4BMJA

Structure of the ubz1and2 tandem of the ubiquitin-binding adaptor protein tax1bp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAX1-BINDING PROTEIN 1
publication title The Structure of Tax1BP1 Ubz1 + 2 Provides Insight Into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 18
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4bmjA00
2M7QA 4BMJA 5AASA
chains in the Genus database with same CATH superfamily
2J7JA 1ZU1A 3C4TA 3L00A 2LV2A 4R8OA 4X9JA 1MGTA 1F2IG 2BB8A 2R1FA 4O4KA 4K0KE 3HPSA 4O5GA 4WSGA 2GHFA 4LFCE 3JU0A 4DR6E 2D9HA 1WXRA 2RPCA 2L6MA 3T1YE 1IQOA 1P47A 1T38A 1HNZE 1UBDC 4RH8A 2EOXA 1GQEA 2DLQA 2EN2A 4GEQB 2JOBA 1LLMC 2CTDA 4BCAA 2K7IA 3ECRA 4R2CA 1NCSA 4DUZE 2EMBA 3M99B 2EPLX 5KL5A 4LF8E 1RC7A 2LMZA 4I8OA 2EPOA 2EPAA 1YPNA 2L3JA 2MC5A 1N32E 2EPKX 4JI2E 4R2SA 3TQMA 1B69A 1T4OA 2CT1A 2DMIA 4LFBE 3ADIA 5IT9C 2LUQA 2PRTA 4JI1E 2ENAA 4BS9A 3J81C 2EN3A 2NUEA 4NXNE 4BHBA 1UILA 2ZM6E 2MKNA 4M2ZA 1AH5A 4WX9A 2EL4A 4BC9A 4BMJA 4LF9E 1N33E 3EPJA 5KL7A 1NEIA 2L3CA 2UUCE 1O0WA 2M9AA 2YTPA 3VYYA 2YTQA 2YZTA 4DV3E 2K4VA 3ADLA 3HTXA 2EMWA 2BBGA 3J7AG 2L8TA 4F54A 1HNWE 2CPNA 2ELYA 2L92A 1EKZA 2IHR1 5IWAE 4JI3E 1XNQE 1ZAAC 1ZBTA 2EMCA 1A1LA 1YFHA 4DUYE 1SR9A 2V8QB 1YUJA 4P78A 2EOMA 1KJKA 2A25A 1ZBQA 2JOXA 4BHCA 3VYXA 3F6GA 4WXDA 1A1KA 2EM6A 2EP3A 1XNRE 1YYKA 3JAMC 4OX9E 2EM0A 2V83A 2EL5A 2YTEA 2EMZA 3IWDA 3JTZA 3H09A 1X48A 3HQ1A 2FGGA 2R76A 2YTIA 4WPYA 4MLVA 2EMAA 4LU9A 4DV2E 1XMOE 4MLQA 4ZYEA 2EPNA 2EM9A 2YTNA 2N8XA 3C4BA 1T4LB 1QU6A 1A1FA 2NUFA 4Q35B 2DMYA 1GTKA 4DR3E 3BBGA 1DQ3A 1DGCA 1SFEA 2EMGA 1PJSA 3UK3C 4KWYA 2EPXA 4X8WA 4B3RE 4YHHE 2WBSA 4TUIA 2I9IA 4ZYHA 2B7TA 4AQYE 3FIGA 1T39A 4DMIA 1A1IA 2HC5A 3EPLA 2L2MA 5LMUE 2EM7A 1N36E 2CSHA 1UN6B 4F9AB 2JY9A 3P1XA 5ADZA 4WSPA 1X49A 2EOIA 1PDAA 1STUA 2YRHA 4LF5E 2V85A 5A6AA 2EMHA 2EN1A 4DV0E 4F6MA 4X62E 3ZOQB 1GZ6A 2EQ0A 2EN8A 4KHPE 2EQ1A 1WHNA 4R2EA 5BR8E 5AASA 5AC5A 5T6JA 1RMDA 2ENCA 3DJWA 1AAYA 2WBUA 2EPRA 2EWLA 2EM2A 2YTFA 2VQEE 5KL4A 4FK5C 1IQSA 1EH8A 5LL6R 4ZYGA 2EM8A 4LF7E 2ENHA 2YU8A 5LLQA 1Z1BA 4ZYDA 3C6MA 4IJDA 4N4RB 2B3TB 2F4VE 2EMFA 2DSYA 1N3GA 1T4NA 4DR5E 2EOEA 1YUIA 4GKJE 2DRPA 1UHZA 2WCC3 1ZR9A 3F6HA 4DV6E 2DB2A 3HXLA 2MDRA 2MDGA 2NABA 3MSWA 1YSAC 2LE2A 3IWCA 2M4IA 4DR4E 4X65E 4L8NA 3T1HE 3KWRA 4DR1E 2G7HA 4LF6E 1IBLE 2KHXA 2EOFA 4LTYA 1BBOA 2RSMA 3THNA 1TF6A 4WXCA 1HR0E 2EPMX 2YRKA 4M0VA 2M7QA 4BBYA 4DV1E 1HNXE 2KOUA 4LF4E 3LLHA 2B7VA 2YPNA 2N3GA 5A6KA 2RS6A 4F9CB 1X3CA 4O24A 4P7DA 2EE8A 4DV5E 2YTDA 2JXPA 2EOQA 4R2DA 2VF1A 4R2PA 3OMLA 3J80C 1BB8A 2EOHA 2UXBE 2B9DA 3MHSC 4DR2E 1A1GA 1YYWA 1IMUA 2YU5A 2EQ3A 2H36X 1A1HA 4F2JC 3KZYA 2LTSA 3C6KA 2UXDE 2V87A 3KZZA 1G2FC 1X47A 2EMXA 2EOJA 5A6BA 1PJTA 4JI0E 2DIXA 3J7Yp 2EM5A 2EPCA 2YTJA 2KONA 1X6EA 2LCEA 5IXMB 3ADGA 1WRJA 5CFFE 5DNYA 2V86A 5AC4A 3AV0A 5AE1A 2V88A 2EMLA 2I13A 2EPUA 2L33A 2LUPB 4F9BB 1PKPA 4B3TE 2LVHA 2N3HA 3VHTB 2EPPA 1IBME 2EL6A 2HJJA 2JWOA 1X6HA 4DV4E 2JVAA 4WYQB 2HHHE 2RTXA 3EPKA 2EOYA 3BGHA 1J5EE 4JI8E 2EJ4A 5AE3A 2ODRD 2JPAA 2DLKA 2ODRC 1FJGE 4NZVA 5F3WA 4JYAE 2VE7C 1EH7A 3LMLA 4RHBB 5TSEA 2F8BA 2LRSA 5A6JA 4DV7E 2UXCE 4R03A 5AE2A 4Q28A 3DF6A 2V89A 5A69A 2YWQA 2EN6A 4GKKE 2LT7A 4X66E 2RS7A 5A2QC 2L2KB 2EPZA 1X5WA 1I94E 2UU9E 5KL2A 2E72A 4JI4E 2JYAA 1JK1A 2GPIA 3OTOE 4F6NA 2RSIA 1JK2A 2L2NA 3VK6A 5KL3A 1WJPA 2YTGA 2EOZA 2UUAE 3QG5C 2VQFE 2MKDA 3THOB 2EOOA 2YTOA 4NXME 2EOSA 3BIDA 3BF2A 3RMPA 4NHRA 1N34E 2M1SA 1YZ9A 1A1JA 2YT4A 2EZ6A 4KZSA 2ADRA 2EORA 2VRDA 4JV5E 1BBGA 4JI5E 3EPHA 2FTXB 1XMQE 4M30A 4O43A 2EN7A 4GZNC 4HEIA 1J26A 3MHHC 4R2QA 5A6BD 4HTGA 1PJQA 3IWBA 4BC7A 2LO3A 4B3ME 4DR7E 2LJUA 2HGHA 3AUZA 2EN4A 1RQ0A 3K6QA 4DKKA 2DGCA 2FV4B 2LBSB 1X6FA 2NUGA 2LJHA 1DI2A 2EMYA 2GLIA 5FLXC 4X64E 2UUBE 1L4SA 2EM4A 4R2AA 3HPZA 1FKAE 2EMKA 1TF3A 2RQLA 2WZOA 2JP9A 2Q8UA 4M9VC 3EQ1A 3ADJA 4J8ZA 4YY3E 5LMNE 4IS1C 4WFTA 2WBTA 2YSPA 2NA2A 1YYOA 5KL6A 1MEYC 4OOGC 2YRMA 1EH6A 2LTRA 4TUGA 2EMIA 2E5LE 2E1MA 2YSOA 1G2DC 2EM3A 1TN9A 2JR1A 2MC6A 4JI7E 4B3SE 4R2RA 1WHQA 5IV8B 1KYQA 2ELZA 1IBKE 4JI6E 1QNTA 4L5NC 4LFAE
chains in the Genus database with same CATH topology
2RS7A 5A2QC 2L2KB 1ZBQA 3C4TA 3MSWA 2JOXA 4R8OA 2LE2A 3VYXA 3F6GA 3IWCA 2M4IA 1XNRE 1YYKA 4DR4E 1I94E 4X65E 3JAMC 2UU9E 4OX9E 4K0KE 4L8NA 3T1HE 2V83A 4JI4E 3KWRA 4DR1E 3HPSA 2G7HA 4LF6E 1IBLE 3IWDA 3JTZA 3OTOE 4LFCE 3H09A 1X48A 2KHXA 2FGGA 2L2NA 3HQ1A 2RSMA 3JU0A 4LTYA 3VK6A 1WXRA 4DR6E 4WPYA 2L6MA 3T1YE 4LU9A 1HR0E 4DV2E 1XMOE 1HNZE 4M0VA 2M7QA 4BBYA 4DV1E 1HNXE 2KOUA 4LF4E 1GQEA 3LLHA 2UUAE 2B7VA 2N3GA 3C4BA 4GEQB 1QU6A 2RS6A 4F9CB 2JOBA 2VQFE 1T4LB 2NUFA 2DMYA 4P7DA 4BCAA 4DV5E 4DR3E 1DQ3A 4NXME 2VF1A 3OMLA 3RMPA 3J80C 4DUZE 1N34E 2M1SA 1YZ9A 2UXBE 2B9DA 2YT4A 2EZ6A 4KZSA 4LF8E 4DR2E 4X8WA 1YYWA 1RC7A 4B3RE 2H36X 2LMZA 4YHHE 4JV5E 4I8OA 4TUIA 4JI5E 2FTXB 1XMQE 4M30A 2LTSA 2B7TA 2UXDE 2V87A 4AQYE 3FIGA 1X47A 4DMIA 1J26A 2L3JA 4JI0E 2MC5A 3IWBA 2L2MA 1N32E 2DIXA 4BC7A 3J7Yp 4B3ME 5LMUE 4JI2E 1N36E 4DR7E 1T4OA 3AUZA 4LFBE 2KONA 1RQ0A 3K6QA 4DKKA 4F9AB 2FV4B 2JY9A 5IT9C 3ADIA 3ADGA 3P1XA 5ADZA 2LUQA 4WSPA 2LBSB 4JI1E 2NUGA 1X49A 2LJHA 4BS9A 5CFFE 3J81C 1DI2A 1STUA 5DNYA 2V86A 3AV0A 5AE1A 2V88A 2NUEA 4LF5E 2V85A 5FLXC 4NXNE 1UILA 4X64E 2ZM6E 4DV0E 2UUBE 3HPZA 1FKAE 2L33A 4X62E 3ZOQB 1GZ6A 2WZOA 4M2ZA 2LUPB 4F9BB 1PKPA 4B3TE 2N3HA 4KHPE 3ADJA 4BC9A 4J8ZA 4BMJA 4YY3E 4LF9E 5LMNE 1WHNA 1IBME 2JWOA 4WFTA 5BR8E 4DV4E 5AASA 2JVAA 4WYQB 2NA2A 5T6JA 2HHHE 1YYOA 2RTXA 1N33E 3DJWA 2EWLA 4OOGC 1J5EE 2L3CA 4JI8E 3HXLA 2VQEE 1O0WA 2UUCE 5AE3A 2ODRD 2ODRC 2LTRA 1FJGE 4TUGA 5F3WA 3VYYA 4JYAE 2YZTA 4DV3E 2VE7C 2K4VA 5LL6R 4LF7E 3ADLA 3LMLA 3HTXA 2F8BA 2LRSA 2E5LE 2E1MA 4DV7E 3J7AG 2UXCE 2L8TA 2JR1A 4R03A 2MC6A 4F54A 4JI7E 1HNWE 2CPNA 2L92A 5AE2A 2B3TB 4Q28A 1EKZA 2IHR1 3DF6A 2V89A 5IWAE 4B3SE 2DSYA 4JI3E 1WHQA 1XNQE 2F4VE 4DR5E 1T4NA 1ZBTA 4GKJE 4JI6E 1IBKE 1UHZA 4GKKE 4DUYE 3F6HA 4L5NC 1SR9A 2DB2A 2V8QB 4X66E 4DV6E 2MDRA 4LFAE 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  4BMJ A;  5AAS A; 
#chains in the Genus database with same CATH topology
 2J7J A;  1ZU1 A;  3C4T A;  3L00 A;  2LV2 A;  4R8O A;  4X9J A;  1MGT A;  1F2I G;  2BB8 A;  2R1F A;  4O4K A;  4K0K E;  3HPS A;  4O5G A;  4WSG A;  2GHF A;  4LFC E;  3JU0 A;  4DR6 E;  2D9H A;  1WXR A;  2RPC A;  2L6M A;  3T1Y E;  1IQO A;  1P47 A;  1T38 A;  1HNZ E;  1UBD C;  4RH8 A;  2EOX A;  1GQE A;  2DLQ A;  2EN2 A;  4GEQ B;  2JOB A;  1LLM C;  2CTD A;  4BCA A;  2K7I A;  3ECR A;  4R2C A;  1NCS A;  4DUZ E;  2EMB A;  3M99 B;  2EPL X;  5KL5 A;  4LF8 E;  1RC7 A;  2LMZ A;  4I8O A;  2EPO A;  2EPA A;  1YPN A;  2L3J A;  2MC5 A;  1N32 E;  2EPK X;  4JI2 E;  4R2S A;  3TQM A;  1B69 A;  1T4O A;  2CT1 A;  2DMI A;  4LFB E;  3ADI A;  5IT9 C;  2LUQ A;  2PRT A;  4JI1 E;  2ENA A;  4BS9 A;  3J81 C;  2EN3 A;  2NUE A;  4NXN E;  4BHB A;  1UIL A;  2ZM6 E;  2MKN A;  4M2Z A;  1AH5 A;  4WX9 A;  2EL4 A;  4BC9 A;  4BMJ A;  4LF9 E;  1N33 E;  3EPJ A;  5KL7 A;  1NEI A;  2L3C A;  2UUC E;  1O0W A;  2M9A A;  2YTP A;  3VYY A;  2YTQ A;  2YZT A;  4DV3 E;  2K4V A;  3ADL A;  3HTX A;  2EMW A;  2BBG A;  3J7A G;  2L8T A;  4F54 A;  1HNW E;  2CPN A;  2ELY A;  2L92 A;  1EKZ A;  2IHR 1;  5IWA E;  4JI3 E;  1XNQ E;  1ZAA C;  1ZBT A;  2EMC A;  1A1L A;  1YFH A;  4DUY E;  1SR9 A;  2V8Q B;  1YUJ A;  4P78 A;  2EOM A;  1KJK A;  2A25 A;  1ZBQ A;  2JOX A;  4BHC A;  3VYX A;  3F6G A;  4WXD A;  1A1K A;  2EM6 A;  2EP3 A;  1XNR E;  1YYK A;  3JAM C;  4OX9 E;  2EM0 A;  2V83 A;  2EL5 A;  2YTE A;  2EMZ A;  3IWD A;  3JTZ A;  3H09 A;  1X48 A;  3HQ1 A;  2FGG A;  2R76 A;  2YTI A;  4WPY A;  4MLV A;  2EMA A;  4LU9 A;  4DV2 E;  1XMO E;  4MLQ A;  4ZYE A;  2EPN A;  2EM9 A;  2YTN A;  2N8X A;  3C4B A;  1T4L B;  1QU6 A;  1A1F A;  2NUF A;  4Q35 B;  2DMY A;  1GTK A;  4DR3 E;  3BBG A;  1DQ3 A;  1DGC A;  1SFE A;  2EMG A;  1PJS A;  3UK3 C;  4KWY A;  2EPX A;  4X8W A;  4B3R E;  4YHH E;  2WBS A;  4TUI A;  2I9I A;  4ZYH A;  2B7T A;  4AQY E;  3FIG A;  1T39 A;  4DMI A;  1A1I A;  2HC5 A;  3EPL A;  2L2M A;  5LMU E;  2EM7 A;  1N36 E;  2CSH A;  1UN6 B;  4F9A B;  2JY9 A;  3P1X A;  5ADZ A;  4WSP A;  1X49 A;  2EOI A;  1PDA A;  1STU A;  2YRH A;  4LF5 E;  2V85 A;  5A6A A;  2EMH A;  2EN1 A;  4DV0 E;  4F6M A;  4X62 E;  3ZOQ B;  1GZ6 A;  2EQ0 A;  2EN8 A;  4KHP E;  2EQ1 A;  1WHN A;  4R2E A;  5BR8 E;  5AAS A;  5AC5 A;  5T6J A;  1RMD A;  2ENC A;  3DJW A;  1AAY A;  2WBU A;  2EPR A;  2EWL A;  2EM2 A;  2YTF A;  2VQE E;  5KL4 A;  4FK5 C;  1IQS A;  1EH8 A;  5LL6 R;  4ZYG A;  2EM8 A;  4LF7 E;  2ENH A;  2YU8 A;  5LLQ A;  1Z1B A;  4ZYD A;  3C6M A;  4IJD A;  4N4R B;  2B3T B;  2F4V E;  2EMF A;  2DSY A;  1N3G A;  1T4N A;  4DR5 E;  2EOE A;  1YUI A;  4GKJ E;  2DRP A;  1UHZ A;  2WCC 3;  1ZR9 A;  3F6H A;  4DV6 E;  2DB2 A;  3HXL A;  2MDR A;  2MDG A;  2NAB A;  3MSW A;  1YSA C;  2LE2 A;  3IWC A;  2M4I A;  4DR4 E;  4X65 E;  4L8N A;  3T1H E;  3KWR A;  4DR1 E;  2G7H A;  4LF6 E;  1IBL E;  2KHX A;  2EOF A;  4LTY A;  1BBO A;  2RSM A;  3THN A;  1TF6 A;  4WXC A;  1HR0 E;  2EPM X;  2YRK A;  4M0V A;  2M7Q A;  4BBY A;  4DV1 E;  1HNX E;  2KOU A;  4LF4 E;  3LLH A;  2B7V A;  2YPN A;  2N3G A;  5A6K A;  2RS6 A;  4F9C B;  1X3C A;  4O24 A;  4P7D A;  2EE8 A;  4DV5 E;  2YTD A;  2JXP A;  2EOQ A;  4R2D A;  2VF1 A;  4R2P A;  3OML A;  3J80 C;  1BB8 A;  2EOH A;  2UXB E;  2B9D A;  3MHS C;  4DR2 E;  1A1G A;  1YYW A;  1IMU A;  2YU5 A;  2EQ3 A;  2H36 X;  1A1H A;  4F2J C;  3KZY A;  2LTS A;  3C6K A;  2UXD E;  2V87 A;  3KZZ A;  1G2F C;  1X47 A;  2EMX A;  2EOJ A;  5A6B A;  1PJT A;  4JI0 E;  2DIX A;  3J7Y p;  2EM5 A;  2EPC A;  2YTJ A;  2KON A;  1X6E A;  2LCE A;  5IXM B;  3ADG A;  1WRJ A;  5CFF E;  5DNY A;  2V86 A;  5AC4 A;  3AV0 A;  5AE1 A;  2V88 A;  2EML A;  2I13 A;  2EPU A;  2L33 A;  2LUP B;  4F9B B;  1PKP A;  4B3T E;  2LVH A;  2N3H A;  3VHT B;  2EPP A;  1IBM E;  2EL6 A;  2HJJ A;  2JWO A;  1X6H A;  4DV4 E;  2JVA A;  4WYQ B;  2HHH E;  2RTX A;  3EPK A;  2EOY A;  3BGH A;  1J5E E;  4JI8 E;  2EJ4 A;  5AE3 A;  2ODR D;  2JPA A;  2DLK A;  2ODR C;  1FJG E;  4NZV A;  5F3W A;  4JYA E;  2VE7 C;  1EH7 A;  3LML A;  4RHB B;  5TSE A;  2F8B A;  2LRS A;  5A6J A;  4DV7 E;  2UXC E;  4R03 A;  5AE2 A;  4Q28 A;  3DF6 A;  2V89 A;  5A69 A;  2YWQ A;  2EN6 A;  4GKK E;  2LT7 A;  4X66 E;  2RS7 A;  5A2Q C;  2L2K B;  2EPZ A;  1X5W A;  1I94 E;  2UU9 E;  5KL2 A;  2E72 A;  4JI4 E;  2JYA A;  1JK1 A;  2GPI A;  3OTO E;  4F6N A;  2RSI A;  1JK2 A;  2L2N A;  3VK6 A;  5KL3 A;  1WJP A;  2YTG A;  2EOZ A;  2UUA E;  3QG5 C;  2VQF E;  2MKD A;  3THO B;  2EOO A;  2YTO A;  4NXM E;  2EOS A;  3BID A;  3BF2 A;  3RMP A;  4NHR A;  1N34 E;  2M1S A;  1YZ9 A;  1A1J A;  2YT4 A;  2EZ6 A;  4KZS A;  2ADR A;  2EOR A;  2VRD A;  4JV5 E;  1BBG A;  4JI5 E;  3EPH A;  2FTX B;  1XMQ E;  4M30 A;  4O43 A;  2EN7 A;  4GZN C;  4HEI A;  1J26 A;  3MHH C;  4R2Q A;  5A6B D;  4HTG A;  1PJQ A;  3IWB A;  4BC7 A;  2LO3 A;  4B3M E;  4DR7 E;  2LJU A;  2HGH A;  3AUZ A;  2EN4 A;  1RQ0 A;  3K6Q A;  4DKK A;  2DGC A;  2FV4 B;  2LBS B;  1X6F A;  2NUG A;  2LJH A;  1DI2 A;  2EMY A;  2GLI A;  5FLX C;  4X64 E;  2UUB E;  1L4S A;  2EM4 A;  4R2A A;  3HPZ A;  1FKA E;  2EMK A;  1TF3 A;  2RQL A;  2WZO A;  2JP9 A;  2Q8U A;  4M9V C;  3EQ1 A;  3ADJ A;  4J8Z A;  4YY3 E;  5LMN E;  4IS1 C;  4WFT A;  2WBT A;  2YSP A;  2NA2 A;  1YYO A;  5KL6 A;  1MEY C;  4OOG C;  2YRM A;  1EH6 A;  2LTR A;  4TUG A;  2EMI A;  2E5L E;  2E1M A;  2YSO A;  1G2D C;  2EM3 A;  1TN9 A;  2JR1 A;  2MC6 A;  4JI7 E;  4B3S E;  4R2R A;  1WHQ A;  5IV8 B;  1KYQ A;  2ELZ A;  1IBK E;  4JI6 E;  1QNT A;  4L5N C;  4LFA E; 
#chains in the Genus database with same CATH homology
 2RS7 A;  5A2Q C;  2L2K B;  1ZBQ A;  3C4T A;  3MSW A;  2JOX A;  4R8O A;  2LE2 A;  3VYX A;  3F6G A;  3IWC A;  2M4I A;  1XNR E;  1YYK A;  4DR4 E;  1I94 E;  4X65 E;  3JAM C;  2UU9 E;  4OX9 E;  4K0K E;  4L8N A;  3T1H E;  2V83 A;  4JI4 E;  3KWR A;  4DR1 E;  3HPS A;  2G7H A;  4LF6 E;  1IBL E;  3IWD A;  3JTZ A;  3OTO E;  4LFC E;  3H09 A;  1X48 A;  2KHX A;  2FGG A;  2L2N A;  3HQ1 A;  2RSM A;  3JU0 A;  4LTY A;  3VK6 A;  1WXR A;  4DR6 E;  4WPY A;  2L6M A;  3T1Y E;  4LU9 A;  1HR0 E;  4DV2 E;  1XMO E;  1HNZ E;  4M0V A;  2M7Q A;  4BBY A;  4DV1 E;  1HNX E;  2KOU A;  4LF4 E;  1GQE A;  3LLH A;  2UUA E;  2B7V A;  2N3G A;  3C4B A;  4GEQ B;  1QU6 A;  2RS6 A;  4F9C B;  2JOB A;  2VQF E;  1T4L B;  2NUF A;  2DMY A;  4P7D A;  4BCA A;  4DV5 E;  4DR3 E;  1DQ3 A;  4NXM E;  2VF1 A;  3OML A;  3RMP A;  3J80 C;  4DUZ E;  1N34 E;  2M1S A;  1YZ9 A;  2UXB E;  2B9D A;  2YT4 A;  2EZ6 A;  4KZS A;  4LF8 E;  4DR2 E;  4X8W A;  1YYW A;  1RC7 A;  4B3R E;  2H36 X;  2LMZ A;  4YHH E;  4JV5 E;  4I8O A;  4TUI A;  4JI5 E;  2FTX B;  1XMQ E;  4M30 A;  2LTS A;  2B7T A;  2UXD E;  2V87 A;  4AQY E;  3FIG A;  1X47 A;  4DMI A;  1J26 A;  2L3J A;  4JI0 E;  2MC5 A;  3IWB A;  2L2M A;  1N32 E;  2DIX A;  4BC7 A;  3J7Y p;  4B3M E;  5LMU E;  4JI2 E;  1N36 E;  4DR7 E;  1T4O A;  3AUZ A;  4LFB E;  2KON A;  1RQ0 A;  3K6Q A;  4DKK A;  4F9A B;  2FV4 B;  2JY9 A;  5IT9 C;  3ADI A;  3ADG A;  3P1X A;  5ADZ A;  2LUQ A;  4WSP A;  2LBS B;  4JI1 E;  2NUG A;  1X49 A;  2LJH A;  4BS9 A;  5CFF E;  3J81 C;  1DI2 A;  1STU A;  5DNY A;  2V86 A;  3AV0 A;  5AE1 A;  2V88 A;  2NUE A;  4LF5 E;  2V85 A;  5FLX C;  4NXN E;  1UIL A;  4X64 E;  2ZM6 E;  4DV0 E;  2UUB E;  3HPZ A;  1FKA E;  2L33 A;  4X62 E;  3ZOQ B;  1GZ6 A;  2WZO A;  4M2Z A;  2LUP B;  4F9B B;  1PKP A;  4B3T E;  2N3H A;  4KHP E;  3ADJ A;  4BC9 A;  4J8Z A;  4BMJ A;  4YY3 E;  4LF9 E;  5LMN E;  1WHN A;  1IBM E;  2JWO A;  4WFT A;  5BR8 E;  4DV4 E;  5AAS A;  2JVA A;  4WYQ B;  2NA2 A;  5T6J A;  2HHH E;  1YYO A;  2RTX A;  1N33 E;  3DJW A;  2EWL A;  4OOG C;  1J5E E;  2L3C A;  4JI8 E;  3HXL A;  2VQE E;  1O0W A;  2UUC E;  5AE3 A;  2ODR D;  2ODR C;  2LTR A;  1FJG E;  4TUG A;  5F3W A;  3VYY A;  4JYA E;  2YZT A;  4DV3 E;  2VE7 C;  2K4V A;  5LL6 R;  4LF7 E;  3ADL A;  3LML A;  3HTX A;  2F8B A;  2LRS A;  2E5L E;  2E1M A;  4DV7 E;  3J7A G;  2UXC E;  2L8T A;  2JR1 A;  4R03 A;  2MC6 A;  4F54 A;  4JI7 E;  1HNW E;  2CPN A;  2L92 A;  5AE2 A;  2B3T B;  4Q28 A;  1EKZ A;  2IHR 1;  3DF6 A;  2V89 A;  5IWA E;  4B3S E;  2DSY A;  4JI3 E;  1WHQ A;  1XNQ E;  2F4V E;  4DR5 E;  1T4N A;  1ZBT A;  4GKJ E;  4JI6 E;  1IBK E;  1UHZ A;  4GKK E;  4DUY E;  3F6H A;  4L5N C;  1SR9 A;  2DB2 A;  2V8Q B;  4X66 E;  4DV6 E;  2MDR A;  4LFA E;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...