4BMJA

Structure of the ubz1and2 tandem of the ubiquitin-binding adaptor protein tax1bp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Tax1BP1 Ubz1 + 2 Provides Insight Into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TAX1-BINDING PROTEIN 1
total genus 18
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4bmjA00
4BMJA 5AASA 2M7QA
chains in the Genus database with same CATH superfamily
2YSPA 1XMOE 1N34E 2EL6A 4F9AB 5T6JA 2I13A 1IQOA 2EPCA 2EN8A 2LE2A 2MKDA 4DMIA 4R03A 2GPIA 2RSMA 4B3RE 2EM0A 3DJWA 4HEIA 2BB8A 1JK2A 3OTOE 1YUIA 2CT1A 2JXPA 2EL5A 2E5LE 2I9IA 4RH8A 2CPNA 1A1JA 4DUYE 4WX9A 2F8BA 2WCC3 4YHHE 4WYQB 2ENHA 4BHCA 1TF3A 5A6KA 5DNYA 1XMQE 3THOB 2ELZA 1QNTA 3F6HA 3H09A 2UU9E 2EN4A 2LTRA 3C4BA 2R1FA 2LUQA 4BC7A 5AE2A 2EE8A 2EMKA 3BIDA 2CSHA 1IBKE 2V85A 4HTGA 5FLXC 2HC5A 2WBTA 2UUBE 2DLQA 2EPZA 5BR8E 2RTXA 1GZ6A 2YTDA 2GHFA 1G2FC 2UXDE 3HQ1A 4JI6E 2EM4A 4B3SE 3P1XA 4JI5E 4OOGC 4DV5E 4DR5E 2YPNA 2EMYA 2B7TA 2EN6A 4OX9E 2KHXA 5KL6A 4LFCE 1N32E 2EZ6A 5IWAE 4O4KA 2DGCA 2LBSB 1RQ0A 2UXBE 5LMNE 1ZR9A 5AC4A 4F6MA 4WFTA 2VQEE 1X47A 1X48A 1EH6A 4DR1E 2GLIA 4TUGA 4X9JA 4GKJE 2EPLX 4JI1E 2EMWA 2NA2A 2V87A 4DUZE 1J26A 5IT9C 2B9DA 1T4OA 4R2CA 1EH7A 3M99B 4R2AA 2FGGA 3DF6A 1TF6A 2BBGA 4LFAE 2L33A 2YTQA 1BBGA 1WJPA 4F9BB 2VF1A 4LF4E 2M4IA 4GKKE 2LVHA 5IXMB 2JP9A 2EOXA 2K7IA 5CFFE 1X3CA 2EN2A 3HPZA 1ZU1A 4R2PA 4LTYA 2EJ4A 2L8TA 2E1MA 3VK6A 2FV4B 4DV6E 2EL4A 4JYAE 3C4TA 4IJDA 4Q35B 5KL7A 3JTZA 3J81C 4WXDA 5LL6R 4DR4E 4KZSA 2HGHA 2EMZA 4JI0E 2NUGA 3EPLA 2N3HA 1PJQA 2EM2A 4GEQB 4O43A 4P7DA 1RMDA 5A6BD 5AE1A 4J8ZA 1YPNA 2LCEA 3EPKA 4X66E 1UN6B 2N3GA 2ENCA 4LF6E 3VHTB 4DV0E 1MEYC 2L6MA 1STUA 4ZYEA 1DQ3A 2LTSA 1GTKA 1A1FA 4X8WA 4NXNE 3MSWA 2VRDA 3ADGA 2LJUA 1T4LB 2EOJA 2JVAA 2EQ3A 2EM9A 2RSIA 4LF8E 4DV3E 3EPHA 1YYKA 4LF9E 3AV0A 1FJGE 1DGCA 2L92A 2EPXA 4IS1C 4R8OA 2J7JA 4MLQA 5AE3A 2EPPA 1WRJA 2EMCA 2LMZA 2YTPA 2EOQA 4BS9A 4FK5C 2EPKX 3EPJA 2VQFE 3QG5C 2UUAE 3ADIA 2EOOA 2DSYA 2EOFA 3EQ1A 2EOEA 3LMLA 2NABA 4GZNC 5A6BA 4WPYA 3T1YE 5A69A 4M30A 2V89A 4M0VA 3IWBA 1KJKA 2YU5A 1NEIA 4AQYE 4BC9A 2IHR1 2Q8UA 1PDAA 1X6FA 4BHBA 2JOXA 2NUFA 2EMFA 2EOIA 2RS7A 4BMJA 2RS6A 1X49A 1RC7A 2ZM6E 2YSOA 2YTIA 4WXCA 3ADLA 5TSEA 3JAMC 4NXME 2EMHA 4JI8E 2RPCA 1SFEA 4X62E 4R2QA 1DI2A 3VYYA 1XNRE 2EPNA 1HNWE 2M7QA 4JI4E 4NHRA 3K6QA 3RMPA 4TUIA 1YYWA 1A1IA 2YTJA 2LRSA 4JI3E 2YRKA 3IWDA 5A2QC 4O5GA 3J7Yp 4M2ZA 4I8OA 5A6AA 4MLVA 5KL5A 2EM8A 1T38A 1ZAAC 1BBOA 2D9HA 2G7HA 2EM5A 2EPMX 2EOMA 2KOUA 3KZYA 5A6JA 2MDGA 2EQ1A 2EMIA 4Q28A 2EQ0A 4DR2E 2JPAA 3T1HE 2EOHA 3TQMA 2V8QB 1IBLE 2R76A 2NUEA 1T39A 2EORA 2H36X 1P47A 1HR0E 1X6EA 3J7AG 3BF2A 3KWRA 4DV7E 2CTDA 2FTXB 2V88A 2YTNA 1F2IG 4M9VC 4DR3E 2WBSA 3LLHA 4NZVA 1TN9A 4LU9A 2YTOA 5KL4A 1GQEA 4RHBB 3HTXA 3F6GA 2YZTA 1MGTA 2EMGA 2EOSA 2MC5A 4K0KE 3FIGA 2YTEA 4JV5E 2MC6A 4BCAA 1FKAE 2V83A 2VE7C 2DMYA 1SR9A 2EMBA 2JY9A 2L2NA 2YRHA 5KL3A 2L3JA 3ECRA 4F2JC 4LF7E 2EN3A 3VYXA 2B3TB 4DKKA 1EH8A 3MHSC 5LLQA 4DR6E 4LF5E 4JI7E 1QU6A 2YT4A 3JU0A 4R2EA 1AAYA 3BGHA 1T4NA 2PRTA 1NCSA 2M9AA 3HXLA 1YYOA 2EOYA 4P78A 2HJJA 1AH5A 4N4RB 1A1LA 5LMUE 2DLKA 4B3ME 5F3WA 1PJSA 2V86A 5AC5A 4ZYGA 2M1SA 1YZ9A 1YSAC 2JR1A 3THNA 1WHQA 3ZOQB 2YWQA 4ZYHA 5KL2A 4KHPE 3HPSA 1XNQE 2EN1A 3C6KA 3C6MA 1JK1A 4R2SA 2F4VE 1UILA 2L3CA 3KZZA 2KONA 2MKNA 4DV1E 5ADZA 4X65E 1EKZA 2YTGA 4R2RA 2E72A 1X6HA 1N36E 4JI2E 2EN7A 2LT7A 1IQSA 2EP3A 1A1HA 2B7VA 4DV2E 5IV8B 1X5WA 1IMUA 2ELYA 1KYQA 2EM3A 4YY3E 4F54A 1A1GA 1WHNA 3ADJA 4KWYA 4X64E 2DMIA 2YTFA 4DV4E 4B3TE 4L8NA 1YFHA 1WXRA 2L2KB 4WSGA 2N8XA 2ODRD 2UXCE 2EM6A 4DR7E 1N33E 2JOBA 2JWOA 2EOZA 1J5EE 3J80C 4O24A 2ADRA 2EPAA 2K4VA 2EPOA 4F9CB 1I94E 2ODRC 2LO3A 2LV2A 1PJTA 2LJHA 3MHHC 4BBYA 2WBUA 1A1KA 2EPRA 2WZOA 4ZYDA 2EPUA 2A25A 1UBDC 1G2DC 3BBGA 2RQLA 1ZBTA 4WSPA 2YU8A 3L00A 2ENAA 1LLMC 3IWCA 1IBME 1UHZA 4L5NC 2EWLA 2DRPA 3OMLA 2MDRA 2L2MA 2LUPB 1B69A 2UUCE 1HNXE 1Z1BA 4LFBE 1BB8A 3UK3C 1O0WA 1PKPA 3AUZA 1YUJA 2EMAA 2EMLA 4F6NA 5AASA 2EM7A 2HHHE 1N3GA 2EMXA 1ZBQA 2YRMA 1L4SA 2JYAA 2DIXA 1HNZE 2DB2A 4R2DA
chains in the Genus database with same CATH topology
1XMOE 1HNWE 4DV1E 1N34E 2M7QA 5ADZA 4F9BB 4F9AB 2VF1A 4X65E 1EKZA 2M4IA 4JI4E 4LF4E 4GKKE 5T6JA 3K6QA 2LE2A 5CFFE 4DMIA 3RMPA 1N36E 4TUIA 1YYWA 3HPZA 4R03A 4LTYA 2LRSA 4JI2E 2RSMA 4JI3E 4B3RE 2L8TA 2E1MA 3IWDA 5A2QC 3DJWA 3VK6A 2FV4B 3J7Yp 4DV6E 4M2ZA 4I8OA 2B7VA 4JYAE 4DV2E 3C4TA 3OTOE 3JTZA 3J81C 2E5LE 2G7HA 2CPNA 5LL6R 4DR4E 4YY3E 2KOUA 4KZSA 4F54A 4DUYE 4JI0E 2NUGA 1WHNA 2N3HA 2F8BA 4Q28A 4YHHE 4WYQB 4DR2E 3ADJA 4GEQB 4X64E 4P7DA 3T1HE 1IBLE 2V8QB 4DV4E 5DNYA 1XMQE 4B3TE 1HR0E 2NUEA 2H36X 4J8ZA 4L8NA 3H09A 3F6HA 5AE1A 4X66E 1WXRA 2UU9E 3J7AG 2N3GA 3KWRA 2LTRA 4DV7E 3C4BA 4BC7A 2LUQA 2L2KB 4LF6E 5AE2A 2FTXB 2V88A 4DV0E 2L6MA 4DR3E 1STUA 3LLHA 2ODRD 1DQ3A 2LTSA 1IBKE 2UXCE 4DR7E 2V85A 4X8WA 1N33E 2JOBA 2JWOA 4NXNE 1J5EE 3MSWA 4LU9A 5FLXC 3J80C 3ADGA 2UUBE 1GQEA 1T4LB 2JVAA 3HTXA 2K4VA 3F6GA 2YZTA 4DV3E 4F9CB 4LF8E 1YYKA 2MC5A 5BR8E 1I94E 2RTXA 4LF9E 2ODRC 3FIGA 4K0KE 4JV5E 1GZ6A 2MC6A 2LJHA 3AV0A 1FJGE 4BCAA 4BBYA 1FKAE 2UXDE 2V83A 2VE7C 2DMYA 1SR9A 2JY9A 2L2NA 2L92A 2WZOA 3HQ1A 3P1XA 2L3JA 4B3SE 4JI5E 4LF7E 3VYXA 4R8OA 4OOGC 2B3TB 4DKKA 4DV5E 4DR5E 5AE3A 2B7TA 4DR6E 4LF5E 2LMZA 4JI7E 4OX9E 1QU6A 2KHXA 2YT4A 3JU0A 4BS9A 2UUAE 4LFCE 1ZBTA 2VQFE 1N32E 2EZ6A 3ADIA 5IWAE 1T4NA 4WSPA 2LBSB 1RQ0A 2UXBE 3HXLA 1YYOA 5LMNE 1XNRE 4P78A 3IWCA 2DSYA 1IBME 1UHZA 4WFTA 4L5NC 5LMUE 3LMLA 1X47A 2VQEE 2EWLA 1X48A 3OMLA 2MDRA 4DR1E 4B3ME 5F3WA 4WPYA 4TUGA 3T1YE 4M30A 2V89A 2L2MA 4GKJE 2V86A 2LUPB 4M0VA 2UUCE 3IWBA 1HNXE 4JI1E 4AQYE 4JI6E 4LFBE 1O0WA 2IHR1 2M1SA 4BC9A 1PKPA 1YZ9A 3AUZA 2JR1A 3ZOQB 2V87A 1WHQA 2JOXA 2NA2A 4DUZE 2NUFA 1J26A 5IT9C 2B9DA 2RS7A 4BMJA 1T4OA 2RS6A 4KHPE 3HPSA 1XNQE 5AASA 1X49A 1RC7A 2ZM6E 2HHHE 3ADLA 3JAMC 1ZBQA 4NXME 2FGGA 3DF6A 2F4VE 1UILA 2L3CA 4LFAE 4JI8E 2L33A 2KONA 2DIXA 1HNZE 2DB2A 4X62E 1DI2A 3VYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMJ A;  5AAS A;  2M7Q A; 
#chains in the Genus database with same CATH topology
 2YSP A;  1XMO E;  1N34 E;  2EL6 A;  4F9A B;  5T6J A;  2I13 A;  1IQO A;  2EPC A;  2EN8 A;  2LE2 A;  2MKD A;  4DMI A;  4R03 A;  2GPI A;  2RSM A;  4B3R E;  2EM0 A;  3DJW A;  4HEI A;  2BB8 A;  1JK2 A;  3OTO E;  1YUI A;  2CT1 A;  2JXP A;  2EL5 A;  2E5L E;  2I9I A;  4RH8 A;  2CPN A;  1A1J A;  4DUY E;  4WX9 A;  2F8B A;  2WCC 3;  4YHH E;  4WYQ B;  2ENH A;  4BHC A;  1TF3 A;  5A6K A;  5DNY A;  1XMQ E;  3THO B;  2ELZ A;  1QNT A;  3F6H A;  3H09 A;  2UU9 E;  2EN4 A;  2LTR A;  3C4B A;  2R1F A;  2LUQ A;  4BC7 A;  5AE2 A;  2EE8 A;  2EMK A;  3BID A;  2CSH A;  1IBK E;  2V85 A;  4HTG A;  5FLX C;  2HC5 A;  2WBT A;  2UUB E;  2DLQ A;  2EPZ A;  5BR8 E;  2RTX A;  1GZ6 A;  2YTD A;  2GHF A;  1G2F C;  2UXD E;  3HQ1 A;  4JI6 E;  2EM4 A;  4B3S E;  3P1X A;  4JI5 E;  4OOG C;  4DV5 E;  4DR5 E;  2YPN A;  2EMY A;  2B7T A;  2EN6 A;  4OX9 E;  2KHX A;  5KL6 A;  4LFC E;  1N32 E;  2EZ6 A;  5IWA E;  4O4K A;  2DGC A;  2LBS B;  1RQ0 A;  2UXB E;  5LMN E;  1ZR9 A;  5AC4 A;  4F6M A;  4WFT A;  2VQE E;  1X47 A;  1X48 A;  1EH6 A;  4DR1 E;  2GLI A;  4TUG A;  4X9J A;  4GKJ E;  2EPL X;  4JI1 E;  2EMW A;  2NA2 A;  2V87 A;  4DUZ E;  1J26 A;  5IT9 C;  2B9D A;  1T4O A;  4R2C A;  1EH7 A;  3M99 B;  4R2A A;  2FGG A;  3DF6 A;  1TF6 A;  2BBG A;  4LFA E;  2L33 A;  2YTQ A;  1BBG A;  1WJP A;  4F9B B;  2VF1 A;  4LF4 E;  2M4I A;  4GKK E;  2LVH A;  5IXM B;  2JP9 A;  2EOX A;  2K7I A;  5CFF E;  1X3C A;  2EN2 A;  3HPZ A;  1ZU1 A;  4R2P A;  4LTY A;  2EJ4 A;  2L8T A;  2E1M A;  3VK6 A;  2FV4 B;  4DV6 E;  2EL4 A;  4JYA E;  3C4T A;  4IJD A;  4Q35 B;  5KL7 A;  3JTZ A;  3J81 C;  4WXD A;  5LL6 R;  4DR4 E;  4KZS A;  2HGH A;  2EMZ A;  4JI0 E;  2NUG A;  3EPL A;  2N3H A;  1PJQ A;  2EM2 A;  4GEQ B;  4O43 A;  4P7D A;  1RMD A;  5A6B D;  5AE1 A;  4J8Z A;  1YPN A;  2LCE A;  3EPK A;  4X66 E;  1UN6 B;  2N3G A;  2ENC A;  4LF6 E;  3VHT B;  4DV0 E;  1MEY C;  2L6M A;  1STU A;  4ZYE A;  1DQ3 A;  2LTS A;  1GTK A;  1A1F A;  4X8W A;  4NXN E;  3MSW A;  2VRD A;  3ADG A;  2LJU A;  1T4L B;  2EOJ A;  2JVA A;  2EQ3 A;  2EM9 A;  2RSI A;  4LF8 E;  4DV3 E;  3EPH A;  1YYK A;  4LF9 E;  3AV0 A;  1FJG E;  1DGC A;  2L92 A;  2EPX A;  4IS1 C;  4R8O A;  2J7J A;  4MLQ A;  5AE3 A;  2EPP A;  1WRJ A;  2EMC A;  2LMZ A;  2YTP A;  2EOQ A;  4BS9 A;  4FK5 C;  2EPK X;  3EPJ A;  2VQF E;  3QG5 C;  2UUA E;  3ADI A;  2EOO A;  2DSY A;  2EOF A;  3EQ1 A;  2EOE A;  3LML A;  2NAB A;  4GZN C;  5A6B A;  4WPY A;  3T1Y E;  5A69 A;  4M30 A;  2V89 A;  4M0V A;  3IWB A;  1KJK A;  2YU5 A;  1NEI A;  4AQY E;  4BC9 A;  2IHR 1;  2Q8U A;  1PDA A;  1X6F A;  4BHB A;  2JOX A;  2NUF A;  2EMF A;  2EOI A;  2RS7 A;  4BMJ A;  2RS6 A;  1X49 A;  1RC7 A;  2ZM6 E;  2YSO A;  2YTI A;  4WXC A;  3ADL A;  5TSE A;  3JAM C;  4NXM E;  2EMH A;  4JI8 E;  2RPC A;  1SFE A;  4X62 E;  4R2Q A;  1DI2 A;  3VYY A;  1XNR E;  2EPN A;  1HNW E;  2M7Q A;  4JI4 E;  4NHR A;  3K6Q A;  3RMP A;  4TUI A;  1YYW A;  1A1I A;  2YTJ A;  2LRS A;  4JI3 E;  2YRK A;  3IWD A;  5A2Q C;  4O5G A;  3J7Y p;  4M2Z A;  4I8O A;  5A6A A;  4MLV A;  5KL5 A;  2EM8 A;  1T38 A;  1ZAA C;  1BBO A;  2D9H A;  2G7H A;  2EM5 A;  2EPM X;  2EOM A;  2KOU A;  3KZY A;  5A6J A;  2MDG A;  2EQ1 A;  2EMI A;  4Q28 A;  2EQ0 A;  4DR2 E;  2JPA A;  3T1H E;  2EOH A;  3TQM A;  2V8Q B;  1IBL E;  2R76 A;  2NUE A;  1T39 A;  2EOR A;  2H36 X;  1P47 A;  1HR0 E;  1X6E A;  3J7A G;  3BF2 A;  3KWR A;  4DV7 E;  2CTD A;  2FTX B;  2V88 A;  2YTN A;  1F2I G;  4M9V C;  4DR3 E;  2WBS A;  3LLH A;  4NZV A;  1TN9 A;  4LU9 A;  2YTO A;  5KL4 A;  1GQE A;  4RHB B;  3HTX A;  3F6G A;  2YZT A;  1MGT A;  2EMG A;  2EOS A;  2MC5 A;  4K0K E;  3FIG A;  2YTE A;  4JV5 E;  2MC6 A;  4BCA A;  1FKA E;  2V83 A;  2VE7 C;  2DMY A;  1SR9 A;  2EMB A;  2JY9 A;  2L2N A;  2YRH A;  5KL3 A;  2L3J A;  3ECR A;  4F2J C;  4LF7 E;  2EN3 A;  3VYX A;  2B3T B;  4DKK A;  1EH8 A;  3MHS C;  5LLQ A;  4DR6 E;  4LF5 E;  4JI7 E;  1QU6 A;  2YT4 A;  3JU0 A;  4R2E A;  1AAY A;  3BGH A;  1T4N A;  2PRT A;  1NCS A;  2M9A A;  3HXL A;  1YYO A;  2EOY A;  4P78 A;  2HJJ A;  1AH5 A;  4N4R B;  1A1L A;  5LMU E;  2DLK A;  4B3M E;  5F3W A;  1PJS A;  2V86 A;  5AC5 A;  4ZYG A;  2M1S A;  1YZ9 A;  1YSA C;  2JR1 A;  3THN A;  1WHQ A;  3ZOQ B;  2YWQ A;  4ZYH A;  5KL2 A;  4KHP E;  3HPS A;  1XNQ E;  2EN1 A;  3C6K A;  3C6M A;  1JK1 A;  4R2S A;  2F4V E;  1UIL A;  2L3C A;  3KZZ A;  2KON A;  2MKN A;  4DV1 E;  5ADZ A;  4X65 E;  1EKZ A;  2YTG A;  4R2R A;  2E72 A;  1X6H A;  1N36 E;  4JI2 E;  2EN7 A;  2LT7 A;  1IQS A;  2EP3 A;  1A1H A;  2B7V A;  4DV2 E;  5IV8 B;  1X5W A;  1IMU A;  2ELY A;  1KYQ A;  2EM3 A;  4YY3 E;  4F54 A;  1A1G A;  1WHN A;  3ADJ A;  4KWY A;  4X64 E;  2DMI A;  2YTF A;  4DV4 E;  4B3T E;  4L8N A;  1YFH A;  1WXR A;  2L2K B;  4WSG A;  2N8X A;  2ODR D;  2UXC E;  2EM6 A;  4DR7 E;  1N33 E;  2JOB A;  2JWO A;  2EOZ A;  1J5E E;  3J80 C;  4O24 A;  2ADR A;  2EPA A;  2K4V A;  2EPO A;  4F9C B;  1I94 E;  2ODR C;  2LO3 A;  2LV2 A;  1PJT A;  2LJH A;  3MHH C;  4BBY A;  2WBU A;  1A1K A;  2EPR A;  2WZO A;  4ZYD A;  2EPU A;  2A25 A;  1UBD C;  1G2D C;  3BBG A;  2RQL A;  1ZBT A;  4WSP A;  2YU8 A;  3L00 A;  2ENA A;  1LLM C;  3IWC A;  1IBM E;  1UHZ A;  4L5N C;  2EWL A;  2DRP A;  3OML A;  2MDR A;  2L2M A;  2LUP B;  1B69 A;  2UUC E;  1HNX E;  1Z1B A;  4LFB E;  1BB8 A;  3UK3 C;  1O0W A;  1PKP A;  3AUZ A;  1YUJ A;  2EMA A;  2EML A;  4F6N A;  5AAS A;  2EM7 A;  2HHH E;  1N3G A;  2EMX A;  1ZBQ A;  2YRM A;  1L4S A;  2JYA A;  2DIX A;  1HNZ E;  2DB2 A;  4R2D A; 
#chains in the Genus database with same CATH homology
 1XMO E;  1HNW E;  4DV1 E;  1N34 E;  2M7Q A;  5ADZ A;  4F9B B;  4F9A B;  2VF1 A;  4X65 E;  1EKZ A;  2M4I A;  4JI4 E;  4LF4 E;  4GKK E;  5T6J A;  3K6Q A;  2LE2 A;  5CFF E;  4DMI A;  3RMP A;  1N36 E;  4TUI A;  1YYW A;  3HPZ A;  4R03 A;  4LTY A;  2LRS A;  4JI2 E;  2RSM A;  4JI3 E;  4B3R E;  2L8T A;  2E1M A;  3IWD A;  5A2Q C;  3DJW A;  3VK6 A;  2FV4 B;  3J7Y p;  4DV6 E;  4M2Z A;  4I8O A;  2B7V A;  4JYA E;  4DV2 E;  3C4T A;  3OTO E;  3JTZ A;  3J81 C;  2E5L E;  2G7H A;  2CPN A;  5LL6 R;  4DR4 E;  4YY3 E;  2KOU A;  4KZS A;  4F54 A;  4DUY E;  4JI0 E;  2NUG A;  1WHN A;  2N3H A;  2F8B A;  4Q28 A;  4YHH E;  4WYQ B;  4DR2 E;  3ADJ A;  4GEQ B;  4X64 E;  4P7D A;  3T1H E;  1IBL E;  2V8Q B;  4DV4 E;  5DNY A;  1XMQ E;  4B3T E;  1HR0 E;  2NUE A;  2H36 X;  4J8Z A;  4L8N A;  3H09 A;  3F6H A;  5AE1 A;  4X66 E;  1WXR A;  2UU9 E;  3J7A G;  2N3G A;  3KWR A;  2LTR A;  4DV7 E;  3C4B A;  4BC7 A;  2LUQ A;  2L2K B;  4LF6 E;  5AE2 A;  2FTX B;  2V88 A;  4DV0 E;  2L6M A;  4DR3 E;  1STU A;  3LLH A;  2ODR D;  1DQ3 A;  2LTS A;  1IBK E;  2UXC E;  4DR7 E;  2V85 A;  4X8W A;  1N33 E;  2JOB A;  2JWO A;  4NXN E;  1J5E E;  3MSW A;  4LU9 A;  5FLX C;  3J80 C;  3ADG A;  2UUB E;  1GQE A;  1T4L B;  2JVA A;  3HTX A;  2K4V A;  3F6G A;  2YZT A;  4DV3 E;  4F9C B;  4LF8 E;  1YYK A;  2MC5 A;  5BR8 E;  1I94 E;  2RTX A;  4LF9 E;  2ODR C;  3FIG A;  4K0K E;  4JV5 E;  1GZ6 A;  2MC6 A;  2LJH A;  3AV0 A;  1FJG E;  4BCA A;  4BBY A;  1FKA E;  2UXD E;  2V83 A;  2VE7 C;  2DMY A;  1SR9 A;  2JY9 A;  2L2N A;  2L92 A;  2WZO A;  3HQ1 A;  3P1X A;  2L3J A;  4B3S E;  4JI5 E;  4LF7 E;  3VYX A;  4R8O A;  4OOG C;  2B3T B;  4DKK A;  4DV5 E;  4DR5 E;  5AE3 A;  2B7T A;  4DR6 E;  4LF5 E;  2LMZ A;  4JI7 E;  4OX9 E;  1QU6 A;  2KHX A;  2YT4 A;  3JU0 A;  4BS9 A;  2UUA E;  4LFC E;  1ZBT A;  2VQF E;  1N32 E;  2EZ6 A;  3ADI A;  5IWA E;  1T4N A;  4WSP A;  2LBS B;  1RQ0 A;  2UXB E;  3HXL A;  1YYO A;  5LMN E;  1XNR E;  4P78 A;  3IWC A;  2DSY A;  1IBM E;  1UHZ A;  4WFT A;  4L5N C;  5LMU E;  3LML A;  1X47 A;  2VQE E;  2EWL A;  1X48 A;  3OML A;  2MDR A;  4DR1 E;  4B3M E;  5F3W A;  4WPY A;  4TUG A;  3T1Y E;  4M30 A;  2V89 A;  2L2M A;  4GKJ E;  2V86 A;  2LUP B;  4M0V A;  2UUC E;  3IWB A;  1HNX E;  4JI1 E;  4AQY E;  4JI6 E;  4LFB E;  1O0W A;  2IHR 1;  2M1S A;  4BC9 A;  1PKP A;  1YZ9 A;  3AUZ A;  2JR1 A;  3ZOQ B;  2V87 A;  1WHQ A;  2JOX A;  2NA2 A;  4DUZ E;  2NUF A;  1J26 A;  5IT9 C;  2B9D A;  2RS7 A;  4BMJ A;  1T4O A;  2RS6 A;  4KHP E;  3HPS A;  1XNQ E;  5AAS A;  1X49 A;  1RC7 A;  2ZM6 E;  2HHH E;  3ADL A;  3JAM C;  1ZBQ A;  4NXM E;  2FGG A;  3DF6 A;  2F4V E;  1UIL A;  2L3C A;  4LFA E;  4JI8 E;  2L33 A;  2KON A;  2DIX A;  1HNZ E;  2DB2 A;  4X62 E;  1DI2 A;  3VYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...