4BLVA

Crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylmethionine (adomet)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
280
structure length
280
Chain Sequence
b'MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKDKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQLRYYPGSPLIARLLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGIAEGYKRFATGIYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPAGTGHATVSWIVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
molecule tags Transferase
source organism Escherichia coli
publication title Structural and Functional Insights Into the Molecular Mechanism of Rrna M6A Methyltransferase Rlmj.
pubmed doi rcsb
total genus 101
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.1.1.266: 23S rRNA (adenine(2030)-N(6))-methyltransferase.
pdb deposition date 2013-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04378 RsmJ Ribosomal RNA large subunit methyltransferase D, RlmJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4blvA00
2BM8A 2XYQA 2IDJA 3KPUA 5FQOA 4XUDA 4RTPA 1RI5A 2A14A 3ORHA 3CKKA 4OA5A 4PINA 1ORIA 4RSRA 5CCBA 3A27A 3GDHA 2P35A 5FADA 3FZGA 5KYGA 2BH2A 1ZHFA 5F2OA 1WS6A 2XYRA 2PGXA 4AX8A 1AV6A 4FGZA 1TPYA 2NXJA 1T43A 1XCLA 1R18A 2YXEA 3JWJA 3X0DA 4YUVA 4DCMA 5M5BA 3KQTA 4QQKA 3DMGA 3G89A 2ZCJA 3SGLA 3DTNA 4F86A 3FYCA 1O9GA 2YR0A 4QPNA 2JHCA 5EHGA 3K6RA 4BP3A 5ICEA 3OPNA 4GQBA 2O05A 3EMDA 5E1BA 5LQJA 2O57A 4IWNA 1ZQ9A 1DL5A 2P41A 2V7EA 2R6ZA 3B7PA 3GRUA 4AZVA 1KR5A 3G5LA 5F2NA 4GF5A 5ERGB 2P1DA 5DSTA 5FWAA 3SSMA 3DLIA 3TLJA 4X1OA 2FK8A 2QRVA 3C6KA 3EGEA 3E8SA 2P8JA 2FYTA 4YV0A 5BP7A 4IV0A 3KU1A 5JR3A 4QTTB 1ZKDA 2AN3A 3HCFA 4FP9A 4QVGA 5CVVA 5K09A 2PBFA 4GC5A 4X63A 2HWKA 4MWZA 1TW3A 5GIOE 3E23A 2BR5A 2PJDA 3P9CA 4HTFA 2PT6A 4C4AA 1YF3A 3MTEA 1KPHA 3MCTA 3TOSA 3B5IA 5FQNA 2IH5A 1EJ6A 1XJ5A 3A7EA 4RTOA 3OU6A 4P58A 4PYLA 3DMHA 3FPGA 5DLYA 5E8JA 2VP3A 4DKJA 1G38A 3I9FA 1FP1D 3BUSA 4P7FA 4XUEA 5K0LA 1RI1A 3G2MA 3OFKA 3PLAE 3PTAA 3MTIA 4PONA 5DM1A 2AVDA 4YUWA 2ZZNA 3UWPA 3BKWA 2I62A 2H00A 5HILA 4WXHA 1O9HA 4M7RA 4GOOD 5GM2A 3LBYA 2IBTA 1XDZA 3ER8A 3SVZA 4HGYA 1VBFA 2ZIFA 5B1SA 4PYNA 2YUIA 5C1IA 3FUXA 2P3OA 3BGVA 3P2KA 4KWCA 5K0FA 5GP1A 3F4KA 3CBGA 3KQYA 3UA4A 2FHPA 3MERA 5EIWA 4IKPA 1N7IA 4A6DA 2GAFA 3DXYA 4V0RA 3TPZA 3FRIA 4OBXA 4R8RA 4BLVA 3GJYA 3LECA 3MGGA 4E2YA 5BW4A 2ZZMA 4MHTA 1QANA 3MCZA 2VDVE 3A26A 1ZG3A 3V97A 3VSEA 4C08A 4HH4A 3TQSA 4RX1A 5K0BA 2BR4A 3ER9A 5E1MA 2QM3A 3DH0A 3PVCA 3KR0A 3SR4A 4X60A 3ERCA 5HOQA 1PJZA 4MTLA 1O54A 3IHTA 2N47A 2NYUA 1SVUA 1UWVA 3HEMA 4F84A 5DX0A 4PGHA 2ZFUA 3UJ9A 5E2BA 4RTLA 5GOZA 3SM3A 3ANXA 3DOUA 2P3QA 3IEIA 4GUAA 1P1BA 3DP7A 5E1OA 5FHRA 4ISCA 3UJCA 4DM3A 5FA5A 4OQDA 2FRXA 2C7RA 1Q0TA 1VIDA 2ONYA 4RYLA 4Y2HA 2F8LA 3DXZA 3JWIA 5EPEA 2ZLBA 1HMYA 3BZBA 1JQ3A 1FBNA 3ELYA 3PT9A 4PYIA 1HNNA 1QZZA 3UZUA 2CMGA 5FUBA 4FS8A 3T0IA 5K0EA 4OBWA 2B2CA 5E9WA 3A25A 3M70A 1L3BA 3P71T 3QOXA 1D2CA 2I9KA 1G8AA 2O07A 4U7TB 1VQ1A 2ZIGA 1RJEA 3HCDA 4R6XA 4R8SA 5ICFA 3DULA 3R6TA 2ZIEA 5HFJA 3LKDA 4JXJA 2Y1WA 1OR8A 3IV6A 4QDKA 5DXJA 3KQMA 3R0QA 3KQSA 2ZBQA 2ZBRA 4FR0A 2NP6A 1VLMA 3GWZA 4V0QA 2P40A 1TW2A 5DRYA 1XCJA 4YMGA 2NNWB 2GB4A 5LQCA 2IH4A 3SXJA 2HV9A 4KRGA 1G60A 3SSNA 4E32A 1L9KA 1BKYA 4RTMA 3PFHA 3M4XA 3LHDA 3FTDA 1KHHA 2IPXA 3FUTA 2AOTA 3HVHA 4FSXA 1M0EA 3HA7A 5EQJB 5K03A 4RV9A 2HTEA 3SSOA 1RJDA 2I7CA 1SUSA 2PWYA 2VS1A 5FCDA 1L1EA 1YZHA 2AVNA 3AXSA 9MHTA 5GM1A 1JSXA 5DX8A 4EMSA 2Z6UA 3OFJA 4ER0A 3GXOA 4EQZA 2ZULA 3HVJA 1RI4A 4HSGA 5DXAA 4RVGA 3HCEA 1EQAA 3KPYA 1EJ0A 4PCAA 1SQFA 4E2WA 4OX9Y 5K01A 2UZ4A 5FWDA 4X41A 1YFLA 1SKMA 5FULA 4PWYA 1FP2A 1VP9A 3C0KA 4POOA 2FCAA 4RVHA 2EX4A 3CJQA 3OZRA 4DF3A 1X1CA 5E2AA 4YUZA 3M6WA 4KIGA 4LWPA 5KS2A 5IKMA 5LQKA 1JG3A 2PT9A 1D2GA 4XUCA 1KIAA 1MJFA 3KQWA 3PX3A 4ER7A 3KPJA 2ZZKA 5EEHA 5IH3A 4YUXA 4E2XA 2K4MA 5U4XA 5LQRA 4M38A 1VE3A 2IGTA 3DXXA 4RTRA 1KYWA 3H2BA 2O06A 3BKXA 3P2EA 3B3GA 4RTQA 1YZ3A 3A4TA 3REOA 2YXDA 5GWXA 3UJ7A 5C9ZA 3CJRA 2OBFA 3GNLA 5DSXA 1KP9A 1NW8A 4PYMA 3RODA 2ESRA 2UYOA 1I9GA 3LX6A 4YUYA 3OZSA 4HC4A 5FTWA 1H1DA 2XYVA 3DR5A 4G56A 1PRYA 4GOND 1NT2A 3PB3A 1SUIA 1NW3A 3ID6C 5CVUA 2YXLA 5H02A 4BP1A 5K05A 1EAMA 3L8DA 5DTRA 3K0BA 3LBFA 2PXAA 4AZSA 4R6WA 3FTFA 3UFBA 7MHTA 3NMUF 1R8YA 4X61A 5EKUA 4E33A 3P9IA 3M6VA 1YFJA 4BLUA 2DULA 1XTPA 3HNRA 5DTQA 1KXZA 3FTEA 1G55A 4MQ4A 3HCBA 2P7IA 2B78A 3G88A 4C06A 1G8SA 3T7SA 2JG3A 2R3SA 4E31A 2IIPA 3P9KA 2ORED 4GOLD 1VPTA 4XCXA 2NP7A 3B89A 1INLA 2JHAA 1F38A 2G72A 4HRAA 2LD4A 5CVDA 1NKVA 2KW5A 2IFTA 2XVMA 1NV9A 4DZRA 5DM4A 4P7GA 5ICCA 1UIRA 1NW7A 1P1CA 1X1AA 1YB2A 2PX2A 3M33A 2EJTA 2PWPA 5KQSA 4GEKA 3GU3A 1QAOA 3Q7EA 4CKCA 4EK9A 2DPMA 3EEOA 2NXNA 4PCLA 5EKXA 3T7RA 3FYDA 4RTKA 5MHTA 3TM4A 2AS0A 3OU7A 3KPVA 2AN5A 3NDIA 1Z3CA 3HP7A 3KQVA 5K8VA 1B42A 3BWMA 1L3IA 2EJUA 4GC9A 1WG8A 4M36A 3KHKA 4HTFB 4ER3A 2IDKA 3EGVA 2VDWA 1XDUA 4CXMA 1P39A 3TRKA 3FPFA 2AOWA 2UYQA 3OE5A 4KVZA 5CVJA 3NW9A 3HCAA 1N7JA 3VC2A 2IH2A 5FA8A 5EMLA 2AR0A 3KQPA 3T7TA 4C07A 2PV0A 4KIFA 1RI3A 4AZTA 2PXXA 5G02A 2IBSA 2Q41A 2WK1A 5EMJA 3B3FA 3EEYA 2PX4A 5HIIA 3AJDA 2G71A 4GBED 4HG2A 5DTMA 4CTKA 4K6MA 5LSAA 2GLUA 3OU2A 4ER6A 1UFKA 2ONZA 3FUVA 4M37A 3BGDA 2V74B 3MQ2A 1X19A 5LQNA 3UJ8A 1M6EX 1YUBA 2PXCA 2ZWVA 4QDJA 4UOEA 4PNEA 2QY6A 4DA4A 3LCUA 2OB2A 2JHPA 3TFWA 2B25A 2B3TA 2YX1A 2ZBPA 3G2PA 2PKWA 4CKBA 1NW6A 3O7WA 4WVLA 2UYCA 1FPQA 5EHIA 2G70A 1WXWA 2PVCA 2OKCA 2P7HA 3ELWA 5BW5A 2WA1A 4CKEA 2XBMA 2PSSA 5DM2A 2BM9A 4RWZA 3O4FA 4ER5A 2FK7A 4PGGA 3JWGA 2VZ9A 2CL5A 5HIKA 1IXKA 5EOVA 4C04A 3GRRA 3GRZA 3E05A 5BXYA 2GS9A 3OE4A 1WY7A 3G2QA 5DT2A 5T67A 5K0JA 1R8XA 4CTJA 4YMHA 5KVAA 5E1DA 4RTSA 3CC8A 3M6UA 3LDGA 3NWBA 2H11A 5CM2Z 4Z2YA 3PS9A 4LG1A 4EKGA 4RTNA 1N2XA 3GGDA 3EMBA 5DX1A 3HM2A 5DWQA 3THRA 4F85A 1DCTA 2Z6QA 3HA3A 1NV8A 3WSTA 1IY9A 3BT7A 1Y8CA 1KPGA 5FHQA 4YV2A 3FRHA 1ZGJA 1KYZA 5DM0A 4DMGA 5D1NA 3EVZA 4DCGA 3GRVA 3I64A 2EG5A 4FT2A 3V8VA 2O0LA 2H1RA 3TKYA 2PX5A 1ZGAA 3UJ6A 3FPEA 2AOUA 2BR3A 4PIMA 3FPHA 1FJXA 4FZVA 1BHJA 3EGIA 5F2KA 2WA2A 5LR6A 5EGSA 1DUSA 3NDJA 2I6GA 2OXTA 4RVDA 5CUQA 2HR1A 3I53A 3EVDA 2AOUB 3NJRA 1IM8A 3EPPA 1F3LA 3D2LA 4PYJA 4U7PB 3I5UA 5ICGA 1MHTA 1R74A 1BOOA 2FPOA 3E7PA 3JWHA 5KQRA 1QAQA 1SG9A 3UJDA 3HA5A 4DQ0A 3BWCA 4P7KA 4BY9E 2BZGA 3P9NA 4R05A 3UJBA 3C6MA 4KDRA 1NE2A 5EG5A 4RVFA 2CWWA 3EVGA 5K0NA 3P8ZA 1R00A 3UBTA 3CVOA 1EG2A 1JTEA 1RJGA 2PLWA 3ELUA 5P8WA 2ZTHA 2HMYB 3GO4A 4KW7A 5EZSA 3MHTA 5EZQA 5E9QA 3RIEA 3UA3A 1JTFA 5HZMA 2OZVA 2C7PA 4C05A 1JR4A 5CCXA 3TM5A 3NWEA 1WXXA 3KR2A 2UYHA 3MAGA 3PFGA 2B9EA 2GH1A 3GCZA 5EC8A 2G1PA 3OCJA 2ZW9A 5LQAA 4BLWA 2HNKA 4PYKA 1L3CA 2G8NA 4MIKA 3EVBA 3HCCA 3LSTA 5DPMA 3DUWA 3AWIA 3B3JA 3FUUA 4E70A 2IP2A 2OO3A 3CJTA 3LKZA 5HIJA 2P3LA 5GINE 3RW9A 3KR9A 4QTUB 3G7UA 3MB5A 5EVJA 2PY6A 1VL5A 1SQGA 4ATNA 2ZVJA 3HTXA 3EVEA 3LDFA 2CMHA 3SMQA 5K0CA 4L7VA 4LECA 1XXLA 3UJAA 3TMAA 4B17A 2CKDA 2YQZA 3G2OA 1AQJA 2NXEA 1VP3A 3FPJA 3BWYA 4A6EA 2JJQA 4AUKA 1JG4A 4FT4A 2XVAA 4OQEA 2OYRA 1NBHA 4O29A 5EEGA 3TKAA 2C7OA 5CVEA 5EIFA 2AN4A 3M6XA 3QV2A 5EMMA 3C3YA 1BC5A 3BGIA 3NTVA 1AQIA 1XDSA 3LDUA 2OPBA 5T64A 5DRTA 5GIPE 4EKIA 1X1DA 2GPYA 3EVAA 2Y1XA 3CGGA 3OZTA 3LCVB 4H0NA 3R24A 3LCCA 4ZTBA 3Q87B 4YV1A 5JUWA 5CIYA 2AOTB 2NXCA 1JG1A 3FUWA 4LWOA 3VYWA 2ZSUA 3GIWA 1XVAA 5E9JA 1KPIA 1WZNA 10MHA 4QQNA 2AOXA 4QPPA 2Z6AA 3AY0A 4P7JA 5D1HA 1QYRA 3BXOA 3GRYA 3KR1A 1JSZA 1NBIA 4KDCA 3KKZA 2ZWAA 1ORHA 3G8BA 4FSDA 1QAMA 3EVFA 3VC1A 3AXTA 3KQOA 4RTJA 3THSA 2OY0A 3PX2A 3KPWA 5K0GA 4IV8A 3NVKI 1RJFA 5LQUA 1U2ZA 4AZWA 3U81A 3ME5A 3G5TA 5T6BA 4PYQA 3G8AA 4PYOA 3FTCA 2JH9A 3I58A 4NECA 1V39A 5CD1A 2C7QA 3SX0A 3EVCA 5HIMA 2QYOA 4E2ZA 3S68A 3LL7A 3QOWA 4Y30A 5C0OE 1I1NA 2VDUE 1G6Q1 2ERCA 3CCFA 1NW5A 3BWBA 3HVKA 3LGAA 4GOMD 2YTZA 3DLCA 2EFJA 2GA9A 2JH8A 4OA8A 2AOVA 3P2IA 1M6YA 4PIPA 1P91A 1JQEA 1EIZA 4CWAA 2ADMA 1X1BA 1D2HA 2PX8A 3P97A 5EMKA 8MHTA 1Q0SA 2QE6A 3TR6A 1JQDA 3A7DA 2E5WA 3ELDA 5HEKA 3R9XB 4C03A 3R3HA 4QVKA 2YVLA 4E30A 1RI2A 3IYLW 3C3PA 4HGZA 1AF7A 2OB1A 1JG2A 3DMFA 3KQQA 1R6AA 2AZTA 2QRVB 3NVMB 3O31A 5E8RA 4EVIA 3HVIA 1I4WA 3LPMA
chains in the Genus database with same CATH superfamily
2WM9B 2IDJA 3C5HA 3DR3A 5F5XA 2RIRA 3C4VA 3IDQA 4I50B 4PNZA 4U7HA 1ORIA 3F4LA 3SBEA 4DSOA 1B43A 4KNVA 4Q9AA 3FZGA 2BH2A 1UH5A 3AR2A 3I5YA 3R5TA 1IN7A 2YJ3A 1WS6A 1GIAA 2JLRA 1CT9A 3NHRA 5GJCA 4ZIRA 5ALGA 1KQFA 4B2IA 4UUNA 5HJEA 3LPAA 1P1FA 2H7VA 2BEVB 4AJOA 5KWIA 4HPJB 5TXGA 1O5OA 2C2GA 1ISSA 2OA0A 1Z6AA 4QPNA 4PC6A 4CLXA 1XLTC 2ZYIA 3EIUA 3IMGA 1K7YA 2GBLC 3GDGA 3M5PA 5ALNA 4QJBA 1T24A 4GQBA 3TW4A 3B9QA 3ZGNA 4YJGB 4OLFA 1T29A 1X42A 5CT9A 3UJNA 3L7IA 4ZDKA 1E3LA 2X9GA 2BHNA 3AIOA 2FW7A 2JJ1D 5IDYA 3EDYA 1I0LA 4OI0A 1YR6A 2VH5R 1RC0A 1NP7A 1CUUA 2CZCA 2CD9A 2VH1A 3BA6A 4L5JA 2FE4A 4FHDA 4HXFB 3TQRA 1WY5A 4BNYA 2ANCA 3ILVA 3WIDA 2FWMX 2EW2A 5CEFA 4KOAA 2NADA 1G3MA 2X0DA 4R69A 2ACEA 5CFLA 5KYXA 1RHUA 3P0RA 4MWZA 4YRZA 1VMEA 2J7PA 2WB2A 3P9CA 4DJAA 3IXMA 2DC1A 3TOSA 4KX3A 3F3KA 3C48A 1BXRB 1VA5A 2H08A 3WAGA 1JSRA 4O6VA 4BNIA 4PFQA 4JMPA 3NHKA 4GOXA 1L5GB 4OHRA 2B1GA 2OG2A 4MV6A 4DRXB 1FFCA 4E3ZA 3PNBA 1L7OA 3DL4A 3FFWA 2WQZA 1MGOA 3ZXUB 1JQ5A 4WGGA 4M60A 3B12A 2Y1EA 4BU1A 1CJUC 1ZESA 2MYUA 1VJRA 2GJ4A 4ZQBA 3KKKA 2J59A 4EOGA 4F06A 3DZBA 4ML3A 4IDGA 1R66A 1EFRD 2W6ZA 3K6KA 4XVCA 4ZGWA 3HWRA 3NTOA 4G5XA 3WS7A 5DJ5A 4QATA 1HFWA 3WYNA 1S5PA 2O1XA 2RHTA 3VBEA 3KC2A 1BCRB 1O97C 3EEIA 1F2UB 1GRVA 4NYJR 5FO1A 3P9PA 2RG7A 1ZN8A 1H8HD 3BGVA 4G81A 4BQEA 4J0FA 3S29A 1PT8A 2EW1A 5DU2A 2XY4A 4AULA 2GRAA 3RS4A 3IDFA 1BCRA 4HAUA 3MGGA 2B2NA 5DYNA 3IEVA 1ZONA 4O63O 1A5BB 3QXGA 3U9SA 5K2MA 4OFZA 3O3NB 4R9UC 3VHXA 821PA 3KTAB 1A88A 1GWNA 2Q5OA 3GI1A 4PVCA 4BZQA 3KR0A 3KQUA 1YZUA 4LZJA 2QV7A 2P9BA 3JYNA 4BRSA 1R6VA 2W11A 2YNMA 3BULA 3EY4A 2XT0A 5CVCA 3H11A 1ML3A 4OOFA 3ZEAA 2Z5FA 2X6TA 1ESDA 1ZD8A 4MYTA 4Q3BA 1FF9A 3EZ2A 4AJIA 1SD5A 5KQGA 3VXKA 2QTTA 2J9FA 3GV0A 5EJMA 2WKRA 2CC2A 5EFZA 4M53A 4AROA 1U7HA 2DAPA 4M9XA 4R2WA 2OAEA 2AFIE 1NVAA 3H1PA 4X3PA 3VDMA 1GPKA 2BFWA 1XA0A 4DIMA 3ELYA 4HYEA 4OB7A 1G8GA 4AG5A 2CMGA 4C4TA 1F51E 3G8DA 3T0IA 5L40A 1XJWA 3EVNA 3A25A 3LK6A 4H59A 4ZYVA 1Y6FA 2I4OA 5FOVA 3DHWC 5CYGA 4YCSA 3RC2A 2H2AA 2ZUFA 2VT3A 4IDOA 4FQ8A 3LLCA 4H0FA 2QTMA 2R79A 3ONWA 2XCSB 4OXQA 2RGCA 4KACA 1O94C 4AJ9A 1OX5A 2XUKA 1PL8A 2Z4RA 3NI2A 4L72A 1JB1A 1A8UA 2PUTA 1ZLXA 4MV7A 4TVBA 4TM8A 4AKEA 4ZCRA 3O8RA 1CE8B 4NU6A 3GLIA 1TW2A 3TW6A 1M54A 5TR9A 1R4MB 2BF4A 5EQFA 3ZGOA 1T2UA 2IPNA 3O26A 3AR8A 3D64A 3S4YA 4FFRA 2QGFA 3CUVA 5ALMA 1IAQA 2OV6A 5LN1A 3LOUA 3VGJA 1L7AA 3L84A 4BNTA 1BGXT 2HX1A 3KZNA 4RU1A 3ZW8A 3STVA 3T0FA 1RPAA 1HETA 3N76A 4B3GA 5C1BA 4KUGA 4CCAA 1QRTA 1H94A 3BCRA 2WR8A 3EH2A 1SXPA 2QQ0A 2XUQA 1LDGA 1V5IA 4OLBA 1H0HA 1T6BY 2AF4C 3GUZA 5AW7A 1J70A 1SVMA 5KVVA 4HMOA 3BTOA 3DE7X 4WXPA 2CHGA 3A4VA 5DXAA 2AZMA 3C6QA 3RS9A 3PXDA 4XX0A 3B6JA 5KX5B 1NBMA 4I1UA 5LMUB 1QFSA 3NAMA 4ESOA 1SAYA 4W8OA 1HM5A 3L8EA 1VMAA 1L7BA 3H3FA 1SHJA 1AOXA 2L19A 1VP9A 2DTDA 2M6KA 3A4MA 2HXYA 3OZRA 5CB6A 5E2AA 5LQKA 5I4IA 4AN0A 3ZGXA 1E9CA 1L5SA 1C3OB 5C8VA 4UHDA 2PYZA 2P5SA 5HZKA 3UOWA 1AHNA 4YXFA 4YEDA 4EHFA 5C8XA 4YAFA 5MGBA 1I2BA 3T34A 1W581 1T3TA 1N0VC 4U2EA 3OHPA 1FS6A 4ZYUA 1QF6A 1TK3A 5C1DA 4MI3A 5J47A 3GLGA 3GC6A 1Q7RA 3INYA 4RWEA 5FTNA 5CA1B 1QHXA 1POXA 1JT9A 4KSCA 2GHTA 2QS9A 2X13A 4J2HA 1N5LA 4YPVA 5L7TA 4V2IA 5JS1A 2VRNA 4RSGA 2QX7A 4ZV9A 2FF7A 2FEPA 3BXHA 3V1KA 3UJPA 1GYPA 3VZCA 5KJCA 2QLFA 3VNQA 4ZCLA 4P5PA 2I65A 1AKVA 1LI4A 4OMCA 4MKFA 4MA5A 2ZJ1A 2MSWA 2JA1A 1C7EA 1XQ6A 2HHLA 2OCYC 2VP4A 5TNXA 1JFSA 2K2WA 5DTQA 3WLOA 4MVJP 3FYUC 4QFMA 4CR6A 4P33A 1OB5A 1ISRA 2ILTA 4H9GA 2QD2A 2H1SA 5KUTA 1SUBA 4ZT4A 1Z0ZA 2DZDA 4KH0A 1R0SA 5CG1A 2NP7A 3IE0A 1Y6QA 1FFHA 1XN4A 2LD4A 2CUKA 1T2VA 2HEIA 1M6VB 3VH1A 2H1HA 2OESA 3B38A 2X58A 1NW7A 2RGAA 4RD2A 1M6WA 2ZYUX 2CD7A 2YJZA 1CJBA 3DE6X 4G5YA 4CKCA 3L6UA 4RGBA 3FYDA 3IP1A 5MHTA 2ZSFA 4DA9A 2G88A 4JEUA 3JVEA 3B36A 3BDVA 4GLJA 4OQLA 4ZT6A 4TZ6A 1NTOA 2VTKA 4FN4A 4HTFB 1E1CB 3RVPA 1RDFA 1HQCA 1TM4E 5FPYA 3WOVA 1YO6A 1QG0A 1V8BA 3BMXA 1Q6YA 3MZ0A 3L3BA 2Y0PA 5F51A 5M3BA 4FNAA 5DOZA 1QTIA 4QNNA 5DWDA 3IBCA 5JXJA 2V4ZA 1H8EA 4HVTA 2F48A 2HK9A 2XMBA 4WLOA 4BQSA 4O5AA 4YQEA 1NOKA 2QN2A 1RI3A 2RHGB 2NQ2C 3OWOA 3WA6A 3LKVA 3C8MA 3GDFA 4PPYA 2RGNA 5D5QA 5JVDB 5AW8A 4N0QA 1UOOA 4NI5A 3F47A 1EFPB 1KARA 1FA9A 2HO4A 1V6SA 2Z3VA 1M83A 2ZXFA 2J5XA 3ABRB 3NP7A 3SHOA 4CTKA 3CVJA 1GVNB 4ERNA 2PANA 2PRYA 3JQ8B 4B2PA 1M6EX 1YUBA 2W6MA 3EG9A 3K1TA 3QNWA 1QRAA 2I4NA 1AKUA 2QY6A 3FOAA 4M83A 4Y2RA 3ZWKA 4FS3A 3QY9A 3TVDA 3TF5A 1KZ6A 2IITA 4EMUA 1TU3A 5DB4A 3SBDA 1MB3A 1TCUA 1UBNA 3H2ZA 5KSWB 4H7DA 1T5OA 3GFSA 4YAKA 1N4DA 5LU9A 2D7DA 1QZ3A 3VR0A 1U7OA 4ZT2A 4PPGA 4GECA 4L8VA 5EJ4A 2IEYA 3GGJA 4MV8A 1R9MA 3RANA 1HQYE 3GRZA 1GZ5A 1P0MA 1ZUD1 4F5ZA 1RYDA 1QP4A 3TIGA 1QH9A 1U0HC 3UCXA 3GRAA 2B83A 2BLNA 2B0JA 4CTJA 1T1RA 2GYWA 3C1TA 1G8PA 2FKNA 3DT8A 4KPEC 4FYWA 1OZGA 3CF6R 5TQ0A 1XTVA 4C30A 5BN3A 4EIWA 3IE1A 1Z4OA 1EP9A 2R47A 5H59A 1AB6A 1XA4A 2WD7B 5LUAA 2XCRB 2CV2A 1YJAA 3DEKA 3Q1LA 4S3MA 4UUBA 2XECA 3HSYA 4EARA 2B5WA 3ADOA 3NV7A 1IYZA 2WOJA 2HQOA 2RGBA 2R5NA 4ND3A 3BRSA 1M8JA 1U1GA 1BN6A 1LNQA 2PUBA 2Y1LA 4EZIA 5DCLA 2O19A 4BEVA 2IHTA 2I3BA 3BPSA 4G89A 2XKAA 1H0KA 4XR9A 4QEDA 4YCDA 2WW8A 2MSEB 3LOQA 4KX5A 1E1YA 4Z9BA 1Y8QA 2B30A 1LW7A 4H0CA 3LUJA 3N59A 3NP9A 1JPUA 2ZQ5A 1E0SA 3EVDA 2GCPA 1IM8A 1FU7A 3WGMA 1CY4A 3D2LA 5LC1A 2HCFA 4HXEB 3TSWA 4DLYA 4O2AA 1BDIA 1KAMA 3AVPA 2VUIB 3OZCA 4F3CA 2QF7A 3BIFA 1LQUA 3HA5A 1Q1AA 2EHJA 2AR9A 2GXQA 4RYDA 2DH6A 4G4SO 4KAAA 1CEYA 2FB9A 2HQ1A 5CJPA 3JVIA 4K1LA 1KMHB 3GP5A 2CLCX 2JIQA 4JHLA 4KQWA 4OF4A 4Q39A 4ZEWA 3B70A 3CRMA 3UKJA 4Z4EA 4MGIR 3R0IA 4WADA 3FWNA 1B76A 3UOGA 4D26A 1GZHB 2I2AA 3DBHA 5EZQA 5DN6D 6PFKA 1JLHA 4AG6A 3SQXA 1D0SA 4MAMA 2AMVA 1S3SA 4CMGA 4LDQA 2AG6A 4D8VA 3G3EA 5ENVA 1XDGA 3DVQX 5MDHA 4DIKA 1PWYE 3QYJA 3IBFA 1GTMA 4CT4B 1OD6A 3V80A 1XZAA 4R8VA 4E21A 4YRIA 2H2IA 3UPDA 2HAEA 2Y05A 3O8OB 1IXZA 4R1MA 2NO7A 3GN2A 3H86A 5J5AA 1GZ3A 4F56A 2JBHA 1SQGA 3WB0A 2FSHA 3EVEA 4WCFC 1UOPA 2R5WA 1CJMA 2PV7A 3QF4A 2OK8A 2XLBA 2JIOA 2NU8A 4TWBA 1VPWA 1E1DA 3A2KA 2C8JA 2FJUA 2OQRA 4JNCA 5KINB 2BFFB 3QX8A 1VP3A 2NVUA 4EHJA 1MA3A 4EQ6B 3JTEA 2D1FA 1SCNE 1VE5A 2OV4A 3UKDA 3OICA 2J5BA 3P2YA 4G65A 2RI0A 4HDOB 4YASA 3V3KA 3USES 5BSGA 1P2VA 3H8SA 3S1SA 2W2LA 3DCYA 1O58A 1I6LA 5T64A 3I4FA 1IY1A 2GI4A 5LQMA 3GLTA 1I1HA 2GPYA 3SR3A 4B47A 5AW1A 4HGRA 4JGGA 3Q2OA 3R24A 3GA5A 3OZDA 3OOSA 2ZRIA 5K20A 3SZUA 4MW2A 4DQDA 5GGYA 3ANTA 2NM0A 2XWSA 2CLOB 4KSYA 3TLZA 1E4VA 3UAGA 2G80A 7AT1A 1M9NA 2AOXA 3T3OA 1BRTA 2FPKA 3DAOA 3P94A 5ESXA 1THMA 3BXOA 4DM4A 3CCBA 4KNYA 1GPJA 4MQFA 5EZYF 4RCVA 4AKTA 2HZ7A 2Q28A 3A70A 4GZ5A 5FUQA 3SYKA 3AESA 3OTWA 2D7JA 3R2JA 4R5MA 2I2WA 4B40A 4J0CA 1G7SA 3RFFA 3KPWA 3U7EB 1ENZA 5B1EA 2LRHA 5KIAA 3R3SA 2TYSB 4RORA 2DH5A 3PNSA 2GN2A 3E2MA 1ODLA 1U8ZA 2JAQA 5LB4A 4ALNA 1UFQA 2PL1A 1U90A 5CA1F 1RZ3A 2P3SA 4FNGA 3TL6A 5GJBA 5A0TA 3RU2A 3KZMA 3QMWA 4PZDA 1HDOA 4ZIRB 4E0BA 2W22A 1N9GA 2BELA 2W58A 1G6Q1 4YAJA 4H3KB 1B6TA 1XJ0A 3MQ4A 3LGAA 3MRXA 4HNRA 5DYTA 2FEWB 4DAOA 3A6FA 3INNA 3RR2A 1A7UA 1FXWA 2X4GA 3JQAB 4OSPA 1U9JA 1WLYA 1YUMA 5EMKA 3V8MA 4HK4A 1IZ9A 3P5SA 3UGQA 3E81A 1IUPA 1US8B 2XZPA 5BN5A 1O5IA 2FLVA 1N8NA 5AW6A 2D2EA 4FN5A 4DIEA 4DRYA 3GLFB 3QWHA 2PEZA 1Q19A 1V71A 3TWOA 2OGTA 3QLJA 5CM8B 2A94A 2P27A 3KT0A 3SK0A 4X84A 3JD4A 2W71A 3WAKA 1HT1E 3F7MA 1ZCBA 3PKIA 5I9BA 3CKKA 1GTZA 2EJCA 3GUHA 3COSA 5BNWA 3GT0A 4INJA 3LMKA 3CUSA 1ZD9A 3HPQA 1RWMA 1T4CA 3MUNA 5GJVC 3AU9A 1TPYA 4R8LA 2X77A 5DNUA 1T43A 3EA5A 2WBLC 5DW3A 3FTPA 3SZGA 3B1WA 2FSSA 2MU1A 3I32A 1QS0B 2BCJQ 2O3UA 4GYJA 2ZCJA 4EO9A 4UOZA 1EK5A 3TL3A 2X0JA 3EFOA 4MARA 1YJCA 2FX3A 4IVPA 5L8VA 2O05A 1CYEA 1QZXA 2W6JA 4QYIB 2O57A 4XWAA 4KQ2A 5F23A 3L1JA 3L40A 1CVRA 3BTVA 3UCEA 3U7QB 4DQLA 2P1DA 3LPDA 3MA0A 5CU7A 3S27A 2YFYA 4UHEA 1YC5A 3MMPA 5L7YA 4R3WA 2WJ6A 2ZUWA 4EGSA 2PK3A 2VJDA 2XQVA 2WINI 3F71A 1J25A 4LJAA 3KTOA 3WMEA 3R44A 5HCUA 4YCNA 4GLOA 2Q8PA 4L6AA 4LDRA 2JD1A 2V3VA 3CLTC 2Q7DA 2VTEA 4NKRA 3WQRA 3EPKA 3OKPA 2DE0X 1JZSA 5ICSA 1CJCA 4IFBA 1TO1E 2HTFA 3P9XA 1EJ6A 1KY4A 2PRZA 2VSFA 2ZI5A 2ZT6A 4JP5A 4LDPA 4Y0VA 3RYIA 2NACA 3UICA 3A7EA 4DCTA 1NG1A 2RGWA 4DLLA 3CSUA 4P58A 3DMHA 4Q6WA 2OORA 2FSFA 5DLYA 5E8JA 1G38A 1M2EA 1ZGBA 2QYTA 4XQGA 5G53C 1GD1O 5AXDA 1HOXA 5MN5A 1WCWA 5K0SA 4JD5A 1TEHA 2VC2B 1FNBA 4RHCA 1JV2B 3PTAA 3SXPA 1ZO8A 1JFFB 3THYB 4Z86A 1JDZA 2DR3A 3E0XA 5JH7F 1P9WA 5C4GB 1XZQA 3QKUA 4LYYA 4WZ6A 2RSLA 1NURA 1E1NA 2FVXA 2FEAA 1MB0A 2JF0A 2QD5A 2AA3A 2ZE7A 3DOIA 5AIBA 4JYAB 4TMTA 4F4IA 2VHJA 1QH1B 1MU0A 1ZS9A 3BRWD 4NV1A 4P4SB 2IYSA 5EIWA 4UAGA 4E46A 4BGUA 4TUYF 3A14A 3QVMA 2KSQA 3CW8X 3DHNA 3O4IA 1KQGA 3F9RA 5FYQA 4L3WA 1O03A 3KEGA 2ZYVX 2QUJA 3NANA 4F9FA 4K86A 2WM8A 3QVJA 3LWNA 1L4GA 3DNPA 3F2VA 3ERCA 2BZSA 2O59A 5F21A 1SCQA 2Y9PB 8OHMA 4HNTA 4IDNA 4TZ0A 2JC3A 2YZ2A 3QKSA 4BV3A 3KV3O 4W9NA 4RY2A 2C7GA 1Y5NA 4UE6A 1SIOA 1QTNA 1LWNA 2Q6VA 5ERXA 3WBBA 4UCFA 1PAUA 4D74A 5H9VA 3NS7A 1XVIA 3AR6A 3GJ3A 1EJBA 2JFVA 3IT0A 4NX2A 1YR2A 4W9NC 4B7ZA 4P93A 4CDGA 4DQXA 3EA4A 4W5OA 1IM2A 1EWQA 1VMIA 1L5OA 2Q49A 4PV7A 2BRUA 4Z4FA 2GOYA 3COPA 3MVEA 5GY7A 2GN6A 2RAPA 1CQXA 3Q3IA 2W2MA 2QK4A 3HSSA 4XVQA 1Y3IA 4FI3F 3G7NA 1TT7A 2OAP1 3F7NA 3PUKA 5TMDA 1EHIA 4TUYA 4V0KA 2QPOA 2FQQA 1TA9A 3I4CA 1F2DA 1OH5A 2NQTA 3HCDA 2YJTD 4O4JB 5CYPA 5HFAA 4HFNA 1DOZA 2A5JA 1DJLA 3FLBA 1GRRA 3CLKA 1HBJA 3PU6A 4JXJA 4Y2QA 4MJ3A 4XEUA 4LBVA 4H17A 4EI2A 4GLLA 3UAVA 2OFFA 1PR0A 1KP2A 1QHNA 5J2TA 2R6R1 3T0GA 1A82A 2OL4A 3K3PA 1JEEA 5E4FA 1NMQA 3KG2A 5FFNA 1UR5A 4YMGA 3NH6A 2ZM6B 3HGMA 4KRGA 4Z1OA 4BO6A 1JFRA 3SSNA 3WWPA 2CB9A 3VR3A 3V9PA 4EJ6A 1FSGA 2OC4A 1XKTA 2P6PA 1G2OA 3GZ4A 4JUDX 5BO5A 3ZHTA 2CN1A 1ULZA 3CX7A 1YONA 5SZJA 2XTNA 4V1CI 3QM1A 2FZEA 2JGFA 4C43A 1SCKA 1KZ9A 1GDDA 2HB6A 5CPBA 1IZ7A 2ZVQX 4CIYA 4I5IA 3AB8A 1OC4A 5FCDA 3R23A 4PQRA 4CUZA 2IIVA 3DTVD 3AXSA 1PZXA 1QGAA 1FNNA 3II6X 2HF2A 1ISMA 3U4GA 1XZPA 3L49A 4FOTA 1XZMA 1T26A 3F3SA 2PA0A 3GCWA 1U4OA 1J0CA 2ZP1A 4R16A 4JK3A 4ZVOA 5HRUA 4JI2B 4R8MA 1YJBA 2BD0A 3EZNA 3GA0A 4PHFA 3GVIA 1YFLA 2Y6VA 4ASUD 2HJWA 3L46A 1G8MA 5LUBA 1POWA 2REQA 4JJEA 3TIXB 1P61B 1VJ5A 4A9AA 2CLSA 2HSZA 1MX9A 4NG4A 1YZQA 5A5EA 1TAUA 4G37A 4LKRA 4ZK6A 3MJEA 5K2OA 2H2HA 5IP5A 4BJ6A 4BJHB 4LNAA 4XQEA 5IC5A 4UTXA 4DBZA 5BMOA 4FFWA 3SFVA 1T4BA 4EA6A 2ZYHA 4C4XA 4KI0A 4CU5A 2ACKA 2E82A 4RTRA 4EMBA 3IB3A 4TT8A 1V37A 1NZDA 3GK3A 2O06A 4MVJF 4RPLA 5EIHA 3V1UA 3UJ7A 3I2KA 1JLKA 3OX3A 4YQFA 3K92A 4TYMA 2O20A 3DTVB 4WNAB 3RQIA 5BUSA 5FWYA 1IVYA 4D1YA 4CLRA 3V8RA 3N8NA 5BV8A 4JR0A 4TOIA 1H1DA 1XZJA 2O5RA 4MYSA 5TQ2B 3L8YA 5JD6A 1Z7WA 3PR1A 4WOKA 1UJCA 5M7EA 1S2LA 1YDMA 3T8YA 3L0IB 4IQ0A 3IULA 3RGWS 3OE7A 4HWTA 3SMVA 1ZVQA 5FJIA 5JWRA 1DQPA 3G59A 1TGYA 1H6AA 5HDBB 5ALHA 4HGOA 2YN2A 4URHA 4YB8A 3O94A 3HQ4O 1BDHA 1U9ZA 1CHNA 4C0HA 1DEKA 4YRCA 4PY2A 5FNVF 3DWIA 3IBSA 1TEZA 2QAGA 1ZZGA 3KLPX 4N40A 4AYWA 1OIVA 3TSAA 3TRFA 3JRXA 1YZTA 2RKBA 1NUTA 2CF6A 1T8UA 3ASZA 4MV0A 4C0LA 4DC9A 1E7SA 3WGHA 3HKCA 1SVOA 5J9FA 1E2QA 1FOEB 2JHAA 4D81A 1K4YA 3AVYA 2AJ8A 1V9CA 4RPGA 3OQNA 1WXFA 1ZNYA 3N2KB 3OPXA 4HAYA 4NBWA 3DZGA 3WGKA 1GZ6A 1T6YA 4DWVA 4BE9A 3GU3A 3QELB 5FOQA 5B12A 4IX9A 1FX0B 1NRIA 4EZEA 4UU1A 1GG5A 5KVQA 3LPNA 1N9ZA 1PQWA 2A0KA 4I5EA 5IVDA 3VR6A 5B6PA 4W99A 5BSWA 1PTKA 3BWMA 3GT3A 5FTLA 1IONA 3FVWA 1E3SA 1FP6A 1ST2A 1GA4A 1L4FA 1L8AA 2AJDA 3QKIA 4JJIA 4H1VA 4Q3OA 3RLIA 3TRKA 3WYEA 2AOWA 2ZROA 4S0XA 2FSVC 4C0QC 4OX9B 1NVVQ 1QO0A 4O4LB 3JR7A 1MTOA 4DLBA 1SKUA 4W4TA 3KVVA 2PV0A 1K7FB 1K2WA 3DWGA 1CIJA 1K8YB 1KIFA 4I1RA 5GJWC 4AS3A 1JHUA 4DAEA 2W6CX 3PRHA 4YCMA 4UNSA 3DEAA 1J8DA 2F1IA 2Y9MB 2X14A 4JENA 1D07A 2BZ0A 3O1JC 4S04A 3D1LA 4D9KA 1CQJB 2AWOA 1L4EA 3WRYC 1WTCA 1BW9A 4GAEA 1K27A 5D6NA 5LSAA 2VJYA 1T15A 2C5AA 1N2CE 2ONZA 3EJ6A 3MQ2A 4JH0A 4QU0A 1F1JA 1PD1A 1KI7A 5LDDC 2H29A 4DA4A 5AUNB 2XNJA 4Q9JA 4WBNA 1S8AA 1XP5A 4MUHA 4QFBA 4HY3A 1XHEA 2WHEA 2YOGA 3BWVA 1N8SA 2UVDA 4YJHA 5IAGA 1RYEA 2QHXA 3CZAA 3TBFA 4HYTA 1TQHA 1XVUA 4QHTA 3ZDYB 2C83A 5HA5A 2HY7A 3KUKA 4FPXA 2E6KA 3KVYA 2WY2D 3VR4A 5HF9A 3VV3A 2IDZA 3O4FA 3CLSC 4HQOA 4IHAA 1Z38A 1PNOA 4RS4A 4CI0B 2G7MC 1TJNA 3R0XA 4DCUA 2ZOSA 1AQLA 5C46F 4GX5A 4ANFA 4IM7A 3FAKA 4NJEA 1R5JA 3LZDA 4Z8XA 4IKEA 1AA9A 1U5BB 1YIAA 1A5ZA 4LTNA 1NXWA 3CC8A 1TVCA 2JVJA 1P60A 4HX5A 4Z2YA 2HFKA 4D9JA 4RTNA 5B55A 3THRA 1R64A 1DCTA 5E3JA 2JLAA 4UUQA 2WP0A 2KJQA 4LRSB 3T4PA 3MOIA 1MB9A 2DFLA 3VYRB 4RQAA 5KTKA 4F4DA 4JQSA 1KYZA 1UJ4A 4CKBB 3NHPA 5IDXA 2JZOA 3X1MA 4BS9A 5D1NA 1YVDA 4E6EA 4DCGA 3L0BA 3I9OA 3GRVA 1FJ2A 3V8VA 4CEJA 3N6XA 2Y4OA 1L5QA 4CQLB 1I80A 4I50F 4RD6A 4OYYA 3FPEA 4PX2A 4QFDA 4U7WA 4X3OA 2J4FA 2BHSA 5J2UA 5AO9A 1JNYA 3B53X 1CUDA 2J9GA 2N1BA 5H1YA 5CLIA 1D3AA 5JOQA 1ZU5A 1GL7A 1HDZA 1M1ZA 1U7ZA 1U7PA 2QY9A 2QVCA 3CLUC 1HNWB 3QWIA 4G23A 3NJRA 3RD5A 3T54A 1WD7A 1F3LA 3CMMA 3BDIA 3G0IA 1V43A 5ICGA 2BP7B 2OHJA 3RKUA 3BTSA 1XN1A 3P0FA 4GHWA 2O0JA 4WMLA 1FQJA 1WAMA 3O83A 4DQ0A 4YO8A 4P7KA 3WYAA 2JA2A 2W00A 1K4KA 4AUEA 2PUDA 4M1EA 3EF3A 4D0NA 3I9KA 4ZYLA 3DZJA 1NXOA 1G9TA 2FRDC 3CPHA 4YJDA 5LA6B 2ISSD 4N82A 3FHTA 6GPBA 3RFVA 3R6WA 5BW5A 4R98A 3LJKA 5CNMA 3WGTA 4IZHA 2Q1TA 4XIJA 4AO6A 1KR2A 3AV3A 5LBTA 2VWHA 4UQLA 1ZL2A 4A03A 4REQB 2R00C 4UQOA 2OZVA 1JTFA 1HNZB 3B3AA 1GA6A 5F7XA 1QYCA 1YJXA 3PFGA 4ZZ3A 3U19A 3OHMA 4HQRA 2YNMC 5TGDA 1U9IA 3ZC3A 1U2GA 1Z6YA 4LJ4A 3WYGA 1RRPA 3ASYA 4ZDIA 2VVTA 3O47A 3PKJA 2KBEA 4MIKA 1ZW6A 2WYIA 3NDRA 5C7LO 4HB0A 4HQFA 3I5XA 2OBNA 1VIYA 4BWVA 2C4NA 3AEQB 2CFCA 5LXTA 1QLWA 2BHTA 4CBVA 2IEDA 3G7UA 4WRRA 4EB0A 2G5TA 1ICEA 3LDFA 1RRGA 3O8DA 4J49A 2WUDA 3LUFA 3NJ8A 4LJLA 3ZZMA 1R0LA 4DA8A 1C41A 1U5CA 3FCXA 3NCTA 4JU9A 2E4VA 2BOVA 1YA6A 2G82A 4XD7A 5ALXA 3W5DA 4NYMQ 4BX3A 5EJ9A 1TRHA 1MENA 1F20A 1F8FA 1G3QA 2HSJA 1V4BA 3MWLA 3QHAA 3TLYA 2CLEB 2G7ZA 3N7TA 2R2AA 5B3LA 4FB4A 1YIDA 1A9QA 2WSMA 1HEUA 3FA2A 1TUGA 4JLJA 4U6SA 3OSZA 3NTVA 3C70A 4JVNA 3LDUA 4M9UA 2GJSA 1SCBA 3LBAA 4JLSA 1TF5A 2ZUBA 3VZBA 4UDNA 2L17A 1BWQA 4E5KA 2C82A 3HCNA 4IDBA 4J0EA 4RKRA 4B7XA 4BCCA 1RE1A 4PN3A 2YCLA 1KJYA 4LRWA 4N8SA 4OGWA 3GMDA 5KOHA 1FVOA 3KEFA 1R37A 5IAAA 4UU7A 3WGJA 2XITA 1X7WB 2H18A 5HR5A 1L8QA 4TXMA 3ROFA 3HCPA 1E0KA 4ZOQI 2XBLA 5CB0A 2ORVA 2XB9A 1NZJA 3KR1A 5K3SA 3I45A 4OP3A 1W0CA 2Q6IA 1NDUA 2JRLA 4YK7A 1T8PA 1T2CA 4C4OA 4UD6A 1US8A 3OAAD 4PO9A 3NQ41 1XE3A 3GPBA 2NUAA 4LQLA 4L4RA 4XW2A 2GM5A 3DCNA 5IK2A 2PSJA 4GT1A 1QJCA 2BEUB 2C8VA 2P5YA 2HHJA 1VKZA 1FBTA 3EC1A 4H60A 4P35A 2PGOA 3AB3A 1IJFA 1ZH8A 3RO7A 2MIIA 1X7GA 4E5DA 4GGOA 4OH1A 1GGVA 4QHYA 2I03A 4JROA 4LE2A 4UBIA 4YX9A 1W36C 1NBEA 2R9VA 1P0QA 3LL7A 2QW1A 3BXEA 3HDHA 3LNTA 3M81A 4AT1A 4JJ8A 1R9NA 4DVJA 1N36B 5JSHA 1NN1A 3WMXA 4Y9RA 2GMWA 1V1RA 3A6GA 5JATA 2JS7A 4OA8A 1UBKS 4CIVA 4CIXA 2PZAA 2VL7A 1HE4A 1D2HA 1NPTO 3DLPX 5DK4A 3E9RA 5JRJA 1Q0SA 4LMAA 3N53A 3U3JA 3DEIA 3ICVA 4XDZA 2VJKA 4ETNA 3JTMA 1Z6TA 3SF0A 3PYLA 1MAVA 4EHLA 4NBVA 1Q83A 2JCSA 1PTJA 3AUKA 4Y1FA 1TD1A 4NAVA 5IG2A 4Q3AA 1UK8A 3DV0A 3IX7A 1SU6A 4U00A 2XA1A 4FE7A 3TOXA 2NYRA 5B4TA 5HIAA 1HQDA 3GMIA 3P52A 3I30X 2BM8A 1JLRA 2EGHA 2XYQA 5SY6A 1W4RA 4XUDA 2P91A 3B51X 4QPDA 4RLHA 3VV2A 4BP8A 1Z5NA 1C2TA 1JHVA 3UATA 3AUSA 3KQLA 1NF3A 3AEXA 2DHRA 2WLTA 3ZBQA 3T5PA 5EWJA 1SM4A 2B99A 2PGXA 3LYAA 1AV6A 1FP4A 1D2NA 1OFUA 1Z34A 1QCYA 1X7XA 2YXEA 3HR7A 2BZ1A 5DHFA 4NHOA 1M8PA 3SZ3A 1LPAB 1IPFA 1NL3A 1RNLA 5K0EA 4YUAA 3K6RA 3V2IA 1KK3A 4KEAA 2L69A 2E6UX 2AI3A 4US2R 3SVLA 1S01A 4RF3A 1PIWA 1BMFA 2JFNA 4LVUA 3AOEC 3NT5A 2IUYA 4BJ1A 2WU8A 2Q9BA 3T5GA 4NBLA 2B7LA 3SBXA 1GPBA 2FK8A 5JSZB 3PNMA 4EVSA 3IP6A 4BYGA 2YBDA 2ZWIA 4S05A 2D62A 4WLEA 5F12A 4NJMB 1FFWA 3ZG6A 3TB4A 3D59A 4BKRA 2JLXA 3O74A 3VC7A 4IDFA 3KUXA 1O3YA 2HWKA 4QO7A 1MPXA 1V3TA 4MA4A 1VBNA 4ETWA 4A2QA 5E7JA 2OCPA 4C2AA 3VUEA 3HYTA 1UBTS 4RZ3A 2Y2UA 1L4BA 4Q05A 3EULA 5FQNA 3LT0A 5G3YA 1GSHA 2CHFA 1JHQA 2ISCA 3CUTA 4Q3LA 4BGEA 1IY0A 2ZBEA 3QE4A 2X8AA 4PZ0A 4L28A 4WN9B 1PZEA 5KTYA 3Q8XB 2AXEA 3FJ1A 1FNDA 1LLCA 1J21A 1WNFA 3I0NA 4FFBA 1QRRA 4E51A 2MMCA 1PG2A 1TF2A 4ZT5A 1KBZA 3JSAA 3CVUA 3OFKA 4EP1A 3PLAE 3AM4A 1II0A 4GX2A 3IKMB 3K30A 1E60A 2FN3A 2J30A 5AM3A 3C15C 1D7AA 4RULA 4FR5A 3LBYA 3HYRA 3DT9A 2F1HA 3E5MA 3LKBA 1SHLA 1YBFA 4YQYA 3UENA 1K06A 4KWCA 3WLAA 4CG0A 1XPRA 1KRXA 1SG0A 4RE6A 2B1IA 1YE5A 4PG4A 4IKPA 1Z75A 2C4UA 1L1QA 3MJRA 1JR6A 3KZKA 1O4VA 4OK5A 4HUJA 4EKDA 5AVJA 3U60B 4BZZA 2LWIA 1CQIA 1SVIA 3H6KA 4RX1A 2IKSA 1YCGA 5AM4A 4AJKA 4KFCA 1ZK0A 2WFAA 3KK0A 2DLCX 621PA 5DW0A 5AR1A 4ZEVA 2OXRA 3OBBA 2A1UB 2VPTA 3QGMA 3UT5A 4J0JA 1Z56C 2JW5A 2OV2A 3EBLA 4ZAWA 2Q6TA 4CL0A 1DKOA 4CFSA 4IOKA 3PQ6A 4NYIQ 2WAYA 4R9RA 1O0SA 1MC1A 3W8RA 1WWKA 2O7SA 2W2QA 3G9QA 1VPLA 4ISCA 1JIXA 4OBBA 4GXQA 4ENUA 2EFHB 4C0JA 3L5OA 4BATA 2RE8A 4XM0A 1ZN9A 5EPEA 4ZAXA 1Z5PA 3AJEA 3IP7A 2HPAA 4QWMA 1EVEA 3THOA 3QU7A 4F7WA 3AILA 1BJKA 1J0EA 1NBWB 4M1KA 4DV4B 4XM1A 2GK7A 3LPLA 4KXNA 4RBNA 1AZTA 4XYBA 2XQIA 5LA6F 4B43A 1ZMXA 5LPNA 5AJXA 4ZT7A 1HGXA 4JC4A 1LLFA 1TZKA 3U48A 2VXBA 4JJ7A 1XAGA 2XMSA 4LYAA 1J7JA 1OR8A 5ADUS 2FPSA 3FJYA 1Y9AA 3W3AH 1LPSA 4K7JA 3F90A 6REQA 1BVHA 4V0QA 4RXMA 1CRZA 4QBKA 5EZYB 2HRCA 4DL9A 1DI0A 3HCWA 4K0KB 3KOWA 2G0AA 1UBSB 2L0XA 2RCYA 4RGQA 4X8LA 3DDNA 3OMWA 3OZXA 3VU8A 4EG3A 2HU7A 1HE3A 2OG1A 2XWQA 2JLCA 2ROQA 3WLKX 1KO5A 3G5UA 5BV0A 1GTVA 3OBIA 1PWEA 2EKBA 2VYQA 2FR1A 2N3ZA 2PAFA 2XAUA 3O4JA 5AKKA 3FKSD 1GU0A 1ZA1A 4LV5B 4E07A 1EGQA 4R0VA 2O8NA 3WP0A 4BFSA 4F91B 2ZR7A 3JZIA 1ODTC 4RH0A 4IRMA 3ORQA 1O87A 1DIGA 3H9BA 5GM1A 3QE0A 4FINA 2WTMA 2J9XB 4RLFA 4M1OA 1MAHA 1Z7EA 3SC3A 4LK3A 1HDIA 4K0RA 2FFRA 1EQAA 2AC2A 2JFGA 1QM5A 2XD4A 3GLHE 2ZG6A 1B2LA 2WTNA 3T1VA 5K01A 1YZNA 2UZ4A 3OT1B 1L6RA 2X5JO 3GPCA 3OKFA 5P21A 1F7VA 2C59A 1I01A 3D8NA 2YMPA 3MWKA 4K26A 4PWYA 5DOVA 1PFGA 2R7KA 2VRWA 3UHPA 3HKEA 1X1CA 3DMRA 4YUZA 3M6WA 3IQGX 3THXB 3W8DA 5JSUA 3RH0A 4H3HB 5F98A 4UBNA 1ELOA 3ZR4B 2PFKA 3GFPA 1ZGGA 2EF1A 4K46A 1CUVA 5BN4A 1SPBS 1O6GA 2CHQA 2Z57A 3ILSA 3JRWA 2WWXA 3MJCA 1SIBE 4KPGA 4Z0NA 5E6UA 2PH5A 3SKYA 4Z1MD 1QJ4A 2M1ZA 1A27A 2YASA 1CDZA 3B3GA 1U4NA 3A4TA 3N75A 3PDWA 4MS3B 4ESEA 2XIQA 2TMYA 2X40A 4I08A 1VI5A 2NVUB 5KJFA 5IJZA 2ESRA 1IMOA 1C7QA 4U5XA 1P0FA 1VJCA 4HC4A 3WL8A 4F0JA 1MRSA 4UDYX 5IVIA 4B33A 3H8WA 4V0ME 2P1RA 3VHRA 1WPQA 4ZREA 1DMSA 2ZAGA 4R1LA 3VR5D 2QROA 1GGMA 2BTOA 3PJDA 1M1YB 1MKYA 1Z4PX 4FWIB 4TQ9A 4BX0A 2W2XA 4RNDB 4HATA 1Z33A 4E09A 5H82A 5CLGA 3TZKA 5GZ1A 7MHTA 3E1KA 3O4GA 3NMUF 1ECGA 3FNBA 1JHDA 3T9EA 2VATA 1YFJA 2ZYGA 4EW6A 3H04A 1JLLA 2WIAA 4LZWA 3QA3E 4U2BA 1SXJC 2FFJA 2ZSBA 4TQGA 1U8XX 4FMDF 1HNXB 3M2PA 4NBTA 4TMYA 3L79A 2F3QA 3ZDRA 4GYKA 4YJ3B 2R3SA 3UV7A 2IIPA 4C76A 1FZTA 1NATA 2NU7B 1RQLA 5TX7A 1ECCA 1JEOA 4FQ5A 4EJMA 1F38A 3AFOA 4ETMA 4X7BA 2AKAB 4OHBA 1PT7A 2ZQYA 4FGWA 1NQOA 4S1VA 3LW7A 4YBZA 5FR2A 4EPWA 4BPBA 4X85A 4LRUA 1R8JA 3H2KA 2XF8A 1W49A 2DPMA 1WVGA 4ZALA 4BMNA 4YLEA 1I24A 1AUOA 3GLVA 3AH8A 3WC4A 3QUCA 4OXXA 2AN5A 4UCQA 1TAGA 2B4KA 3H9QA 2WTAA 3HP7A 4FLMA 4XGNA 5SZIA 4ED9A 4DLZA 1VDMA 4P3KA 1T1SA 4D25A 1JLMA 2O5VA 4F04A 2Q29A 2HSEA 3EQ2A 2XB2A 3ND6A 4W1QA 3KWLA 5HUQA 3FYUB 1OIXA 1N2OA 2CFIA 2GO1A 1S9DA 3FZNA 4V0SA 4AG3A 2HDHA 3DE2X 2TRSB 1XRJA 1B3RA 2C9YA 3U3KA 5A2GA 3W0LB 3HM9A 1RQ2A 3P45A 5TS3A 3ZXIA 4DQKA 3C45A 3B3FA 1DXYA 1ZY2A 2DQ4A 2PX4A 5HIIA 3HJGA 4DE5A 2IHKA 4HG2A 5LVAA 5JJKA 3HU5A 3CH7A 4TTPA 4V38A 1UDWA 5HTKA 4HLUA 5LQNA 4AF7A 4A82A 2X1HA 4UOEA 1R6DA 2IHNA 5BN1A 3LIPA 3LXRA 3M6MD 2JASA 5EJIA 3L01A 3AEKA 3Q3EA 1YVRA 2A0YA 3DDUA 6AT1A 4F8YA 2GN0A 4DLUA 3RHSA 4LF8B 1JHYA 2QTRA 3VAYA 3RF6A 1E6EA 4B6EA 3HXMA 2V9PA 1D4FA 3T7DA 3LQFA 2CJXA 3VKWA 4NQZA 2GCNA 4CKEA 3DV2A 1XKLA 4IY1A 2BM9A 5EYPB 5JMWA 2XBMA 3OETA 3IEUA 4UTRA 3JWPA 1G18A 5HIKA 2GQ0A 4KQFA 4RA6A 3NC0C 2YWGA 4HWRA 3FBWA 1LB1B 2OZKA 4LHZA 2PL3A 1XU7A 2QNIA 3RRBA 1OH8A 1HEYA 1WZ2A 5JT1A 1DKPA 3GLQA 4I1OA 4IXNA 4QZVA 3OUUA 4PW0A 4BWYA 4PRYA 2QMQA 1I6MA 2H11A 2WKSA 3OJCA 3PDHA 2PWAA 1PDWA 4RVUA 2B4YA 2H0AA 2IHYA 3NRCA 3QQ5A 4YFYA 3BEDA 5C7IO 3GLIE 5BQXA 1NV8A 2PGIA 3RIXA 3TD6A 1QFZA 1T5IA 2HZBA 1FSFA 5I9IA 2QLJA 1ONPA 4ZCMA 2CB0A 1GOTA 2HLDD 2VSXA 4M99A 3PXAA 3RC3A 1JALA 3ZLVA 4RENA 1JBEA 2ICAA 4G97A 4JSTA 1OLXA 4QPZA 4GBJA 2VSYA 4YMLA 1Q1QA 1E9EA 4NAHA 3UH1A 4DLAA 1ZGCA 2WIFA 5JAIA 2WPNA 1Q1ZA 2I6GA 3WKCA 2AF3C 1T8SA 1HLDA 3ESRA 5H70A 4AXXA 1NVKA 5A7GA 1JZQA 4KXFB 3RGGA 3A28A 4PSVA 1QTQA 2O8CB 1SQ6A 2BGKA 1Z0UA 3DZ8A 5DYIA 2RHJA 3FIJA 3G5MA 3IPXA 5I7SA 1P7ZA 2HH9A 3I62A 1V9SA 4FZJA 2L18A 1YIOA 4Q9NA 4B79A 5J58A 4GKVA 4G0MA 1NYLA 3H2SA 1U3FA 1Z13A 1LTHR 1THGA 2Q3EA 4L7QA 1GAWA 1U2RA 3FLAA 4I1SA 1W88A 3B82A 2H1WA 3PLRA 3T12A 4YRBA 4XTRA 5I7FA 1CJTC 2QZ4A 1XNJA 3K35A 3WGNA 1EE2A 2C92A 3IPRA 5AOCA 2ATEA 2GM9A 2DUJA 2HRDA 2XRMA 4IIGA 4Y18A 3RIEA 2R8BA 2RHMA 1BU5A 1EB9A 1W5AA 2ATIA 2OHGA 2RGXA 3D3EA 4HWOA 4X8HA 3V1NA 5A9SA 5CITA 1QIJA 5FJJA 4MVCA 4TLEA 3F6BX 1PQPA 3ND7A 4QJ3A 1LBHA 2UYYA 4RKEA 5KNDD 2FR0A 5JROA 2HNKA 4UVDA 1SA0A 2YC2C 5LXTF 1JWAB 3BEOA 4ZZIA 2VF2A 5L9AA 2QT9A 1KC3A 1F2VA 3AUTA 4KMSA 2OO3A 3I23A 2GX6A 4HAZA 4DEXA 1JS1X 3D3QA 3I2HA 4TPKA 5AJVB 5EVJA 4E1AA 1U28C 3R7FA 3K09A 3KXLA 2RHHA 3RYCB 3TLBA 1QGOA 2Q6OA 4Q34A 1EFUA 3DEZA 1H6BA 3HDJA 4ILEA 3ZV5A 2GKOA 4LECA 3Q8LA 1DUIA 2K7ZA 1FYWA 2ZB2A 1AQJA 3KJIA 1CF2O 4UASA 2O8DB 2HMSA 5KWSA 3CZCA 3L0YA 5CT4A 1ZVMA 2VPWA 3ABZA 2NUAB 1GR1A 1S2GA 1UBCA 1XK6A 1ZK2A 4PSCA 4L5IA 1XZDA 2VBGA 3RS7A 1N2IA 3Q9SA 3F7OA 5I7UA 3TZLA 3BGIA 3WE7A 1UJ5A 2B1RA 3LCJA 1XDSA 4K6CA 1A8IA 3HYLA 1A5AB 1TVMA 4YP5A 1JQLB 1K7SN 3HBAA 5AESA 3HK2A 2GR9A 1IZ0A 4QASA 5CVTA 1KFBB 3VU9B 1GKIA 2IYNA 2AOTB 4FBLA 5JASA 1CDOA 1O1YA 4XGRA 2ZXUA 2WG2A 4G67A 3HO6A 1M2WA 1GSOA 1XVAA 3PXEA 2PKCA 2OMEA 1FRNA 1R0KA 1PR4A 1MABA 2CYBA 3U7FB 1K75A 4FXPA 3UYLA 2BN4A 2W2OA 5DMHA 2C4VA 1C1HA 1DRUA 3GMTA 3Q41A 4LNHA 4MRNA 4DIBA 4Z0PA 1AXEA 3BFKA 3GROA 4RJLA 3AGPA 5U9CA 3KQOA 4ZQFA 1TIPA 4NMLA 4OUDB 4AD8A 2X0EA 1WMBA 4BUCA 1AGRA 1UZNA 2C3MA 4BKMA 4CQNA 1O95C 1CUJA 3DZIA 1IVSA 4MVJI 3OD5A 3S0JA 4TRNA 3SZRA 1ULBA 4A0GA 2NZVG 3AQ4A 4IFTA 1AN9A 3ZBUA 1LPMA 3K9NA 4ENSA 5I01A 4JBNA 4J0KA 4Q7LA 3ZK9A 1R0WA 3NATA 1AHIA 3QOWA 4AM8A 2WICA 1E61A 4KJZA 4CTMA 2I87A 3WNDA 1U63A 1KO4A 1BX3A 5LZ9A 2NIPA 4F6CA 1ZGHA 2ZSKA 2BH9A 3W5IA 4UTOA 4BQIA 3PQ5A 3OCCA 4ZU1X 5M2QA 3GZNA 4NDAA 4YY3B 3OFVA 4CIBA 1JQDA 3A7DA 3HKBB 5HEKA 1HDYA 4B81A 3CNOA 2D5BA 1T9CA 2P4UA 3HG7A 4S0ZA 1H8ED 1YHYA 5KOJA 1EDDA 4W5JA 5IVKA 1UP4A 4BIMA 3DBRA 4XPIB 1TYBE 1R6AA 5IZ4A 5KYUA 4OGGA 4LE1A 4GWLA 4TSRA 3QE2A 2WOOA 3FG9A 1KMNA 1X74A 1QOZA 4LYHA 2UZ0A 1P2SA 1CDDA 3KCQA 5TARA 1UZAA 3T7IA 2OGUA 4J7CA 1NVVR 1OFGA 2G76A 2EYQA 3AYZB 3SJZA 5KC9A 3UPUA 2VYVA 2QBYB 2DFKB 1Z35A 2INGX 2WFMA 4LPSA 5LZ5A 1TXGA 3RJZA 1PFWA 3VA7A 3C7TA 1W85A 4C14A 4ETIA 2AMYA 1SK8A 3C3JA 4M0DA 4A10A 2QD4A 4LXHA 4UBOA 3D5QA 2QBYA 1G9XA 1ZWKA 1ZQ9A 1E94E 1GUBA 3BF8A 3PD1A 2DGDA 2YWJA 1W36B 4JOCA 1JBKA 2QPAA 4BO2A 1U1CA 2LV8A 1KNQA 3E9QA 3N39C 4Y1RA 1YOBA 2XE7A 1OWMA 1A4XA 4B73A 3HCRA 4DCSA 3ZD9A 2IQ5A 3U31A 2Q2WA 2P8JA 3U26A 4WSOA 4ENWA 2DBYA 3L92A 4WN3A 5CVVA 1RBYA 4FDUA 5DCYA 4ENQA 1YRLA 3I6ZA 5IBRA 1ECLA 1P9OA 3ONNA 1L8OA 2YYYA 2GASA 3BS4A 5CR9A 5JPDA 5ILOA 1NRJB 2HIHA 3E1SA 5GIOE 1ENOA 1B4DA 3TXXA 4BU0A 4GPEA 4W9RA 4CTNA 1X8JA 1N3YA 4KYIB 1OYVA 5D84A 1JHMA 4FYPA 4IS3A 4M87A 1HL3A 4Q6BA 4BNNA 2FZ5A 4JYPA 1G5RA 4E1VA 5BV1A 4N8EA 2IS4A 1Q0ZA 3O3CA 4NRDA 1JHZA 3SQDA 1DJPA 2A0UA 2ASVA 3TBKA 4U4AA 1ADBA 5HS6A 5BVGA 4NXMB 4EA7A 1UT6A 3GJRA 4LYDA 1U2DA 3TTWA 1Q22A 2JK0A 1IHOA 3EOBI 4I4CA 5IVPA 2D0OB 1EWKA 5FEMA 1T10A 4QO8A 4RAOA 3EIXA 1VZ3A 3R5XA 4UTVA 1ZCJA 1OLSB 5L4LA 2QRUA 2G83A 4GOOD 4Z51A 4L4UA 4PZPA 1XDZA 2KMLA 1VRCA 4UEWA 5K3BA 3T1OA 3ETLA 4P4GA 2GAIA 4PYNA 4FSHA 3KAQA 2PJUA 3OURA 3FPLA 4PS0A 2GAAA 3QVGB 2IZZA 3NLLA 4WBNB 3W2GA 5G4LA 3COYA 5JZ9A 3G7SA 2K87A 3BJIC 1B0UA 3WHLA 2IHVA 2QRJA 4BFCA 3IVMA 4ZO9A 2BI4A 3N1UA 4DKXA 4DRXA 3BYZA 3K9CA 1I2CA 1RIFA 3QVGA 4LVOA 1N32B 1AXGA 3WFIA 3JZMA 4BYMA 1A97A 1JIUA 3TECE 1GZUA 3V8BA 5EHXA 3SY8A 4MAAA 4RKFA 4YRLA 4KXYA 1HFEL 1MJHA 4MYUA 3T4XA 1M5TA 1UWVA 1N34B 1PFYA 3KELA 5DX0A 5E3IA 3T9DA 3S8MA 2HA5A 1YBMA 3NYRA 4JX8A 4YCAA 1C30B 1XLVA 1YSCA 1DAMA 1TNDA 2GBFA 2N9UA 3LQQA 3M3DA 4HNVA 4IXWA 3AV0B 4O8ZA 2GZMA 1X86B 3E5HA 1B6SA 3ZEIA 3IJRA 2V9ZA 1O57A 3V4ZA 1EXNA 5KZMB 4CF6A 3BZBA 5K6RA 5HMLA 1X92A 3K5IA 2BSAA 2H0QA 2Y92A 3QXJA 4HWGA 1NUPA 1I8TA 2VP2A 2UUOA 4MO9A 4ND2A 3WLLA 2VPPA 3MUOA 4J2TA 3V8EA 1IUKA 3SIWA 3HJBA 2WLSA 4FKZA 4F4CA 3AJRA 1T8WA 4L15A 4S35A 3COJA 3C3DA 4LMRA 3ZQJA 1ZCZA 1QQBA 4MKXA 4KE6A 1A72A 2VTBA 2IE8A 4AJJA 2XRYA 1OE0A 3R0QA 5B53A 3DE3X 3BMCB 4EGQA 4ZN6A 5IXYA 3K8YA 3HL0A 3G9TA 1QYVA 1THTA 2FW9A 3GWZA 4KUEA 4RV5A 1U0RA 2WV7A 3KEOA 3O1HB 3B9RA 4JQZA 4Z9AA 1FSZA 5AXCA 5K3OA 3AVUA 1W44A 4ONEA 2JDIA 1G60A 1Y89A 3LL4A 3LT4A 2X0KA 5BSUA 5LB2A 3RWMB 3WXMA 5KWVA 4RS3A 1GCOA 4EL5A 3A8TA 1PQYA 5AVVA 5IULC 3FH0A 3HVHA 2VXOA 4I1VA 4KQMA 5K03A 3PQCA 3K6SB 2ZIUB 3MK31 4EGFA 1NLFA 3LCRA 3L82B 4ITRC 2I6TA 5CDFA 3ZDEA 4A16A 4YJ2A 5AVSA 1KJZA 3D8TA 1NM5A 2H4ZA 1Z26A 2C0CA 3PQDA 1LLDA 5GONF 2IZ7A 3F7TA 1W93A 4FDVA 2AT1A 1HKHA 1C9YA 4ER0A 2FGKA 3SAJA 1SXQA 4CEIB 1GRNA 3PI6A 2A2ZA 3CNNA 4B34A 2NV6A 3HCEA 5I7WA 1OGJA 3HMKA 1LK7A 4KGZA 1H9BA 4WH0A 4QRIA 5CK5A 2COKA 4J0DA 4P4NA 3RCBA 1SKMA 1AGPA 1KY3A 1FUUA 1GLGA 3R0JA 3AHEA 4I8DA 4RCYA 1UOQA 1UCFA 4POOA 3K5PA 4FDTA 3QXHA 4FHFA 4RVHA 4XUGB 2BYTA 1DEOA 1ZX1A 1XLTA 1XVTA 2BCEA 4L4ZA 3K16A 4Q82A 2HIGA 3I8OA 4XJVA 4MPPA 4A5SA 4PRKA 3SF8B 4ZYYA 3VO8A 1PR9A 1PUXA 1XFDA 2JGKA 5EUQB 5B64A 5JCJD 1CF4A 3AESB 3N8HA 3PE6A 4X6UA 1FDVA 3D6MA 1RHQA 1T5TA 5T4BA 4ZQEA 2OAQ1 3PNQA 1P2FA 2JGEA 2DKNA 4DGSA 1ZP6A 4HB2A 1JAHA 4U6NA 2IHBA 2WV9A 2XADA 2NSHA 4OJNA 1HLGA 2CLFB 2VT6A 5DSXA 5KDLA 1BAPA 4P9NA 1FTSA 4ZV7A 5AICA 2D06A 4JU8A 1SBZA 1ZGZA 2G0TA 3KQHA 4PLFA 4HS4A 2HSGA 2D13A 5KX5A 5KTOA 1M67A 2HCBA 4ABTA 1GCUA 2H31A 4O2AF 1CETA 1CRQA 2AK2A 2BMVA 4PQFA 1X14A 3TUJC 3ZDFA 1A8QA 4UZFA 5IARA 1RQ7A 1U8UA 1VYHA 2V1XA 2XA9A 4BMPB 4E14A 3LVRE 1VB3A 3QITA 4X94A 1EFVB 2O2SA 3DYIA 5A5VA 3G1UA 4TKUA 2TSYB 4BMYA 4UFNA 3FNEA 3SLKA 1VHDA 5D87A 2OPHA 4EKYA 2YMLA 1GSIA 1M6HA 3SM9A 2XF2A 3STWA 1RZRA 2J0EA 4HJXA 4CM8B 1LWOA 5K3DA 4C06A 8AT1A 3GF4A 4JBXA 2OCKA 2RGUA 4BX2A 4X44A 4DIUA 5L95A 1NN5A 3CHYA 4TSKA 1AS3A 3AL2A 4EY7A 2A1TS 1SUPA 1I4DD 4A26A 5JMPA 3QE9Y 4XVHA 2VEDA 1IAVA 2HA3A 1SUEA 3QMMA 4IRUB 4MX8A 5IANA 3MWYW 4OFBA 3Q0TA 3GUCA 4FDMA 3E9ZA 3AY6A 4WXYB 3SZMA 4IUDS 1GZDA 1JT2A 1T8RA 2AKEA 2IKQA 4K28A 4J1NA 4KDEA 2VDWB 1KZ1A 4R3NA 2VNIA 2F59A 2NTYC 2RHDA 1XHLA 3ZYCA 4I46A 1GQSA 3KQVA 1NW4A 1UWKA 1I6KA 2C77A 2H07A 3L6RA 3ZXSA 4M36A 4A2CA 2ZBUA 3KHKA 4HHEA 1FUKA 4ER3A 5KNDA 3L6CA 2OECA 3C5EA 3FMIA 1XDUA 3DQQA 1P39A 2GXSA 2J09A 3D3WA 5BR8B 1QCDA 2QTGA 3HCAA 4YP7A 2A5FA 4LPKA 3TIIA 5EMLA 3G2JA 2BBTA 4PWZA 4RVCA 3FZQA 4PLYA 1RTTA 3RJ5A 4H7PA 1ANKA 1JKJA 1O6BA 2XNHA 1ODKA 4EH1A 4W5QA 2BEWA 4Q7MB 3AJDA 1YZFA 1WPXA 2CVPA 2J0VA 2G71A 3CSSA 4Q4HB 3TVYA 4J1SA 4B35A 2JBWA 1JG7A 2VUSA 1L7EA 4BBJA 4PXAA 2ACVA 3H1FA 3MWEB 1M1YE 3KKEA 2IUUA 3X2FA 1A9RA 1QIKA 2GJ8A 4CM5A 2F4VB 5CLJA 5LQUA 4HFMA 3FUCA 1FP4B 4P4SA 3EZXA 4LUCA 2B3TA 1K68A 2WMYA 3LUCA 5BWNA 3IIKA 3LY9A 3RIHA 4DMUB 2XPCA 5COAA 3RIMA 2Y99A 2EKZA 1KETA 3G2NA 4QEKA 5AK0A 5JFGA 4ZOLB 4CR8A 1SR8A 5L3SA 1EK6A 2HV8A 1TAHA 1Z15A 3IQEA 4J76A 3QWBA 1P2GA 1H2ZA 4NFSA 4Q18A 8GPBA 1U0NA 4MULA 5T41A 4BHTA 3OH8A 3B1VA 4CM7A 1DWQA 2QQGA 1KYVA 3U4IA 1C9JA 4RM3A 1LV7A 4E4RA 5EXEA 1RXIA 1JXMA 2JI6A 3KZ1E 3M6UA 3K0AA 3LXUX 1KH1A 4YYZA 3PS9A 5DBFA 1GLVA 3HB0A 5FBRB 2GEBA 4DJEC 2ZKIA 4LCBA 4P84A 3NBKA 2ZJOA 2QVBA 3E8XA 4DSAA 4DLXA 4YV2A 1ZJ4A 3HJCA 3LC2O 4ISBA 4W82A 3L6BA 4CMJA 4OAOA 3W5CA 3KSAC 1HTWA 4CDRA 2G4LA 3QU2A 3R3UA 1JMKC 4RVNA 4G4SP 5EERA 2ZITA 4N0MA 3BWEA 4MVJH 4G4GA 3VOAA 2HMUA 4TM7A 4WN9A 3ROGA 3PICA 4Q4JA 3L04A 2CJFA 3ZE9A 2DETA 1PFKA 1Z28A 4N0DA 4ND6A 4UTZA 2E4WA 5F2KA 4LF4B 2CUZA 4BMZA 1A8PA 4DLVA 3JQDA 1P75A 1U3UA 1RKVA 3LE8A 3TQIA 3OT4A 4P81A 4ZVPA 1Q92A 1Z4MA 4F5WA 1G6KA 4M86A 3L6DA 1QZUA 2PKQO 3SX4A 2FPOA 1JU3A 1Y4DE 2VXCA 2ZSHA 3I6BA 3KTDA 4N7MA 4RMJA 1KEPA 3STUA 1ZOOA 4FMPA 1VC2A 3V7NA 5EIXA 3T3GA 4JXKA 5JCPA 1K8QA 4LNUA 3MBOA 5EG5A 1X7YB 4K9QA 4C2BA 2O2HA 3DL7A 4CQMA 4D96A 3LXMA 3TD2A 3QKWA 3DWEX 2FW1A 1F5SA 3O8QB 2JAWA 2XOKD 4KGVA 4YGYA 1Z5GA 3JQPA 3ORYA 3U4CA 2ASEA 3ORFA 1PWXA 3MCUA 1JA0A 3RS3A 3TM5A 3MXTA 3HKDA 4Q3EA 1TRKA 4ZMSA 4A5OA 3AP1A 4OKIA 1BVRA 2F55A 1H0SA 2GKSA 4XJSA 1ZI6A 3MEQA 4FEGA 5A4KA 3T9FA 3W9BA 1A2BA 2V6IA 1L3CA 3A3OA 3BQ9A 3QJGA 4XWTA 4YRRA 4BEJA 4ZI2A 5JADA 5LWQA 1ID1A 4E15A 3JATA 5DPMA 4KMRA 1BGVA 2A9FA 3F6YA 4JJFA 2NWQA 1YXMA 2VRCD 4TKMA 2YDXA 4TLCA 5CLLA 4YAIA 2VWGA 4ZGBA 1R4AA 3W6UA 2Q5QA 1Y9JA 3GJZA 1TQ8A 2JKZA 3D1JA 5GINE 1KWKA 4IYJA 1EM8A 1U2EA 2QQFA 5AJZA 5JY6A 1OXXK 3BSSA 1M2JA 1P9NA 3FAZA 3QENA 3EF1A 3JQGA 4B3IA 3ZCUA 4G1BA 4L7VA 2W2KA 3VR5H 3U5TA 1BD3A 4HLNA 4UZEA 5EJEA 1TZCA 1ZWLA 1FYDA 3GZJA 1SELA 2HJSA 2REQB 3EAQA 4EWLA 5COQA 3KHSA 2VJAA 2DBVO 5HKKA 3NIDB 1NBHA 2W2KB 3ZQ4A 3HB5X 3QLUC 2BV3A 1N0UA 3R5KA 3M6XA 2XQKA 5CVEA 2HF9A 3TKAA 4BTVA 1M0WA 1C1DB 3DC2A 1VSUA 3R09A 1RAEA 2WHPB 4W6QA 5TS2A 4Z53A 2ECOA 2PZLA 4JB2A 3WRYA 3I04M 4YMVA 3QEMB 1U31A 2Q7XA 4OEHA 3O21A 2AI1A 3GJTA 4TVOA 3GLKA 1V5EA 4PYQA 1SH7A 3LCVB 1Y63A 2WJWA 3Q87B 4N5LA 2ZS8A 3RVRA 2QRGA 1Z29A 4LWOA 2DVMA 2FAXA 4QYTA 4EG5A 3TI9A 1U2QA 3FDIA 5CH8A 1QO9A 2PIDA 1RVDA 1A8SA 1C2YA 1Q0HA 2EKDA 1H9CA 5DCWA 2YZKA 4UUOA 3OA2A 5HOEA 4P7JA 1CY7A 5HG0A 3N28A 5JYBA 4N9WA 4ZXPA 1JSZA 3CV3A 3NHFA 1G3UA 2O4UX 2DCMA 3ENNA 2RHBA 3H1EA 3G8BA 4J9UE 1UDAA 5LLTA 2IGBA 1AGYA 3EVFA 3F3YA 5LIPA 5JS2A 1BOFA 3ILHA 2GZSA 3EWIA 4LI0A 2XD9A 3PC8A 1PNQA 2W2TA 2P5TB 4S1PA 4YCLA 2XNDD 1EP2B 1BGWA 1BKSB 3Q7RA 2EL7A 4PLHA 5JNUA 3AY3A 4QARA 2PH1A 3EWNA 1BH2A 4PAMA 4WTOA 3DO5A 2C7QA 3G0DA 4D43A 3OEHA 3FPCA 4HAWA 3SX0A 2NTJA 2YUTA 1O08A 3H1GA 3H18A 4MH0R 1AKWA 2CCGA 3IMKA 5GVSA 3PT5A 4JLMA 5C0OE 3D5EA 1WMAA 1U2PA 3DOFA 5HKKD 2BBOA 4CCSA 4XARA 3DVAA 4XYMA 4B1FA 2JH8A 3SC4A 5LP6B 4JXXA 1M6YA 4HDRB 4MWDA 3CEPB 1QMGA 1DT3A 2IXBA 3KJEA 3IQXA 1UZLA 1XOIA 2R8RA 4KR3A 1NQVA 2PCLA 4D6YA 5BWLA 4RKWA 2YRFA 2E5WA 3UJ3X 1IWPB 2JGNA 1I94B 2EU8A 1WDLA 4MUMA 1R3UA 4RMHA 1W52X 1NJ8A 3FFXA 3NZEA 2OB1A 4ILKA 4BUJA 3CZQA 1OAAA 2J67A 1E9SA 4FLFA 4MDHA 4Q7EA 5E8RA 5ICMA 2RH4A 4INZA 3TLCA 2WWIA 1YBVA 3F5FA 3G0BA 5FAKA 1FDWA 3DMPA 4GUDA 3SDSA 1S8NA 2A9RA 2EF0A 2R4TA 1QP0A 4OB8A 3H4VA 4Q1CA 3VPSA 2JKYA 3QFFA 2XYRA 4XD2A 4Y2PA 4EF5A 4L2IA 5DN9A 2NXJA 2VNSA 1PCXA 3LZCA 3QF7A 4AY4A 1JIJA 3I72A 4LF9B 3TPCA 3DF9A 3WGLA 4JCOA 3AO0B 5EHQA 3EFHA 5G4KA 3OPNA 5BVGB 1NVTA 5TPZA 2R25B 3SHFA 3JY6A 1JR2A 2ERXA 4CVNA 5CIQA 1Y3AA 2C97A 2V7EA 4JJZA 1UMBA 5HJ2A 3QXXA 3G5LA 4FYMA 4KQ1A 2VYVD 3WICA 5F2NA 1QGED 5D3KA 1H22A 2I2DA 4R1QA 1UC5B 2ZBGA 5G4KB 1OX6A 1RR6A 2BFBB 1KH3A 1T5BA 2FYTA 3A06A 3GX1A 1S2IA 4H7KA 4P3PA 4P0PB 2BWJA 2AN3A 4FP9A 2IF0A 1RFLA 4MUJA 3IUPA 3KCNA 1FYXA 1ZM4A 1LVHA 3K31A 4WOJA 4YBRA 1ZAYA 1RYFA 2J8ZA 2WF8A 3ZIAD 4YMTA 4OHZA 4LRQA 2DKOA 4RDIA 1GPWB 4D8YA 3RFUA 1U9YA 2C5EA 5DTEA 1JVBA 3PPYA 2PR7A 4GR5A 3KEMA 1FFBA 1IB0A 2PD6A 1XYVA 3HR8A 4IPTA 2G08A 1YOVB 1OMOA 2D2XA 4R9VA 4INOA 4M55A 1X1EA 1UWLA 3FN4A 5AVXA 3WGUA 2WJJA 4K1XA 4NCAA 3QBDA 3T3EA 4PC1A 2YWRA 4Q12A 4KDFA 4XZ3A 3HJRA 4OM7A 2CXHA 2QDXA 3G8CA 3NEJA 4JEMA 4U0JA 4BFTA 1MEJA 4F4FA 3VU3A 3DLBA 1XEAA 5HILA 4BE4A 4D56A 3ZD6A 1U3WA 1JG6A 2JLVA 4MR9B 1WP9A 1P5RA 2DPLA 3JV7A 3ZKWB 3M4ZA 4XD7D 3KUDA 1K8RA 1IUOA 2AEFA 2FPWA 2PD4A 4GVPA 4TL9A 2HOQA 4RL4A 1OC2A 4CQLA 3Q72A 1T2NA 4NS1A 4Z6KA 3HBMA 2P9JA 4MR9A 2M9MA 1L0BA 3OG9A 1GV1A 2WJZB 3RNLA 1KTIA 2H4FA 3THWA 1OBOA 2NO6A 2XUZA 1N6OA 4UEOA 5JANA 1NVMB 2H7CA 1AKRA 5C35A 2DERA 3KAKA 4E94A 5I7VA 4NCIA 5K99A 1C81A 1Y37A 3I2YX 4NCJA 1V35A 3VYSB 1VYUA 2P75A 3KT6A 1QX4A 1SULA 2AZDA 3I42A 4US0R 4MTLA 2A5GA 1FRFS 2HPHA 5KCZA 3W5HA 1KJ8A 1A9SA 1MJNA 1O97D 2EG9A 1P80A 1JDNA 2EATA 2NXWA 1TT5A 4XFKA 1C9MA 4F84A 5E2BA 2R1UA 1J0XO 1BWRA 1E5LA 1OHHD 3SM3A 4D98A 4OJTA 1G16A 5ECGC 3R7SA 3Q9NA 5HK8A 6CHYA 1OZHA 4DM3A 4D9NA 1ENYA 1G2QA 4FGSA 2QTHA 4WW0A 3H11B 2QPLA 3Q9LA 4RY0A 1PK7A 4BFZA 4BNFA 1ZBDA 1JVNA 1QH1A 2DBZA 3GP3A 2E2WA 1AZSC 1PZHA 3H9JA 1XZEA 5FUBA 3U40A 1JN0A 3DOOA 3EXFA 3P96A 4OBWA 2LUOA 1NHWA 1F4VA 2H1FA 4G07A 1Z07A 3I8SA 3M5CA 2VP5A 2FOIA 4ESVA 2BISA 4R6XA 1I5RA 2XUAA 1UDCA 1OX4B 5JG7A 3RYFB 4JJKA 2A0FA 4Q02A 1N5OX 3U0VA 3R74A 1D0IA 3KM0A 4YAUA 2Y1WA 3Q5DA 4M4SA 5HYVA 2I7VA 1ZD3A 2PGNA 2ZPTX 3KQSA 1NF8A 2ZBRA 4GGMX 4P32A 1XA3A 2PQ6A 5LD2B 1WNTA 4CM9A 4MRRA 4OYHA 1AG9A 2AYYA 4WERA 3OO1A 1BVUA 3BD6A 5MFZA 3L7YA 1SBCA 2QKYA 3N3AC 1LD3A 1MO4A 4Y6OA 5G0TA 3HP4A 2ISQA 1BKYA 2G3YA 1ATIA 2IOYA 4NY1A 1V7PC 1VL6A 4TYPA 3NHWA 2WAAA 3UUEA 4B80A 4BE7B 4YRGA 3N2LA 3HS3A 4HD8A 4W8GA 2G6BA 1F2TB 1LI7A 1UAGA 3SF8A 1VPVA 3VDNB 1BRMA 4RV9A 3Q0EA 2GCGA 4Q7QA 4MV1A 3SSOA 3NHJA 1DP4A 4OAPA 1QCCA 1CUCA 1SUSA 4YR9A 4DV7B 2PX0A 1GG2A 4WBXC 1Y7IA 2AMFA 3AJ8A 4RMGA 4RK4A 1H85A 4BTEA 3ITKA 5HMMA 4LWZA