4BMJA

Structure of the ubz1and2 tandem of the ubiquitin-binding adaptor protein tax1bp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'MDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAX1-BINDING PROTEIN 1
publication title The Structure of Tax1BP1 Ubz1 + 2 Provides Insight Into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 18
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4bmjA00
5AASA 4BMJA 2M7QA
chains in the Genus database with same CATH superfamily
4R2SA 4R03A 2B9DA 5LMNE 1A1JA 3KZZA 2UUAE 2YRMA 1ZBQA 1NCSA 1L4SA 3C6MA 4ZYGA 4BC7A 2V88A 1AH5A 3HXLA 2B7VA 3IWBA 2JY9A 4JI3E 4DUYE 1A1GA 1XNRE 2LTSA 2A25A 4DR5E 3J81C 5F3WA 3H09A 3LLHA 2LO3A 2EOYA 2YU5A 2LJHA 2EPAA 3C4BA 2MKDA 2NABA 5KL6A 2YTDA 2N3GA 3MHSC 5AC4A 1UBDC 4B3TE 5LLQA 2MKNA 2HHHE 3J7AG 2FV4B 2UXDE 2YTPA 3BBGA 4JI2E 2E72A 2V89A 1JK1A 1A1FA 3F6HA 3DF6A 5ADZA 4JV5E 4BCAA 1X47A 2EOXA 4F9AB 4X62E 2I13A 2ODRD 3LMLA 5FLXC 4HTGA 1WJPA 1QNTA 4DR1E 5IXMB 2LUQA 5DNYA 4HEIA 4M9VC 5AE3A 3ADJA 2NUFA 1MEYC 4R2CA 2EM3A 4R2DA 1DGCA 2CSHA 2YTNA 4WX9A 1X49A 2WBTA 2LUPB 2YRHA 2LRSA 5A6JA 5IWAE 2DLQA 3T1HE 1MGTA 2EN7A 4WSGA 2HGHA 5KL2A 4ZYHA 2EOFA 4NXNE 2F4VE 2YZTA 2EPUA 2EQ1A 2EMAA 3THNA 2HC5A 2EPXA 4LF8E 2L6MA 2V85A 4DV4E 4LFCE 4DV5E 2L33A 2EM6A 3HQ1A 1PJQA 1HR0E 2EMCA 2UXCE 2LJUA 4TUIA 4WFTA 1T39A 3ZOQB 1YPNA 1I94E 3ADLA 4R2AA 2JOXA 1J26A 2EWLA 4JYAE 4JI1E 4JI6E 2GLIA 3ADIA 2LV2A 4DV1E 2VE7C 3EPHA 1DI2A 1YSAC 2VQFE 4WPYA 3OTOE 4M0VA 2L2KB 1KJKA 1KYQA 1T4NA 2EPPA 4X9JA 3T1YE 1UILA 2MDRA 5T6JA 1T38A 1A1KA 2EM8A 3KWRA 2UUCE 4NXME 1BB8A 4Q35B 1EH6A 2EL4A 1YUIA 4WXCA 2KONA 4LFAE 2DMIA 4JI7E 2E1MA 2WBUA 4O43A 4L5NC 1UN6B 2JWOA 2ELYA 2DSYA 4IJDA 4LF7E 2EMKA 4LF9E 4F9BB 3M99B 2DIXA 5KL7A 2EM9A 1N34E 4F9CB 1A1LA 1GZ6A 2Q8UA 4Q28A 2YTQA 2KOUA 2N3HA 2DMYA 4KZSA 1YYWA 2DGCA 3VHTB 1F2IG 4F6NA 1J5EE 1P47A 2LMZA 2YWQA 2EOOA 5IV8B 2UUBE 2L2MA 1N36E 1PJSA 2EMHA 2NA2A 2WZOA 2EM2A 4B3ME 3IWCA 2YRKA 2L3CA 2ZM6E 2ADRA 2K4VA 2MDGA 5AE2A 2UXBE 2EPRA 1JK2A 1ZR9A 2JR1A 2EOIA 2EM0A 2JP9A 2YTEA 4DV0E 1X5WA 2DB2A 1YYKA 3QG5C 5AC5A 4MLVA 2VRDA 1LLMC 4LF6E 5KL4A 1X3CA 1YUJA 1SR9A 2EN8A 2JOBA 1IQOA 3RMPA 3EPLA 4ZYDA 1IBKE 2YT4A 3EQ1A 4K0KE 2ENCA 5A69A 2B3TB 2EMZA 1FKAE 2LCEA 2EN1A 2V8QB 4ZYEA 1B69A 3AUZA 2RPCA 3VK6A 2EM7A 1YZ9A 1NEIA 4B3RE 2EJ4A 5A2QC 4M2ZA 2V87A 2RS7A 1WRJA 2FGGA 4WYQB 4OOGC 4DV2E 1GTKA 1T4LB 2E5LE 1EH8A 5BR8E 2CT1A 1WHNA 3MHHC 2YTOA 2K7IA 4LF4E 4DR3E 4B3SE 4BHCA 1XMQE 2FTXB 4LFBE 2EOSA 2MC5A 5TSEA 4F6MA 1TF3A 2MC6A 1ZU1A 3C6KA 4FK5C 4N4RB 2RTXA 2EN4A 2EPCA 2YTGA 2D9HA 2EMLA 2EPLX 3JAMC 2ODRC 1ZAAC 4F54A 2EP3A 2B7TA 2YPNA 2EOZA 2EPOA 4BC9A 2UU9E 2YTJA 4DR7E 4WXDA 3AV0A 2M4IA 5A6KA 1HNZE 4F2JC 2BBGA 2EN6A 4RHBB 1X6HA 1N32E 1TN9A 2F8BA 2EPZA 1DQ3A 5CFFE 2YSOA 4DR2E 3EPJA 1EH7A 4BS9A 3BF2A 4GKKE 2GPIA 4KHPE 3L00A 2BB8A 2EN2A 3VYYA 5A6AA 2EN3A 3ADGA 4JI8E 5IT9C 2R76A 2EMXA 2YTFA 1ZBTA 1UHZA 1X6FA 2M7QA 2R1FA 1TF6A 4LTYA 4X8WA 1IBME 1N33E 2GHFA 4DR6E 4L8NA 2ENAA 2JYAA 1X6EA 4M30A 4BHBA 1X48A 1XMOE 4DMIA 3J7Yp 2YU8A 4R2QA 2JXPA 2G7HA 2EMIA 3IWDA 2RSMA 1YYOA 2WBSA 1RQ0A 1XNQE 1WHQA 4NZVA 4R2EA 4TUGA 2J7JA 2LTRA 3BGHA 1A1IA 3MSWA 2RQLA 2CPNA 4DV6E 4DR4E 1RMDA 5AE1A 2HJJA 4J8ZA 2NUEA 3P1XA 5AASA 3BIDA 2PRTA 2L92A 1IBLE 1HNXE 4NHRA 1PDAA 5LMUE 3JTZA 1T4OA 2KHXA 3HPZA 2EOMA 3HPSA 4O5GA 1G2DC 5A6BA 3OMLA 4KWYA 4R2RA 4X65E 1BBGA 5A6BD 4JI5E 4JI4E 1QU6A 2EPMX 2EQ0A 2EPKX 4DKKA 3THOB 2H36X 4DUZE 4BMJA 4R8OA 4AQYE 3HTXA 2EMWA 4WSPA 2VF1A 2EMYA 2EE8A 1STUA 1EKZA 2LBSB 3ECRA 1BBOA 2RS6A 2JPAA 1AAYA 3EPKA 2DRPA 3DJWA 1G2FC 1GQEA 2RSIA 2LT7A 2WCC3 1HNWE 1PJTA 1IQSA 2EL5A 2N8XA 4GZNC 4YY3E 1WXRA 2L8TA 2EM4A 3TQMA 2LVHA 2EM5A 4O4KA 2M9AA 2NUGA 3J80C 1YFHA 3F6GA 3VYXA 2I9IA 2EOJA 2V83A 4RH8A 3FIGA 4OX9E 2EMGA 2EOQA 4IS1C 4LF5E 1FJGE 4YHHE 3C4TA 2EOEA 2L2NA 2CTDA 3JU0A 2EPNA 2VQEE 2EZ6A 2EORA 2JVAA 2L3JA 4GKJE 3KZYA 4R2PA 4GEQB 1O0WA 1SFEA 4JI0E 4I8OA 2EQ3A 4X64E 2YTIA 4DV3E 4P7DA 1Z1BA 4X66E 1A1HA 1PKPA 5LL6R 2ENHA 4O24A 2DLKA 2V86A 4P78A 2LE2A 2IHR1 2M1SA 3UK3C 2ELZA 4LU9A 2EMFA 1RC7A 4DV7E 4BBYA 2EMBA 1IMUA 5KL3A 4MLQA 2EL6A 5KL5A 1N3GA 2EOHA 3K6QA 2YSPA
chains in the Genus database with same CATH topology
3ADIA 4K0KE 4R03A 4DV1E 2B3TB 4J8ZA 2VE7C 2NUEA 3P1XA 2B9DA 1FKAE 5AASA 5LMNE 1DI2A 2L92A 2V8QB 2UUAE 1ZBQA 2VQFE 3AUZA 4WPYA 1IBLE 1HNXE 5LMUE 3OTOE 4M0VA 3VK6A 3JTZA 4BC7A 2V88A 1T4OA 2KHXA 3HXLA 2L2KB 3HPZA 1YZ9A 4B3RE 1T4NA 5A2QC 2B7VA 4M2ZA 2V87A 3IWBA 2JY9A 2RS7A 4WYQB 2FGGA 4OOGC 4DV2E 4DUYE 3T1YE 1T4LB 2E5LE 4JI3E 2LTSA 3HPSA 5BR8E 1XNRE 1UILA 4DR5E 1WHNA 3OMLA 3J81C 2MDRA 3H09A 5T6JA 5F3WA 4LF4E 4X65E 3LLHA 4DR3E 4B3SE 2LJHA 3KWRA 2UUCE 4JI4E 1XMQE 2FTXB 1QU6A 2MC5A 4JI5E 3C4BA 4NXME 4LFBE 4DKKA 2KONA 2MC6A 4LFAE 4JI7E 2N3GA 2E1MA 2RTXA 2H36X 4B3TE 4DUZE 4L5NC 2HHHE 3J7AG 2FV4B 4BMJA 2JWOA 4R8OA 4AQYE 3HTXA 2UXDE 3JAMC 4JI2E 2ODRC 2DSYA 4WSPA 4F54A 2VF1A 4LF7E 2V89A 2B7TA 1STUA 3DF6A 3F6HA 5ADZA 1EKZA 4JV5E 2LBSB 4BCAA 4LF9E 4F9BB 1X47A 2RS6A 2DIXA 4BC9A 2UU9E 4DR7E 3AV0A 3DJWA 1N34E 2M4IA 4F9AB 1GQEA 4X62E 1HNWE 4F9CB 1HNZE 1GZ6A 2ODRD 3LMLA 5FLXC 4Q28A 4DR1E 4YY3E 2KOUA 1N32E 1WXRA 2N3HA 2F8BA 2L8TA 2LUQA 5DNYA 1DQ3A 5CFFE 2DMYA 4KZSA 4DR2E 1YYWA 5AE3A 2NUGA 3J80C 3ADJA 2NUFA 3F6GA 1J5EE 3VYXA 4BS9A 2V83A 4GKKE 2LMZA 3FIGA 4OX9E 4LF5E 2LUPB 1FJGE 1X49A 4KHPE 4YHHE 2UUBE 2L2MA 1N36E 2WZOA 2NA2A 3C4TA 2L2NA 2LRSA 3VYYA 3ADGA 4JI8E 5IWAE 5IT9C 4B3ME 3IWCA 3JU0A 2L3CA 2VQEE 2ZM6E 1ZBTA 2EZ6A 1UHZA 2JVAA 2M7QA 2L3JA 3T1HE 4GKJE 4LTYA 2K4VA 5AE2A 4X8WA 4GEQB 1IBME 2F4VE 1O0WA 4NXNE 2YZTA 1N33E 2UXBE 2JR1A 4JI0E 4I8OA 4DR6E 4L8NA 4DV0E 4X64E 4M30A 4DV3E 2DB2A 4P7DA 4X66E 4LF8E 1X48A 2L6MA 1XMOE 1PKPA 4DMIA 2V85A 5LL6R 3J7Yp 4DV4E 4LFCE 4DV5E 1YYKA 2L33A 2V86A 4P78A 2LE2A 2IHR1 2G7HA 3HQ1A 1HR0E 2M1SA 2UXCE 4LU9A 3IWDA 4WFTA 4TUIA 2RSMA 1RC7A 3ZOQB 4DV7E 4LF6E 4BBYA 1YYOA 1SR9A 1RQ0A 1XNQE 2JOBA 1WHQA 3RMPA 1I94E 4TUGA 1IBKE 2LTRA 3ADLA 2JOXA 2YT4A 3MSWA 1J26A 2EWLA 4JYAE 2CPNA 4JI1E 4JI6E 4DV6E 4DR4E 3K6QA 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAS A;  4BMJ A;  2M7Q A; 
#chains in the Genus database with same CATH topology
 4R2S A;  4R03 A;  2B9D A;  5LMN E;  1A1J A;  3KZZ A;  2UUA E;  2YRM A;  1ZBQ A;  1NCS A;  1L4S A;  3C6M A;  4ZYG A;  4BC7 A;  2V88 A;  1AH5 A;  3HXL A;  2B7V A;  3IWB A;  2JY9 A;  4JI3 E;  4DUY E;  1A1G A;  1XNR E;  2LTS A;  2A25 A;  4DR5 E;  3J81 C;  5F3W A;  3H09 A;  3LLH A;  2LO3 A;  2EOY A;  2YU5 A;  2LJH A;  2EPA A;  3C4B A;  2MKD A;  2NAB A;  5KL6 A;  2YTD A;  2N3G A;  3MHS C;  5AC4 A;  1UBD C;  4B3T E;  5LLQ A;  2MKN A;  2HHH E;  3J7A G;  2FV4 B;  2UXD E;  2YTP A;  3BBG A;  4JI2 E;  2E72 A;  2V89 A;  1JK1 A;  1A1F A;  3F6H A;  3DF6 A;  5ADZ A;  4JV5 E;  4BCA A;  1X47 A;  2EOX A;  4F9A B;  4X62 E;  2I13 A;  2ODR D;  3LML A;  5FLX C;  4HTG A;  1WJP A;  1QNT A;  4DR1 E;  5IXM B;  2LUQ A;  5DNY A;  4HEI A;  4M9V C;  5AE3 A;  3ADJ A;  2NUF A;  1MEY C;  4R2C A;  2EM3 A;  4R2D A;  1DGC A;  2CSH A;  2YTN A;  4WX9 A;  1X49 A;  2WBT A;  2LUP B;  2YRH A;  2LRS A;  5A6J A;  5IWA E;  2DLQ A;  3T1H E;  1MGT A;  2EN7 A;  4WSG A;  2HGH A;  5KL2 A;  4ZYH A;  2EOF A;  4NXN E;  2F4V E;  2YZT A;  2EPU A;  2EQ1 A;  2EMA A;  3THN A;  2HC5 A;  2EPX A;  4LF8 E;  2L6M A;  2V85 A;  4DV4 E;  4LFC E;  4DV5 E;  2L33 A;  2EM6 A;  3HQ1 A;  1PJQ A;  1HR0 E;  2EMC A;  2UXC E;  2LJU A;  4TUI A;  4WFT A;  1T39 A;  3ZOQ B;  1YPN A;  1I94 E;  3ADL A;  4R2A A;  2JOX A;  1J26 A;  2EWL A;  4JYA E;  4JI1 E;  4JI6 E;  2GLI A;  3ADI A;  2LV2 A;  4DV1 E;  2VE7 C;  3EPH A;  1DI2 A;  1YSA C;  2VQF E;  4WPY A;  3OTO E;  4M0V A;  2L2K B;  1KJK A;  1KYQ A;  1T4N A;  2EPP A;  4X9J A;  3T1Y E;  1UIL A;  2MDR A;  5T6J A;  1T38 A;  1A1K A;  2EM8 A;  3KWR A;  2UUC E;  4NXM E;  1BB8 A;  4Q35 B;  1EH6 A;  2EL4 A;  1YUI A;  4WXC A;  2KON A;  4LFA E;  2DMI A;  4JI7 E;  2E1M A;  2WBU A;  4O43 A;  4L5N C;  1UN6 B;  2JWO A;  2ELY A;  2DSY A;  4IJD A;  4LF7 E;  2EMK A;  4LF9 E;  4F9B B;  3M99 B;  2DIX A;  5KL7 A;  2EM9 A;  1N34 E;  4F9C B;  1A1L A;  1GZ6 A;  2Q8U A;  4Q28 A;  2YTQ A;  2KOU A;  2N3H A;  2DMY A;  4KZS A;  1YYW A;  2DGC A;  3VHT B;  1F2I G;  4F6N A;  1J5E E;  1P47 A;  2LMZ A;  2YWQ A;  2EOO A;  5IV8 B;  2UUB E;  2L2M A;  1N36 E;  1PJS A;  2EMH A;  2NA2 A;  2WZO A;  2EM2 A;  4B3M E;  3IWC A;  2YRK A;  2L3C A;  2ZM6 E;  2ADR A;  2K4V A;  2MDG A;  5AE2 A;  2UXB E;  2EPR A;  1JK2 A;  1ZR9 A;  2JR1 A;  2EOI A;  2EM0 A;  2JP9 A;  2YTE A;  4DV0 E;  1X5W A;  2DB2 A;  1YYK A;  3QG5 C;  5AC5 A;  4MLV A;  2VRD A;  1LLM C;  4LF6 E;  5KL4 A;  1X3C A;  1YUJ A;  1SR9 A;  2EN8 A;  2JOB A;  1IQO A;  3RMP A;  3EPL A;  4ZYD A;  1IBK E;  2YT4 A;  3EQ1 A;  4K0K E;  2ENC A;  5A69 A;  2B3T B;  2EMZ A;  1FKA E;  2LCE A;  2EN1 A;  2V8Q B;  4ZYE A;  1B69 A;  3AUZ A;  2RPC A;  3VK6 A;  2EM7 A;  1YZ9 A;  1NEI A;  4B3R E;  2EJ4 A;  5A2Q C;  4M2Z A;  2V87 A;  2RS7 A;  1WRJ A;  2FGG A;  4WYQ B;  4OOG C;  4DV2 E;  1GTK A;  1T4L B;  2E5L E;  1EH8 A;  5BR8 E;  2CT1 A;  1WHN A;  3MHH C;  2YTO A;  2K7I A;  4LF4 E;  4DR3 E;  4B3S E;  4BHC A;  1XMQ E;  2FTX B;  4LFB E;  2EOS A;  2MC5 A;  5TSE A;  4F6M A;  1TF3 A;  2MC6 A;  1ZU1 A;  3C6K A;  4FK5 C;  4N4R B;  2RTX A;  2EN4 A;  2EPC A;  2YTG A;  2D9H A;  2EML A;  2EPL X;  3JAM C;  2ODR C;  1ZAA C;  4F54 A;  2EP3 A;  2B7T A;  2YPN A;  2EOZ A;  2EPO A;  4BC9 A;  2UU9 E;  2YTJ A;  4DR7 E;  4WXD A;  3AV0 A;  2M4I A;  5A6K A;  1HNZ E;  4F2J C;  2BBG A;  2EN6 A;  4RHB B;  1X6H A;  1N32 E;  1TN9 A;  2F8B A;  2EPZ A;  1DQ3 A;  5CFF E;  2YSO A;  4DR2 E;  3EPJ A;  1EH7 A;  4BS9 A;  3BF2 A;  4GKK E;  2GPI A;  4KHP E;  3L00 A;  2BB8 A;  2EN2 A;  3VYY A;  5A6A A;  2EN3 A;  3ADG A;  4JI8 E;  5IT9 C;  2R76 A;  2EMX A;  2YTF A;  1ZBT A;  1UHZ A;  1X6F A;  2M7Q A;  2R1F A;  1TF6 A;  4LTY A;  4X8W A;  1IBM E;  1N33 E;  2GHF A;  4DR6 E;  4L8N A;  2ENA A;  2JYA A;  1X6E A;  4M30 A;  4BHB A;  1X48 A;  1XMO E;  4DMI A;  3J7Y p;  2YU8 A;  4R2Q A;  2JXP A;  2G7H A;  2EMI A;  3IWD A;  2RSM A;  1YYO A;  2WBS A;  1RQ0 A;  1XNQ E;  1WHQ A;  4NZV A;  4R2E A;  4TUG A;  2J7J A;  2LTR A;  3BGH A;  1A1I A;  3MSW A;  2RQL A;  2CPN A;  4DV6 E;  4DR4 E;  1RMD A;  5AE1 A;  2HJJ A;  4J8Z A;  2NUE A;  3P1X A;  5AAS A;  3BID A;  2PRT A;  2L92 A;  1IBL E;  1HNX E;  4NHR A;  1PDA A;  5LMU E;  3JTZ A;  1T4O A;  2KHX A;  3HPZ A;  2EOM A;  3HPS A;  4O5G A;  1G2D C;  5A6B A;  3OML A;  4KWY A;  4R2R A;  4X65 E;  1BBG A;  5A6B D;  4JI5 E;  4JI4 E;  1QU6 A;  2EPM X;  2EQ0 A;  2EPK X;  4DKK A;  3THO B;  2H36 X;  4DUZ E;  4BMJ A;  4R8O A;  4AQY E;  3HTX A;  2EMW A;  4WSP A;  2VF1 A;  2EMY A;  2EE8 A;  1STU A;  1EKZ A;  2LBS B;  3ECR A;  1BBO A;  2RS6 A;  2JPA A;  1AAY A;  3EPK A;  2DRP A;  3DJW A;  1G2F C;  1GQE A;  2RSI A;  2LT7 A;  2WCC 3;  1HNW E;  1PJT A;  1IQS A;  2EL5 A;  2N8X A;  4GZN C;  4YY3 E;  1WXR A;  2L8T A;  2EM4 A;  3TQM A;  2LVH A;  2EM5 A;  4O4K A;  2M9A A;  2NUG A;  3J80 C;  1YFH A;  3F6G A;  3VYX A;  2I9I A;  2EOJ A;  2V83 A;  4RH8 A;  3FIG A;  4OX9 E;  2EMG A;  2EOQ A;  4IS1 C;  4LF5 E;  1FJG E;  4YHH E;  3C4T A;  2EOE A;  2L2N A;  2CTD A;  3JU0 A;  2EPN A;  2VQE E;  2EZ6 A;  2EOR A;  2JVA A;  2L3J A;  4GKJ E;  3KZY A;  4R2P A;  4GEQ B;  1O0W A;  1SFE A;  4JI0 E;  4I8O A;  2EQ3 A;  4X64 E;  2YTI A;  4DV3 E;  4P7D A;  1Z1B A;  4X66 E;  1A1H A;  1PKP A;  5LL6 R;  2ENH A;  4O24 A;  2DLK A;  2V86 A;  4P78 A;  2LE2 A;  2IHR 1;  2M1S A;  3UK3 C;  2ELZ A;  4LU9 A;  2EMF A;  1RC7 A;  4DV7 E;  4BBY A;  2EMB A;  1IMU A;  5KL3 A;  4MLQ A;  2EL6 A;  5KL5 A;  1N3G A;  2EOH A;  3K6Q A;  2YSP A; 
#chains in the Genus database with same CATH homology
 3ADI A;  4K0K E;  4R03 A;  4DV1 E;  2B3T B;  4J8Z A;  2VE7 C;  2NUE A;  3P1X A;  2B9D A;  1FKA E;  5AAS A;  5LMN E;  1DI2 A;  2L92 A;  2V8Q B;  2UUA E;  1ZBQ A;  2VQF E;  3AUZ A;  4WPY A;  1IBL E;  1HNX E;  5LMU E;  3OTO E;  4M0V A;  3VK6 A;  3JTZ A;  4BC7 A;  2V88 A;  1T4O A;  2KHX A;  3HXL A;  2L2K B;  3HPZ A;  1YZ9 A;  4B3R E;  1T4N A;  5A2Q C;  2B7V A;  4M2Z A;  2V87 A;  3IWB A;  2JY9 A;  2RS7 A;  4WYQ B;  2FGG A;  4OOG C;  4DV2 E;  4DUY E;  3T1Y E;  1T4L B;  2E5L E;  4JI3 E;  2LTS A;  3HPS A;  5BR8 E;  1XNR E;  1UIL A;  4DR5 E;  1WHN A;  3OML A;  3J81 C;  2MDR A;  3H09 A;  5T6J A;  5F3W A;  4LF4 E;  4X65 E;  3LLH A;  4DR3 E;  4B3S E;  2LJH A;  3KWR A;  2UUC E;  4JI4 E;  1XMQ E;  2FTX B;  1QU6 A;  2MC5 A;  4JI5 E;  3C4B A;  4NXM E;  4LFB E;  4DKK A;  2KON A;  2MC6 A;  4LFA E;  4JI7 E;  2N3G A;  2E1M A;  2RTX A;  2H36 X;  4B3T E;  4DUZ E;  4L5N C;  2HHH E;  3J7A G;  2FV4 B;  4BMJ A;  2JWO A;  4R8O A;  4AQY E;  3HTX A;  2UXD E;  3JAM C;  4JI2 E;  2ODR C;  2DSY A;  4WSP A;  4F54 A;  2VF1 A;  4LF7 E;  2V89 A;  2B7T A;  1STU A;  3DF6 A;  3F6H A;  5ADZ A;  1EKZ A;  4JV5 E;  2LBS B;  4BCA A;  4LF9 E;  4F9B B;  1X47 A;  2RS6 A;  2DIX A;  4BC9 A;  2UU9 E;  4DR7 E;  3AV0 A;  3DJW A;  1N34 E;  2M4I A;  4F9A B;  1GQE A;  4X62 E;  1HNW E;  4F9C B;  1HNZ E;  1GZ6 A;  2ODR D;  3LML A;  5FLX C;  4Q28 A;  4DR1 E;  4YY3 E;  2KOU A;  1N32 E;  1WXR A;  2N3H A;  2F8B A;  2L8T A;  2LUQ A;  5DNY A;  1DQ3 A;  5CFF E;  2DMY A;  4KZS A;  4DR2 E;  1YYW A;  5AE3 A;  2NUG A;  3J80 C;  3ADJ A;  2NUF A;  3F6G A;  1J5E E;  3VYX A;  4BS9 A;  2V83 A;  4GKK E;  2LMZ A;  3FIG A;  4OX9 E;  4LF5 E;  2LUP B;  1FJG E;  1X49 A;  4KHP E;  4YHH E;  2UUB E;  2L2M A;  1N36 E;  2WZO A;  2NA2 A;  3C4T A;  2L2N A;  2LRS A;  3VYY A;  3ADG A;  4JI8 E;  5IWA E;  5IT9 C;  4B3M E;  3IWC A;  3JU0 A;  2L3C A;  2VQE E;  2ZM6 E;  1ZBT A;  2EZ6 A;  1UHZ A;  2JVA A;  2M7Q A;  2L3J A;  3T1H E;  4GKJ E;  4LTY A;  2K4V A;  5AE2 A;  4X8W A;  4GEQ B;  1IBM E;  2F4V E;  1O0W A;  4NXN E;  2YZT A;  1N33 E;  2UXB E;  2JR1 A;  4JI0 E;  4I8O A;  4DR6 E;  4L8N A;  4DV0 E;  4X64 E;  4M30 A;  4DV3 E;  2DB2 A;  4P7D A;  4X66 E;  4LF8 E;  1X48 A;  2L6M A;  1XMO E;  1PKP A;  4DMI A;  2V85 A;  5LL6 R;  3J7Y p;  4DV4 E;  4LFC E;  4DV5 E;  1YYK A;  2L33 A;  2V86 A;  4P78 A;  2LE2 A;  2IHR 1;  2G7H A;  3HQ1 A;  1HR0 E;  2M1S A;  2UXC E;  4LU9 A;  3IWD A;  4WFT A;  4TUI A;  2RSM A;  1RC7 A;  3ZOQ B;  4DV7 E;  4LF6 E;  4BBY A;  1YYO A;  1SR9 A;  1RQ0 A;  1XNQ E;  2JOB A;  1WHQ A;  3RMP A;  1I94 E;  4TUG A;  1IBK E;  2LTR A;  3ADL A;  2JOX A;  2YT4 A;  3MSW A;  1J26 A;  2EWL A;  4JYA E;  2CPN A;  4JI1 E;  4JI6 E;  4DV6 E;  4DR4 E;  3K6Q A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...