4BMJA

Structure of the ubz1and2 tandem of the ubiquitin-binding adaptor protein tax1bp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Tax1BP1 Ubz1 + 2 Provides Insight Into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TAX1-BINDING PROTEIN 1
total genus 18
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4bmjA00
5AASA 2M7QA 4BMJA
chains in the Genus database with same CATH superfamily
2EM6A 1G2DC 2KHXA 3THOB 2EMFA 2L2MA 2L8TA 3JTZA 1EH6A 2EM2A 1DGCA 2ADRA 2E5LE 1ZR9A 2YTFA 2YT4A 2V8QB 1YFHA 2EN3A 4L5NC 4NHRA 4NZVA 4DV4E 3VYYA 4DV0E 3H09A 2EL6A 1WXRA 1YYWA 1RMDA 2FTXB 4DKKA 2YWQA 1O0WA 1YZ9A 1A1KA 2LBSB 5IV8B 1UHZA 2EMHA 2MKDA 1XMQE 4R2SA 2RSIA 2YRHA 2KOUA 3FIGA 2PRTA 5KL4A 2EORA 3T1HE 2EMXA 1UILA 2UUAE 4KZSA 1T39A 2EN4A 1A1JA 2DMYA 1HNZE 4LF7E 2GPIA 2N3GA 1GZ6A 2JY9A 2L2KB 4WSGA 3F6HA 3IWCA 4JI6E 2B7TA 2UUBE 5CFFE 2EOSA 2EMAA 4ZYDA 2EM4A 4M30A 3OTOE 3BBGA 2EM0A 4DV3E 2LRSA 4WXCA 2J7JA 1DQ3A 1LLMC 2A25A 3EQ1A 2EOXA 1DI2A 2FV4B 3EPJA 1T38A 5AE3A 2EM3A 5A6BD 2I13A 2M1SA 1I94E 3C4TA 4Q35B 2JOXA 1IMUA 3HXLA 4JI2E 2MKNA 2EPKX 1JK1A 4R2DA 4DR4E 1WHNA 5IWAE 5TSEA 2EM5A 2IHR1 2JVAA 2WBSA 1NCSA 1PJQA 4DV6E 5AE1A 3J7Yp 2VQFE 2DGCA 4BHCA 2EPUA 2RS6A 2EMLA 3ADIA 2LUQA 2ELZA 4LF5E 2EL4A 4WX9A 3MHSC 4NXNE 4O24A 4JI5E 2EOEA 4DV2E 4DUZE 4F6MA 2WZOA 1STUA 2EMKA 2VF1A 4R03A 2LJUA 2NUGA 4ZYGA 4OX9E 1HR0E 4F2JC 3LMLA 2YTQA 3VHTB 4KWYA 2UUCE 2V86A 2YTNA 4BC9A 4DMIA 2EPOA 4RHBB 1AAYA 3T1YE 2LCEA 4B3SE 1KYQA 2V83A 1Z1BA 2NUFA 1X49A 2EE8A 4L8NA 2DLQA 2LVHA 2DMIA 2V89A 2YRMA 2EOHA 5IXMB 1PJSA 1PDAA 2JYAA 1N32E 1ZU1A 2CSHA 3J7AG 2EPCA 2YTGA 3ZOQB 1G2FC 2LTRA 3KWRA 3HQ1A 2UXBE 1ZBQA 3HPZA 1B69A 4GKKE 4X65E 2V85A 1TN9A 4DR5E 4DUYE 4WXDA 2E72A 2EM8A 2ELYA 3ECRA 2M4IA 3VYXA 1GTKA 2HJJA 3UK3C 5A6KA 2YSOA 2RSMA 3LLHA 3M99B 2YTIA 4MLVA 1J26A 2R1FA 2F8BA 3ADJA 1BBOA 2LTSA 2UU9E 5AASA 4LF8E 2EMCA 3BIDA 2F4VE 5AC4A 4BC7A 4WYQB 3IWDA 4Q28A 1T4OA 2RS7A 1N33E 5KL7A 2HGHA 4ZYEA 3DJWA 2E1MA 4JYAE 4I8OA 4F6NA 1MGTA 4R2PA 1PJTA 4R2CA 3EPKA 4B3ME 4JI1E 5A6JA 2HHHE 1A1FA 4LTYA 1IBME 3EPLA 2V88A 2LJHA 2UXCE 2EOQA 4X64E 1A1IA 4DV1E 2ENHA 1WJPA 2EMBA 1J5EE 4BBYA 3RMPA 3L00A 4RH8A 4O4KA 4JI0E 1QNTA 2N8XA 2M9AA 2GLIA 1XMOE 2NABA 2VRDA 2UXDE 2CT1A 4X8WA 4P7DA 1T4LB 1UBDC 5LMUE 4GKJE 1IBLE 1RQ0A 1HNWE 1T4NA 4N4RB 4BHBA 2MDGA 3MHHC 4O5GA 4F9AB 2VE7C 1WRJA 2MC5A 4JI4E 2JXPA 3KZZA 2YPNA 2EPNA 5KL3A 1SR9A 2JR1A 1A1GA 4JI3E 4YHHE 4R2EA 2JPAA 1QU6A 2YTEA 3ADGA 4WFTA 2ZM6E 1N34E 1L4SA 1F2IG 2L2NA 2B3TB 2EOFA 5T6JA 1X47A 2LMZA 2EWLA 4M2ZA 5F3WA 2EZ6A 2YTOA 4GEQB 4IS1C 1ZAAC 1NEIA 1YPNA 2EPMX 4DR6E 2YTPA 1A1LA 5LL6R 4LFCE 3AUZA 4K0KE 2K7IA 4NXME 2EMIA 2D9HA 2M7QA 4X9JA 1ZBTA 2ODRD 1EKZA 2EPXA 4LFAE 1EH7A 3BF2A 3C4BA 1P47A 2JP9A 5IT9C 2EL5A 4KHPE 1FKAE 2EQ3A 1IBKE 3ADLA 2LT7A 4FK5C 4JV5E 2EPZA 3IWBA 2EP3A 1AH5A 2DRPA 1JK2A 4LF6E 2B9DA 2EOIA 2B7VA 5LLQA 2EOYA 5FLXC 2K4VA 1YYOA 1HNXE 2EN1A 4BMJA 2EMWA 3JU0A 4BS9A 2H36X 4P78A 3DF6A 4TUGA 2ENCA 2JWOA 3J81C 2LO3A 1X5WA 2EMYA 2WCC3 4LF9E 5KL5A 2WBTA 4IJDA 1UN6B 2WBUA 4DV7E 1BBGA 2EN8A 4BCAA 2I9IA 3C6KA 2YRKA 2EM9A 2LV2A 5A6BA 4MLQA 1YSAC 1TF3A 3C6MA 2BBGA 3VK6A 4R2AA 2MC6A 2EPLX 3EPHA 3OMLA 3P1XA 3K6QA 3KZYA 1BB8A 2RPCA 2BB8A 1XNQE 1A1HA 2DIXA 2VQEE 5A2QC 2JOBA 4LF4E 2Q8UA 4JI8E 2EPPA 4JI7E 3J80C 4R2QA 2EMZA 1WHQA 1X6HA 4DR1E 2L3CA 4B3TE 2DLKA 4HEIA 4DR3E 2YSPA 5KL2A 1FJGE 2YTDA 2ODRC 5AE2A 2MDRA 4X62E 4O43A 1N36E 2NA2A 5AC5A 5KL6A 4OOGC 5DNYA 3HTXA 1MEYC 3BGHA 2HC5A 2EOMA 4J8ZA 3AV0A 4TUIA 3TQMA 2EQ0A 4R8OA 2G7HA 2EN7A 2FGGA 1TF6A 2CTDA 4DV5E 4GZNC 2EN6A 4M9VC 2EOOA 2EJ4A 1IQSA 5A6AA 4F9BB 1X48A 4X66E 4M0VA 1N3GA 2EOJA 4WSPA 1GQEA 2KONA 3QG5C 2GHFA 2NUEA 5ADZA 2YU5A 3THNA 2L3JA 5BR8E 2RQLA 1X3CA 4F9CB 5LMNE 4B3RE 2V87A 5A69A 2EPRA 2EQ1A 1IQOA 2YU8A 2DSYA 1XNRE 1EH8A 2L92A 2CPNA 4HTGA 4LU9A 2DB2A 2YZTA 3JAMC 4ZYHA 2EM7A 2EOZA 3F6GA 3MSWA 1PKPA 2EN2A 1SFEA 4LFBE 1X6FA 2R76A 1YUIA 1KJKA 2LUPB 4WPYA 4DR2E 2LE2A 1X6EA 2ENAA 2N3HA 1YYKA 2RTXA 2YTJA 1RC7A 2L6MA 3HPSA 4DR7E 4YY3E 4R2RA 4F54A 2L33A 1YUJA 2EPAA 2EMGA 4AQYE
chains in the Genus database with same CATH topology
4LF5E 2KHXA 4DV1E 4DV7E 4BCAA 4NXNE 2L2MA 2L8TA 3JTZA 1J5EE 2E5LE 4JI5E 4DV2E 4BBYA 2YT4A 3VK6A 2MC6A 4DUZE 2V8QB 1STUA 2VF1A 2WZOA 3OMLA 4R03A 3RMPA 2NUGA 3P1XA 4L5NC 3K6QA 4DV4E 4JI0E 4OX9E 1HR0E 1XMOE 3LMLA 3VYYA 4DV0E 3H09A 2UUCE 1XNQE 1WXRA 2UXDE 2V86A 1YYWA 4BC9A 2DIXA 4X8WA 4DMIA 2FTXB 4P7DA 4DKKA 2VQEE 5A2QC 5LMUE 1T4LB 4GKJE 2JOBA 4LF4E 3T1YE 1O0WA 1IBLE 1YZ9A 1RQ0A 4JI8E 2LBSB 4B3SE 1HNWE 4JI7E 3J80C 1UHZA 1T4NA 2V83A 2NUFA 1WHQA 1X49A 1XMQE 4DR1E 4F9AB 2KOUA 2VE7C 2L3CA 3FIGA 4B3TE 4DR3E 2MC5A 4L8NA 3T1HE 4JI4E 1FJGE 2ODRC 1UILA 5AE2A 2MDRA 2V89A 2UUAE 4KZSA 4X62E 1N36E 2NA2A 1N32E 3J7AG 4OOGC 5DNYA 3HTXA 1SR9A 2DMYA 2JR1A 1HNZE 4LF7E 2N3GA 4JI3E 1GZ6A 4J8ZA 3AV0A 3ZOQB 4YHHE 4TUIA 1QU6A 2LTRA 2JY9A 3ADGA 3HQ1A 1ZBQA 3HPZA 3KWRA 4R8OA 4WFTA 2G7HA 3F6HA 2V85A 3IWCA 4X65E 2ZM6E 4JI6E 4GKKE 4DR5E 1N34E 4DUYE 2FGGA 4DV5E 2B7TA 2UUBE 5CFFE 2L2NA 2B3TB 1X48A 5T6JA 4F9BB 4X66E 4M0VA 1X47A 4M30A 3OTOE 2LMZA 2EWLA 4WSPA 2M4IA 1GQEA 2KONA 5F3WA 4GEQB 4M2ZA 2EZ6A 3VYXA 2NUEA 5ADZA 4DV3E 2LRSA 4DR6E 2L3JA 5BR8E 1DQ3A 5LL6R 4LFCE 4F9CB 3AUZA 5LMNE 4K0KE 4NXME 2UXBE 2RSMA 3LLHA 2M7QA 4B3RE 2V87A 1ZBTA 2ODRD 1J26A 1EKZA 1DI2A 4LFAE 2DSYA 3ADJA 2F8BA 2FV4B 3C4BA 1XNRE 2LTSA 2UU9E 5AASA 5AE3A 5IT9C 4LF8E 4KHPE 2M1SA 1FKAE 2L92A 2F4VE 1I94E 3C4TA 2L2KB 2CPNA 1IBKE 3ADLA 4LU9A 2DB2A 2JOXA 2YZTA 3IWBA 3HXLA 4WYQB 4BC7A 3IWDA 3F6GA 3MSWA 3JAMC 1PKPA 4JI2E 4JV5E 4LFBE 4LF6E 4DR4E 4Q28A 1T4OA 2B9DA 1WHNA 2B7VA 2RS7A 2LUPB 1N33E 4WPYA 4DR2E 5IWAE 2LE2A 3DJWA 2E1MA 2IHR1 5FLXC 4JYAE 4I8OA 2JVAA 2K4VA 1YYOA 2N3HA 1HNXE 4BMJA 1YYKA 2RTXA 1RC7A 2L6MA 3JU0A 4BS9A 2H36X 3HPSA 4B3ME 4DV6E 4JI1E 4DR7E 5AE1A 4YY3E 2HHHE 3J7Yp 4P78A 3DF6A 2VQFE 4TUGA 4LTYA 2JWOA 1IBME 3J81C 4F54A 2RS6A 2L33A 4AQYE 3ADIA 2V88A 4LF9E 2LJHA 2LUQA 2UXCE 4X64E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAS A;  2M7Q A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 2EM6 A;  1G2D C;  2KHX A;  3THO B;  2EMF A;  2L2M A;  2L8T A;  3JTZ A;  1EH6 A;  2EM2 A;  1DGC A;  2ADR A;  2E5L E;  1ZR9 A;  2YTF A;  2YT4 A;  2V8Q B;  1YFH A;  2EN3 A;  4L5N C;  4NHR A;  4NZV A;  4DV4 E;  3VYY A;  4DV0 E;  3H09 A;  2EL6 A;  1WXR A;  1YYW A;  1RMD A;  2FTX B;  4DKK A;  2YWQ A;  1O0W A;  1YZ9 A;  1A1K A;  2LBS B;  5IV8 B;  1UHZ A;  2EMH A;  2MKD A;  1XMQ E;  4R2S A;  2RSI A;  2YRH A;  2KOU A;  3FIG A;  2PRT A;  5KL4 A;  2EOR A;  3T1H E;  2EMX A;  1UIL A;  2UUA E;  4KZS A;  1T39 A;  2EN4 A;  1A1J A;  2DMY A;  1HNZ E;  4LF7 E;  2GPI A;  2N3G A;  1GZ6 A;  2JY9 A;  2L2K B;  4WSG A;  3F6H A;  3IWC A;  4JI6 E;  2B7T A;  2UUB E;  5CFF E;  2EOS A;  2EMA A;  4ZYD A;  2EM4 A;  4M30 A;  3OTO E;  3BBG A;  2EM0 A;  4DV3 E;  2LRS A;  4WXC A;  2J7J A;  1DQ3 A;  1LLM C;  2A25 A;  3EQ1 A;  2EOX A;  1DI2 A;  2FV4 B;  3EPJ A;  1T38 A;  5AE3 A;  2EM3 A;  5A6B D;  2I13 A;  2M1S A;  1I94 E;  3C4T A;  4Q35 B;  2JOX A;  1IMU A;  3HXL A;  4JI2 E;  2MKN A;  2EPK X;  1JK1 A;  4R2D A;  4DR4 E;  1WHN A;  5IWA E;  5TSE A;  2EM5 A;  2IHR 1;  2JVA A;  2WBS A;  1NCS A;  1PJQ A;  4DV6 E;  5AE1 A;  3J7Y p;  2VQF E;  2DGC A;  4BHC A;  2EPU A;  2RS6 A;  2EML A;  3ADI A;  2LUQ A;  2ELZ A;  4LF5 E;  2EL4 A;  4WX9 A;  3MHS C;  4NXN E;  4O24 A;  4JI5 E;  2EOE A;  4DV2 E;  4DUZ E;  4F6M A;  2WZO A;  1STU A;  2EMK A;  2VF1 A;  4R03 A;  2LJU A;  2NUG A;  4ZYG A;  4OX9 E;  1HR0 E;  4F2J C;  3LML A;  2YTQ A;  3VHT B;  4KWY A;  2UUC E;  2V86 A;  2YTN A;  4BC9 A;  4DMI A;  2EPO A;  4RHB B;  1AAY A;  3T1Y E;  2LCE A;  4B3S E;  1KYQ A;  2V83 A;  1Z1B A;  2NUF A;  1X49 A;  2EE8 A;  4L8N A;  2DLQ A;  2LVH A;  2DMI A;  2V89 A;  2YRM A;  2EOH A;  5IXM B;  1PJS A;  1PDA A;  2JYA A;  1N32 E;  1ZU1 A;  2CSH A;  3J7A G;  2EPC A;  2YTG A;  3ZOQ B;  1G2F C;  2LTR A;  3KWR A;  3HQ1 A;  2UXB E;  1ZBQ A;  3HPZ A;  1B69 A;  4GKK E;  4X65 E;  2V85 A;  1TN9 A;  4DR5 E;  4DUY E;  4WXD A;  2E72 A;  2EM8 A;  2ELY A;  3ECR A;  2M4I A;  3VYX A;  1GTK A;  2HJJ A;  3UK3 C;  5A6K A;  2YSO A;  2RSM A;  3LLH A;  3M99 B;  2YTI A;  4MLV A;  1J26 A;  2R1F A;  2F8B A;  3ADJ A;  1BBO A;  2LTS A;  2UU9 E;  5AAS A;  4LF8 E;  2EMC A;  3BID A;  2F4V E;  5AC4 A;  4BC7 A;  4WYQ B;  3IWD A;  4Q28 A;  1T4O A;  2RS7 A;  1N33 E;  5KL7 A;  2HGH A;  4ZYE A;  3DJW A;  2E1M A;  4JYA E;  4I8O A;  4F6N A;  1MGT A;  4R2P A;  1PJT A;  4R2C A;  3EPK A;  4B3M E;  4JI1 E;  5A6J A;  2HHH E;  1A1F A;  4LTY A;  1IBM E;  3EPL A;  2V88 A;  2LJH A;  2UXC E;  2EOQ A;  4X64 E;  1A1I A;  4DV1 E;  2ENH A;  1WJP A;  2EMB A;  1J5E E;  4BBY A;  3RMP A;  3L00 A;  4RH8 A;  4O4K A;  4JI0 E;  1QNT A;  2N8X A;  2M9A A;  2GLI A;  1XMO E;  2NAB A;  2VRD A;  2UXD E;  2CT1 A;  4X8W A;  4P7D A;  1T4L B;  1UBD C;  5LMU E;  4GKJ E;  1IBL E;  1RQ0 A;  1HNW E;  1T4N A;  4N4R B;  4BHB A;  2MDG A;  3MHH C;  4O5G A;  4F9A B;  2VE7 C;  1WRJ A;  2MC5 A;  4JI4 E;  2JXP A;  3KZZ A;  2YPN A;  2EPN A;  5KL3 A;  1SR9 A;  2JR1 A;  1A1G A;  4JI3 E;  4YHH E;  4R2E A;  2JPA A;  1QU6 A;  2YTE A;  3ADG A;  4WFT A;  2ZM6 E;  1N34 E;  1L4S A;  1F2I G;  2L2N A;  2B3T B;  2EOF A;  5T6J A;  1X47 A;  2LMZ A;  2EWL A;  4M2Z A;  5F3W A;  2EZ6 A;  2YTO A;  4GEQ B;  4IS1 C;  1ZAA C;  1NEI A;  1YPN A;  2EPM X;  4DR6 E;  2YTP A;  1A1L A;  5LL6 R;  4LFC E;  3AUZ A;  4K0K E;  2K7I A;  4NXM E;  2EMI A;  2D9H A;  2M7Q A;  4X9J A;  1ZBT A;  2ODR D;  1EKZ A;  2EPX A;  4LFA E;  1EH7 A;  3BF2 A;  3C4B A;  1P47 A;  2JP9 A;  5IT9 C;  2EL5 A;  4KHP E;  1FKA E;  2EQ3 A;  1IBK E;  3ADL A;  2LT7 A;  4FK5 C;  4JV5 E;  2EPZ A;  3IWB A;  2EP3 A;  1AH5 A;  2DRP A;  1JK2 A;  4LF6 E;  2B9D A;  2EOI A;  2B7V A;  5LLQ A;  2EOY A;  5FLX C;  2K4V A;  1YYO A;  1HNX E;  2EN1 A;  4BMJ A;  2EMW A;  3JU0 A;  4BS9 A;  2H36 X;  4P78 A;  3DF6 A;  4TUG A;  2ENC A;  2JWO A;  3J81 C;  2LO3 A;  1X5W A;  2EMY A;  2WCC 3;  4LF9 E;  5KL5 A;  2WBT A;  4IJD A;  1UN6 B;  2WBU A;  4DV7 E;  1BBG A;  2EN8 A;  4BCA A;  2I9I A;  3C6K A;  2YRK A;  2EM9 A;  2LV2 A;  5A6B A;  4MLQ A;  1YSA C;  1TF3 A;  3C6M A;  2BBG A;  3VK6 A;  4R2A A;  2MC6 A;  2EPL X;  3EPH A;  3OML A;  3P1X A;  3K6Q A;  3KZY A;  1BB8 A;  2RPC A;  2BB8 A;  1XNQ E;  1A1H A;  2DIX A;  2VQE E;  5A2Q C;  2JOB A;  4LF4 E;  2Q8U A;  4JI8 E;  2EPP A;  4JI7 E;  3J80 C;  4R2Q A;  2EMZ A;  1WHQ A;  1X6H A;  4DR1 E;  2L3C A;  4B3T E;  2DLK A;  4HEI A;  4DR3 E;  2YSP A;  5KL2 A;  1FJG E;  2YTD A;  2ODR C;  5AE2 A;  2MDR A;  4X62 E;  4O43 A;  1N36 E;  2NA2 A;  5AC5 A;  5KL6 A;  4OOG C;  5DNY A;  3HTX A;  1MEY C;  3BGH A;  2HC5 A;  2EOM A;  4J8Z A;  3AV0 A;  4TUI A;  3TQM A;  2EQ0 A;  4R8O A;  2G7H A;  2EN7 A;  2FGG A;  1TF6 A;  2CTD A;  4DV5 E;  4GZN C;  2EN6 A;  4M9V C;  2EOO A;  2EJ4 A;  1IQS A;  5A6A A;  4F9B B;  1X48 A;  4X66 E;  4M0V A;  1N3G A;  2EOJ A;  4WSP A;  1GQE A;  2KON A;  3QG5 C;  2GHF A;  2NUE A;  5ADZ A;  2YU5 A;  3THN A;  2L3J A;  5BR8 E;  2RQL A;  1X3C A;  4F9C B;  5LMN E;  4B3R E;  2V87 A;  5A69 A;  2EPR A;  2EQ1 A;  1IQO A;  2YU8 A;  2DSY A;  1XNR E;  1EH8 A;  2L92 A;  2CPN A;  4HTG A;  4LU9 A;  2DB2 A;  2YZT A;  3JAM C;  4ZYH A;  2EM7 A;  2EOZ A;  3F6G A;  3MSW A;  1PKP A;  2EN2 A;  1SFE A;  4LFB E;  1X6F A;  2R76 A;  1YUI A;  1KJK A;  2LUP B;  4WPY A;  4DR2 E;  2LE2 A;  1X6E A;  2ENA A;  2N3H A;  1YYK A;  2RTX A;  2YTJ A;  1RC7 A;  2L6M A;  3HPS A;  4DR7 E;  4YY3 E;  4R2R A;  4F54 A;  2L33 A;  1YUJ A;  2EPA A;  2EMG A;  4AQY E; 
#chains in the Genus database with same CATH homology
 4LF5 E;  2KHX A;  4DV1 E;  4DV7 E;  4BCA A;  4NXN E;  2L2M A;  2L8T A;  3JTZ A;  1J5E E;  2E5L E;  4JI5 E;  4DV2 E;  4BBY A;  2YT4 A;  3VK6 A;  2MC6 A;  4DUZ E;  2V8Q B;  1STU A;  2VF1 A;  2WZO A;  3OML A;  4R03 A;  3RMP A;  2NUG A;  3P1X A;  4L5N C;  3K6Q A;  4DV4 E;  4JI0 E;  4OX9 E;  1HR0 E;  1XMO E;  3LML A;  3VYY A;  4DV0 E;  3H09 A;  2UUC E;  1XNQ E;  1WXR A;  2UXD E;  2V86 A;  1YYW A;  4BC9 A;  2DIX A;  4X8W A;  4DMI A;  2FTX B;  4P7D A;  4DKK A;  2VQE E;  5A2Q C;  5LMU E;  1T4L B;  4GKJ E;  2JOB A;  4LF4 E;  3T1Y E;  1O0W A;  1IBL E;  1YZ9 A;  1RQ0 A;  4JI8 E;  2LBS B;  4B3S E;  1HNW E;  4JI7 E;  3J80 C;  1UHZ A;  1T4N A;  2V83 A;  2NUF A;  1WHQ A;  1X49 A;  1XMQ E;  4DR1 E;  4F9A B;  2KOU A;  2VE7 C;  2L3C A;  3FIG A;  4B3T E;  4DR3 E;  2MC5 A;  4L8N A;  3T1H E;  4JI4 E;  1FJG E;  2ODR C;  1UIL A;  5AE2 A;  2MDR A;  2V89 A;  2UUA E;  4KZS A;  4X62 E;  1N36 E;  2NA2 A;  1N32 E;  3J7A G;  4OOG C;  5DNY A;  3HTX A;  1SR9 A;  2DMY A;  2JR1 A;  1HNZ E;  4LF7 E;  2N3G A;  4JI3 E;  1GZ6 A;  4J8Z A;  3AV0 A;  3ZOQ B;  4YHH E;  4TUI A;  1QU6 A;  2LTR A;  2JY9 A;  3ADG A;  3HQ1 A;  1ZBQ A;  3HPZ A;  3KWR A;  4R8O A;  4WFT A;  2G7H A;  3F6H A;  2V85 A;  3IWC A;  4X65 E;  2ZM6 E;  4JI6 E;  4GKK E;  4DR5 E;  1N34 E;  4DUY E;  2FGG A;  4DV5 E;  2B7T A;  2UUB E;  5CFF E;  2L2N A;  2B3T B;  1X48 A;  5T6J A;  4F9B B;  4X66 E;  4M0V A;  1X47 A;  4M30 A;  3OTO E;  2LMZ A;  2EWL A;  4WSP A;  2M4I A;  1GQE A;  2KON A;  5F3W A;  4GEQ B;  4M2Z A;  2EZ6 A;  3VYX A;  2NUE A;  5ADZ A;  4DV3 E;  2LRS A;  4DR6 E;  2L3J A;  5BR8 E;  1DQ3 A;  5LL6 R;  4LFC E;  4F9C B;  3AUZ A;  5LMN E;  4K0K E;  4NXM E;  2UXB E;  2RSM A;  3LLH A;  2M7Q A;  4B3R E;  2V87 A;  1ZBT A;  2ODR D;  1J26 A;  1EKZ A;  1DI2 A;  4LFA E;  2DSY A;  3ADJ A;  2F8B A;  2FV4 B;  3C4B A;  1XNR E;  2LTS A;  2UU9 E;  5AAS A;  5AE3 A;  5IT9 C;  4LF8 E;  4KHP E;  2M1S A;  1FKA E;  2L92 A;  2F4V E;  1I94 E;  3C4T A;  2L2K B;  2CPN A;  1IBK E;  3ADL A;  4LU9 A;  2DB2 A;  2JOX A;  2YZT A;  3IWB A;  3HXL A;  4WYQ B;  4BC7 A;  3IWD A;  3F6G A;  3MSW A;  3JAM C;  1PKP A;  4JI2 E;  4JV5 E;  4LFB E;  4LF6 E;  4DR4 E;  4Q28 A;  1T4O A;  2B9D A;  1WHN A;  2B7V A;  2RS7 A;  2LUP B;  1N33 E;  4WPY A;  4DR2 E;  5IWA E;  2LE2 A;  3DJW A;  2E1M A;  2IHR 1;  5FLX C;  4JYA E;  4I8O A;  2JVA A;  2K4V A;  1YYO A;  2N3H A;  1HNX E;  4BMJ A;  1YYK A;  2RTX A;  1RC7 A;  2L6M A;  3JU0 A;  4BS9 A;  2H36 X;  3HPS A;  4B3M E;  4DV6 E;  4JI1 E;  4DR7 E;  5AE1 A;  4YY3 E;  2HHH E;  3J7Y p;  4P78 A;  3DF6 A;  2VQF E;  4TUG A;  4LTY A;  2JWO A;  1IBM E;  3J81 C;  4F54 A;  2RS6 A;  2L33 A;  4AQY E;  3ADI A;  2V88 A;  4LF9 E;  2LJH A;  2LUQ A;  2UXC E;  4X64 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...