2W5UA 4NX2A 5DFAA 5A62A 4EENA 5CFZA 4XX1A 4H27A 4IJWA 2LCQA 1TMGE 4AN0A 1ISSA 2AYYA 3LY9A 2VHTA 4PHTA 4OHWA 1ISHA 3AKCA 5FFNA 5H80A 2NP7A 4II7A 3V48A 1G0OA 1SCAA 2VUTA 2ZBRA 3ZCRA 221PA 1WPQA 1FLDA 1JI3A 1FP4A 2FQYA 1UKBA 3AHCA 4H18A 4C5BA 2V97A 3AF2A 3AYZB 1LBQA 1IBCA 1NR7A 3L6OO 4IJKA 4DXHA 4GMFA 2VO1A 5ALVA 3F0TA 4UU0A 1C3JA 3UWDA 1CJBA 4UD2A 4D4IA 3CLRC 1OX4B 1R7RA 1XG5A 4DS3A 1PLJA 4EHAA 2LKDA 4X9XA 3BWEA 5AVVA 3FYUA 1XQVA 1KSJA 4OGGA 3HA2A 1J9EA 1VCNA 2AG8A 2IYOA 5AW9A 3QVOA 4HQFA 1SVMA 1EZ1A 1QKJA 5CYOA 1GWNA 3CF0A 1M2OA 2JBWA 1PWHA 1JHYA 1KEVA 3IUQA 4E5VA 1G42A 1SN7A 3HI6A 4ON9A 2NU8A 3VVMA 4KNYA 2AOVA 1KS9A 5IFKA 1U5BA 3LUDA 2XQFA 1LBTA 3OTHA 4HYTA 1KR2A 3IBFA 5TPZA 4W8OA 1U2EA 3N0RA 1CF2O 3KQKA 1PZEA 3D3NA 1GPYA 3MTIA 4H7HA 4S35A 1I7DA 5AKJA 6AT1A 2DSTA 1A77A 1Q0HA 4G0PA 4N3BA 4FSXA 4YMGA 3IKTA 1U2RA 1AN9A 2A3RA 4TYMA 5CRIA 2WJJA 3VSEA 1U2GC 3MRSA 4K6FA 1LZLA 3RT1A 1TM4E 2J85A 1GN9A 1G7CA 1U94A 4CG3A 2TMGA 3IT1A 3B38A 4Z2YA 3O82A 3WG9A 1ZZEA 2XJ9A 3TLGB 2GD0A 2XUDA 2B1JA 2FPIB 4OH1A 5HE8A 3BL6A 1CUZA 4DV5B 3EPJA 5K0ZA 2JGMA 2V7EA 1BNCA 3L82B 1TUBA 4WOJA 2JLRA 2XUJA 2V7VA 1V8OA 1DDGA 3DNPA 4D9HA 3CLUD 2IRWA 4EEZA 2NUBA 4JT9A 1HBJA 2IP2A 3UJ7A 1L5HB 5JPDA 5K05A 5JE8A 4TRRA 1WUJS 2HCBA 3DB1A 5ECWA 1V9CA 1M5UA 2OQIA 2UUAB 1S2IA 1JL3A 4P7BA 3DJYA 4HRXA 1SWWA 2RGBA 3I0NA 2WZCA 4KVGA 4CF3A 1R74A 2PLAA 2X1LA 1K4KA 1DIHA 3DVSX 3P97A 5CNKA 2CV2A 3DDZX 4H1VA 1UXJA 1B7GO 3T5AA 2W8ZA 4WCFC 4WK2B 2CLOB 4P4LA 5EHGA 3ZXYA 3QE3A 5ETJA 5AVQA 1AS0A 2G83A 2ZIEA 4PCVA 3V46A 2C31A 4A8JC 4UOEA 5L7TA 3VHXB 2UKDA 2VQEB 4PCUA 4AUMA 2XGSA 2JS7A 2J3HA 3UMSA 3DAPA 1W5BA 4S24A 4BUJA 4BMPB 1H4SA 4EHFA 1OFTA 1FU4A 1XVIA 2Q2OA 4UMEA 3EHEA 4YAEA 1PLKA 2HJWA 5DHRA 3O3OB 1QHHB 3H5NA 1UFOA 1U2TA 2GCOB 3DR5A 1VL2A 3I4FA 4JFAA 4EUSA 3H3XA 3GGPA 3A4VA 4ZVVA 4OUDA 4A91A 2X9VA 5KPDA 1P4AA 5BNIA 2PX8A 1QAMA 3KT3A 3HGQA 2EJCA 3P5SA 4YROA 2W6MA 1BW9B 3EVGA 3LMKA 3I5UA 3PICA 4WADA 4WMLA 4BKPA 3O9ZA 1F2UA 4GM4A 4CLOB 4DMLA 3QTBA 2C1ZA 3C8HA 2C9YA 3ZQJA 5JMTA 1DOAA 1ZIXA 3HVUA 5AK3A 5FRDA 4LYAA 4JSTA 5EWJB 1LPPA 4HGOA 1VHWA 3UFBA 4BLPA 1DT5A 1EZZA 3RFFA 3OIUA 3KLBA 4M60A 1WXFA 5IZCC 3E8SA 3QV2A 2L42A 2PA0A 2PX2A 4D3SA 5JSUA 1JHZA 5KJ1A 4RLSA 3GJ6A 4FGWA 4FMCB 3M3HA 4A0GA 1VSBA 3GLGA 1X0XA 3JD0A 1DCMA 4H0FA 1E2PA 5CVDA 1QGDA 1C30A 4JLDA 1KFKB 4IZOA 4U7HA 4X0EA 1V3TA 3AM4A 5IJAA 4KSYA 5EZQA 3PGA1 1LV7A 3ADKA 2F1KA 3QY0A 3WBJA 2FEAA 5LJLA 4OA8A 1ODCA 3C4JA 3HA3A 4LJKA 1A9QA 2BFEB 2WU4A 1IC6A 3G17A 3QLTA 4E4YA 5JZOA 3MEQA 1ECLA 3M83A 1V25A 1BTOA 1LW7A 3D5QA 3O92A 4JENA 4S2UA 4UAJA 2ZUSA 4QPZA 1YVEI 5I7FA 3OT1B 2IIVA 2I78A 3RS5A 3ZWAA 3CPJB 3NOQA 3S6JA 2EARA 5KKCA 2XDYA 1B6SA 4W1SA 4WHMA 3OLQA 2OBBA 4MMZB 3OX3A 4BQOA 4ZC1A 1X87A 2QB5A 1DCKA 5HJ5A 1JLRA 1IE3A 4IXTA 3WWPA 4E32A 1O7JA 4LW8A 4X7PA 1E79A 3KXLA 4G0QA 1WHTB 1XJ0A 1ZRHA 3QITA 1EUYA 2GDZA 1DBIA 1Q2UA 3JQPA 3NU1A 4C4YA 1ZC3A 1XV5A 3E9DA 1Z13A 3KR2A 4FPXA 3C3JA 1UC5B 3TD6A 3QFCA 4Z86A 1PSDA 3I92A 4NHOA 4A16A 4ESHA 2HT1A 4IFBA 1WW3A 2SBTA 4JBGA 4WAUA 2HLDA 1PJZA 3W5HA 1Y33E 4KMRA 2ISSD 2AQ8A 1DS6A 4P33A 4ZZ1A 3KU1A 4GXNA 4MWOA 2O2YA 3CW2A 3EIHA 1QC5B 3OHSX 4C0XA 2N75A 3RRYA 2ZYWX 3RG2A 2V6MA 2PUEA 3B6IA 2ZRDA 3HK2A 2GEVA 3GFRA 2WJHA 4K86A 4B80A 2PJUA 3C1TA 1FRNA 3HCNA 3IUBA 1TKAA 3K0CA 2CFIA 4FC7A 1N2JA 2KBEA 4XIYA 3UMJA 3WLPA 4UZEA 4CQMD 2B4KA 5LQNA 3BHNA 5DNUA 4Q3OA 4PZEA 5CIQA 4JXKA 4U7WA 1LDNA 4FLMA 1O94D 3P2KA 3N8IA 4BNTA 4BV8A 2GFQA 2YUTA 1NAHA 3LBAA 1W0CA 2K87A 4QOFA 3FFXA 1KI6B 5KJ6A 1VSQA 3A9UA 3CZPA 3EZYA 2ODWA 1U9CA 1YZVA 1E5VA 2EFEB 3OF5A 2WYVA 4MP6A 4MRNA 5ARDA 4R0VA 3LY8A 4EW3A 1W25A 4C88A 2ACEA 1UFVA 1IBMB 4UCFA 1JR6A 2FUKA 2E4ZA 2ZRMA 5P8WA 4RAQA 4O4LA 1NURA 3N2GB 1Z47A 4RUKA 1M76A 2PUJA 3UANA 4E1VA 3V8BA 5LL6P 3FI0A 1NF8A 4N65A 4DNXA 2OGTA 3LFTA 3B70A 4GMGA 2PFSA 3ZTYA 2F64A 2R44A 2ZUEA 2IY8A 4ZYUA 3O90A 5J5AA 3DBLA 3FVVA 2IYVA 1PR2A 1Y1TA 4HWRA 4Y2UA 5LBIA 2A9KA 3KKKA 4QNNA 5JIBA 3EC7A 2YJ4A 1F38A 4WNCA 5H3LA 5IASA 2GM4A 3SQXA 1AS2A 3D6AA 4JAVC 1YA6A 5HS6A 3EFBA 3IJPA 2OOKA 3RAEC 1KDRA 3KOOA 3ZDFA 4ZXPA 1C5KA 1E8NA 5HBRA 5JH7F 1VLLA 2Q9CA 4DANA 3L8HA 4RYDA 1O6BA 3HUDA 1QIHA 1RWWA 4HNQA 1JEEA 2XUHA 5D1NA 4Y3UA 4KYIB 1JV2B 1KORA 2NX2A 3EVBA 3PX2A 1GG9A 4N7JA 4EKYA 1JB9A 1R6XA 1G21B 4GR9A 4OY3A 1F3LA 1KK1A 2GK7A 5JPIA 4YJ2A 2I1VB 4KO4S 4E5PA 3L05A 5EIWA 3T9EA 5FTJA 4EBBA 4ZHQA 1XZQA 2YS6A 1ILWA 1SY7A 4X97A 3Q8WA 3V7WA 4PSDA 1RKVA 3UEOA 1WKVA 4A3SA 3EWSA 1MIOA 3S8MA 3TIXB 2PZJA 1K8ZB 4JXZA 2E5FA 3TW6A 3VHRA 4BMSA 1K3TA 2V9PA 2ZZKA 5EJGA 4EY3A 4Y1EA 3IXLA 4EFLA 3AVWA 4HWKA 1F8FA 5FKJA 5EFOA 4ZOCA 4B6EA 4C5AA 1AKMA 5L3QB 4W6QA 5DBEX 1UM8A 5F3RA 5G0TA 1G8AA 2X42A 3AEUB 3W8EA 1DGQA 2VPPA 2CWWA 1DJQA 2G72A 1MB0A 4OQPA 3DMTA 4X8OA 5CX1A 3L18A 5EMLA 3UW1A 4YMHA 1FBNA 1P31A 1RVDA 4P7FA 2WJVA 5DF1A 3AJAA 3K9WA 3PDWA 1PEDA 3B3FA 4UDXX 3A3PA 4ND6A 4E22A 5K3SA 1KZHA 3EVAA 3CUTA 5F3DA 1JPVA 1Q21A 5TX7A 3CRMA 5E9JA 4RVHA 3AR6A 1VHDA 3OCVA 5CVJA 4BXOB 3S81A 4G26A 4OB8A 3G8YA 3I8SA 1GV1A 1OD6A 2DPXA 4WACA 2E49A 3T5PA 2DETA 4GKVA 4PR3A 1M8GA 1W9MA 1YI1A 2R65A 3AFNA 4UEWA 3REGA 1G9TA 1Y48E 1T5TA 3EGDA 3HADA 1Z9BA 1DBRA 3ITKA 3PNOA 4J1TC 4ND3A 4R2XA 4XR4A 3ZUGA 3FPKA 4F45A 3DLHA 1CJSA 1W7AA 1NVEA 4E2ZA 4E6PA 1I0IA 5E3IA 1T4MA 1RXUA 5IDQA 2M9MA 2WVJA 3ELBA 3IP9A 4RZIA 4NYMR 2JLZA 4B71A 4E88A 5CFRA 2R11A 4CG1A 1JKFA 4C29A 4RMGA 4EGCB 3AKYA 4NFLA 3RK1A 1B0PA 1DPGA 1E2DA 1EX1A 1OXBB 1TF5A 2XUPA 3DJFA 3EQ8A 1XB2A 3IUPA 4LDRA 5EA2A 3RYFB 4WBNF 4JYBA 3HV2A 3BD7A 1Z08A 1RBMA 2IIQA 1JR3E 1K8XB 3SEAA 1WB6A 3NR2A 2PO5A 4JLUA 1DBWA 2GUWA 4ZOAA 2NU7B 5KYWB 4KGZA 1H4TA 2JFQA 2X6TA 2NYAA 5TPWA 4D0RA 2ZIXA 3D8UA 3A14A 5KOYA 4ZO7A 2X0RA 2XOKD 3ZTTA 1UKEA 1AXEA 3GAZA 5BYBA 3TX6A 5FI0B 1OWMA 5I9LA 1H05A 2BDUA 5AI0A 3RNOA 5AKEA 1C80A 1PL6A 1J39A 3ZHTA 3AOEC 5CDTA 4D97A 4J03A 2QQEA 1ISIA 3FCXA 3PJFA 4O4HA 3ZJUA 3I6IA 1Z22A 2HAEA 1Q15A 3H1BA 5AO9A 4BZWA 1NN5A 1M74A 3T1QA 1G5RA 2CLIB 5EJ5A 4HGZA 1Y8QA 4V2IA 3UCEA 4MS1A 1R5NA 2XA1A 3OLWA 5EZSA 5AQ1A 3ANLA 5JD4A 4KAJA 1AKUA 4ZT5A 1J97A 2F3QA 1Q95A 2R4UA 4NAVA 1JBEA 4G8DA 1ZHOA 3NJ8A 4ZTBA 1YK0A 2HY7A 1XRRA 4X20B 4WLOA 1NW6A 5JOQA 3AYXB 5EGNA 2CMDA 1OAKA 1TPZA 1ZJ6A 5AXBA 2RDMA 4ZEMA 5JJBA 1NVXQ 4QTUB 1RS0A 2IY9A 1IIBA 1KO1A 1LWOA 2QTHA 5ALNA 4CKZA 4XYMA 1BGWA