4BMJA

Structure of the ubz1and2 tandem of the ubiquitin-binding adaptor protein tax1bp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'MDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAX1-BINDING PROTEIN 1
publication title The Structure of Tax1BP1 Ubz1 + 2 Provides Insight Into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 18
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4bmjA00
4BMJA 2M7QA 5AASA
chains in the Genus database with same CATH superfamily
2RS6A 2VRDA 1ZBTA 4LU9A 3LLHA 2YU8A 1UN6B 5IV8B 2YTIA 4NXNE 4WFTA 1YSAC 2EPCA 2DMYA 4BHBA 4B3RE 2EM5A 2EOZA 2LJUA 1YPNA 4J8ZA 2EN8A 2EN2A 2N3HA 4DV3E 3IWBA 2RQLA 2L6MA 1HNZE 2EOQA 2EL5A 3DJWA 4JI0E 1A1HA 2V88A 2BBGA 2VF1A 3QG5C 2MDRA 4L8NA 4WSPA 1X6FA 2EL6A 1TF6A 2PRTA 3HXLA 2GLIA 4JI7E 2J7JA 1UILA 2YTPA 4IJDA 5IWAE 1JK2A 1PJQA 2ENCA 2ADRA 3T1HE 3IWDA 1N34E 1YUIA 2EPOA 4GKJE 2EPUA 4LF9E 3THOB 2G7HA 2DRPA 4LF8E 4KWYA 1G2DC 2EMYA 2EM4A 5KL7A 1T4NA 4R8OA 4DR4E 2L8TA 3HQ1A 4DR5E 2M7QA 1T4LB 2EOOA 2RPCA 2LE2A 2MKDA 4O24A 1N36E 4F54A 2CT1A 2UUAE 5KL6A 2EOSA 2K7IA 3AUZA 4JI1E 3VYYA 2EPMX 2UXCE 4R2SA 2EQ1A 4R03A 2EM0A 2EPKX 1STUA 2LRSA 5LLQA 3EPKA 3OMLA 2EOFA 4X9JA 4DV0E 2EN7A 4NHRA 2I13A 2LTSA 2YU5A 2EPLX 4DV7E 1GZ6A 2JP9A 3FIGA 5AE1A 1J26A 3F6GA 2LBSB 2LCEA 1T38A 4O43A 4R2AA 2EM3A 1EH6A 2ODRC 4DUYE 3BIDA 2NUFA 2JOXA 5A6AA 4HTGA 1RC7A 3JU0A 4DR3E 3ADIA 1RMDA 2EMHA 2IHR1 4X62E 2L3JA 1RQ0A 4JYAE 2EWLA 2EQ3A 2JVAA 3J80C 1YYKA 2M4IA 4Q35B 4LF7E 1YYWA 3KWRA 2YTNA 2M9AA 3VHTB 2EPPA 2N3GA 2LUPB 2EOIA 1N3GA 1PKPA 2V87A 2EN4A 5KL4A 1A1FA 2KONA 2EPNA 2MDGA 1WJPA 2L2KB 2EP3A 4K0KE 2B9DA 2YPNA 2EMLA 2EN1A 3RMPA 2K4VA 4M9VC 3EPHA 4HEIA 1KJKA 1LLMC 2DB2A 1L4SA 2VE7C 2EM6A 2V85A 2UUCE 3VK6A 5LL6R 3ZOQB 1NEIA 5AE2A 3KZZA 1GTKA 3C6MA 2UUBE 1A1GA 3C4TA 1X47A 2LMZA 5T6JA 3ADGA 4F6MA 1BB8A 2MC5A 2DMIA 5DNYA 5FLXC 1JK1A 4LFCE 2EZ6A 4ZYDA 4LTYA 2EQ0A 2UU9E 1X48A 1XMQE 4BHCA 4M30A 5A6JA 4WXCA 2B7TA 2YRHA 4X66E 1J5EE 3EPJA 2B3TB 4I8OA 4GKKE 4R2PA 2ZM6E 3ADLA 2NABA 5AC5A 4DUZE 4F9CB 2F4VE 1B69A 2EPAA 1ZU1A 2EL4A 2EMGA 1YUJA 1IQOA 4LF6E 3L00A 3K6QA 1XNQE 2F8BA 5LMUE 2EMWA 2YZTA 4X8WA 3EPLA 2UXBE 2EMKA 2GHFA 2Q8UA 1WRJA 2E72A 3P1XA 2EM8A 4IS1C 5LMNE 4B3ME 5A6BA 2L33A 1IBME 3C6KA 5A69A 1DI2A 3HTXA 1PDAA 2L2MA 1X3CA 3THNA 3VYXA 1X5WA 4X64E 1HNXE 1QNTA 1IQSA 1XMOE 1ZBQA 4OOGC 1A1KA 1KYQA 4WPYA 1SR9A 2EMAA 2ELZA 3DF6A 4YY3E 2EMXA 2CPNA 1PJTA 2RS7A 5CFFE 1QU6A 1P47A 2EPXA 1YYOA 4BC7A 4YHHE 5A6BD 2ELYA 2R76A 4JI6E 3M99B 3IWCA 4R2EA 4X65E 2EN6A 2EOXA 1ZAAC 4BMJA 3BBGA 1YZ9A 4JI3E 3TQMA 1GQEA 2YSOA 2EMBA 5F3WA 1TN9A 4F9AB 4WX9A 4NZVA 4O4KA 2E5LE 4DR2E 2EOYA 2YRMA 4DV1E 4LFAE 1X49A 2DGCA 1O0WA 2YTFA 4RH8A 2HGHA 2EPZA 1IBKE 2JY9A 4JI4E 2EMCA 1N32E 5IT9C 4M2ZA 3T1YE 2EOEA 4M0VA 1SFEA 3JAMC 4LF4E 1WHNA 4OX9E 2DSYA 2EN3A 1AAYA 2JYAA 2FTXB 1G2FC 2YWQA 5AASA 1EKZA 4R2DA 2NUEA 3J7AG 1N33E 1A1JA 2H36X 1A1LA 2ODRD 2HC5A 4MLQA 1Z1BA 4WXDA 1EH8A 1WXRA 2I9IA 1TF3A 2YSPA 4KHPE 1I94E 1X6HA 2B7VA 2YTOA 1BBOA 4BS9A 2EM9A 4L5NC 3MHHC 3C4BA 4FK5C 3MSWA 4BCAA 2WBSA 2EPRA 2YTQA 4DR6E 4WSGA 4N4RB 2L92A 4JI8E 4BC9A 2YTEA 2EOMA 3BGHA 5AE3A 4JI2E 4ZYGA 2N8XA 2ENAA 2FGGA 4B3SE 2YTJA 5KL2A 4TUIA 4BBYA 4DKKA 1DGCA 2GPIA 2RTXA 1NCSA 4WYQB 2MKNA 5AC4A 3H09A 2EOHA 3HPZA 1WHQA 4ZYEA 2FV4B 2YTDA 2RSIA 1MGTA 3BF2A 1F2IG 5BR8E 1HNWE 2VQEE 3EQ1A 4O5GA 4KZSA 2D9HA 4F6NA 2KHXA 1FKAE 4JV5E 1UBDC 1IMUA 3JTZA 3OTOE 2LVHA 2YTGA 2DLQA 4DR7E 1FJGE 2MC6A 5TSEA 2LTRA 1HR0E 2LT7A 2VQFE 3MHSC 2L2NA 4F9BB 2UXDE 4F2JC 4Q28A 1T4OA 2EE8A 4GZNC 2WBTA 1BBGA 2ENHA 5ADZA 2V83A 2EMIA 2BB8A 3J81C 2LJHA 4GEQB 4DR1E 4RHBB 2M1SA 3ADJA 2EMZA 4JI5E 3UK3C 4DV2E 2E1MA 2V86A 5KL3A 2HJJA 2YRKA 4R2CA 4B3TE 2LV2A 2WCC3 4NXME 4DV6E 2A25A 2EM2A 2JR1A 1YFHA 3F6HA 2JOBA 3AV0A 1MEYC 4TUGA 4P78A 5A6KA 2R1FA 1AH5A 2EORA 1T39A 4DMIA 5A2QC 5IXMB 1XNRE 2EMFA 3KZYA 2JPAA 2RSMA 4ZYHA 2DLKA 4DV5E 1UHZA 2CSHA 4P7DA 2YT4A 5KL5A 1IBLE 2CTDA 2V8QB 3HPSA 4AQYE 1PJSA 1X6EA 4R2QA 2NA2A 1DQ3A 4LFBE 1EH7A 2LUQA 4LF5E 2EM7A 2KOUA 2EOJA 3ECRA 2NUGA 2DIXA 3J7Yp 2JXPA 1A1IA 2WZOA 1ZR9A 3LMLA 2V89A 2L3CA 2HHHE 4MLVA 4DV4E 2EJ4A 2LO3A 4R2RA 2JWOA 2WBUA
chains in the Genus database with same CATH topology
2IHR1 4OOGC 2RS6A 4WPYA 1ZBTA 1SR9A 4LU9A 1RQ0A 3LLHA 4X62E 2L3JA 3DF6A 4YY3E 4JYAE 2EWLA 2CPNA 5BR8E 4NXNE 2RS7A 5CFFE 2VQEE 1QU6A 2JVAA 4WFTA 3J80C 4KZSA 1HNWE 1YYKA 1YYOA 2M4IA 4BC7A 4YHHE 3ADIA 4B3RE 2DMYA 2KHXA 4LF7E 1YYWA 3KWRA 1FKAE 4JV5E 4JI6E 2N3GA 3JTZA 2LUPB 3IWCA 1PKPA 2V87A 4J8ZA 4X65E 3OTOE 2KONA 4DR7E 4BMJA 1FJGE 2MC6A 2LTRA 2N3HA 4DV3E 3IWBA 1YZ9A 2L6MA 1HNZE 1HR0E 4JI3E 2L2KB 3DJWA 2VQFE 1GQEA 2B9DA 2L2NA 4JI0E 2V88A 4F9BB 4K0KE 2UXDE 3RMPA 2K4VA 4Q28A 5F3WA 1T4OA 4F9AB 2VF1A 5ADZA 2E5LE 2DB2A 2V83A 4DR2E 2MDRA 4L8NA 4WSPA 4DV1E 4LFAE 1X49A 1O0WA 3J81C 2VE7C 2LJHA 1IBKE 4GEQB 2V85A 4DR1E 2UUCE 2JY9A 3VK6A 4JI4E 2M1SA 5LL6R 3ZOQB 3ADJA 5IT9C 4M2ZA 3T1YE 1N32E 3HXLA 4M0VA 5AE2A 4JI5E 4JI7E 3JAMC 4DV2E 1WHNA 2E1MA 4LF4E 2V86A 1UILA 2UUBE 5IWAE 2DSYA 4OX9E 3C4TA 1X47A 2LMZA 5T6JA 2FTXB 3ADGA 4B3TE 2MC5A 3T1HE 3IWDA 1N34E 5AASA 5DNYA 5FLXC 1EKZA 4LFCE 4NXME 2NUEA 4DV6E 2EZ6A 2JR1A 4LF9E 4GKJE 4LTYA 2G7HA 3F6HA 2JOBA 3AV0A 1X48A 2UU9E 4LF8E 4TUGA 4P78A 1XMQE 3J7AG 1N33E 2H36X 2ODRD 1T4NA 4R8OA 4M30A 2L8TA 4DR4E 3HQ1A 4DR5E 2B7TA 1WXRA 2M7QA 4DMIA 1T4LB 5A2QC 4KHPE 4X66E 1XNRE 1I94E 2LE2A 2B7VA 1N36E 4BS9A 4F54A 1J5EE 4L5NC 2RSMA 3C4BA 2B3TB 4I8OA 2UUAE 3AUZA 4JI1E 4GKKE 3MSWA 2ZM6E 4BCAA 3VYYA 3ADLA 2UXCE 4DV5E 4R03A 1UHZA 4DUZE 4F9CB 2F4VE 4P7DA 2LRSA 1STUA 2YT4A 1IBLE 4DR6E 3OMLA 2V8QB 4DV0E 3HPSA 4LF6E 3K6QA 4AQYE 2LTSA 2L92A 2F8BA 4JI8E 5LMUE 4BC9A 1XNQE 2NA2A 2UXBE 2YZTA 1DQ3A 4X8WA 5AE3A 1GZ6A 4DV7E 3FIGA 4JI2E 5AE1A 4LFBE 1J26A 3F6GA 4DR3E 2FGGA 2LUQA 2LBSB 4LF5E 2KOUA 3P1XA 4B3SE 4TUIA 5LMNE 4B3ME 4BBYA 2NUGA 2DIXA 4DKKA 3J7Yp 2WZOA 2ODRC 2RTXA 4WYQB 2L33A 3LMLA 4DUYE 1IBME 1DI2A 2NUFA 3HTXA 2V89A 2L2MA 3H09A 2L3CA 2JOXA 1RC7A 2HHHE 3VYXA 3HPZA 4X64E 3JU0A 4DV4E 1WHQA 1HNXE 2FV4B 2JWOA 1XMOE 1ZBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMJ A;  2M7Q A;  5AAS A; 
#chains in the Genus database with same CATH topology
 2RS6 A;  2VRD A;  1ZBT A;  4LU9 A;  3LLH A;  2YU8 A;  1UN6 B;  5IV8 B;  2YTI A;  4NXN E;  4WFT A;  1YSA C;  2EPC A;  2DMY A;  4BHB A;  4B3R E;  2EM5 A;  2EOZ A;  2LJU A;  1YPN A;  4J8Z A;  2EN8 A;  2EN2 A;  2N3H A;  4DV3 E;  3IWB A;  2RQL A;  2L6M A;  1HNZ E;  2EOQ A;  2EL5 A;  3DJW A;  4JI0 E;  1A1H A;  2V88 A;  2BBG A;  2VF1 A;  3QG5 C;  2MDR A;  4L8N A;  4WSP A;  1X6F A;  2EL6 A;  1TF6 A;  2PRT A;  3HXL A;  2GLI A;  4JI7 E;  2J7J A;  1UIL A;  2YTP A;  4IJD A;  5IWA E;  1JK2 A;  1PJQ A;  2ENC A;  2ADR A;  3T1H E;  3IWD A;  1N34 E;  1YUI A;  2EPO A;  4GKJ E;  2EPU A;  4LF9 E;  3THO B;  2G7H A;  2DRP A;  4LF8 E;  4KWY A;  1G2D C;  2EMY A;  2EM4 A;  5KL7 A;  1T4N A;  4R8O A;  4DR4 E;  2L8T A;  3HQ1 A;  4DR5 E;  2M7Q A;  1T4L B;  2EOO A;  2RPC A;  2LE2 A;  2MKD A;  4O24 A;  1N36 E;  4F54 A;  2CT1 A;  2UUA E;  5KL6 A;  2EOS A;  2K7I A;  3AUZ A;  4JI1 E;  3VYY A;  2EPM X;  2UXC E;  4R2S A;  2EQ1 A;  4R03 A;  2EM0 A;  2EPK X;  1STU A;  2LRS A;  5LLQ A;  3EPK A;  3OML A;  2EOF A;  4X9J A;  4DV0 E;  2EN7 A;  4NHR A;  2I13 A;  2LTS A;  2YU5 A;  2EPL X;  4DV7 E;  1GZ6 A;  2JP9 A;  3FIG A;  5AE1 A;  1J26 A;  3F6G A;  2LBS B;  2LCE A;  1T38 A;  4O43 A;  4R2A A;  2EM3 A;  1EH6 A;  2ODR C;  4DUY E;  3BID A;  2NUF A;  2JOX A;  5A6A A;  4HTG A;  1RC7 A;  3JU0 A;  4DR3 E;  3ADI A;  1RMD A;  2EMH A;  2IHR 1;  4X62 E;  2L3J A;  1RQ0 A;  4JYA E;  2EWL A;  2EQ3 A;  2JVA A;  3J80 C;  1YYK A;  2M4I A;  4Q35 B;  4LF7 E;  1YYW A;  3KWR A;  2YTN A;  2M9A A;  3VHT B;  2EPP A;  2N3G A;  2LUP B;  2EOI A;  1N3G A;  1PKP A;  2V87 A;  2EN4 A;  5KL4 A;  1A1F A;  2KON A;  2EPN A;  2MDG A;  1WJP A;  2L2K B;  2EP3 A;  4K0K E;  2B9D A;  2YPN A;  2EML A;  2EN1 A;  3RMP A;  2K4V A;  4M9V C;  3EPH A;  4HEI A;  1KJK A;  1LLM C;  2DB2 A;  1L4S A;  2VE7 C;  2EM6 A;  2V85 A;  2UUC E;  3VK6 A;  5LL6 R;  3ZOQ B;  1NEI A;  5AE2 A;  3KZZ A;  1GTK A;  3C6M A;  2UUB E;  1A1G A;  3C4T A;  1X47 A;  2LMZ A;  5T6J A;  3ADG A;  4F6M A;  1BB8 A;  2MC5 A;  2DMI A;  5DNY A;  5FLX C;  1JK1 A;  4LFC E;  2EZ6 A;  4ZYD A;  4LTY A;  2EQ0 A;  2UU9 E;  1X48 A;  1XMQ E;  4BHC A;  4M30 A;  5A6J A;  4WXC A;  2B7T A;  2YRH A;  4X66 E;  1J5E E;  3EPJ A;  2B3T B;  4I8O A;  4GKK E;  4R2P A;  2ZM6 E;  3ADL A;  2NAB A;  5AC5 A;  4DUZ E;  4F9C B;  2F4V E;  1B69 A;  2EPA A;  1ZU1 A;  2EL4 A;  2EMG A;  1YUJ A;  1IQO A;  4LF6 E;  3L00 A;  3K6Q A;  1XNQ E;  2F8B A;  5LMU E;  2EMW A;  2YZT A;  4X8W A;  3EPL A;  2UXB E;  2EMK A;  2GHF A;  2Q8U A;  1WRJ A;  2E72 A;  3P1X A;  2EM8 A;  4IS1 C;  5LMN E;  4B3M E;  5A6B A;  2L33 A;  1IBM E;  3C6K A;  5A69 A;  1DI2 A;  3HTX A;  1PDA A;  2L2M A;  1X3C A;  3THN A;  3VYX A;  1X5W A;  4X64 E;  1HNX E;  1QNT A;  1IQS A;  1XMO E;  1ZBQ A;  4OOG C;  1A1K A;  1KYQ A;  4WPY A;  1SR9 A;  2EMA A;  2ELZ A;  3DF6 A;  4YY3 E;  2EMX A;  2CPN A;  1PJT A;  2RS7 A;  5CFF E;  1QU6 A;  1P47 A;  2EPX A;  1YYO A;  4BC7 A;  4YHH E;  5A6B D;  2ELY A;  2R76 A;  4JI6 E;  3M99 B;  3IWC A;  4R2E A;  4X65 E;  2EN6 A;  2EOX A;  1ZAA C;  4BMJ A;  3BBG A;  1YZ9 A;  4JI3 E;  3TQM A;  1GQE A;  2YSO A;  2EMB A;  5F3W A;  1TN9 A;  4F9A B;  4WX9 A;  4NZV A;  4O4K A;  2E5L E;  4DR2 E;  2EOY A;  2YRM A;  4DV1 E;  4LFA E;  1X49 A;  2DGC A;  1O0W A;  2YTF A;  4RH8 A;  2HGH A;  2EPZ A;  1IBK E;  2JY9 A;  4JI4 E;  2EMC A;  1N32 E;  5IT9 C;  4M2Z A;  3T1Y E;  2EOE A;  4M0V A;  1SFE A;  3JAM C;  4LF4 E;  1WHN A;  4OX9 E;  2DSY A;  2EN3 A;  1AAY A;  2JYA A;  2FTX B;  1G2F C;  2YWQ A;  5AAS A;  1EKZ A;  4R2D A;  2NUE A;  3J7A G;  1N33 E;  1A1J A;  2H36 X;  1A1L A;  2ODR D;  2HC5 A;  4MLQ A;  1Z1B A;  4WXD A;  1EH8 A;  1WXR A;  2I9I A;  1TF3 A;  2YSP A;  4KHP E;  1I94 E;  1X6H A;  2B7V A;  2YTO A;  1BBO A;  4BS9 A;  2EM9 A;  4L5N C;  3MHH C;  3C4B A;  4FK5 C;  3MSW A;  4BCA A;  2WBS A;  2EPR A;  2YTQ A;  4DR6 E;  4WSG A;  4N4R B;  2L92 A;  4JI8 E;  4BC9 A;  2YTE A;  2EOM A;  3BGH A;  5AE3 A;  4JI2 E;  4ZYG A;  2N8X A;  2ENA A;  2FGG A;  4B3S E;  2YTJ A;  5KL2 A;  4TUI A;  4BBY A;  4DKK A;  1DGC A;  2GPI A;  2RTX A;  1NCS A;  4WYQ B;  2MKN A;  5AC4 A;  3H09 A;  2EOH A;  3HPZ A;  1WHQ A;  4ZYE A;  2FV4 B;  2YTD A;  2RSI A;  1MGT A;  3BF2 A;  1F2I G;  5BR8 E;  1HNW E;  2VQE E;  3EQ1 A;  4O5G A;  4KZS A;  2D9H A;  4F6N A;  2KHX A;  1FKA E;  4JV5 E;  1UBD C;  1IMU A;  3JTZ A;  3OTO E;  2LVH A;  2YTG A;  2DLQ A;  4DR7 E;  1FJG E;  2MC6 A;  5TSE A;  2LTR A;  1HR0 E;  2LT7 A;  2VQF E;  3MHS C;  2L2N A;  4F9B B;  2UXD E;  4F2J C;  4Q28 A;  1T4O A;  2EE8 A;  4GZN C;  2WBT A;  1BBG A;  2ENH A;  5ADZ A;  2V83 A;  2EMI A;  2BB8 A;  3J81 C;  2LJH A;  4GEQ B;  4DR1 E;  4RHB B;  2M1S A;  3ADJ A;  2EMZ A;  4JI5 E;  3UK3 C;  4DV2 E;  2E1M A;  2V86 A;  5KL3 A;  2HJJ A;  2YRK A;  4R2C A;  4B3T E;  2LV2 A;  2WCC 3;  4NXM E;  4DV6 E;  2A25 A;  2EM2 A;  2JR1 A;  1YFH A;  3F6H A;  2JOB A;  3AV0 A;  1MEY C;  4TUG A;  4P78 A;  5A6K A;  2R1F A;  1AH5 A;  2EOR A;  1T39 A;  4DMI A;  5A2Q C;  5IXM B;  1XNR E;  2EMF A;  3KZY A;  2JPA A;  2RSM A;  4ZYH A;  2DLK A;  4DV5 E;  1UHZ A;  2CSH A;  4P7D A;  2YT4 A;  5KL5 A;  1IBL E;  2CTD A;  2V8Q B;  3HPS A;  4AQY E;  1PJS A;  1X6E A;  4R2Q A;  2NA2 A;  1DQ3 A;  4LFB E;  1EH7 A;  2LUQ A;  4LF5 E;  2EM7 A;  2KOU A;  2EOJ A;  3ECR A;  2NUG A;  2DIX A;  3J7Y p;  2JXP A;  1A1I A;  2WZO A;  1ZR9 A;  3LML A;  2V89 A;  2L3C A;  2HHH E;  4MLV A;  4DV4 E;  2EJ4 A;  2LO3 A;  4R2R A;  2JWO A;  2WBU A; 
#chains in the Genus database with same CATH homology
 2IHR 1;  4OOG C;  2RS6 A;  4WPY A;  1ZBT A;  1SR9 A;  4LU9 A;  1RQ0 A;  3LLH A;  4X62 E;  2L3J A;  3DF6 A;  4YY3 E;  4JYA E;  2EWL A;  2CPN A;  5BR8 E;  4NXN E;  2RS7 A;  5CFF E;  2VQE E;  1QU6 A;  2JVA A;  4WFT A;  3J80 C;  4KZS A;  1HNW E;  1YYK A;  1YYO A;  2M4I A;  4BC7 A;  4YHH E;  3ADI A;  4B3R E;  2DMY A;  2KHX A;  4LF7 E;  1YYW A;  3KWR A;  1FKA E;  4JV5 E;  4JI6 E;  2N3G A;  3JTZ A;  2LUP B;  3IWC A;  1PKP A;  2V87 A;  4J8Z A;  4X65 E;  3OTO E;  2KON A;  4DR7 E;  4BMJ A;  1FJG E;  2MC6 A;  2LTR A;  2N3H A;  4DV3 E;  3IWB A;  1YZ9 A;  2L6M A;  1HNZ E;  1HR0 E;  4JI3 E;  2L2K B;  3DJW A;  2VQF E;  1GQE A;  2B9D A;  2L2N A;  4JI0 E;  2V88 A;  4F9B B;  4K0K E;  2UXD E;  3RMP A;  2K4V A;  4Q28 A;  5F3W A;  1T4O A;  4F9A B;  2VF1 A;  5ADZ A;  2E5L E;  2DB2 A;  2V83 A;  4DR2 E;  2MDR A;  4L8N A;  4WSP A;  4DV1 E;  4LFA E;  1X49 A;  1O0W A;  3J81 C;  2VE7 C;  2LJH A;  1IBK E;  4GEQ B;  2V85 A;  4DR1 E;  2UUC E;  2JY9 A;  3VK6 A;  4JI4 E;  2M1S A;  5LL6 R;  3ZOQ B;  3ADJ A;  5IT9 C;  4M2Z A;  3T1Y E;  1N32 E;  3HXL A;  4M0V A;  5AE2 A;  4JI5 E;  4JI7 E;  3JAM C;  4DV2 E;  1WHN A;  2E1M A;  4LF4 E;  2V86 A;  1UIL A;  2UUB E;  5IWA E;  2DSY A;  4OX9 E;  3C4T A;  1X47 A;  2LMZ A;  5T6J A;  2FTX B;  3ADG A;  4B3T E;  2MC5 A;  3T1H E;  3IWD A;  1N34 E;  5AAS A;  5DNY A;  5FLX C;  1EKZ A;  4LFC E;  4NXM E;  2NUE A;  4DV6 E;  2EZ6 A;  2JR1 A;  4LF9 E;  4GKJ E;  4LTY A;  2G7H A;  3F6H A;  2JOB A;  3AV0 A;  1X48 A;  2UU9 E;  4LF8 E;  4TUG A;  4P78 A;  1XMQ E;  3J7A G;  1N33 E;  2H36 X;  2ODR D;  1T4N A;  4R8O A;  4M30 A;  2L8T A;  4DR4 E;  3HQ1 A;  4DR5 E;  2B7T A;  1WXR A;  2M7Q A;  4DMI A;  1T4L B;  5A2Q C;  4KHP E;  4X66 E;  1XNR E;  1I94 E;  2LE2 A;  2B7V A;  1N36 E;  4BS9 A;  4F54 A;  1J5E E;  4L5N C;  2RSM A;  3C4B A;  2B3T B;  4I8O A;  2UUA E;  3AUZ A;  4JI1 E;  4GKK E;  3MSW A;  2ZM6 E;  4BCA A;  3VYY A;  3ADL A;  2UXC E;  4DV5 E;  4R03 A;  1UHZ A;  4DUZ E;  4F9C B;  2F4V E;  4P7D A;  2LRS A;  1STU A;  2YT4 A;  1IBL E;  4DR6 E;  3OML A;  2V8Q B;  4DV0 E;  3HPS A;  4LF6 E;  3K6Q A;  4AQY E;  2LTS A;  2L92 A;  2F8B A;  4JI8 E;  5LMU E;  4BC9 A;  1XNQ E;  2NA2 A;  2UXB E;  2YZT A;  1DQ3 A;  4X8W A;  5AE3 A;  1GZ6 A;  4DV7 E;  3FIG A;  4JI2 E;  5AE1 A;  4LFB E;  1J26 A;  3F6G A;  4DR3 E;  2FGG A;  2LUQ A;  2LBS B;  4LF5 E;  2KOU A;  3P1X A;  4B3S E;  4TUI A;  5LMN E;  4B3M E;  4BBY A;  2NUG A;  2DIX A;  4DKK A;  3J7Y p;  2WZO A;  2ODR C;  2RTX A;  4WYQ B;  2L33 A;  3LML A;  4DUY E;  1IBM E;  1DI2 A;  2NUF A;  3HTX A;  2V89 A;  2L2M A;  3H09 A;  2L3C A;  2JOX A;  1RC7 A;  2HHH E;  3VYX A;  3HPZ A;  4X64 E;  3JU0 A;  4DV4 E;  1WHQ A;  1HNX E;  2FV4 B;  2JWO A;  1XMO E;  1ZBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...