4BLVA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylmethionine (adomet)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
280
structure length
280
Chain Sequence
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
total genus 101
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blvA00
2ZLBA 5EZQA 5HZMA 4HSGA 5EZSA 5EC8A 5FQOA 3BXOA 3M4XA 4RTSA 4RYLA 5K05A 3NVMB 1X19A 3LHDA 4XUCA 3AY0A 3P2IA 4RTNA 3UFBA 2GB4A 5E1BA 5HEKA 1KPGA 2O07A 4E70A 1NW8A 2B3TA 2AS0A 2DULA 2AN3A 2YX1A 4GOND 4QDJA 2JG3A 1KIAA 2CMHA 4CKCA 5DX1A 1NW6A 3M6XA 1EG2A 4FR0A 4EKIA 1I4WA 4ER7A 5K8VA 3TKYA 3UJ7A 3MCZA 3UJ8A 1ZG3A 2ORED 2WK1A 1M6EX 3HA3A 2GPYA 2VS1A 4RVDA 5CVDA 2QE6A 5DT2A 5ICFA 4L7VA 1FBNA 3CBGA 5FWAA 3MTIA 1R8XA 5DRTA 2XVAA 2Y1XA 2NYUA 5GOZA 3T0IA 1NBHA 4HTFA 5DM1A 1EJ0A 3DTNA 3JWGA 3SXJA 5FQNA 2P1DA 1P39A 3DXZA 5DM4A 4A6DA 5LQCA 3I58A 3C6MA 4M36A 3FPFA 3KQWA 4R6XA 4KDRA 3G2MA 3A26A 1KP9A 3G2OA 4OX9Y 2BZGA 2FK8A 2JJQA 2NXJA 3V8VA 3QV2A 2Q41A 3GRRA 1KXZA 2AN4A 2HNKA 1AQIA 3DULA 3ELYA 4HGYA 4WXHA 4YUYA 3K6RA 3FUUA 3SX0A 3R3HA 3T7SA 3OE5A 4C06A 3TQSA 3M33A 1NW3A 5FHRA 4HH4A 4F85A 4F86A 2AOTB 2PV0A 4HRAA 5M5BA 1NT2A 1RI3A 4NECA 4WVLA 5IKMA 5KQRA 4RTOA 3LBFA 5LQRA 3NW9A 5KVAA 4C03A 3PX3A 4BLWA 4CKBA 5LQJA 5EMKA 3LBYA 2I9KA 5DM0A 2FHPA 3BKXA 2AVDA 4PYKA 3KQPA 4PIPA 4AX8A 5DXJA 4U7PB 1U2ZA 1XDUA 4PYQA 4BP1A 4DMGA 2ZBQA 5JUWA 2C7QA 3HTXA 5ICCA 5EKUA 2H00A 1M0EA 4PCAA 2O06A 1WY7A 1X1BA 4DA4A 2ONZA 3V97A 3OZSA 3P2KA 4KIGA 2CKDA 4OQDA 4QVKA 2ZCJA 4GC9A 4RVGA 1NW5A 3OCJA 4GOMD 2ZW9A 5DXAA 1SVUA 5K0BA 3HA5A 5HFJA 3BGDA 3F4KA 5KQSA 3FTEA 3A25A 1VIDA 1XDSA 2ZWAA 4FP9A 2AOWA 5DWQA 1VLMA 3KHKA 3UA4A 1SQFA 5ICGA 3JWHA 2ZBPA 3PFGA 1G8SA 3E7PA 2JH9A 2NP7A 4FGZA 3S68A 2BM9A 1NBIA 1Y8CA 2EG5A 4QTTB 1X1AA 2ZIFA 5DX0A 4YV2A 1L3IA 2ZTHA 3BWBA 4YMGA 1IXKA 1H1DA 2PX5A 4X61A 1JG3A 5E1OA 5LQNA 3TM4A 4RTJA 3PTAA 4C07A 3TKAA 1RI2A 2P3LA 9MHTA 3LECA 1UWVA 2P40A 1AV6A 1FJXA 4XUDA 3EGIA 4DM3A 2PY6A 4PYOA 3HCCA 4RX1A 5EOVA 3WSTA 2HMYB 4R8SA 3VYWA 3OU7A 3G8BA 2AOUA 5E9JA 3KQMA 1AF7A 2YTZA 3BT7A 3CJTA 2AZTA 3HCAA 3LL7A 4F84A 3UJ6A 3EVCA 3P9IA 5FTWA 3IV6A 4R8RA 4RTMA 3GXOA 3I53A 3FRIA 3R24A 4QDKA 4C08A 3KQTA 2LD4A 4OBXA 2ZSUA 1RI5A 2PT6A 4POOA 2ZZMA 1RJEA 4FSXA 2P41A 3NDIA 3BZBA 1ZHFA 1SKMA 3EVBA 3IYLW 3UZUA 4CTKA 5FUBA 2Z6AA 4E2XA 1ZGAA 3KR0A 3GNLA 3FZGA 4MWZA 5U4XA 4K6MA 5GIPE 2CMGA 3I5UA 5DM2A 1NW7A 3G89A 5EHIA 1RI1A 3VSEA 4FT4A 4YV0A 5KS2A 3ER8A 3FUWA 3DXXA 5EIFA 3LDFA 2NP6A 1AQJA 3GRYA 3K0BA 4MQ4A 5LQKA 2N47A 5CCBA 4AZVA 2PX2A 2PXXA 4XUEA 4E2YA 2FK7A 3KR2A 4GC5A 3NVKI 5K0NA 3X0DA 1EIZA 5EHGA 3FPHA 5CVVA 1D2CA 1JSXA 1YB2A 3VC2A 5K0EA 3FTFA 3FYDA 4GF5A 1QAOA 3KPYA 3LCCA 1R8YA 4XCXA 1SUSA 3C6KA 3DMHA 4MIKA 4ER5A 3PX2A 1HMYA 5CVEA 4PYMA 3KU1A 2VDUE 4P58A 2B9EA 3LCUA 5DX8A 1ZQ9A 1SG9A 1TW3A 4YUWA 4LECA 2PKWA 1BKYA 3B7PA 5ICEA 3LDGA 2ZULA 3H2BA 7MHTA 1MHTA 4DQ0A 1XXLA 5E1MA 4OBWA 1XCLA 2GH1A 4YUVA 2PLWA 1QZZA 3LDUA 3M6VA 3PVCA 3MQ2A 4PCLA 3OU6A 5ERGB 4QPPA 5E8JA 4AUKA 5K0JA 1MJFA 5CCXA 2EJTA 2H1RA 3TOSA 5LQUA 3CJRA 2B78A 4KIFA 1L1EA 3DOUA 5G02A 5HIMA 5T67A 3HCFA 3FUTA 2GLUA 5JR3A 4X1OA 1FP1D 3REOA 3G7UA 1VP3A 4DKJA 3P2EA 1INLA 1WXWA 3CVOA 1JG1A 3OZTA 2F8LA 2PXAA 5K03A 5D1HA 2ZWVA 3C3YA 2R3SA 3EVFA 1N2XA 3MERA 4ATNA 4EMSA 1P1CA 5BW4A 3HM2A 2PVCA 1D2HA 2G8NA 3KKZA 2QM3A 1DL5A 2B2CA 4GUAA 3DMFA 5EMMA 4YUZA 2VDWA 2YQZA 1WXXA 4Y2HA 5EIWA 1B42A 3SM3A 2PGXA 1RJDA 2GA9A 1KYZA 1T43A 2P8JA 3BWYA 5E1DA 2ZBRA 2CWWA 4PGGA 5DTRA 3EVEA 3NMUF 2IH5A 3M6UA 4GOOD 2QRVA 4HTFB 1DUSA 1DCTA 2V7EA 1KHHA 3GWZA 5K01A 5CIYA 3PT9A 3GIWA 2IGTA 2H11A 4RTQA 2G1PA 3ERCA 3KQOA 1X1DA 2PSSA 3NWEA 3JWIA 5EMJA 4YMHA 3TFWA 3TMAA 4AZSA 1D2GA 1R6AA 3EPPA 5K0GA 3MTEA 1YFJA 4E30A 1O9GA 3BKWA 1PJZA 3SR4A 1XVAA 1L3BA 2JHCA 5FA5A 4ZTBA 1G8AA 2PX4A 3R6TA 4CXMA 3HCBA 3B5IA 3EVDA 2B25A 2NXNA 1VP9A 3O31A 3UJ9A 1VQ1A 5K0FA 5E2BA 3BGIA 3HCEA 4U7TB 4MHTA 4EQZA 2FPOA 4FZVA 3A7EA 2HTEA 4IKPA 3AXSA 3Q7EA 4PYJA 1G38A 2NXEA 4R6WA 2BR5A 2JHPA 5DSXA 3R9XB 3GU3A 3CGGA 1IM8A 2K4MA 5K0LA 3O4FA 2BM8A 2FCAA 3EMBA 3FPGA 3OU2A 3M6WA 4H0NA 1PRYA 2EFJA 3EEOA 1YZHA 1QANA 5IH3A 4E2WA 1FP2A 2PWYA 3OFKA 4AZWA 4GOLD 2XBMA 1RI4A 3OZRA 4BP3A 4M37A 4HG2A 3RIEA 4RTKA 4P7GA 4QQNA 5E9QA 1ORIA 2ZFUA 3B3JA 4E33A 3UWPA 1JR4A 1KPHA 2ERCA 2QRVB 1WS6A 3HCDA 5F2OA 2Y1WA 1VE3A 1Q0TA 4FSDA 3FYCA 5EVJA 5FA8A 3UBTA 1M6YA 3CCFA 4KWCA 5B1SA 4MTLA 10MHA 2OYRA 2HWKA 4CWAA 3BWCA 3EEYA 3DLCA 3FUXA 1XJ5A 1G55A 3RODA 5EGSA 4E32A 3MHTA 4QTUB 2XYRA 5HIJA 2UYHA 2I62A 1KPIA 5GM2A 2P7HA 3DMGA 3TLJA 4RTRA 2HR1A 2AOTA 2YXDA 4HC4A 1JQDA 4V0RA 4AZTA 2UYOA 1BC5A 1YZ3A 3ELWA 1YFLA 4P7KA 4ER3A 3Q87B 2G71A 4R05A 1KYWA 2ZZKA 5C1IA 3I64A 5E8RA 5BP7A 4PONA 2IDJA 3BGVA 1F3LA 3GDHA 3HA7A 1JG2A 5DLYA 2PJDA 3THRA 3BUSA 5DTMA 3B3FA 2XYQA 5CM2Z 5HIIA 3PS9A 4C04A 1VPTA 4G56A 2BR3A 4LWOA 1P91A 5HILA 4E2ZA 4ER0A 2ZIGA 2OY0A 5H02A 2IPXA 5K0CA 1NE2A 2KW5A 2YUIA 1N7IA 3DR5A 4HGZA 1O9HA 5FULA 3T7TA 4GBED 3ER9A 2ADMA 4PINA 2AOUB 1YUBA 2QY6A 2HV9A 3TM5A 5C9ZA 3D2LA 2AOVA 2G70A 2WA1A 3LSTA 3FPJA 3GGDA 1L3CA 3G8AA 5HIKA 3OPNA 2Z6UA 3MCTA 3L8DA 3HEMA 1UFKA 2IIPA 2PT9A 3AJDA 3HVHA 4JXJA 4QVGA 3JWJA 2AR0A 4BLUA 3NDJA 1L9KA 4P7JA 5KYGA 1WG8A 2O57A 2C7PA 1RJFA 3IHTA 4EK9A 2XYVA 3I9FA 5GINE 2I7CA 1FPQA 2P7IA 1G60A 4RWZA 5EKXA 3SSNA 1R00A 4PYIA 1IY9A 3PLAE 2OB2A 4ER6A 4X60A 2YR0A 5FADA 3G5TA 2A14A 3UJAA 2IBTA 3KQQA 3KPJA 3P71T 3KQVA 2UYQA 2OXTA 3LPMA 4V0QA 5CUQA 3DLIA 1Q0SA 5C0OE 1XDZA 3IEIA 3LKZA 3O7WA 5CVUA 5EEGA 2NXCA 4DZRA 3E05A 8MHTA 1SUIA 5CD1A 3KQSA 3EVAA 5DRYA 1Z3CA 2AOXA 3E23A 5FWDA 5FHQA 3GRVA 4RSRA 2WA2A 2OB1A 2UZ4A 5DPMA 4RVHA 1V39A 2R6ZA 2FYTA 4RTLA 3C3PA 3LX6A 1JTFA 3MB5A 3LGAA 3LCVB 3R0QA 2EX4A 3A4TA 4OA8A 1ZGJA 5FCDA 4KW7A 5K09A 3CC8A 3NJRA 3KQYA 4PWYA 5EEHA 2CL5A 3U81A 4PIMA 4Y30A 3UA3A 3HP7A 3ID6C 5LSAA 5P8WA 3A7DA 3GCZA 3GRUA 4KVZA 3TR6A 2P3OA 1JQEA 1SQGA 3HNRA 2XVMA 4CKEA 2P3QA 2GAFA 2O05A 1ORHA 3E8SA 3NTVA 4DCMA 3P9CA 5F2KA 2OO3A 3HVIA 1NV8A 5T64A 4B17A 4C05A 2C7OA 3CKKA 3DUWA 3FPEA 3SSMA 3MGGA 1RJGA 2VZ9A 4RTPA 3UJDA 2EJUA 3A27A 3FTDA 3DP7A 3EGEA 4PYLA 2C7RA 1QAMA 3SMQA 1VL5A 1BOOA 2BR4A 2P35A 3DH0A 1QYRA 1R74A 3AWIA 3LKDA 4OA5A 5DSTA 1ZKDA 5E2AA 2QYOA 4UOEA 2PXCA 3FUVA 3VC1A 3C0KA 3EMDA 3P9KA 2OKCA 5E9WA 3QOXA 3BWMA 3ORHA 5EG5A 4EVIA 4A6EA 3B3GA 3FRHA 5GP1A 2IP2A 3GO4A 3OFJA 4RV9A 3TRKA 5F2NA 2VDVE 2YVLA 3P9NA 4CTJA 4PYNA 4EKGA 1EAMA 3RW9A 3P97A 5LQAA 2Z6QA 1I9GA 1UIRA 3B89A 3HVKA 3EVZA 3THSA 5EPEA 1HNNA 2V74B 3ELUA 4OQEA 1EQAA 3KR1A 2E5WA 2OBFA 3GRZA 3PB3A 4LG1A 2IFTA 5EMLA 1TPYA 3P8ZA 4C4AA 4YUXA 3G88A 4FT2A 2PX8A 2DPMA 4QQKA 3AXTA 2UYCA 1XCJA 5LR6A 2O0LA 3KR9A 3SVZA 1JTEA 2AVNA 4O29A 4QPNA 2VP3A 2YXLA 3KPVA 4FS8A 5T6BA 4LWPA 3G5LA 5HOQA 4M38A 3GJYA 2I6GA 4IV8A 1N7JA 1WZNA 1O54A 3T7RA 4ISCA 2FRXA 4IV0A 5BXYA 1JSZA 4E31A 3FTCA 3CJQA 2ONYA 1JQ3A 2ZIEA 2OPBA 2ESRA 5MHTA 4Z2YA 1EJ6A 4M7RA 1QAQA 2NNWB 3UJCA 3SSOA 3KPUA 3TPZA 3ME5A 4DCGA 3HVJA 1G6Q1 1NKVA 3ANXA 4PNEA 3NWBA 1X1CA 4BLVA 2IDKA 2PWPA 2GS9A 2BH2A 2JH8A 1OR8A 5GIOE 5DTQA 4KRGA 5GWXA 2PBFA 3KPWA 4P7FA 2JHAA 3OE4A 5EQJB 1YF3A 1KR5A 2IBSA 2ZZNA 3M70A 1JG4A 3UJBA 3EGVA 4PGHA 4X63A 3MAGA 2YXEA 1I1NA 3ELDA 3G2QA 4YV1A 4BY9E 1R18A 4IWNA 4X41A 5GM1A 4GEKA 5CVJA 1P1BA 3G2PA 1NV9A 1VBFA 3EVGA 3PFHA 3SGLA 5BW5A 2IH4A 2ZVJA 3DXYA 1F38A 4DF3A 2IH2A 2AN5A 2G72A 1XTPA 1BHJA 4GQBA 2OZVA 4KDCA 5D1NA 3QOWA 1TW2A 4RVFA
chains in the Genus database with same CATH superfamily
3SZGA 2AYXA 1GEEA 2Z2KA 1NJ1A 4HSGA 1Y4SA 3IXMA 1AXGA 2SKEA 2YHAA 4BN4A 3PXXA 2F3QA 4MWEA 3L05A 1RWXA 1X42A 3P2IA 3RVMA 1PNRA 1DTSA 4RLHA 3H4IA 1RQXA 4KK3A 3VDNB 2YHIA 4GLBA 1AURA 2W2KB 4Y2TA 4CMKA 3F46A 4V38A 2B3TA 3U09A 2NUAA 5EIBD 5F52A 1QHIA 4WOCA 3ZGXA 2QN6A 3AFGA 4TYYA 4W5NA 1EP1B 4P4SB 3F71A 4W7SA 4MINA 4H7PA 1TEXA 1V8DA 1ODLA 3A36A 4WEQA 4E12A 3TKYA 3V4FA 2PMFA 3KE8A 3LQYA 4OM8A 1RAIA 2UZ0A 4AKIA 5AVRA 1CP2A 4IIUA 2HW8A 1XHLA 3OQJA 4FB5A 4F8JA 1R4AA 1JHOA 2HHJA 1ZJWA 4J94A 2FX3A 2GAIA 1PEDA 3EXIA 3R6WA 3NGMA 4L4RA 4TXJA 5EAIA 1FQJA 3DOJA 2BGWA 4D25A 5DM4A 1DV2A 5EXXA 3R9IA 5IU6A 2ZS7A 2QY9A 1DG3A 4NKRA 2H7VA 5EFZA 2Q4BA 4ZVNA 2P6MA 1KQOA 4GICA 4IHJF 1G1AA 4MP3A 1IDOA 3REGA 4CEJB 1LX6A 2A9QA 4YB8A 4JLKA 5SY4A 3GFRA 4CL2A 4IH9A 1TLLA 2R8XA 3KHUA 2VA9A 3B12A 2WKPA 1ZC4A 5HFAA 3A3NA 2A7XA 3ZU3A 5AQ1A 2Z5LA 3R20A 1Y7PA 2JLCA 1VZ3A 3DCJA 1X14A 1NL3A 4X3CA 2RGBA 2XTAA 1DJQA 3KYCB 2BI4A 1P1HA 4FNOA 3BSFA 4EG6A 3LUDA 5FWXA 1E2MA 3NOQA 4Q0MA 2FMKA 4O8ZA 2IY7A 5BSFA 4RH3A 5JV5A 4KLNA 4CMHA 1HDZA 2DUJA 3EZFA 1T0HB 2QL7A 4LK2A 2UZ1A 3W8RA 2AD1A 2ON6A 4L7QA 3GFFA 4PIPA 2ZRFA 5J2UF 1XZHA 4HY3A 1XRMA 1CUGA 1YBVA 3WJ7A 5DHAA 2H00A 1KJWA 2ZRPA 2FSVC 3IE2A 3JYPA 3AGPA 1E2QA 1DRKA 2O06A 4BNNA 2IPMA 4D0SA 4D0NA 1HKUA 1F4PA 4N39A 4YMTA 4MR9B 5FLYA 1JP7A 2OUIA 3S1SA 2FUNB 2P9EA 4S1PA 4AP9A 5BR8B 4WTOA 1A8SA 5HP4A 4JKIA 2OENG 4MYHA 3MRTA 4RKEA 2YNMD 3QKUA 3DO8A 1WP9A 5IJ9A 1NVEA 2R6FA 3IB6A 3BMOA 1WEHA 4KI7A 2JVIA 1JHRA 3F9CA 1RADA 4FP9A 3TUIC 3EDQA 4ZKDA 4DSTA 2PFKA 1YQEA 3L6RA 3VBCA 5LYJF 2HMVA 1P18A 2C9DA 4JGBA 1LBEA 1XP8A 4KKXB 4OYLA 1K68A 3HDGA 3OUZA 4R69A 4OFWA 4P80A 5KQGA 5L51A 3UMMA 4TX1A 2CW5A 4BVBA 2D5AA 1EZ4A 4A26A 3VVBA 1GPLA 3GNTA 1N8TA 4IRXA 1X1SA 1CY7A 4X90A 3RVLA 4O2AF 4XVQA 2WILA 4CI0B 2P3LA 1YK1A 5JC8A 1NDQA 1GGEA 1M8PA 3CS3A 1A8PA 3LECA 4QJIA 4PVDA 1SOUA 2CFCA 3ILVA 3O26A 5JH7B 3HCCA 3RAPR 4GHWA 4R8SA 3KEGA 5F5XA 2P2LA 1FU4A 2YFQA 1DE0A 3D6NB 1A77A 3DHYA 3KQMA 1VTKA 4OM7A 4RIEA 3T3HA 3U31A 5FBVB 4LRTB 5AHXA 2D2FA 2R65A 3HCAA 1GPKA 4BE4A 2FDXA 1E2UA 1CFJA 2H5JA 5CH3A 1IBMB 1LRLA 1CY0A 3I53A 4L2IB 1PV2A 2ORIA 3E48A 3KQTA 4OQMA 4V0OA 1RI5A 6Q21A 2PSJA 2Q5HA 3MD9A 4BFLA 3OZIA 1EFRD 1SKMA 1D2RA 2OBLA 3PD0A 4RFLA 1USVA 3UZUA 1XZBA 1ZUIA 3PJRA 3GNLA 3PC6A 1OU4A 2B83A 2ZSAA 1P1JA 3ABRB 5ALKA 5I8PA 4EG4A 4MVJG 4MV1A 4DUYB 4RCYA 4OI4A 1E5XA 4IMPA 4LHSA 2AC4A 3L6CA 2QJWA 3GR6A 2R6GA 3A58B 3L0OA 3ZD7A 3OP1A 3BMQA 1AS3A 4L1KA 1ZN2A 1Z83A 3A3PA 2GNAA 1ORTA 1E5VA 1EBUA 1ZK4A 2I2XB 1J09A 3DTVA 3RQIA 4LJYA 5CVVA 3PPWA 5AUQA 2QX9A 1JSXA 3SQDA 1JBKA 3TD6A 4BV8A 1IN7A 3HWRA 4L5IA 3DFMA 4KPGA 3IUNA 5KYUB 4EI2A 2IP1A 5FUMA 4KUEA 2FTKE 1BE8A 3OQBA 4JIMA 2W6JA 4RXTA 1FRFS 3RKUA 1FFHA 1ZCAA 5EZYF 4C0JA 2ZQ5A 4TLCA 2HMUA 3PC3A 4YDRA 1TPZA 2RAUA 2CDAA 3OUUA 4EG0A 2XKAA 3ZXUB 4YCMA 2QZ9A 2AUMA 3CLTC 1DT3A 3KEMA 3PVCA 4LE0A 4WOPA 2SHKA 1QB7A 4YCJA 2FEAA 4AURA 1DEKA 4JOCA 3SFZA 5IAOA 3FWZA 2R1ZA 1T1RA 4MRMB 3AUAA 3UMGA 1NT4A 2F59A 1G5FA 1FLDA 1GUZA 1TZMA 2JEYA 4UVEA 5TB5A 1FP1D 3V7YA 4D8YA 3NJ8A 1VP3A 3HDHA 3EH2A 3F4BA 5KQLA 1FUYB 3DTTA 4CQMB 3TTWA 1SIWA 5LLSA 3UXEA 1ZKMA 4JLDA 5JNWA 4OQPA 4C4RA 3WSWA 3M5CA 2O0HA 4IMIB 4E11A 1U2SA 3TGLA 3ZHBA 2KHZA 3D6AA 4HLCA 5IJAA 3ZCSA 3TR5A 2XSZA 3HCNA 1Q91A 3R5JA 5F9HA 1QLHA 3ORFA 2WWIA 5DBHX 1QJCA 1GCOA 4ZANA 5LNK1 2VHWA 1DBQA 1KKLA 4HB4A 2LPMA 1II8A 3OETA 1EYZA 1ES9A 3CUTA 1USWA 3JQBC 3KWFA 3VJRA 3OMLA 4UD6A 2IH5A 3QLEA 4DEYA 1ZD5A 4P53A 3VGJA 2EW2A 3FH0A 3GIWA 2DUWA 4TKLA 3ZDDA 3M3HA 2IEYA 3SBDA 2OV6A 2H92A 4YMHA 3I73A 1W85B 1THTA 4YRTA 1Z6QA 3K9QO 3T5MA 5CX1B 2WBLC 2XXJA 3D0QA 1NP7A 5JRDS 1H3NA 1M6HA 2NVWA 3EFHA 4CBVA 1XMJA 4TV9A 4WAUA 1HDIA 4ND8A 3GVIA 3ESDA 2G36A 2AFHA 4JOSA 4TT8A 5DTEA 4D92A 4E5YA 4F3TA 5JS2A 2VA8A 3UJ9A 2VJMB 4UBNA 2A35A 1L5GB 1ULZA 4RFSA 4UOZA 3R7WB 4XWAA 2P9ZA 4O4LA 3RS5A 2FWBA 4KN5A 3IUEA 3HCEA 3F49S 1ZD2P 1V11A 3ZIDA 2F8MA 4QHYA 1FSZA 4ZQIA 5EE9A 4CM4A 4HNTA 4DV7B 4FMCB 1V35A 3FHOA 3RE1A 4AF6A 4B3CA 5L6LB 3R9XB 1ICIA 3LNTA 1W2HA 1X7YA 4GVXA 4DARA 2WTUA 5I9BA 1O2DA 1Q19A 1GCIA 1GTZA 1Z0JA 5L3QB 2DBQA 1E3IA 1UWLA 3JARB 4H0NA 3EEOA 5HCNA 1SHJA 1K5DA 3ZLUA 3QEOA 3GMIA 1KMIY 1RI4A 4GOLD 4AKHA 1PR4A 1HLFA 4GBGA 4WWHA 5H7XA 1X9GA 5IWCA 4E15A 3DEHA 4KN9S 2P11A 2Z5GA 3I9MA 1FYDA 4MS4B 1THGA 4G1FA 3ACBA 4NR0A 4LDZA 1ZJ5A 1ODKA 5HUQA 2J3QA 3WRYC 2I9PA 1NXTA 3IERA 4D97A 2VN8A 3VGPA 4GPD1 4Q05A 2ZETA 2NZJA 3V1TC 3SC2B 4LF7B 3AM3A 4MQEB 3MHTA 2AIRA 1NVUQ 2D1RA 2LZ0A 2ZUSA 3CWCA 3DEIA 3KTDA 1XA4A 4DS3A 4NCBA 3Q3CA 1DFGA 1YQGA 4YRZA 2P90A 3FHJA 2HQBA 2GXSA 4C0QC 4V0RA 2DEUA 3WWPA 1XFAA 2QE7D 2V9CA 1ATIA 1GDDA 2PFGA 2QX4A 3I4CA 1YDMA 4AT1A 2ZSEA 1EM8A 1Z2DA 3GLRA 5C5DA 2CK3A 1F1JA 1K88A 1QH1B 3UB2A 1G20E 2QMZA 4EELA 1LQ2A 3PQ3A 4F1JA 3GDHA 2BRUC 2BKVA 4YHBA 4AJNA 3H8WA 2I3AA 3BFJA 4K88A 4QTYA 3LYLA 1GPNA 3QSYA 4G56A 3OM0A 3D3WB 4PG7A 4WECA 3C6YA 1N5RA 2BDTA 3Q88A 1NE2A 1J8DA 3W6PA 5K09A 3WBFA 3DKIA 4C4ZA 3GUHA 3KZCA 4W1RA 5EMNA 3IBYA 3TTXA 1V8ZA 5B57C 3FVQA 1ZNYA 1WCXA 2F1HA 3M1YA 1W1IA 3N87A 1E3SA 1SXQA 2BSAA 3KB1A 1OH5A 1DIAA 3TB4A 3GGDA 1YFKA 2JI6A 2C2WA 3I32A 5FUVA 5T57A 3WL4A 3U44A 2B1QA 3S8YA 2NQ8A 2PNFA 1ZY2A 2G17A 3BHIA 4G09A 2E0IA 2QUAA 4KSYA 1UFRA 4TRMA 2JKVA 4WXRA 3EF0A 2XE6A 3OCUA 1L9KA 4HDAA 1IC6A 1W35A 5KYGA 2WP0A 3PQ7A 4IEEA 3GAFA 3ZWPA 1U0EA 3L5KA 2FU5C 4GPBA 1KDYA 2OXIA 3CURA 1X8LA 3AB8A 1P80A 1CUCA 2OCLA 4UW9A 5CW1A 3VXKA 4EMUA 4ERNA 3GLFA 2ZM5A 3B48A 1Y8QB 3OZUA 5T4EA 3RU2A 4IQ4A 3GA0A 3O83A 4JGIA 5C35A 4TWAA 3ZDZB 1PNQA 2VG8A 2RHGB 2CNWD 2I8CA 2UYQA 2VHQA 3OIVA 4K9QA 4O2LA 5DI9A 2OXTA 3I1FA 5C0OE 1NBWB 13PKA 1Z8HA 3B20A 4G41A 3EXHB 5AKXA 2VJOA 1PWXA 5AKGA 4V0SA 4G1MB 4DZRA 3R8FA 1VE6A 1LSUA 4U8GA 4BX2A 1F06A 3T5GA 4QGFA 5DRYA 1DCKA 1NQVA 2DFVA 1V5FA 3I39X 3LPLA 1L7AA 4REQB 1NJ8A 3HHPA 5G4KB 3E15A 2RHBA 3NKVA 4L4YA 2Y4NA 3UGTA 4UAUA 1V39A 2FZKA 1TO2E 3F7TA 2YICA 4KQKA 2D13A 5B1HA 4EHFA 1JDBC 3MB5A 2Q45A 4MP6A 2G67A 4DY6A 1QFZA 4J3FA 5AOAA 1OX4B 1Z13A 3A4TA 2GAOA 3HBNA 1SVOA 2D06A 4MRPA 3ZZ1A 3NJRA 3ZE6A 4MI1A 1NMEA 4Y30A 1RBMA 3OZDA 2DH5A 2Z1MA 3QEMA 2V6IA 3EIEA 3BB4A 4QA9A 2FX2A 4B3MB 1ZVKA 1YBFA 4KYVA 3FHTA 3NBMA 2BBOA 4UU8A 1KNQA 5AJWA 1GT6A 4OGWA 3IURA 3TL2A 1GWNA 1U1EA 5HZGA 4C0XA 1HSOA 4XOIA 3WGNA 1U2DC 1E4OA 3LKDA 5LZ2A 4M9CA 2PXCA 3FUVA 2H2GA 5ESXA 3U4MA 1NXWA 1NVMB 3KOZA 4QUJA 3X1ZA 2A30A 4QNNA 4MQ5A 5I9LA 2XNSA 3BS4A 1G7RA 4DIMA 3DFIA 4GLOA 1LKZA 3UUGA 5GVSA 1IBRA 4PCUA 4RF3A 3DE7X 4IIFA 4EVRA 1GLVA 1QC5A 2YYSA 5DIZA 2WJHA 1Y6ZA 1W4ZA 3B8EA 5HRAA 2HO4A 3P97A 1I9GA 1JLSA 2QEQA 5AW4A 3NBXX 1SIBE 1S3SA 3KBBA 5AJHA 1U2GA 1BGWA 1I7QB 4B3BA 2GM4A 5LA6F 2C4KA 2RGUA 1KE2A 1N2CA 5DGIA 3WKCA 3KT3A 4LOLA 5D86A 4K2HA 3T5CA 3KAJA 1RPTA 3B1XA 5DN9A 3HSYA 4FT2A 1B3BA 3F6CA 3FMIA 4XPIA 4DV3B 1QGZA 4URFA 4O4JA 4IXTA 1TB4A 2JKZA 2PT5A 2EG9A 5T6BA 3AJ9A 5CDSA 1JXMA 1SKUA 1PFUA 1WZNA 2D1FA 2ETVA 3FNGA 1K8RA 1JSZA 3H9JA 4N4AA 4U7DA 4QGBA 2I4NA 1M34B 5E4YA 1HT1E 1K98A 2NZWA 2B9VA 2OPBA 2HRDA 2PMBA 3RRFA 2YMPA 3VU3A 4F91B 16PKA 4PGAA 5JSQA 1C1DB 4W1PA 3STHA 3PDCA 2X8LA 1P6UA 1L4MA 1DARA 4PRYA 5CCDA 3SQOA 5JSZB 4P3YA 4RGBA 1RYZA 2W00A 2C04A 3GBSA 1PFYA 2PMWB 4EJSC 3GFPA 3LQ2A 4XM2A 4IHAA 1X86B 4ND2A 2VSNA 5C5IA 5DTQA 2C7GA 2VAVA 4HXFB 2Z8XA 4J0GA 5GIOE 3KOWA 4BMNA 4Y6OA 1U0TA 4LISA 3QVKA 2X5NA 1NYLA 2ZSIA 2HPVA 1HH4A 1O95A 2HQRA 4NZPA 5KCMA 2PQ0A 2CK3D 3TNJA 5JCZA 2GK4A 3N2EA 5ESDA 3PUXA 2GD0A 4ZCPA 1K6MA 5F1PA 4CM8A 521PA 5AXDA 4KXWA 2QAGA 3CE6A 1T1GA 3KRTA 1V4NA 1F1BA 5THXA 1U98A 1XTPA 1E2LA 2PL5A 1LRKA 2QIOA 1FUKA 1O0SA 2XMQA 1N78A 3MHPA 5EIBC 3WB9A 4EOGA 1EWYA 3L8GA 1KRHA 4QEKA 5HKKD 4LCJA 2DFNA 3ENZA 2IOFK 2Q6VA 4JT8A 3RADC 1NXPA 1NRXA 2CBZA 2PQ2A 1YZUA 4ZVLA 2ZYAA 2PUGA 3ZS9A 3B70A 4V24A 1KOLA 3IEVA 2VUSA 3LL4A 4DDTA 1E2EA 4X3PA 2JG3A 1NYTA 1IK6A 1KIAA 1PWYE 2CMHA 3CNBA 3GEDA 3Q3HA 1Q11A 4BFXA 5LQMA 1QPZA 1VCHA 2E4XA 4ZCSA 4CCYA 4CLHA 4HN9A 5C46F 3VJKA 3SC3A 1I4WA 3X1KA 4DPKA 1E7YA 5DEIA 2JFPA 2W2LD 3NIGB 3F98A 4ZEMA 4INOA 1EM6A 3F90A 4BJ1A 3IAHA 3NDRA 5CVDA 3OZEA 5THQA 2ZSBA 2XUDA 5FWAA 4QTXA 4D44A 4Q3EA 1BU8A 1YC2A 4MK4A 1CR4A 1LXCA 3QXGA 3VTFA 5CLJA 2WDZA 1OPRA 2KWIA 5GJWC 3E81A 3FNFA 1ZMXA 3KKLA 5HRUA 3JQQA 3HUEA 2P1DA 5DBFA 3SR3A 1SU8A 4Y6QA 1E2KA 2XE4A 3AEKB 1HBJA 4ZYZA 3F7OA 2FA9A 3NHBA 4FMCF 2VDNB 2Y8EA 1LDYA 1TM4E 3JD3A 2H1WA 3FPFA 3QEKA 1E1MA 2F1KA 4P33A 5CH8A 5BQPA 3A26A 3FWNA 5F3DA 1SY7A 3TSAA 4O4IA 2JHFA 3KYBA 4FZRA 5A6VA 5K3OA 1CQPA 3T9EA 4ENRA 2VPYA 2HLDD 3IEKA 1ORDA 3LYHA 5KVVA 2FW1A 2C97A 1N2SA 3N0RA 3O4RA 5JE8A 4LXHA 3RJZA 3MJEA 5FOQA 3JSXA 3OWOA 3Q5DA 3QFTA 1PS8A 4JUFA 3QVGB 1EINA 4M1KA 2W6MA 4JLBA 4YLEA 2UUCB 1E9FA 2O3RA 1NQAO 3O3OB 4YAUA 2CDRA 2I9KA 2GEJA 1QCZA 1RTKA 1T5DX 3SSAA 4LTNA 4AX8A 2YV4A 3F3YA 2PUHA 3QHAA 1RVDA 2MJLA 4L95C 5HF6A 4EW3A 5ILOA 1DXQA 3IIMA 2BFAA 3C7KA 4I5EA 3UC5A 2MHCA 1OROA 3JQAA 1M0EA 3LSYA 4MH0R 2BC9A 1QNFA 4OGFA 5FLEX 2ONZA 4FQ7A 1GAWA 3ROEA 3WKAA 1W0JD 5C5EA 3O8LA 3ISJA 5KWIA 4Z3OA 3TLBA 4P83A 3GN2A 2OLKA 1WPRA 1Y34E 2C61A 2R4QA 1OX6A 3H5AA 4FGUA 5HFJA 3WY9A 1RC8A 3L6OO 3FTEA 2XGSA 3E53A 1DBRA 1H1LB 1XDSA 2EX0A 3U3KA 4DEXA 5CBPB 4C30A 4EVQA 4A36A 1F0NA 4X91A 3W4KA 2BCGY 2ZAGA 1T5LA 1Z62A 5JAQA 4L0DA 3KYIB 2AV6A 3T7DA 1SVKA 2NX2A 4HEA6 4M3NA 3R9KA 3W2FA 2CY0A 3BQNB 4ZYWA 1V96A 2HCRA 3ZWYA 1NVVQ 1KI8A 1JMKC 2RG7A 3UJ3X 3WFIA 4GYWA 4QUAA 2O5CA 3NUZA 1ZA1A 3KO8A 3NFRA 1M5TA 4JBNA 3HDJA 2ZEJA 3TAXA 3IQZA 1L7BA 2YYAA 3AY6A 1MPTA 4HPWA 4L4XA 1DEHA 5JFGA 2XYPA 4XUDA 3HU1A 3E84A 4PYOA 2D7CA 3HU2A 4R1MA 7GPBA 2IEDA 1RCFA 1W1WA 2JEZA 3NBZC 4KB5A 2GUWA 2UVPB 1LZLA 4TM7A 3AETB 4GP9A 1HDYA 5BQ3A 1YT5A 3GXBA 2GF9A 3FYUA 3RYFB 3UJ6A 3WO0A 3A1SA 3H11B 3ABQB 1L7NA 1TA9A 4RTMA 4EPTA 3JQ9A 2BP7A 2QTVB 4F5WA 3NHMA 4G5RA 4NJEB 3QOFA 4RVNA 3LGXA 1PE0A 1LVUA 2JEOA 2HF9A 3RKSA 4D4GA 1NLUA 4PGFA 4I99A 2IU3A 3A9UA 4W7HA 4X6UA 1N2OA 1ZGAA 4OU5A 4ETWA 1YQ9A 4BVHA 4DPMA 2ES4A 3WC4A 1GKLA 1B0PA 3IOEA 3P0FA 1UXOA 1UODA 3HDVA 3D1LA 4M89A 3VSEA 3EWSA 1OZAA 1U3UA 3KFVA 1ULSA 3L8HA 1N6RA 1IHOA 3Q5EA 1P0PA 2PWAA 5FI5A 4KLZA 2OHXA 3ILSA 3SNKA 2CXOA 3ST7A 3VV2A 1XTTA 3D8UA 2PXXA 4XUEA 2C4WA 2NUTB 1C3JA 4U9HS 2EFHB 4RK1A 4IGFA 4E03A 1E1CA 1VBKA 1YTUA 3WGTA 2D59A 1R7RA 1FJHA 5EGNA 1QH8A 4R1NA 1XAGA 1ZMRA 4PY2A 3U49A 2ZUVA 1J1IA 4XB6B 1SUSA 3V3KA 2FDRA 2W6ID 3GT4A 1GHTA 2CXNA 2X22A 3EGXB 2H16A 2I4LA 2ANCA 3PITA 5CVEA 3SCZA 2PZBA 3ODPA 2HB6A 4J0IA 1JG6A 1Y5MA 5F9MA 1P4JA 3CLUC 1PFWA 2IWHA 1N0IA 1P75A 1BKYA 4DB2A 2PU5A 1A4XA 1W93A 4OHBA 5LLTA 4TN1A 3QPAA 1C9EA 1SCDA 2GCOB 4PHGA 1PJ3A 1XZEA 3QVTA 1DI0A 3BREA 1U8AA 1S8OA 4NYMR 3UFXB 1XCLA 1XCGB 4LGCA 1VLHA 1H6DA 2H1LA 1A4RA 2QRGA 3FNQA 4PTZA 2A3NA 1TJYA 2AN1A 4QAJA 3SF8A 5CCXA 5C7LO 2H1RA 1QQ7A 2OV8A 5HQTA 2Z98A 1MRSA 4RPLA 3FZYA 4A9AA 4QC2A 4HAXA 1UBLS 3FOWA 1DHRA 1EX9A 5F12A 5K1ZA 5JAZA 4EG8A 1OZFA 1G59A 1RYEA 3K8OE 1N1EA 3PNVA 2RIRA 2WNSA 1NSTA 3OZTA 4ZTUB 1XQ9A 1Z2PX 2F8LA 3G59A 1AZWA 3HYCA 4AG3A 1J9ZA 1T4CB 1XDBA 2EKPA 3FPBA 3HYNA 3KJIA 3ZUPA 1XZJA 4I4LA 1N2XA 5E7JA 4Q18A 5K6RA 4HK4A 3NIFB 2JAUA 2Q9AA 3NP7A 5M34A 4IMRA 1DL5A 4LF5B 2IEIA 1YBMA 1ZJJA 3KYDA 3KT6A 3PSAA 2V98A 1E3QA 1YHYA 5EIWA 3TNFA 2EOAA 2WE7A 5B4VA 3HJFA 2GA9A 5E6RA 2RK6A 5CT9A 4AJ2A 1U5BB 4PGGA 4DRXA 2B4QA 4CF3A 4DMMA 2CD7A 5KUTA 4Q4JB 2H6EA 4RJLA 4HTFB 1OXTA 4F60A 5IF3A 3AOGA 3PDHA 5ERYA 5JU6A 1HQKA 4MKHA 4EJ2A 5F9FA 2MINA 2BPOA 2Q21A 1EIWA 5HDBB 3CLKA 1UAAA 1I7DA 2B20A 3VU8A 3ENWA 2WF9A 3QMPA 5KNCH 1OWPA 1KFBB 1YCFA 4ZDJA 2Q5CA 2P9HA 4ZRNA 4BQNA 3QU9A 1P2GA 2C29D 2RGGA 1LH0A 2FZVA 1WW2A 5F35A 3O31A 1SBHA 1W44A 3EZNA 3UM9A 4Q1BA 1FJ2A 3KXPA 2VNAA 4JJ7A 4QXOA 3PU6A 5HVNA 5LN1A 1IHYA 5NULA 3OPYI 2WHRA 4CM8B 5EHZA 4R51A 5I51A 4UE2A 2NPFA 2IXBA 3WLRA 5TF0A 4ZO9A 3LC2O 3QX7A 1IM8A 4YONB 1QMGA 1YVEI 2FCAA 3MMSA 2A1TR 3FPGA 1ZU5A 3GF4A 4MYUA 3A1WA 5AESA 1ESDA 1I36A 1KRWA 3MT0A 5TF4A 4AZWA 3ND9A 4O2RA 3GCGA 4CNQA 4MW6A 5KYNA 1TTHA 2Q9BA 4F38A 4LF8B 3E6AA 3NYWA 2F4VB 4MWSA 2QX6A 5DASA 4ZVQA 1CZNA 2YYZA 3CKMA 5CNMA 3HCOA 2RH4A 1PUIA 1OC4A 1WS6A 1BE6A 1OU0A 4H18A 4WSOA 4HR7A 3LYAA 3HGMA 2OILA 5ILGA 5FPTA 4D3XA 5FA8A 2ACVA 1HYHA 2F4NA 2HO5A 3GMSA 3RUIA 4EPYA 4HNAB 1GRQA 2XE7A 2VWPA 3CZPA 4XB2A 4M55A 4X6XA 1YDHA 1ZN9A 3F97A 2KBFA 4JVMA 3QM1A 3DMGA 4I9GA 3A06A 3B6ZA 3AIKA 3DL7A 3KKKA 3PT5A 1RYDA 2WC1A 4J0HA 3T7JA 4AZTA 5AVVA 3HB0A 4KXXA 2ZM6B 2UYOA 5FOXA 5BR7A 4A8JA 2FZCA 1NLMA 2ZZKA 3KV3O 5E8RA 1H2XA 3FOZA 1UOOA 4WLOA 3MRXA 4PQRA 5TPWA 5JQWA 4FLEA 5AK0A 1US8B 3L6DA 4PCVA 4C04A 1V9CA 2QQ0A 2WIJA 2Y0PA 3V4ZA 4P34A 2Q1SA 3KLOA 4IM7A 1RKXA 4PZUA 5K0CA 4M1WA 3AIMA 1ZW1A 4DIKA 1O9HA 1R5JA 3T7TA 2GK7A 2OOKA 2BW0A 5A7FA 5FT9A 1KEWA 1DEXA 1LW7A 3AYZB 3GPIA 1NM5A 2I3BA 2V0NA 2OHFA 4MGKR 2HA4A 4N5LA 3BK7A 4MV9A 5JARA 3A14A 3KALA 5AKYA 5B1IA 3T9BA 3GV0A 2JDID 4ASUA 2J9XB 1Y1RA 1MO5A 1WB6A 3MA0A 4HVAA 4KBYA 4UHHA 3RBAA 3L8DA 4MYTA 3HVHA 3TOCA 1I2CA 1L5ZA 3NXSA 4HN4B 3JWJA 4FKZA 4OAOA 3ZHXA 5I7SA 5JNLA 4J49A 3G1WA 3JQFA 4JN6B 5BWLA 2A0UA 3WRVA 2H18A 3EF3A 5IAKA 1C29B 1HOTA 4OK6A 4XWOA 1K4KA 3PXGA 2BFEA 4N8DA 4RD6A 2XI4A 4KV7A 4DZTA 4F4HA 2O7RA 3OIFA 1YIDA 2VR1A 3ZNOA 1LBQA 2Q5EA 1KO7A 2A5YB 1IY9A 5CXXA 1JAHA 2FPLA 2H57A 4ER6A 1ODCA 1K08A 3UJAA 3PF9A 1TAHA 2DLNA 2K7ZA 3GDFA 4XVHA 1SPBS 4R16A 1UPXA 1SHTX 1CV2A 5CUQA 1GKUB 3I2YX 3OD5A 3R3SA 4IH1A 5EINA 5B30A 3TGWA 4JROA 2EAUA 3LVQE 4B2PA 1MTOA 3E23A 1ZUD1 4M9RA 3ABSB 4RSRA 3QA3E 5SZJA 3EQ2A 3PHGA 3SZOA 3JVVA 3QW2A 4IS2A 5H16A 4WKCA 2C1XA 3TUZC 1GFIA 1P74A 2PKRA 4B85A 2VBCA 1X38A 1FTYA 9GPBA 3EBOA 1ZHOA 2FGKA 2WHPA 4FGSA 4XYGA 4AMZA 5FPHA 2NUPB 3G5MA 1QOQB 1T6XA 5TGTA 3EPLA 4CM5A 1SELA 4RNCA 4KE6A 5P8WA 3IUSA 1MAUA 2IHBA 1E1NA 2DQKA 2J9RA 2VQ3A 5FUWA 5IDXA 2GCPA 5HJ7A 4OBBA 1T9KA 3DT9A 4FK8A 1CF9A 3IHLA 1NBEA 1RWPA 5TY0A 4RTPA 3L8FA 3OAAA 4D0RA 1DLJA 2G28A 3VOBA 2EX1A 4XAQA 5BN4B 4B4KA 3WRWA 3FOCA 5E2AA 3CNNA 1WZ2A 3DBRB 2V5VA 4NP6A 4RUKA 3ZV3A 4RVOA 3TECE 3OQVA 1G20B 5EIAA 3TMKA 2R96A 1Z5UA 3KLBA 2E18A 4ZEOA 1F2DA 1ZISA 3A4IA 2A0FA 1GXSB 1Z0SA 2HDWA 4L74A 1YC5A 3O91A 5C51B 4L5JA 4OLFA 5EP3A 3GELA 3CF6R 4LYYA 4Q3LA 4PQYA 3VDQA 3C5VA 4MR8B 1GDHA 1H2ZA 1W8DA 5GONF 4TMYA 1Z35A 2XMRA 3TFQA 3RK1A 4ZJZA 5BRJA 4JAVC 2IYYA 5P21A 1NC1A 2OQRA 2DR2A 1FW6A 4UUAA 4IH4A 4ZYLA 1PGQA 2BWJA 2O48X 1IM5A 4QUKA 4X8MA 1E9SA 3PFBA 1EWTA 2FHSA 2Y9PB 5BPFA 4Q1EA 3BBPA 1Z45A 4HWGA 4IQ0A 1ODFA 4WZBB 3VPDA 3NANA 3MF4A 5KDLA 1V5IA 3Q6MA 5K05A 5L95A 2AG5A 2J9GA 3JQ7B 3KPVA 1I3NA 3KOOA 3S40A 1X7WA 3FCEA 4NPCA 2FRXA 1O08A 2C0CA 3JATA 3V7UA 2UZ3A 5AW7A 2O8CA 3N07A 4UPVA 2ZREA 1BMFA 2ESRA 1R0XA 1DINA 2FJPA 3QKRA 4INJA 3EUFA 4C0BA 3LPAA 4JXXA 3W7VA 1UAGA 4LTDA 2H3EA 1QTIA 3ME5A 3UTDA 2Q3EA 1W5FA 1U3TA 3VUFA 4Y2UA 4E07A 1YWGO 1RHJA 5FX2A 1JQBA 1BN6A 2IDKA 2QI9C 2PV7A 4I9FA 4I08A 3ZJUA 4MOWA 2OCKA 2ZQZA 4V0LA 1TEVA 1FLVA 3E9DA 2Z4SA 3IILA 2GVDC 4GNRA 2CFOA 5KZMB 2DHDA 1K3FA 2EWWA 1JG4A 2BFBA 2CZGA 3MM4A 4JLNA 1AZSC 4JL8A 4PC3A 4QOEA 4RD4A 5LBUA 3AVUA 3I9OA 2NU9B 4MUJA 1SVLA 4JB3A 3DMNA 4IWNA 4S1WA 4L02A 1QR6A 3FWYA 3I0MA 2VHXA 5BMVB 3EVGA 3MWJA 3LPCA 2O54A 3GGPA 3K9WA 4NAHA 1LWOA 3PRHA 1Q0QA 1TGVA 2QNRA 4I1YA 4PPYA 3FRJA 4OI1A 1M2NA 3IP5A 3ZU6A 3G0HA 1W25A 4KSCA 1O1YA 4G5YA 1TW2A 1DOZA 2SKDA 3WL3A 2OK7A 1PGOA 4ENWA 1JB9A 4RTSA 3BF8A 1O97D 1ODJA 2CLFB 4MKRA 1UANA 5TJHA 5L6MB 3LLUA 2Y1KA 4MQFB 1VI5A 4M0LA 1UPAA 2VSFA 1E5DA 1FLNA 1SOAA 1FS4A 4K81B 5DTJA 2B36A 2X0NA 3UB4A 3CINA 4JVLA 2H1FA 3GMDA 3RB8A 4RK4A 3SAJA 2DU8A 3LZCA 4D42A 2B61A 3H7AA 1C7FA 1SCAA 4K6CA 3QFSA 3TOVA 1LEHA 2HSJA 3W9UA 3W5AA 3ENNA 1JT9A 4CN8A 3TXYA 3RYTC 4DIBA 1C3VA 1ZG3A 1DIOB 2EBHX 5F73A 2XUAA 4NXMB 4GE3A 2QVCA 2C9MA 4B3TB 1RVV1 1DWPA 1W19A 2QMHA 4ENUA 4L5CA 1EH5A 1MC1A 2WRZA 4RZHA 3DZCA 4NARA 3N70A 2HC9A 3QPBA 2XZLA 4K1XA 3C8MA 2VYND 4DR7B 1W75A 2EDCA 4ESOA 1GCUA 2ZTLA 4OG2A 2FMUA 3HCPA 4X1YA 4EYKA 1M8GA 1T2FA 1HYEA 1S2IA 3T95A 1DC8A 3RTBA 2H4XA 1KP9A 1UT6A 3QVLA 1VLLA 5HIJA 2VRCD 2VHJA 2D6FA 5EJ2A 3AMVA 3KSDO 4YUYA 5SICE 3O8OB 4XTCS 3SNHA 4Q3DA 2CFRA 4R01A 4F85A 5IKEA 1R6VA 1ML4A 3IOBA 4KXYA 1Z82A 4ZO6A 4I3GA 1C30A 5AVUA 1YASA 2BGTA 1BN7A 4ZAXA 5IKMA 4EHIA 2R1TA 3UGQA 3OEWA 1YS7A 5IVDA 1RQNA 1BU5A 1OGJA 4MR7B 2GJKA 4D9JA 2W71A 2FMFA 4F4IA 2H5IA 3H2IA 721PA 3PPIA 5IXYA 2QBYB 2EDAA 3DEAA 2SKCA 3KQPA 4K9KA 4PYKA 4R98A 1MC4A 4BNZA 1F8FA 2ZE5A 3T0FA 5HCIA 2OHIA 3ZBPA 3JASA 4FBMA 4LVCA 4JC5A 5HX7A 1H0HA 3AYXB 1JDUA 3H9EO 1X1BA 5AKIA 5BNFA 4J3NA 1JU9A 3K2IA 2IUUA 3UK2A 1XT6A 5AXAA 3FI0A 1D4OA 2ZCJA 2G1JA 4RVGA 4HDMA 2HA0A 4BPRA 1SVUA 1Z6XA 2IUFA 4EVSA 1UT8A 1X13A 3BDAA 1WOMA 2XT9A 3M82A 2D2VA 4Y1GA 1QIHA 4M0CA 1B0UA 4PG6A 2ZWAA 4J0DA 5EP1A 3KDSE 3VI4B 3BX1A 2QTNA 5EERA 3RV4A 1VHTA 2XMGA 1DQPA 3OFND 1T0JB 4G4JA 5J4VA 5CK5A 1LQUA 2ZSDA 3O74A 4JZYA 2C5AA 2REXB 3EZ7A 3NEJA 3QQ5A 1M74A 4W5HA 4BMOB 1OIWA 4GYYA 2IX9A 1CUFA 3F47A 6CHYA 3P9ZA 2EG5A 1WTCA 1CE8B 2HSEA 4RL4A 2VK1A 1DVRA 3DW3X 4X61A 3CU5A 2HTFA 1OV4A 4KO8A 4MGIR 1W52X 4B3GA 4C07A 2HRQA 2VATA 3BD6A 2WAXA 1NIPA 2G1UA 1Y9EA 3ICWA 4A16A 3Q3JB 4QSMA 4UM8B 2YV5A 4OFZA 1RS0A 1WHTB 3IX7A 3RVQA 3X1JA 2GZMA 1YRBA 2Q4RA 4A27A 2V9PA 3I9V6 4PPFA 1EP9A 1XWFA 1DELA 1I10A 2XDQA 3BXXA 4J1TA 5JZMA 4WY5A 1M1YA 1T9GS 1ZVJA 5TVGA 3ASUA 3RU3A 4TV8B 3P9YA 4IUCS 5E6SB 5FD8A 4QDKA 1RRFA 2C8JA 2F1OA 1RQ7A 5B55A 3HO6A 4M54A 4POOA 2FUG6 3VTKA 3INTA 4ECEA 5CP8A 4PG5A 2ODBA 3OFVA 2GN8A 3GZNB 5NLLA 1MJHA 4YRNA 1E0JA 4E1VA 3IYLW 5HM6A 4W9RA 1GQFA 1J21A 3T1NA 5EJ4A 2AFHE 4MGZR 1VKHA 5CNKA 1MJGA 2HA7A 1W1UA 1J9GA 2R25B 4P8RA 2NSHA 5L7WA 2DQSA 2XUFA 4D8TA 2YRFA 5KX5A 3P9RA 1W88A 2Q29A 3AI3A 3BFPA 4HDSB 3I6BA 4L57A 4Y2VA 2I7TA 5BN3B 2CYAA 5CLIA 3DXFA 4KZKA 4NICA 1T4BA 3KHSA 3L7DA 4LJRA 4F8EA 5MN5A 2HPAA 3NI2A 1KORA 1D2CA 4H1UA 4RDCA 3VC2A 2OHGA 3U16A 2CC2A 3OQNA 2FRDC 2RFLA 2ZTUA 1X70A 4LK3A 1A9QA 4MIKA 2WICA 1XTSA 3WADA 3KUUA 1Y4AE 2XCUA 2NU6A 3H1EA 2DYKA 2ZWPA 2EFCB 2W93A 2JIMA 1BMFD 4HHEA 3WJAA 3K4HA 3WYNA 5JNRA 1H6AA 2C4TA 3ESCA 2DFKB 2E9SA 4G0PA 3SJBA 3LDGA 4B32A 4Q4HA 2B1JA 4PQEA 3ZWKA 8LDHA 4RZUA 3GVCA 4FYIA 4IBOA 3Q2KA 2B6HA 4O4JF 4D4JA 5JW6A 3R3JA 2IYSA 2I7XA 3OU6A 5E8JA 3T3OA 5FIUA 1FFWA 4BO3A 3CJRA 2B78A 4E3ZA 3IBCA 1L8XA 3AKYA 1G18A 4HGNA 1SMKA 5T67A 1Z5PA 3BMCA 3NIWA 2AMVA 4P2GA 4O4HA 3CTPA 4JHLA 4UAVA 4Z1MA 2OCDA 3C85A 3P2EA 2C9YA 4Y1RA 1I9CA 3NM5A 4WZZA 4JI0B 2ZJ1A 4K40A 3WP0A 3J7TA 3GHYA 3ZUGA 5DYTA 3AK4A 4L9AA 3PGA1 4U6QA 5AK5A 4TS9A 3UAYA 1XFDA 3BG5A 3BWEA 1YDEA 3K72B 1PSZA 1BCSA 2R7LA 4YT4A 4KACA 3IVMA 3O4VA 4DADA 1B42A 1E96A 1NVAA 1XRJA 2FWRA 3DE4X 5GZ6A 3GP3A 4CT5A 3FLEA 3DBLA 5DK6A 5E1DA 3W79A 3N7TA 2NLOA 3FBWA 2DT8A 4OJYA 3JZDA 4E5KA 1RFLA 1ABFA 4QXQA 1N8KA 2VJBA 1J22A 1DAGA 3A6FA 5AI0A 5CIYA 2G1PA 1DX6A 2OO5C 4Y9UA 3H5VA 1UQUA 3L7NA 1A8UA 3H9CA 1V7QA 4HXGA 1C3EA 2L17A 3EXFB 3F7MA 4HEQA 4TXLA 3VFDA 4ACAA 2J3JA 5F1YA 4TZ6A 4PR0A 5J1SB 3AF1A 3HU5A 2FFHA 3MT8A 4UAJA 3FOEC 4BKRA 1L6RA 2CXTA 1EXWA 1YR7A 2JHCA 2WWFA 5CW2A 1JHZA 4LJ7A 3WNZA 1V1RB 4NBVA 3GFVA 1QZUA 3DDHA 4LYAA 2PZAA 1QZXA 1V7CA 1QORA 3PCXA 2YHIB 1P5HA 3P0RA 5AIAA 5TMBA 1NJGA 1HLDA 1NI5A 2WIFA 3ZE7A 4R2XA 3EDCA 3N53A 2R5WA 4YWHA 1Z7GA 4IKPA 4TRRA 4YAFA 1FFCA 1UBCA 3UEOA 2F3PA 1ZESA 3A6DA 3C45A 1E1DA 3I5XA 3AR8A 4RESA 5JPCA 1DAPA 1U4OA 2ZT8A 4ND6A 5ITZA 4F2DA 4OYRA 3W9YA 4F4DA 4UVHA 4HUQA 1NKTA 1VZ2A 1AKNA 5A4KA 1UJ4A 1P2SA 4WFIA 1TLFA 4FZ5A 1SD1A 2BFDB 3DMTA 1BGXT 4KDEA 4DHEA 5AUPB 4RTKA 2Q07A 3G8YA 4Z4IA 4UU0A 1YQDA 1ORIA 1IPHA 5F4ZA 2V7TA 3DYVA 2QK4A 2BONA 2VSOA 5EE0A 3KSBC 2P67A 1H5NA 1X74A 2ZCVA 1PNOA 3D7LA 3JWPA 3GPCA 4IFBA 5C81A 1GN9A 1CJVC 4ND7A 4J7UA 3IP6A 5B1SA 1M5RA 3DPSA 2JA2A 3HSKA 3RAGA 1LF5A 4L8YA 4NG4A 3OLQA 3ANNA 3W77A 1UBJS 3UOAB 1USGA 4CEJA 4QTUB 5HUHA 4GWLA 3VOAA 1E9EA 1D4FA 2P7HA 2AEMA 4BWYA 1XD2A 1CJMA 5A7HA 4AVYA 3SQNA 1VMDA 4H3HB 1T9ZA 2XUJA 4BJ3A 4HATA 5ADWA 1GTRA 1BGVA 3MILA 3KT8A 1XUOA 2FQQA 2Y66A 3B51X 4BO7A 5HKAA 5EJ5A 4CL0A 3WQRA 1KJYA 3QH4A 1DPFA 1XSEA 2FW7A 1R0SA 3PS9A 3TLKA 1GT91 3OD1A 2BR3A 1OHHD 3RJ5A 3ZYCA 4DNQA 4MVCA 3N2NA 3LM8A 2PGDA 3DZHA 1JJAA 2JI4A 3FZNA 3H0CA 3D0OA 4GBED 3D2AA 4PINA 3ITDA 3NV7A 2GZ3A 3W0LB 3O1IC 5BVHA 3E9NA 4GS5A 3VJLA 3GG9A 2ECOA 1N5DA 3KWMA 5CAEB 4ESVA 1HDOA 1OXUA 1RWMA 1RRCA 3AT1A 1WJGA 2WSBA 5G1NA 3SDZA 3CIOA 1K8QA 3VR4D 3JALA 4JH0A 2F17A 3MCTA 4QTZA 4D6YA 1KERA 3AJDA 1YHZA 4GBMA 2BKUA 1MMFB 4AG6A 2R00A 2CNNA 4DMLA 3LW7A 4H2DA 3SEFA 2O57A 4Q66C 3N6XA 5FO1A 4IUDS 4QBKA 2QUIA 1FVOA 2RGXA 3PTLA 2HDNB 3OE7D 2HIAA 4EMBA 3B3AA 4E08A 3KOUA 1A72A 1XX6A 3CRZA 2Z09A 1J4AA 3GRCA 3IELA 3QGMA 4MVJM 4O2AB 1K7FB 4X60A 3EPJA 5MFPA 3G5TA 1BHO1 2F55A 3P71T 1UDAA 2NSJA 1I94B 4BNWA 3QNUA 1YULA 1M0TA 5AJXA 4DAEA 3FYSA 1I80A 3OQIA 5JSYA 1WCIA 5DFAA 3WG9A 3WGZA 1XZAA 1WMBA 3O8BA 1KQPA 3R23A 4IDOA 3C1OA 1K7CA 1N6KA 3EJ6A 1W9MA 1VCIA 3ZHQA 1LLUA 2HF7A 3KUKA 2CL0X 1GLGA 4Y6PA 1UQTA 1WP4A 2YL2A 3IVXA 3AU8A 1AUPA 1UCFA 5DEOA 1PR3A 1ZGJA 3BL6A 5B3KA 2FPIA 2H7CA 3AHDA 2YXNA 1B93A 1CUAA 1UEJA 1FNCA 2EQBA 3I4LA 3MELA 2L0XA 4NNPA 1Y6RA 4PLHA 3TI7A 3TR6A 3VSDA 4C3VA 4EY8A 1XMPA 1UAYA 1IWPB 1W0JA 2P3QA 2O05A 2PGJA 4JQYA 2XTMA 4A0FA 1QONA 2XGGA 5FNVA 5LMNB 1Y3AA 2OO3A 2VC2B 3GLVA 4YLGA 3I34X 3EC7A 3N7UA 1XZIA 2CXUA 3HSSA 621PA 3FD8A 1HL7A 3MPOA 4NYIQ 2VAMA 2HCJB 3EGEA 3FTDA 4NONA 5INTA 1BS9A 2WOOA 1BOOA 2HMAA 4RBNA 2WTNA 2FW0A 2GZ1A 2R6DA 2VUHB 3WLTA 5AW8A 1A8IA 3U0BA 2CV2A 4MHSA 2BY4A 3BDVA 2CNBA 2RI0A 5EG5A 2EKQA 1IK4A 2BHNA 2NSDA 1SQ5A 2Q0XA 2WAAA 4RPKA 5GP1A 4W5RA 3BSSA 4M49A 3TINA 3KCQA 2YVLA 3PNPA 3OIGA 1TD1A 2QV7A 4KQHA 3KFXA 3R5HA 4TMKA 4BQSA 3HP4A 3JQRA 3BJIC 1D5CA 5DCUA 3VNSA 4DGSA 1BMTA 3JS5A 1D0SA 1E1KA 2WW8A 3TUJC 1EQAA 1EQ2A 4UBMA 2QENA 3PF8A 2XB9A 3H0EA 3NT2A 1RLOA 4UVDA 4WJKB 4NYIR 4YUXA 4ZCRA 2REOA 3ZVMA 2GCEA 4CF4A 4CKBB 1P62B 2RBGA 1ABBA 4KO3S 1U0JA 2O0LA 3WKBA 3H0KA 3ADDA 4YCSA 1XRLA 1AMNA 1GKYA 1JSRA 2QNIA 4IDHA 4LOKA 4UCXA 1JI0A 5AJYA 4X71A 2MR5A 4MRMA 1V3VA 5T3UA 4UAGA 1GUYA 3EY4A 1IU9A 4I5IA 1JLRA 2ONYA 4V2IA 1P73A 4Y18A 2JAHA 5IN4A 3MBKA 1ORWA 2R4TA 3PD1A 1J8FA 1E8NA 1ZSYA 2DKFA 2EATA 5JT1A 4OHYA 4C5AA 3H1AA 4J4BA 4CL3A 1WE2A 4B7CA 3RIGA 1NKVA 1U0RA 4CFSA 2EKZA 1EPUA 3EPKA 4BGUA 4P0PB 1KDVA 2YWDA 1MJ5A 2WP8J 5JRZA 1NUSA 1RHKA 2GS9A 1OJ7A 2PD4A 1QQ6A 4QREA 2CHFA 4C7OB 3FFXA 3ZIAD 1GYPA 4IQGA 3L7BA 2OT3B 2VF5X 5AOBA 2JHAA 1X0VA 4PVCA 4BNJA 1U1IA 3TL3A 4LHEA 1NP6A 3UJBA 3WGYA 4WLNA 4PGHA 4PGMA 3L02A 3SYNA 1B2RA 5ECGC 1C2TA 3KTAB 3T9FA 3OPYA 3MBOA 3FVRA 4JB2A 4ZZIA 2O2DA 1OYYA 3ZXIA 5BVGB 3Q8LA 3DT6A 2R2GA 4E51A 1G6KA 1MQ9A 2ZVJA 1UZLA 4YJKA 1G5QA 1NXSA 4B47A 2Z2IA 3FX2A 2ZBDA 1B76A 4EFDA 1S2NA 2YBDA 2AFHB 4NLLA 4ITUA 3UHJA 1NR7A 3CH4B 3M4XA 3F96A 2J48A 4II2A 4O4LB 3R7WA 4EKDA 5KPJA 3GFGA 2JPDA 4D1YA 2JF0A 3LXXA 1OI2A 3S70A 3CSUA 3TG8A 2KM1A 4MVJI 2GFHA 1R9MA 3ILHA 4TT3D 1X7YB 4Q6BA 2OCBA 1VHWA 4W8GA 4CF7A 4FILA 3QHPA 5TQ0A 5BV8A 5A0VA 1RZ3A 3AOEA 1UKVY 1WPGA 1JHDA 4LFCB 3BWDD 1NW6A 1Q44A 5DBIA 1OH7A 2XVZA 2W8BA 1MRZA 2GJ8A 1ANKA 1WXDA 3BL5A 3DE1X 2H4WA 4X7RA 2WNHA 4D7AA 4OIMA 5AVOA 1DG9A 2AG6A 4QG7A 3TW8B 5BV2P 5C52B 1KVRA 3IC5A 4MWDA 1NMYA 2P27A 4EUNA 1LI7A 1ZH4A 4G4GA 2VBFA 3MTIA 4ID3A 4M0DA 4X3OA 1FRQA 2Y76A 2R5NA 5GOZA 1IUOA 5H81A 1FDUA 4PZ9A 4K9MA 3DAOA 4KR3A 1RRGA 3H84A 4JI2B 1XEAA 3C7CB 1LJUA 3ND5A 1R6UA 4MKXA 4K6KA 4XWGA 4CPDA 421PA 1UJ2A 3GL9A 3HHEA 3TE6A 5KKCA 2YJ6A 3DNPA 5D01A 2VYVD 3VHLB 2FLKA 3EXG2 4QBHA 3N8GA 3OSZA 3GI1A 3DVAB 5AVSA 3QV2A 1BW9B 2HNKA 4WXHA 5A4JA 2DERA 2PSHA 5KKAA 2HU7A 1Z56C 3E5HA 3WLEA 1SXJA 3TQSA 4QICA 1A5TA 3Q9UA 4RMJA 5J4HA 1UMCB 2AOTB 5DW3A 5CFPA 1Q1ZA 2OTCA 3D7MA 3LOPA 4A1OA 5A03A 4V0KA 3Q3GE 2G40A 3QEAZ 3T38A 3QOYA 1BTOA 1YS1X 2NYRA 3BZWA 3H87A 1KMHA 3KB8A 3PNKA 4L0CA 3AR3A 5T8KA 3V8NA 3WYAA 5BXQC 5FOWA 1PNTA 1E18A 1K1EA 3VR5D 2X19A 1NNUA 1NNLA 1UBHS 4O6VA 1I3LA 1A9XA 3QUTA 4BEBA 4QJBA 1VBMA 3LT5A 4HLNA 4D9GA 1RT9A 4ZAFA 2Q28A 4WNAB 4F3NA 3C1TA 3O3MB 3ZR4B 3GLIE 2E48A 5BYBA 2C7QA 4QOFA 2FPUA 3QUQA 2IDZA 1VE9A 1OLSA 2IITA 3G49A 4E14A 4F3RA 1O77A 3VU9B 3DG9A 5HW0A 1CZKA 1T3GA 4RHCA 4W9NC 4OK3A 1UBMS 2VT3A 4YPFA 2C58A 1GNVA 4ZYXA 1U7UA 2XAUA 5HE9A 2I66A 2WDPA 3IBGA 5ILQA 1Z8FA 4Q16A 1VJRA 4MV5A 3VR0A 3COJA 1YAJA 2ACWA 4I6EA 4AMVA 4ZI3A 3WLLA 3CEAA 3KHKA 4F56A 4S35A 5CFMA 3WMEA 3UWOA 3PEVA 1YB4A 4OXRA 4MAFA 4BFZA 2WWWA 1U0HC 2BI8A 4QNRA 4Z0HO 3VPXA 2ZIFA 3I09A 4RABA 3EVTA 3UO8B 2KE5A 5EP2A 3P2JA 1SK9A 4ZVSA 1GZ6A 1H8HA 1AS0A 1TM3E 1AOXA 2RDMA 1LDNA 4N7MA 1FCJA 3ZKWA 4B84A 4OI0A 3PWKA 3TZHA 1TKRA 2J7PD 2HU2A 4TUYB 3FROA 1ILWA 1VSTA 3QVMA 2H54A 2CHQA 1Y98A 4OP3A 3UTCA 5CXSA 3U4AA 3ZEIA 1AHIA 2PY6A 4CV3A 4D56A 4HMPA 4IIDA 4EF4A 2P9YA 2XMSA 4HNUA 3DKRA 4X8HA 3RFCA 1U9IA 1LPAB 5E3JA 1JKMA 1I4EB 1CVRA 3ENKA 4CMEC 4ZHQF 1I4DD 3PP8A 1J2JA 2B2XA 1QK5A 1WHSA 3FAZA 4HQKA 4EQ6B 3IV6A 3QVXA 3RARA 1J0XO 1FXWF 3DO5A 3GAAA 3QEMB 4UPEA 3FYUC 2V97A 1A04A 1Y1KE 3UOGA 1Z26A 2PT6A 5CDUA 3SYTA 1KDPA 1ZJ4A 4KEAA 4FWBA 3HI6A 4UMDA 4K0KB 2RGCA 5CRIA 1GPJA 3CZRA 2R5FA 4PIVA 4B45A 1JEYB 1JGTA 1H22A 2CLLB 3CNEA 2R6CA 2W83A 2QN8A 4MWZA 2QN7A 5U4XA 3RROA 2X3FA 3GFQA 3OECA 5L7YA 2GEUA 2NQTA 1MUUA 2ZI5A 3FPLA 2O8BA 4TV9F 3W1EA 2YHUA 4H1HA 3TIVA 4E22A 4DZZA 2WWHA 1JWBB 3O92A 4KJXA 4L73A 4IIVA 1EK2A 1UH5A 2NN3C 1U7ZA 1P77A 3LTNC 4REOA 3PQ5A 1B00A 5ARCA 4LF6B 1KK0A 1G8YA 4E2YA 5CFOA 3OCXA 3A9TA 3AC0A 5GVRA 4RXMA 1TUIA 1U3VA 1AV7A 2JFXA 4OL9A 4QOJA 1ZAYA 1KFCB 2NADA 3ABZA 1KVUA 3FYDA 3GC6A 1S2LA 3MBIA 2HIHA 4FNMA 2BF4A 3TF5A 5IS2A 2BGGA 3NH6A 4TZ0A 1H0RA 1LTKA 2MSNA 4RVSA 5AK6A 4NV0A 4Q24A 4INAA 3MGCA 5E95A 3UCFA 3VVMA 2A92A 4CEHB 1CNMA 1MOPA 2OZLA 4NENB 2VJAA 3FJOA 2VDUE 5EZ5A 1O8BA 4A0SA 4LZZA 2GFQA 2XRYA 1RPNA 4UJ5A 1P5JA 1SCIA 3FSRA 2BCEA 2B92A 1QHFA 3EW9A 1EG7A 4Z7QB 3H1FA 2PKWA 5JASA 1G5PA 4DR4B 3IUBA 5LL6P 1WDMA 2P2GA 1E62A 3BGOS 4LMBA 1JMYA 1BHSA 3ROKA 1KY5A 3LS2A 4PSVA 1QKKA 1PZFA 1T2AA 2FG7C 3IQEA 3MTDA 3TSOA 2EJTA 5KTYA 5JXGA 1HUQA 4JITA 2A9OA 4LNAA 4MCJA 1IN4A 4AROA 3DOUA 1YDGA 4IR7A 4HVLA 5AW6A 4MKGA 2Z4TA 2ILTA 2AL7A 4IDCA 1VCOA 2W2TA 2IXFA 2C4HA 1ZQ1A 1ZITA 3F6BX 1JA1A 4FFLA 2NAFA 3TVTA 5KHOC 3D1VA 4P32A 4ABYA 2RGDA 3PVZA 4ZK6A 2Q6OA 3KAQA 1A50B 4HDKA 3S8MA 2H85A 3ZOZA 3AIIA 2A59A 4BVAA 3C4QA 1T0UA 4MYRA 1O94A 4RMHA 5B7QA 1RZVA 1RSZA 2JW5A 3F5DA 3I37X 5IMSA 5C53B 4UKDA 4MUGA 1DGQA 4JU9A 1XOIA 1LFDB 1WDKA 1N7GA 2AKEA 1DUSA 2O8FA 3CMCO 1KHHA 4QQFA 1T8YA 4AZ0B 4Q37A 3CZAA 1ZNQO 4RTQA 1U31A 5EESA 3KOYA 3T3MB 1ITZA 2DPLA 5ULLA 4G8CA 3A1DA 3FGOA 5JS8A 3HVRA 1QZTA 3JWIA 3OIUA 4X66B 2OAP1 2OGWA 2BE9A 1HLPA 3OMXA 2XB2A 3H04A 4HYTA 1PJZA 2IT1A 1KKUA 1OASA 1XVAA 2BF7A 1Z28A 3BD9A 1DTWB 3BGSA 1XTZA 3HKDA 1G8AA 4DG8A 1DJMA 1UJBA 1IULA 3WOHA 5SV2A 1FFDA 4WFJA 2HWYA 2YZ2A 2P69A 4F2GA 2PZJA 3E5MA 2XV1A 1FRVA 3EXEA 4C1BA 4XGNA 4MHTA 4QO8A 4OV6B 2VP0A 1NU8A 1BWQA 1SEPA 1CR0A 1N4AA 2W9XA 3AEYA 5TX7A 4NCJA 2X1LA 2BFMA 3EG9A 2H4ZA 2HWWA 3IJ5A 3LUPA 4X44A 4EA6A 4LDQA 3WLKX 3ZVLA 1GZDA 4AIRA 4BMDA 3D8TA 1J0DA 1E79D 3WL8A 4BCBA 4MS1A 5ALTA 3WGGA 4I5GA 1PO7A 4KQXA 2D8AA 2ZRNA 3QFRA 4FMPA 5ES3A 3OESA 4U7HA 4S04A 1VHQA 1LA2A 1X8XA 1WCYA 2BFCA 2DR3A 1HE1C 4AN1A 1YH3A 2FPRA 1E6MA 3OO0A 4DMRA 5BURA 4YHHB 1ZRMA 2Q7DA 1R16A 3A6EA 2VTEA 2CDBA 4X93A 4Y2GA 2FGJA 2FEOA 3EISA 3KP1A 5F2OA 1VE3A 1P4RA 1VGVA 3TDMA 4Y6SA 1I5OA 3OX2A 3EYWA 1TKAA 3UCXA 1D1PA 1M8FA 2IPOA 3GOQA 3OLYA 4L6IA 3HBFA 1JS1X 1NX9A 1GFSA 4MQMA 3TN7A 4PW0A 3A70A 1QKJA 1TL7C 2WYVA 4YFYA 5J2TB 1D2EA 1TUEA 2IE0A 3C15C 4LVNA 1S02A 2J6CA 5KJCA 1XC7A 2FOXA 2YQ4A 3RSLA 4DUGD 4YJHA 3R6DA 5GM2A 1C41A 3K0FA 2IV3A 2JBAB 3R5TA 4R3NA 1CEYA 2YXDA 2X2FA 3WBBA 3NDPA 1QIEA 4O02B 3ELWA 2JZNA 1ZL2A 2FMXA 4EFMA 2QMUA 2ZITA 2WM3A 3PXUA 4Y7DA 3UAVA 1Y7LA 1XEXB 4UVGA 4XEUA 4NEQA 3G9ZA 2OFXA 4LWOA 5H3CA 5HILA 2QG6A 2ZIGA 2BJVA 1IB0A 4KAJA 5CTAA 4JLSA 1N7IA 2F43B 3PDWA 3JXEA 2GJSA 4KQGA 1SC6A 2X8JB 3CCCA 4MW0A 5ALRA 5AP9A 1YUBA 3CF0A 3C41J 3I6QA 3P9QA 1B6GA 3ZW7A 5C9ZA 3GLIA 3G2NA 3U4QB 3OTQA 4HKTA 1T9CA 1USKA 2YIDA 3D2LA 2B4TO 3E8XA 5JLJA 2WFMA 1Y0BA 3CTMA 4A3SA 2R00C 4WKPA 4RULA 1C0KA 2QVZX 5EXEA 3U7QB 1U5CA 2IYXA 5GQSA 1UBUS 2JGAA 2WJIA 2CNOA 1OWMA 1AKWA 4CJXA 1KS2A 1CUBA 2PGOA 3DVSX 3OQPA 1HPLA 1J2RA 1RHMA 4OVKA 5KNBD 1Q5PA 1XLTC 3K5HA 3I83A 3DV0B 4YJDA 5LYJA 1Q21A 2P2DA 3W1VA 3ZE2B 4YREA 5KEIA 2AJ8A 3M4ZA 1YZQA 3Q11A 5JMPA 1S3IA 3H9GA 1XMOB 3HJGA 5G41A 3EGOA 5DNAA 5DWVA 1IY2A 4H1VA 2ZYVX 5EL0A 5AIBA 4RK6A 4PYIA 1Q57A 1L8AA 2OB2A 1WMAA 3E7FA 4KDFA 4UUMA 4M9SA 4FZ3A 3B2QA 4B8ZA 3K2BA 3KQQA 4B6QA 3T5BA 3I5YA 4JVOA 3KXDA 5KC9A 1G3RA 5WRFA 4J0EA 1A2OA 5B3AA 1DT5A 1E1LA 3O5AA 3IEIA 1C4KA 1PT9A 5JBIA 3NB0A 3H5IA 3MMZA 1FQOA 1HNXB 3IP7A 3W3ZB 1YS9A 3R3WA 3HXMA 1Q1NA 1FP4A 1V26A 3JAWA 3ZDQA 3FYUB 3BTUA 1J1UA 2GR9A 3DCYA 1VBNA 3K8ZA 3INGA 3LGAA 1A3CA 1RAGA 1S4QA 1XU7A 4JBYA 5DM60 4DQVA 1K7EB 1V37A 2XUZA 3SX2A 4HV4A 1HFKA 1VG9B 4NJMA 5LSAA 1BMDA 4TKVA 3OTWA 4QQRA 4MI6A 2P3OA 4F2HA 1MEOA 2WJGA 4FFDA 3NTVA 2HMSA 4ARSA 2C7OA 3GUYA 4KH0A 3CKKA 2Q4TA 2Y3IA 4QPDA 1KYYA 1RJGA 1YB7A 4HDRA 1H8EA 3A27A 5EZYB 5GV8A 4UNQA 4WPGA 4GMXA 1CY6A 3WLHA 1EHYA 1O9BA 1YVRA 2RHWA 2YV1A 3KJFA 5IUJC 2JATA 1S9DA 1JDSA 3C0KA 1O57A 2A1TS 2VOJA 5JJLA 1HC7A 2UKDA 3TI9A 5F7OA 4P9NA 1E5TA 1UJCA 3AEZA 3CG4A 4M8SA 5JYDA 1Z4NA 3SLKA 3GO4A 1ZBDA 4I8DA 5A0TA 3P2OA 1A4UA 5GADl 1ISRA 3ELBA 1Z5NA 5LQAA 2X42A 2AXNA 3KWJA 3O7MA 4NBWA 3U3DA 1W87A 5I8ZA 5GJBA 1PQUA 1NJ2A 2FFQA 2PS1A 4NAVA 1G21E 5EPEA 4BFYA 1EFVB 3ELUA 3Q7IA 1WM1A 2QSZA 3GJSA 4EH1A 2BFPA 1UBTS 4G9EA 1A71A 2PRJA 3PB3A 2HQOA 2N0SA 2WZBA 4J0CA 4JP1A 2Q0QA 5TMEA 1ZOPA 3D81A 2Q5JA 1TRHA 2DPMA 4FHCA 4QQKA 4OJNA 1Q15A 4WLEA 5CYFA 3RHTA 2IYUA 3SN6A 2UYCA 4D9FA 3OKFA 3KT0A 3ZJVA 4NU8X 4BNDB 3EVNA 3SVZA 4NSNA 2XWPA 3U1TA 1VB3A 5KYYA 2H9AA 4DIUA 1TK2A 2AWOA 1LGYA 5HJ2A 3AI2A 4BQQA 1YXMA 2RH5A 3C39A 3DKPA 2OM2A 3F78A 2PYIA 3RUEA 4CKEB 1PJSA 4Z3KA 4RSGA 2IXDA 1KJIA 3OZ7A 4MKIA 3QV1A 4Y2RA 3QBVA 3QVOA 4KREA 4YAKA 5K2MA 1ULBA 3HKCB 4R1LA 4ZU1X 4G1VA 1PJLA 4FI3F 1NFQA 1SIOA 4XPZA 1KJ8A 1IQRA 3TPZA 5G0SA 1TJNA 1L4NA 3DNMA 3W8FA 2C5SA 4J9UE 2XJ4A 3OWHA 4HQ0A 4QO7A 1E7MA 2R2AA 2I3GA 4J7CA 4EB6A 3AHEA 1SG0A 1TK9A 1CUXA 4JYAB 4AMBA 1LB1B 3DBVO 2VWGA 4ZGBA 4NCXA 2O2ZA 5JQGF 4KRGA 2J0EA 1I33A 4NFYA 1YVDA 2GKSA 1M72A 4B7XA 4HRXA 4MRSA 4IUYA 1B41A 2D5IA 4EY7A 3WBJA 4C2BA 2YXEA 3AEQA 4C9BA 3RYCB 3C14C 2HQ1A 4NBNA 3MWEB 2X5OA 3GQBA 4BY9E 1Y9AA 2OZPA 3N0WA 1S7CA 2YZMA 3VNRA 1L7XA 2O2XA 4GEKA 1AS2A 1V4VA 1BSVA 1EQUA 2ZKLA 5AICA 4R5HA 3CLRD 3CCBA 2BTQB 3V3TA 3HBLA 2J0SA 2IYLD 3WWOA 3DXYA 1KEKA 2G72A 2WU0A 4GSKA 1E69A 2QD4A 5ECYA 4K9NA 3OIWA 1IPFA 2A94A 3UK7A 2WT9A 3DP9A 2D62A 2ZLBA 4ED9A 4L3OA 4JFAA 4RZQA 5FQOA 1XZGA 4RYLA 3AR6A 4JT2A 4WMLA 4ZOEA 1OWLA 1I7SB 3D5EA 2CLKB 1JLKA 1JDJA 1Y3IA 4EL0A 3MJDA 5COQA 5D87A 1MFZA 4P4SA 3OEEA 3HJRA 4U2GA 3GGJA 4JLPA 3RUDA 1EVLA 2JFFA 2ONJA 2HLHA 6YASA 3DZDA 2BDUA 3EH1A 1RYHA 1F9AA 3PXEA 4QHSA 4RGVA 1AQ6A 5IJ0B 2HJHA 4PHFA 4WNYA 5BSKA 3DZGA 3MS2A 2GBIA 1KZ4A 5D5PA 5I7EA 1CG6A 5JIBA 5THKA 2B8NA 1DIBA 4TRJA 3WMWA 5DT2A 2HF2A 5EMHA 3IBTA 5ICFA 3VR1A 4DUGA 7REQA 4S3MA 2ERYA 2C95A 4D8WA 2C2KA 1Y1PA 2F3RA 4AG5A 1SC4A 5DDIP 1KJZA 1C2YA 3GVXA 3QXCA 4NOMA 4X1KB 4B46A 1PR9A 4PYRA 1SC1A 3DXZA 3SXUA 1ZOIA 2ZAIA 1BXZA 4AB1A 1DWOA 1HRKA 5AHOA 2XEDA 3PUKA 4EFKA 1EFPB 5KTKA 1URPA 3T7CA 5ADUS 2PG3A 2O0JA 1R6DA 1UPUA 3G7SA 4H27A 1VLJA 4IDDA 1M7GA 1ESEA 1AQIA 1NATA 3ELYA 4J90A 4ZI7B 1XYGA 2OR3A 2W2OA 1J2TA 2JLWA 1NN1A 2IHJA 1K75A 2K2QB 5GMOA 1UM9B 4LWQA 1D07A 2UUBB 3NP9A 1KR2A 5ALVA 5GJCA 5FWXB 1YE5A 4WEOA 1RI3A 1F2VA 2M32A 3NHAA 1JVSA 1XQ1A 2IIQA 1BYUA 2PKQP 3IAS1 3NW9A 4R2HA 2UZ1B 2WVHA 3Q40A 4B87A 5BWCA 3ZE9A 5KKNB 1JIJA 1N6PA 2FZ5A 2GGSA 3H3FA 5K8JB 2DY1A 2HJRA 2AVDA 3TAUA 2B5WA 3NASA 4Y7CA 4H15A 2V3CC 3E5NA 4FE4A 2LCQA 1DIGA 1QLWA 1SA0B 1U2PA 3EIWA 5ALOA 5EP4A 1E3LA 2WF5A 3WL5A 2NZ2A 1TGYA 4QVIA 2HK7A 3G79A 4TLEA 3P2KA 3IAAA 1IUPA 4UCWA 3E1SA 2X9VA 1DJOA 3NXKA 2ZTSA 1GILA 4GSYA 3ZV6A 2Y92A 4YJGA 5L4LA 5AI4A 3KYJB 5AK3A 3E7DA 2BGKA 4C78A 1VIDA 4YP7A 1FFAA 5KTSA 1SULA 4PXYA 1AO0A 1PWZA 1EE1A 2NZYA 1KNXA 1Y6QA 5ICGA 4F3KA 5A6SB 1D03A 3SFTA 4I14A 1ZVVA 4RD3A 3O03A 2IHYA 4GKVA 3ZNPA 1E2PA 4KR2A 1K5PA 1XTUA 4FGZA 5IC5A 3WX0A 2FG5A 2YWGA 5EWJA 4ZFNA 1ZVMA 1NFRA 4K05A 5DX0A 4TMTA 4K3UA 4OLHA 1P8JA 1DB3A 1BE1A 1CY1A 1BA2A 1JIKA 1GTL1 2F6RA 1GTJ1 3CLSD 1CJKC 1RXSA 4IG9A 2XOEA 4JR2A 5A0FA 4BOYA 1KI1A 1RQPA 4RZ3A 3PTAA 3AJ8A 4CM1A 2Y68A 4ZT6A 1FB5A 3LA6A 1T2DA 5IC4A 4B7UA 3RWMB 3SJUA 3PXBA 3ESYA 3EGIA 4JUDX 4V1CA 1M54A 3M81A 5J1TB 2WHQA 1AKMA 3NS7A 1MJGM 1OREA 1JFSA 3OZAA 5EUBA 4Q7LA 3W5BA 1U1DA 4N54A 3W2IA 4I3HA 4G89A 3LLSA 2PKYX 5K3FA 3OO1A 3QKWA 3TQHA 1U4NA 4DM7A 2F48A 1XU4A 3H3XA 5FUYA 1NBOA 5JDIA 2C3OA 3EEIA 3K09C 1KHTA 2ZSUA 3FHLA 5IAAA 3V4LA 4AAYA 5JCJA 3FNEA 3EUEA 4H31A 1YQWA 3GRFA 4NOJA 2FP4B 4R9RA 1B8NA 3ICCA 4ZQBA 1QIGA 3ZTTA 3FZGA 4E7PA 1JB1A 4K6MA 3W5DA 3I5UA 1SCUB 4H59A 4FHGA 1WSBA 3R7BA 3GA5A 1MX3A 3WGVA 1F3OA 4FT4A 1ONOA 4B6PA 3ER8A 4KQWA 1FDSA 4BC0A 4JXZA 3A3KA 1PEAA 1W5EA 3CPJB 3ZCVA 4XA8A 2DWPA 3FWKA