4BMSA

Short chain alcohol dehydrogenase from ralstonia sp. dsm 6428 in complex with nadph
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
249
structure length
247
Chain Sequence
b'MYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPIIENQTQEEADELRAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
publication title Structures of Alcohol Dehydrogenases from Ralstonia and Sphingobium Spp. Reveal the Molecular Basis for Their Recognition of 'Bulky-Bulky' Ketones
doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 249
chains with identical sequence B, C, E, F, K
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bmsA00
2E49A 3DOJA 3E6AA 1ZO8A 4OKNA 4CLRB 3HFSA 2I76A 2Q2VA 3SX2A 1GR0A 1YE3A 4RPHA 2DT5A 1LUAA 3VH2A 2YW9A 4IPTA 1G6KA 2HDHA 4DGSA 1NVMB 1ONPA 3ASVA 3WR5A 3S2GA 3NDJA 1EE2A 2AE1A 1KC3A 2X86A 3V8BA 5JYDA 5TNXA 3OIDA 2ZB3A 5JDIC 2EIHA 4ND5A 4FDAA 1QORA 2BFPA 1SMKA 4NFYA 2IDZA 2VRCA 5KTKA 1HE2A 3R1IA 3F5QA 4YWJA 9LDTA 2VNAA 4N18A 1VL0A 2G5CA 2JCVA 1AE1A 4MVJA 2C82A 2FPIA 1OOEA 4CM9A 2NLOA 1E92A 5MDHA 3U4IA 3GN2A 2XOXA 1NQAO 1ZFNA 4HFNA 1ZW1A 7MDHA 5DF1A 3KO8A 3W1VA 3GHYA 4K1LA 5AYVA 3V2UA 3OJ0A 1C0PA 2PZMA 4F6LA 2X4GA 1LDNA 5ENVA 3JQAD 4KUHA 1JU9A 4QSMA 3WQRA 3FNGA 1LC3A 2AW5A 1LRJA 4BNLA 2AQKA 4GX2A 1RM3A 3WS7A 3EHEA 5C7LO 3EY4A 1D7OA 3WICA 4P4LA 2OFPA 1CDOA 1CRWG 2V6GA 4HFJA 3ZW9A 4ALNA 1EFKA 2ZQZA 3QWAA 4J1SA 4N7RA 4OOEA 2PGDA 2VHVA 4I8XA 4CL3A 5T8KC 1HZZA 2QZZA 1NQOA 3MWDB 3KOUA 2JCXA 4XCVA 1LNQA 5DBIA 3F9IA 5AOVA 3R3JA 3H3FA 2ZCVA 4BQRA 1I5RA 1VM6A 3SLGA 4UREA 4RO0A 4E6PA 2I3GA 5DZSA 4NBTA 5DP2A 5IDYA 4BIIA 4CM4B 4R5MA 1BW9A 3CKYA 4LW8A 4NBUA 3VHRA 5KJEA 1ADBA 4CQMD 4CM8A 4KQXA 1A7KA 4D44A 3WGHA 1VE9A 3PZRA 4W9NA 1E7QA 1O0SA 1H6DA 3WMXA 2YUTA 2X5JO 4IS3A 3UGKA 1LDEA 3WIEA 3ZWXA 1YJQA 2GD1O 1PTJA 3GVPA 4L76A 1ISMA 1V3UA 2P5UA 1QYWA 3L6DA 3U49A 1QYDA 2CNBA 4HP8A 2X9VA 2VTDA 2J5RA 3QWHA 3AUSA 3B6ZA 2JL1A 3D64A 2VRCD 2Y93A 3E03A 3V1YA 3RC2A 2PK3A 1DAPA 2GZ2A 1TA4A 3RKRA 4DYDA 3ZWYA 1VKOA 2YHIB 3WWZA 4A0SA 5I7FA 3FTNA 3WNQA 1KBZA 2AG5A 4Z9FA 3N74A 4P4GA 5J23A 3DFUA 2H1SA 3RVDA 2C54A 3QP9A 4PG6A 4CMEC 3ZWMA 4B4OA 1M2WA 3DZKA 3HE3A 3BMNB 4BNVA 4CV3A 1G0OA 1LXCA 1H9AA 2Y1GA 3NV9A 3RBVA 3WGZA 4AJNA 1HYGA 2WYUA 2CF5A 3RI3A 4CLDA 3ICCA 1Q2XA 2C7GA 5F1KA 1IE3A 3KSZO 1E3LA 1PQPA 5U1PA 3INGA 4JROA 5TSDA 1IUKA 1GQQA 1MUUA 4YCAA 4R1NA 4HFRA 2NU8A 2NACA 3WSWA 2GNAA 2NWQA 2YV2A 4CMBA 1I3KA 2GASA 1ZEJA 2O4UX 3KHUA 3H9QA 4IZIA 3IIEA 3HB5X 1EDOA 2X58A 2O2SA 4UEKA 1C1XB 5I7EA 1DO8A 4RVUA 2YQ5A 1GZ4A 3D5QA 1UXHA 1J49A 3AW9A 1XG5A 3Q2IA 3GNQA 1KC1A 4J43A 1PX0A 4Q3DA 1W8DA 1MA0A 1JTVA 2B35A 3Q1LA 1YWGO 2OORA 3E48A 1YL5A 1PL8A 4GKBA 2GN4A 4PIVA 1U3WA 3WJAA 3FNHA 4PG4A 3PEFA 1X0VA 1HKUA 2B36A 3C7CB 4R4JA 1ZCJA 3P19A 5HBRA 2XXBA 4BKQA 2PNFA 4ROSA 1H2HA 5TF4A 1NVTA 4CR7A 2POQX 1O89A 4Y6SA 2PD4A 2VYND 4JJFA 2XAAA 3JQBC 4DQVA 4YA6A 2R00A 4CUZA 1ISFA 2NQ8A 2EKLA 3G0OA 4GQAA 4Y6RA 5IG2A 4YJFA 4BKPA 3ULKA 1FDVA 3JQEA 3K5PA 5A5EA 1UZLA 1Y8QA 1ZEMA 2IZZA 2OZPA 3JQ6A 4S3MA 4BNUA 1DEHA 1TT5A 3DZFA 4EEXA 4JP3A 2Q50A 3KSDO 4LSWA 4L75A 1HE5A 3W8DA 3KUXA 2O23A 2NV6A 4WLOA 4BO0A 1OFGA 1PJQA 2DTXA 3CMMA 3PIIA 3JQ8B 4E21A 1Y81A 1HYEA 3MEQA 4WLUA 3B70A 3TDKA 2GN9A 2I65A 3FHLA 4ZVVA 5CDYA 3LYLA 1Z73A 2BGKA 5HS4A 3LK7A 4ALJA 5JAZA 1UXKA 3RFTA 5B4TA 2GDZA 1GV1A 4UVDA 3I9OA 2CDAA 2P4QA 4GVXA 1ZK3A 4CLOA 3DBRB 4WNIA 4IM7A 2OXIA 4R1SA 4CODB 4TKMA 4AG3A 3C1AA 3NX4A 2X0IA 4DIBA 1Z45A 4L4RA 4YRBA 3LT4A 4NDNE 1E7RA 3L0DA 1R0LA 4J7UA 4XD2A 3MJTA 4CJXA 1V3TA 1NR7A 2IODA 4JGBA 2H9IA 4BO9A 3DC2A 4CMHA 2RBEA 3QVWA 4D7AA 4TROA 4AICA 4RVGA 1WWKA 1YVEI 4U7WA 1P3DA 3C1TA 5DCUA 5L45A 4R9RA 4J9UE 4XRGA 4E12A 2Q3EA 4Y6PA 1JKFA 3A14A 3IDSA 3ST7A 5L3ZA 2GZ1A 1PEDA 3OA0A 4DPKA 4AJPA 4B7XA 3MJSA 3FPCA 4OJNA 2JD1A 4EJ0A 1F8FA 3CZMA 4YT2A 4NQZA 3K30A 3QE3A 4II2A 1ZK4A 3BMQA 3ZWCA 1LQUA 4LN1A 1HLDA 3ZNPA 5CEFA 3W4KA 5JNLA 1PL6A 1GUFA 4GMGA 2GN6A 6ADHA 3K9QO 2HK9A 4XJSA 2HMVA 1RPNA 3ITDA 4YJHA 1SPXA 2GCGA 3WOHA 3NYWA 3B1JA 1K6JA 3CSDA 3EVTA 3TL2A 4ZQFA 4K6CA 1E6UA 1PGJA 1YBAA 4ZU3A 5A3VA 4QFDA 4DLAA 1ARZA 2Z1MA 4U0KA 5B12A 1Q7BA 2E4AA 4MJLA 2ET6A 2OO5A 5LDGA 4BO3A 2JJYA 2AE2A 4FFNA 4M1QA 1YQXA 3W6UA 1LDMA 3M2TA 1ID1A 2FR8A 4BNZA 4E2WA 2HLPA 1BG6A 4XR4A 3WGYA 4RLSA 5I8ZA 3KYDB 1ADFA 1D8AA 1Q0HA 4F46A 2GZ3A 4DVJA 3GNTA 5KJFA 4YRAA 2O3TA 4IJVA 4GLOA 1YGYA 1LRKA 1ZK0A 3GEGA 1ZZEA 1K0UA 4KQWA 1O8CA 3QWIA 4NJOA 1E5QA 1RKXA 4XYGA 4FFRA 1Z82A 1NXQA 3A06A 2EHDA 3PJGA 1DIHA 3VDQA 3WB9A 2QRKA 4YR9A 5COQA 1H2BA 4RVFA 1B8PA 1R66A 4DPLA 1I36A 4FFMA 3NGLA 1HDZA 4GVLA 4MINA 4NJMA 4D45A 2F1KA 4XQGA 3A1NA 1CYDA 3GHHA 3VH1A 3EMKA 3JD1A 1ZUD1 3R0IA 1B26A 3PXXA 1KS9A 5GZ3A 3F1KA 4HNHA 2A35A 2I5PO 3UOGA 1SBYA 3QV1A 4TVOA 3BTVA 3TFQA 4YACA 4UVHA 1DSSG 3K2BA 1I01A 3MJVA 1EQUA 1K6IA 4L8VA 3DXFA 3V5NA 3SBOA 4ESOA 3VC7A 3I1JA 2O3SA 2E82A 2AG8A 4A5OA 2LDXA 3ZU5A 1HDOA 1ZSVA 1P1RA 4H16A 1UXJA 1ZKMA 3BHMA 3C8MA 4CLXA 4ZQEA 1ZXBA 2EEZA 2PZJA 2B0JA 3QVXA 1LC0A 2EJVA 1SEVA 3LQFA 4ALKA 4FPXA 3HQ4O 3AY7A 4O63O 4I5FA 3S1LA 3WYEA 1GQ2A 2PKQP 3DHYA 3PDJA 3U4HA 5IN4A 1H0KA 3C85A 1MG0A 4J16A 4BV9A 1EUDA 4GPD1 3JD3A 4W9NC 1GZ6A 4DL9A 5LCXA 4BNGA 5F21A 4L73A 3WTBA 3DOCA 5L7YA 5JC1A 4ILKA 4WLNA 3DZBA 1DIRA 3PFWO 2NVWA 3PQDA 4PCVA 3RBXA 4TRJA 1B7GO 4U6SA 1IHXA 4KUEA 3RASA 2CVZA 3I6QA 3BIOA 4JBIA 3BMCA 1HSZA 2UYYA 3H5NA 1XA0A 2DPGA 3VPSA 2RH8A 5DP1A 3RQSA 1T1SA 1AXEA 1UH5A 4P4NA 3PHJA 3FNEA 1Y8RB 2W2LA 4Q3AA 1ISIA 3EYWA 4FFLA 3S2FA 5BNFA 3I9KA 1M67A 4KP7A 2Y67A 1GUYA 2C5EA 3HZZA 3UUWA 5MGBA 3ZNOA 1NAIA 4R69A 3GAFA 3I52A 2O50A 5DNAA 3LT1A 3ZHZA 4GAEA 4XGIA 1UXIA 3UXYA 2WMDA 4XEHA 3WBFA 4WK6A 2FHSA 4YYZA 5CEEA 4II3A 4HXYA 3CH6A 1NWHA 1NQ5A 2AEJA 2Q1WA 1I2BA 4BHTA 2EP5A 2VHXA 3M1AA 5JLAA 4FB5A 3L77A 2VZ8A 4QUKA 1PZFA 4QX6A 3FNFA 3WGGA 2PZKA 4MP6A 1HT0A 1C14A 4IDAA 5EJ2A 3KLPX 1H94A 5LDHA 1FDSA 1I0ZA 4IDBA 3D1LA 4D42A 4Z3KA 3F5SA 4AJKA 1A9ZA 3L4SO 3TPCA 3LC7O 1DLIA 2BELA 4BL5A 1SB9A 2Q49A 1UDCA 4J91A 5JMPA 5ENDA 3Q6IA 3ZV4A 2OL4A 2CUKA 4MVJM 3GRPA 5L53A 1T2FA 3BMOA 3INRA 4UUPA 2NTVA 8LDHA 2X1HA 3DFZA 2NSDA 4WKGA 3F4LA 1PL7A 1VRWA 2BLLA 2P5YA 2VWPA 3ICPA 4GMFA 4WOKA 2EP7A 2Y1OA 4MIYA 4XYBA 1ONOA 5T6BA 4A10A 1MG5A 1PR9A 1O6ZA 3KBOA 4GH5A 4JIGA 4XX0A 2R2GA 3DZJA 3JQGA 2D59A 1Z7BA 2CVOA 5CDTA 4DMMA 3PVZA 2A4KA 2R00C 1WXDA 4WGGA 4J2OA 4YRDA 3DAGA 1XLTA 2CDBA 3K8ZA 5L95A 4OXNA 2X0NA 4ZHSA 3GGPA 4RPJA 2J3KA 5G0UA 3AFMA 4K9DA 4MVJE 4J7CA 3NUGA 1DJQA 2NVBA 3IKTA 2ZTVA 3PPIA 4XWYA 4YAKA 1P1IA 5BR7A 2WE7A 4FJ1A 4AJIA 3SVTA 3DEYX 5I7VA 1PJ4A 5DOZA 3V2GA 3D7LA 1ENPA 4OAQA 3ZZNA 5FWNA 1E1KA 3SLKA 1HF3A 1BXZA 5C7OO 3DR3A 3VAZA 3ZWWA 4C4OA 1B16A 1EZ4A 4EYEA 4D0SA 4IIUA 4CV1A 4IJKA 3PYLA 2GGSA 3JQDA 1T4DA 2EGGA 2Y0CA 3QRWA 3WGTA 4BO6A 4NBWA 1NNUA 2CZCA 4OHUA 4UVEA 5DBGA 5L51A 3HDJA 2VTEA 1M6WA 3KSUA 4CM5A 2YV1A 1R12A 3FI9A 5CPFA 1ZSNA 3QW2A 1FK8A 1UR5A 4LMRA 4WNCA 1YBVA 1NPYA 3WDSA 4CM4A 4DRYA 3VZQA 3GGGA 1VSVA 1E3SA 4BVAA 1NVGA 2O7SA 2YJZA 1PGNA 4LVUA 4FQ8A 2VYVA 3GK3A 5TJHA 4QQRA 5EPOA 1Z7EA 2VOJA 4WEOA 5CG2A 4BO2A 1QMGA 4ZA2A 4RF4A 1VC2A 5KVSA 2C29D 2YZ7A 2OOSA 4KOAA 1E1MA 1DIBA 3RIHA 4PG7A 2EF1A 2DPHA 2NTJA 1PSDA 2V7PA 4W7IA 5EIOA 3DZIA 1R37A 3GT0A 3HFGA 1P0FA 1PJTA 3T4EA 1CJCA 2IYPA 1ENOA 2Q99A 3DOOA 4PGFA 1X7DA 2JFHA 1L7EA 4KDFA 3IP3A 1EBFA 4XJTA 1U4OA 1LSSA 3ZGYA 1U3TA 4D43A 1DJNA 1E0DA 1U7TA 4XYMA 3PJFA 3T4XA 5ICSA 1IPEA 4J90A 3ZDFA 1P77A 2O48X 2YHIA 4CMJA 3VTFA 2J5KA 4HWKA 1DHTA 1N7HA 3KTDA 3HG7A 4YJDA 3LC2O 1KERA 4M86A 1KEUA 3VPGA 1X15A 2NTNA 1YS4A 4QT0A 3PGJA 1G0NA 4UEOA 4DMLA 2BI8A 3ONDA 5THKA 4EZBA 5HA5A 3R3SA 1JWAB 3KXDA 2HMUA 4S1VA 5I9MA 4EJMA 1SZJG 1T25A 1VJ0A 2QHXA 2FSSA 3D4PA 4FFPA 3DTYA 3H6KA 1ZMTA 4GSKA 1E3EA 2FOIA 2IEDA 2Z95A 2HRZA 3ZI0A 3DAFA 4QO7A 3I4CA 1QXSA 3GFBA 1T26A 4NU6A 4PLVA 2WEKA 4ONEA 2Z1NA 5GZ1A 3HJAA 3QQPA 3B20A 2FPPA 3QJ5A 3V1UA 2SCUA 4R9SA 1GPJA 3WXBA 5L7WA 2Q1UA 1GYPA 1HLPA 4O0LA 1C1XA 4JBHA 5L4NA 2YY7A 1EE9A 1WPQA 2BHLA 4CMIB 3FR8A 1GUZA 1GY8A 3GLQA 4QECA 1E5LA 2P9CA 1HTBA 3RUIA 1D3AA 1I10A 1I8TA 2V6BA 2O3QA 4A26A 5JSFA 1ZIDA 1LI4A 3JYLA 4WASA 1YOVB 3GVHA 1MC4A 4OQYA 3GEDA 4BGEA 1OZAA 2Q2QA 3EUWA 3RC7A 1VI2A 4M89A 1A5ZA 1KYQA 1R4MB 3GAZA 4INAA 3INTA 3TRIA 1U5AA 1ZXLA 3S55A 4U0JA 4W6ZA 4WCFA 3FR7A 2DUUA 4WLVA 1HZJA 4PZCA 2X5OA 3MOIA 4D0RA 1F12A 4CV2A 3GMSA 4RL6A 3LT0A 3ANMA 2OHXA 1NFQA 2J5QA 1DC6A 1GD1O 3OH8A 2BFAA 1DC4A 3P2OA 1VKNA 2GR9A 2D8AA 3JQAB 1LSOA 3JQ7B 1AHIA 1ISGA 1V8BA 5EN4A 3TNLA 4AVYA 4PLPA 4YT4A 3OQBA 5DULA 4UUOA 4E0BA 1O95A 2QG4A 2BKAA 3D3WB 4OYRA 4XB1A 5T64A 4OKIA 1HRDA 3QVOA 4YJGB 3ROMA 3QLJA 1Q1NA 4CUJA 2QQ5A 3JQ8A 3FSRA 1R0KA 4MVJD 1AGNA 3OJEA 4XIJA 3U4DA 2V65A 4TRMA 3Q9UA 5DT9A 1I3NA 5I8WA 5ITVA 4CM9D 1W0CA 3H65A 4DQUA 2YQ4A 1QP8A 1YB1A 4MIEA 1HWYA 5EESA 3GG2A 1DRVA 4XGKA 4JJGA 3DL2A 3DBRA 2DAPA 1HDYA 2PA3A 3UH1A 4CQMB 3G17A 4OXKA 1LX6A 2W4QA 1LEHA 1KETA 3WYBA 3ASUA 3OETA 2VHZA 4IDGA 3UICA 5FF9A 2D5CA 3TSCA 4OM8A 4JLWA 2DFVA 3MOGA 3O9ZA 1F0YA 4KWIA 4PVDA 1IL0A 2P4HX 4AJ1A 4YAIA 1QYXA 2LDBA 1F17A 2GYYA 4CLEA 1T2EA 3OJOA 3DHNA 3MZ0A 1RM4A 3H4VA 4J7XA 1NAHA 2PKQO 3FN4A 2HAEA 3IJPA 4JBGA 1G1AA 1U28A 5BQFA 3KVOA 1NFRA 2NM0A 1YONA 2JAHA 4EITA 1R16A 1UJMA 1I2ZA 3RUEA 4CV0A 1I2CA 4A03A 1PJCA 3VPHA 5TIIA 4F3YA 1SB8A 4NI5A 3E18A 1VPDA 4IQ0A 5JAQA 3AU8A 2UUOA 4PLGA 3PWSA 3RC9A 1QV7A 2CF6A 2Y1CA 4EUFA 2HCTA 1GV0A 5JDCA 4RORA 2O4CA 3IC5A 3EW7A 3TOXA 5A03A 1DLJA 5ITWA 4RF2A 1Y6JA 4DLLA 1FXSA 5KJ6A 3L07A 2QW8A 4E5NA 3AUAA 1JA9A 4B8ZA 4IINA 4UUMA 1JQBA 1RJWA 3AY3A 4XB2A 2PH5A 1XELA 1JKJA 2I3AA 3F4BA 4PLCA 4BO8A 2ZIZA 4XDZA 3MJEA 3H9JA 4O5OA 1BDMA 4R5HA 2Y66A 5DDIP 4B79A 1MB4A 2Q4BA 2VNSA 3NKLA 4NFHA 4IXWA 3JQ9A 1ZMOA 1RYDA 4Z6KA 2EKQA 3I6IA 3QIVA 1B8VA 3KYDA 3VKVA 2AEMA 1X7HA 3I3OA 4B3IA 4D46A 3KETA 3GGOA 3G3EA 4QEDA 1SC6A 4XZ3A 3FCOA 1K3TA 1IY8A 2IXBA 3AOEC 5EL0A 1N9GB 4OH1A 5L40A 3K2EA 5T57A 5GY7A 3QVSA 2DQ4A 4PLYA 4B4VA 5IF3A 2NNLD 3QY9A 4G2NA 1CQJA 3H2ZA 4FN4A 3ZWAA 4YAEA 5JC8A 4P22A 4M8SA 2X0JA 2I67A 5ES3A 1X1EA 2NU6A 2VQ3A 2HK8A 3AI1A 5FYDA 3I9MA 4WECA 2EJWA 2ILTA 4Q3BA 4JK3A 3ZV3A 4TSKA 2AEFA 3E8XA 1XEAA 1U1IA 1E7MA 3GVIA 4FJ0A 4Y8VA 2AQ8A 1XDWA 3S8MA 3KYCA 1UUFA 3NDRA 4K26A 4CQLB 5AQ1A 1YDEA 3E5RA 3JYQA 5EQDA 4AJ4A 3N7UA 1LQTA 1YBMA 5THQA 4D3DA 4ZQHA 4CM7A 2E48A 5HRUA 4DUPA 1FDWA 2X9GA 1WNTA 3C7DB 5EMHA 4AJLA 4F6CA 1ZK2A 3M6IA 4B3JA 4NK4A 4I9NA 1CERA 3IUPA 4BKRA 1BSVA 5IZCA 5IAAA 2HK7A 3G79A 3E82A 1B3RA 4IJWA 4JQCA 3I9NA 1BVUA 2WYVA 5GZ6A 1ISHA 1P1FA 3FBTA 5TX7A 4NFSA 4OOFA 1ENZA 4K28A 4CLHA 1YL7A 1SEPA 2OMEA 4R51A 2C7VA 1QG6A 2BH9A 4J1NA 1U2DA 4KMSA 3ROPA 4B4WA 3PZBA 3ZU4A 1LLDA 1E1LA 1ZK1A 3OECA 3OF2A 5T67A 1H6BA 3U3XA 4FS3A 2DBZA 2A92A 2WTBA 5JCXA 1T1RA 4XDYA 1F8GA 1KEPA 1KVUA 4MDHA 2H63A 2PZLA 1A7AA 3Q9NA 4MPDA 3DMTA 2VZ0A 4R54A 2DFDA 4GI2A 3VPFA 4YXFA 2FRDA 4GX5A 4AJEA 2JHGA 4B4UA 3DBHA 3PHGA 3ZWOA 3TL3A 4J1TA 3KZVA 1WLYA 4A27A 1DPGA 3BXXA 5A9SB 4YB8A 3ANLA 2G17A 2Q1TA 2UUPA 2ZB4A 5BT9A 3V1TC 5DOVA 4ALLA 5A3JA 3K6JA 4BV8A 1PS0A 3DAPA 4FOOA 3T7EA 3WGOA 3TQHA 5C3MA 1DFGA 3DTTA 4AL4A 1ZVMA 4PRLA 4RDHA 4MVJH 4IDEA 1Y8RA 2Y99A 4I9HA 3ZW8A 4JJIA 1LJ8A 3PP8A 4PVCA 2P9GA 3WFJA 3RJ5A 4BO5A 1DAOA 1ONNA 4TZTA 3Q0EA 5FI3A 5G2OA 4A7PA 3ZHBA 4EGFA 2X23A 4O1MA 3I9LA 5A4DA 2WJPA 3RJ9A 4PLHA 4MP3A 4ND3A 3FBGA 3BHJA 3I5MA 3W8EA 3G1UA 5IZ4A 3AUTA 3DQPA 1UZNA 3AUUA 3PYXA 3OIFA 5ICMA 3K96A 3B1KA 3NGXA 4XR9A 1MXHA 4H3VA 1DFIA 4Y98A 1BDBA 2W2KB 2YV3A 4PG8A 1WMBA 5KJ1A 2ZYDA 5L4LA 4FFOA 4RQUA 2CY0A 1UP7A 3O03A 3NTQA 4L0QA 4OIMA 3UW3A 2Y05A 4RPGA 3BYZA 3NT4A 2XXJA 4BUCA 3HN2A 1HXHA 1B14A 2CDCA 1CQIA 3IKVA 3W8FA 2ZTUA 4DC0A 2VOEA 3GH3A 3DB2A 2VZ9A 6LDHA 3D3EA 3PWKA 1NASA 2EV9A 3PIDA 4BNKA 1UAYA 4HUJA 1IZ9A 1NR1A 3QHAA 1OC2A 2D3TA 4UAGA 1HE4A 1BHSA 4W7HA 3BTOA 4MVJI 2EKPA 4DIFA 3KB6A 4I5GA 4BO1A 4IUYA 3WSVA 1LBEA 3AM4A 3MJ4A 5ADHA 4YTEA 2ZJ0A 3NT2A 1XHLA 4EUEA 3GEMA 4WCFC 3AI3A 3JD0A 5H83A 4FSHA 1FMCA 5JFOA 2JD2A 2HRBA 4R3WA 4DQXA 5IJZA 5TLSA 1DIAA 2I66A 1T4BA 3C1OA 4Y67A 1CF2O 5C5IA 1WDMA 1V9LA 1XSEA 2G0TA 4MVJG 1U3VA 4E5PA 3CXRA 1DC5A 2PD3A 1XIVA 2RCYA 2P2SA 5G0SA 1PQUA 2D1YA 5AXBA 1DXYA 1HDRA 3BHIA 2JHFA 3L6EA 3IMFA 4J1QA 2QIOA 1FDUA 1TB4A 1E3WB 2VUSA 3BMQB 1NQTA 4AFNA 4JNKA 2I99A 2ZCUA 1C0KA 3QWBA 4B7CA 4BOYA 4HADA 1KEWA 1U9JA 4B8WA 5BSHA 3NJ4A 4R1TA 3AWDA 4FW8A 4NMHA 4E2YA 3RU9A 2HU2A 2IEBA 1LDBA 4CMEA 3CPSA 2Z5LA 5H82A 3UFXA 2WWRA 3OICA 5TC4A 3UCFA 1E7SA 1LTHR 2RIRA 1R6DA 5JMWA 5IFLA 2W90A 1K5HA 7ADHA 3ZWNA 1N5DA 1PJBA 2C59A 3ZHXA 2BRUA 3DBVO 1T24A 3EAGA 1LRLA 4GWGA 1BTOA 1XGKA 3PK0A 1GTMA 4OL9A 4RPKA 5EERA 2ZK7A 3JD2A 4N5LA 5IXSA 1Y5MA 2C0CA 3ZH2A 5JCJA 3PLNA 2P9EA 1CWUA 3WNVA 1ZNQO 5K0ZA 4WOJA 2W8ZA 4IJUA 1E7YA 1V0JA 3GVCA 1B8UA 1EQ2A 5TJ9A 1ISJA 1ULUA 4XGNA 1E6WA 2HUNA 3F47A 3L4BA 1OBFO 2R6JA 3RKUA 3OBBA 4XRRA 3GPDG 4FBGA 4RZIA 4AJHA 4PRKA 3RCBA 4RDIA 1MV8A 1KVRA 2GERA 3CIFA 4R3NA 1DIGA 4E13A 4HV4A 2JAPA 3PJDA 2ZJ1A 4LSMA 3PHLA 1RYEA 4I5DA 1YJ8A 4WLEA 1EEHA 5ER6A 5G4KB 5JYEA 4P38A 4RCVA 2WSBA 4CLRA 3CZRA 3ETEA 3W4IA 1PU2A 5FFFA 3LDHA 4C7JA 3ZWPA 4XQCA 1PIWA 2PD6A 3PLRA 2B83A 4RPLA 5F5NA 5IXYA 1HDCA 1GPDG 1QR6A 1WZEA 4BNMA 2A9FA 1P9LA 4W99A 5HWSA 1N8KA 4LRSB 4OXYA 3H9GA 3TN7A 1UZMA 3GA0A 1J0XO 2GO1A 5G0WA 2V6FA 2PV7A 4EW6A 4MP8A 5TQVA 3GC6A 3L9WA 2B4RO 1HEUA 1RM5A 4PLFA 4ZJUA 2W2LD 1N7GA 2VWQA 2TMGA 2HJRA 1S6YA 4EJ6A 1P0CA 1JLLA 1Y7TA 1GL3A 4AJJA 3HADA 1JW9B 4TZKA 3DMYA 1PJSA 1QYCA 3ORFA 4CL8A 3WQQA 1I33A 1EVIA 1YKFA 3O8QB 4DIOA 1UXGA 2DTDA 1UP6A 1VSUA 2EERA 4G5HA 2DLDA 4HY3A 4CMIA 4M49A 5JAMA 1B15A 1EDZA 2EXXA 5HS6A 1Y9EA 3OIGA 2PGJA 4LCEA 2JD0A 4IQGA 4NG5A 5FI5A 3OM9A 3IUSA 2PFGA 1YOVA 1E3IA 2CSUA 3EGOA 4WEQA 3EK2A 3OP4A 4YVFA 5A05A 3ZWBA 1NM5A 2HMWA 1ADCA 1EK5A 3L6OO 3TJRA 1R4MA 4UUNA 4UVIA 1GAEO 1MLDA 3H3JA 4M87A 5A9TA 2X8LA 3HSKA 1GDHA 1Q0QA 4NZ9A 4BMVA 5K6AA 2AMFA 5IZCC 1OMOA 1T2DA 3AM5A 1JAYA 1E1NA 2BMAA 4TWRA 1N2SA 1RWBA 5CDUA 4RLHA 3WGIA 2OP1A 3GPIA 5T5QA 1D1TA 3JQAA 5TT1A 3JQ7A 1VJ1A 3GUCA 5JAIA 4HFMA 4H7PA 5TS3A 3U09A 1VL8A 4Q3NA 1NWCA 3UCXA 1C0IA 1H6AA 3D3WA 4BB6A 4D79A 4I08A 4YJGA 3PWZA 1KEVA 1U8FO 1DHRA 4URFA 2IXAA 1DRUA 3Q11A 3CUKA 1DC3A 2C07A 3X2EA 1J4AA 2EW2A 2CD9A 3DMTC 3BA1A 3UN1A 1PZGA 4FGWA 4IDCA 5IDWA 3QWFA 4IY1A 2JCYA 1B0AA 4CPDA 2PGLA 2EWMA 2YDXA 1ULSA 4J4BA 1K6XA 2Y0DA 2AQIA 5A06A 3SEFA 4YT8A 3BZUA 3DBLB 4E3ZA 3BMNA 4ND1A 1HE3A 2FN7A 4BNNA 1U5CA 3NEPX 3WWYA 4CQMA 4TRNA 3BMOB 2PR2A 5TRTA 1B3BA 3RUDA 5BSGA 1H6CA 3TOZA 1A71A 2DU8A 1U4SA 2FZEA 2WD7B 3R6DA 3PQFA 1GEGA 2B5VA 3RSHA 3LC1O 3M2PA 3OHSX 1BXKA 2ZB8A 4YAJA 3WGQA 4W4TA 4NIMA 3ZWVA 2BI7A 1A4UA 1JVBA 1YB5A 2J3IA 4F45A 2FMUA 2CMDA 5B4VA 4PZDA 1ZH8A 4J49A 3O38A 1R15A 1YXMA 5C37A 3JCZA 3K73O 2ZQYA 4KTTE 1I30A 4Z3DA 5G0TA 3JQGB 2ZATA 3GDFA 4YT5A 3AY6A 3K92A 5G0VA 4RVSA 3G1TA 3HDYA 3H5RA 1XWFA 1QSGA 3SXPA 3C3XA 3JD4A 2GPTA 3LT2A 1BXGB 3G49A 3RFXA 1IYZA 1DBVO 3QVTA 2NVUB 5F1PA 1AHHA 3GNSA 2VWGA 3FD8A 3PGXA 2VYVD 4IZHA 2HJSA 1EMDA 1WAMA 2XPCA 2VUUA 3JTMA 3PHHA 3PTZA 4RF3A 2X0RA 3ROKA 3VZPA 5AXDA 3KLMX 2DTEA 3W6ZA 1KVTA 5F1OA 1PWXA 3LVFO 2DBRA 4GGPA 1SOVA 4FR5A 4Z9XA 4KUGA 4Z0HO 4NNJA 2G1UA 3UAGA 5KVQA 3OJLA 3GZNB 3OFSA 4XQ9A 4LMPA 5CFZA 4GX1A 5I9LA 1Z6ZA 5AXAA 1R4NB 5KVCA 4J9VA 2X7HA 5ILOA 5JS6A 4NBRA 1JKIA 2HMTA 2NADA 4BNYA 1FF9A 1TEHA 4R1UA 5CHEA 4LVCA 1HSOA 1X13A 4GX0A 1C1DB 4BGUA 1YQGA 2FWMX 4PFJA 4GWKA 3ZCXA 1BWSA 4LK3A 2YYYA 4QTZA 3PI7A 4C7KA 1YQDA 1NX6A 4EUHA 2P91A 3CTMA 2X5KO 3H8VA 4BGVA 1A27A 1PS9A 3JQFA 1HDGO 3AJRA 2B5WA 3DWFA 3E9QA 4YAGA 1N9GA 1WMAA 1X1TA 5U9CA 4M54A 1O5IA 3ZU3A 2O3RA 4ZRMA 1U7HA 2A94A 1NHWA 4DPMA 3WBBA 4BO4A 3ONEA 4RVDA 4N5MA 4DA9A 1ZSYA 3LF2A 3WFIA 2O2YA 1LLUA 2DKNA 1MGOA 3ONFA 3FRJA 3U5TA 3WX0A 1P31A 2HKIA 2VYNA 4BO7A 1ZBQA 3VOSA 4KTVE 4CQLA 1SAYA 4NH4A 4JX8A 1WP4A 3WLFA 1KY5A 2EG9A 3QA9A 1GU7A 4MKRA 1KVSA 1EUCA 1P45A 4E31A 5KIAA 1Z75A 4OQZA 1A9YA 1O94A 4FIZA 3KEQA 2CFCA 2G82A 4N54A 5K9ZA 5CAEA 3T7CA 1E6EA 1D4FA 2VUTA 3WIDA 3DDNA 3SC4A 4IDDA 3TFOA 1DRWA 1A72A 3NT5A 4Z0PA 1GQYA 4FC7A 2DC1A 5B37A 4JP2A 5COAA 3V2HA 4ZD6A 5FEUA 2Y1DA 4J6FA 4YBZA 1SCUA 2PLAA 4TMFA 3DZGA 1K2WA 2VHYA 4B7UA 4E30A 3E9MA 3BTSA 3VH3A 1PGOA 3ZV6A 3I83A 1E3JA 2JFGA 3CINA 4LRTB 4NBVA 4DLBA 4NPCA 1HYHA 2QRLA 1Y1PA 3KEOA 1OC4A 1DB3A 1GZ3A 2AHRA 3NTOA 1AN9A 3L9XA 1EVYA 4I1IA 5I9NA 3ON5A 1BGVA 1UDBA 1JAXA 1XR3A 2X6TA 3GDGA 4QO8A 4QXMA 4XKJA 4HBGA 2YFQA 3S2IA 1XQ1A 3EVNA 1AXGA 3X2FA 2BGMA 3L4BC 4IXTA 1J6UA 4YQYA 3RU7A 4IQ8A 1HETA 5KJCA 4E5MA 4XYEA 5BSFA 4DXHA 4XYLA 1EVJA 4UVGA 5DCWA 5A9SA 1QLJA 1P1KA 2F00A 5KVVA 3F1LA 3SJ7A 4BNHA 2XF8A 3I4FA 3JYNA 4OSOA 2YHUA 1PWZA 2WM3A 1DFHA 3OMLA 4ZRNA 2Y1FA 3SC6A 2IE0A 4EEZA 3AU9A 4BKUA 5A5FA 3HN7A 1OI7A 3TWOA 2QZ9A 5AVOA 2UV8A 1JN0A 1UDAA 5ER9A 2OBYA 3ADOA 1PQWA 4IMRA 4A2CA 1GYQA 5HTOA 1R0SA 1T2CA 2EW8A 2JFFA 1Y9AA 1L1FA 4CMKA 1BW9B 2IZ0A 3D4NA 4Q3EA 5GMOA 1F14A 1BRMA 3PYMA 4XIYA 4GL4A 1MFPA 4WCFB 1IHYA 4CM8B 4FJ2A 2RH4A 1Z74A 2PH3A 2W98A 3MCVA 4X54A 3WMWA 2BFMA 1KY4A 4R41A 4BNFA 1J5PA 1YO6A 3ENKA 3GVXA 5H81A 2FPGA 4MKZA 4WJZA 3M1LA 3RC1A 5L9AA 1PS8A 3CEAA 4Y9DA 4MO2A 3PQEA 3FTPA 5U4QA 3MWEB 2D2IA 2W2KA 2WYWA 4MOWA 3JV7A 3WQSB 1IOLA 2NUAA 1I32A 4ND2A 1E77A 1QYVA 3MTJA 2GN8A 3NAQA 1PZEA 1LDGA 2FZWA 4CM3A 3P5SA 4Q39A 1ML3A 1PJLA 4B3HA 4UULA 2GLXA 1P74A 1Q7CA 1GYRA 3BTUA 4RQTA 1PJ3A 4G65A 1S7CA 1NP3A 3RBZA 2D4AA 2FR0A 1PJ2A 5TT0A 4ITUA 4GGOA 4RVHA 1M76A 4FCCA 3A4VA 4BNWA 4EI2A 1W73A 5KKCA 3U0BA 1TT7A 4CMCA 2RHCA 9LDBA 2OP0A 4O59O 3FWZA 4BNIA 4DBVO 1MXFA 3IS3A 1GFSA 3WYCA 4RZHA 5AXCA 5JBIA 1YRLA 5JW6A 4L74A 4JN6B 3WTCA 3KV3O 4FOSA 5K6AC 5IDQA 1C0LA 5KWEA 3VKUA 4MKXA 1DOHA 2TMDA 3RAJA 4BB5A 4M55A 1QRRA 3VDRA 3ROQA 5JO0A 2AXQA 1M66A 2WDZA 1HL3A 4TVBA 4CM1A 2YDYA 4PN3A 2BF7A 5A02A 3PHIA 4L4SA 4FC6A 3FPLA 2C2XA 2PKRA 3AFNA 4J3FA 4CR6A 4TQGA 5BNIA 3D4OA 3GG9A 3AOGA 1I3LA 3TZQA 1A4IA 5L4SA 2UDPA 1EUZA 3U9LA 3IJRA 4ZN6A 1E3WA 4I9UA 1NFFA 4U5QA 4IGFA 5COBA 2DVMA 3ABIA 3F6YA 4N5NA 1LA2A 3EZLA 2CVQA 3VVCA 4BMSA 4E2XA 3VVBA 3OEWA 4ZICA 4WPGA 3C7AA 4K6FA 4OO3A 3F3SA 3OQ1A 1NHGA 5JDIA 1F06A 2BGLA 4LGVA 5DCYA 5IN5A 3RWBA 3GRKA 2VCYA 4NHEA 3SJUA 3UVEA 4Z9YA 4I5EA 3TZHA 5KCZA 4GLLA 4CUKA 4D41A 1TVEA 2C2YA 2I9PA 4FD3A 1TLTA 3QSGA 4YJFB 1H93A 1X7GA 1MP0A 1JWBB 1O9BA 4MVJF 4DTIA 3UHAA 4DREA 2ZKLA 4GKVA 1HDXA 3GF4A 4CMGA 3EZYA 3JQCA 2RAFA 1Y8QB 3JYOA 4EBFA 5A9RA 1NBOA 1TT5B 4XQEA 4AJOA 4BS9A 1KVQA 1PGQA 2E6UX 1IB6A 1E7WA 3NRCA 3CMCO 1P1HA 4JXKA 5A1TA 3H9UA 1EBUA 3RUCA 3PFFA 1TI7A 5CDGA 4IMPA 5JY6A 1U3UA 2QYSA 1X14A 1KOLA 2Y1EA 5B4UA 2B4TO 4QFCA 4RF5A 1CEQA 3COSA 4G81A 4BNJA 1VL6A 3STHA 1VJTA 3LSYA 4E2ZA 1WDKA 2OBNA 2I6TA 4YQZA 3RUAA 3K31A 5G4KA 1DDOA 3D5TA 3I23A 4YDRA 5F5LA 5JXWA 4L9RA 4R01A 5T8KA 3KRTA 5KNLA 2J3HA 3GN1A 5CEJA 4CLOB 1WW8A 2AA3A 4YPOA 3ETDA 3KYCB 1KIFA 2AQHA 3RROA 3WJ7A 4E4YA 4IDFA 4OGWA 1LSJA 1SOWA 3NTRA 4NK5A 3CE6A 2DM6A 4Q3CA 4D3FA 2O7QA 3WLEA 2VT3A 4OMUA 2NU9A 3MJCA 5EINA 1NPTO 4NU5A 3H9EO 1H9BA 1N92A 3U62A 4HX5A 4NR0A 1JVSA 3TZCA 1LLCA 1ZJZA 3PDUA 3OA2A 1GEEA 4E5YA 1XYGA 4PG5A 1CIVA 2Q45A 3HDQA 2Y0EA 2X9NA 3ADPA 3S2EA 4WCDA 3H5AA 5DBFA 2UAGA 3AI2A 3ZV5A 1AUPA 5JPIA 2J8ZA 3ETGA 2H6EA 2ZYAA 3JQFC 4HNGA 3OJFA 4BQPA 4ND4A 4P8RA 3O8QA 2C5AA 4E33A 2PTGA 1ENYA 3IP1A 3IOYA 1QKIA 3HWRA 3LLVA 3ANNA 3LZ6A 4R68A 1L7DA 2GSDA 1NYTA 4RV9A 4TKLA 2UVDA 3NDIA 3DBHB 1WZIA 1P33A 4J4HA 4YJHB 1WVGA 4U8GA 4YEDA 5JE8A 4CR8A 1N1EA 1CETA 3ITKA 4BKOA 3LLSA 2DBVO 3ZNQA 4LISA 5JO9A 4WE3A 5EQFA 2DUWA 1RM0A 1V3VA 1I24A 2ZYGA 1P44A 5F3RA 1XCBA 4D3SA 5C7IO 1YH3A 2JKVA 4MIOA 3GZ4A 3HUDA 4Q9NA 4U6QA 2HSDA 3NJ8A 3AK4A 5CP8A 1OAAA 1VLLA 2GRAA 3E1KA 4EDFA 4PZEA 2X22A 1H5QA 2Q1SA 3IQDB 1UP4A 1YB4A 2Q4EA 2GF2A 4IS2A 1PGPA 5JY1A 3GMDA 4UEJA 5CPBA 3TZ6A 3U4CA 3ZN2A 1M6HA 2O3UA 8ADHA 5G4LA 3JYPA 3W4JA 1GCUA 3JSAA 3ENNA 3DO5A 3H7AA 1Q7GA 4DBZA 2WD8A 1PR3A 3DZHA 1C3VA 3EDMA 3E9NA 1PZHA 3Q2KA 4BNXA 1FDTA 1M75A 3GUYA 3UCEA 3MTGA 5JDCC 4DYVA 2HQ1A 1ADGA 2DBQA 3EC7A 1YDWA 4ALMA 4WUVA 4NJMB 1TXGA 2HO5A 2EGHA 4XA8A 3RD5A 3GOHA 2WE8A 4FGSA 4ID9A 3P2YA 4LCJA 4MVJP 4OSPA 2FR1A 4H15A 3ZHYA 3ZNNA 1GADO 1Y5RA 1MFZA 3KM0A 2FY8A 2BFOA 1SNYA 3RUHA 3DBLA 3JQBA 5CDSA 4ZGWA 1LDYA 5B1YA 4DWVA 3TF5A 2O3JA 1QV6A 1W4ZA 4L4XA 3HDHA 4O6VA 3PJEA 2IZ1A 3RFVA 4PLZA 5BNTA 5HM8A 3TZKA 2WD7A 1LLQA 2IRWA 2QRJA 2VRBA 3JQ9C 2V6MA 3DONA 4J0EA 3GR6A 3VH4A 3HNPA 4ZQBA 3OEYA 3GQVA 3OSUA 3ZU2A 2J3JA 4R16A 4KDEA 2QX7A 1B2LA 2B37A 1WDLA 3IAHA 3AOEA 2VT2A 2Y68A 2GUGA 1W6UA 1GCOA 2NU7A 3P7MA 5CG1A 5A04A 3B1FA 3E5MA 4KZPA 3RUFA 4E5KA 1V6AA 1K89A 3FWNA 2BD0A 3UKOA 3VZRA 1QLHA 1BXGA 3D0OA 2QYTA 3AM3A 3I9JA 2H5LA 5KKAA 2NVUA 1LU9A 4PLTA 1EK6A 1IZ0A 2J6IA 1I3MA 3A9WA 2VHWA 5JCJD 1D1SA 1T2AA 2NQTA 1EVZA 1NPDA 5BSEA 2FSVA 3N58A 3LU1A 4ZQGA 3GFGA 5L7TA 4HKTA 1V35A 1EFLA 5KOIA 4Z0TA 2D5AA 2PY6A 1Q0LA 2RHRA 2YFHA 3BMCB 3GZNA 4IGEA 4IIVA 1IULA 3PRJA 3FF4A 1P1JA 3O4RA 4ALIA 4CM6A 1R4NA 2VWHA 2HMSA 3O26A 4GSLA 4PLWA 1X0XA 1XKQA 1ORRA 3DHEA 2E37A 1XU7A 3VTZA 1LSUA 4J4TA 4A73A 4KWHA 4BGIA 1FJHA 1C1DA 1U2GA 2ZTLA 1ZJYA 3IL2A 3GY0A 1MX3A 4BMNA 5DN9A 1XU9A 5LC1A 4CMAA 4BNTA 3C24A 2G76A 3BAZA 2OUIA 1IPFA 3HHPA 4W82A 3WG9A 5I7SA 4J0FA 2PWZA 4AJ2A 5TGDA 3UF0A 1XQ6A 1U8XX 2FP4A 1N1GA 4WLFA 4RJTA 3A28A 3VPXA 2IYOA 3VZSA 1UAGA 5ILGA 2OGUA 1BVRA 3F46A 4RGBA 3H2SA 2B69A 1SO8A 1BMDA 2Q46A 3GDOA 3Q3CA 4DC1A 2P68A 1MC5A 2Q2WA 1JDJA 4JCOA 4J2HA 3LF1A 1NTOA 4TRRA 3OQ6A 2C20A 2D0IA 4IBOA 1YL6A 2VN8A 2ZTMA 4GBJA 5IDXA 4E32A 2ZB7A 2B4QA 3KYBA 3HB4X
chains in the Genus database with same CATH superfamily
1QC5A 3GD7A 3EXAA 4UAVA 4OKNA 4GYYA 2H8GA 4WZAE 3FTFA 2Q2VA 1V8ZA 1QU3A 1D9XA 3NHKA 2AG6A 3CF2A 4ZQIA 2C31A 3VH2A 3KQNA 3Q3IA 1SVKA 2HDHA 1NVMB 2OBXA 4P08A 3S2GA 3PC2A 1KC3A 5HFAA 1FSSA 4JZYA 3V8BA 5HM6A 2ERXA 5H4GA 2A7XA 4UPDA 5ULLA 4D9NA 5JDIC 2F3QA 4IR7A 2EIHA 4XX0B 2F3PA 1CB0A 1QORA 1LPPA 3AEKB 3E81A 3A2MA 3CISA 2IDZA 1TD9A 1QTIA 4KQFA 3M6MD 4DMCA 4EHHA 9LDTA 5CYGA 4N18A 4CDMA 5J9FA 1VL0A 2G5CA 3DGFC 4X71A 4XIGS 5TQJA 2GTPA 1NW6A 2AFIB 2ZJ5A 3P9ZA 3WE7A 2JI9A 4CM9A 4BFVA 4UJ3A 5TR9A 1MORA 1TK9A 1TQ2A 1NQAO 2XOXA 3EIUA 4DCVA 1ZW1A 1XA3A 5KNBD 4LY9A 3AIIA 4Z49A 1EA7A 2J3LA 3LPMA 3W1VA 3AVWA 1XQVA 3A6JA 3GHYA 1C7IA 2A5JA 2AYYA 5FYQA 5J63A 1V5IA 2IW1A 2PZBA 4ANFA 4F84A 3V2UA 3DPIA 3GLGB 1JXMA 1UC4B 1XLVA 1MTOA 1R00A 2BC9A 3I34X 4IRMA 2FEXA 4G5YA 3WQRA 5ERXA 1LC3A 4DA6A 4M60A 1GZUA 1E5DA 3EWAA 3PE4A 5GADl 4D0NA 1ULZA 3DVRX 2EDAA 4TOIA 5HIJA 2JCSA 1ICEA 3EY4A 1D7OA 3OU2A 2WICA 5JMTA 3HCBA 1GPH1 5EHNA 3ZW9A 4ALNA 4J1SA 2PMBA 4G9GA 1EHCA 4CL3A 3AEZA 5T8KC 4P0PB 2EZTA 2QZZA 3H5TA 2BMJA 3EYAA 1CNEA 2YJ6A 4B6RA 4LQ4A 2CLKB 3R3JA 5JBNA 3M6XA 3NUZA 2CCKA 4BQRA 4F3CA 4G25A 4M7RA 5K7SA 2OPBA 4E6PA 1CUJA 1TM7E 4NBTA 4BIIA 4MUAA 4RD2A 4ZANA 4CM4B 1I80A 1W36D 2J6CA 1TYDE 2W8BA 3S99A 4B3RB 1AUVA 4LW8A 1H0RA 2HJ9A 2KSQA 3GEEA 4M98A 4JJEA 1NY6A 5FULA 1Z4LA 3UUFA 5LQUA 1VE9A 2WYIA 4W9NA 1K5DA 2WY2D 1O0SA 1VPEA 2R8PA 1H6DA 1OQAA 2VJPA 2YUTA 3PVCA 4PC7A 5GVSA 1A2BA 4G0NA 3UJ7A 4O33A 4WAUA 1U1GA 3UGKA 5CR9A 3M89A 1WZNA 2L0XA 3CZPA 2V59A 1E6LA 1YJQA 2GD1O 2H2FA 1GAJA 3A9SA 4GLJA 5GONA 1DPFA 4DRXA 5CDHA 3HJUA 2Q3MA 4KQEA 2P5UA 4H4EA 5GV8A 4NMWA 2UZ4A 2WPDA 2ZBVA 3HLYA 5JSUA 2JL1A 3UWDA 2OCLA 4R7GA 2VRCD 1CY4A 1MEOA 4GOKA 3E03A 2Y92A 5IVDA 3UAZA 4RDXA 2J41A 2O2IA 1P91A 2ZUVA 2VNHA 2GZ2A 1J2EA 1TA4A 3RKRA 4F92B 4GZMA 3T35A 1P3JA 3X1MA 1J1ZA 4NMMA 2YHIB 5EE9A 4DYDA 3WWZA 4KVZA 4QYTA 4A0SA 1EAMA 4CE6A 4YRIA 4YRZA 5I7FA 2OAP1 1L9KA 1G64A 1KBZA 2AG5A 3GUUA 1IN1A 1JJVA 5E1MA 3GLHA 2ZSUA 4Y2HA 4YUYA 2P9YA 1UC5B 1OVMA 3HTXA 3UUEA 1KEKA 1CW2B 2FOXA 5IPFA 3N8HA 3ZWMA 3USZA 2W2TA 2QRUA 1ZCBA 3A10A 3OM1A 3G7SA 3QEKA 2QTAA 4P86A 1LXCA 3GQBA 3NIFB 3T3EA 3WB0A 5GJBA 5IX8A 1M1YB 3TQQA 1INLA 1HYGA 2KX7A 2OY0A 2BRUC 4U9UA 5AI4A 4ZAWA 2C7GA 4EAAA 4OHKA 1LV7A 1W1UA 1I7QB 4P81A 3RWOA 3B13B 1QO0D 4IWNA 3RSSA 1VIMA 1CRPA 1T2VA 1XZ8A 1QUFA 1E3LA 2BI4A 3OEHA 1XCGB 5IMBA 5U1PA 4MWOA 3PEEA 5HX7A 2W0MA 3BWMA 3R5FA 2FFHA 4ZREA 5TSDA 1OX6A 4W7SA 4BJHB 4JSRA 1IUKA 3UT5B 4QBFA 1GQQA 1MUUA 3IBYA 1OT5A 5E4JA 1TMGE 4Q1EA 2NU8A 2PU7A 1IK4A 2NWQA 1H1LB 2ZRGA 3LMKA 2WWVD 1I3KA 3L8DA 3SZMA 3R5JA 5JRZA 2R5WA 2FPPB 2IYNA 2GAIA 2AJBA 5ALKA 4BJ1A 1EDOA 2N3ZA 1Y1LA 3AB7A 3P52A 1QAOA 1VDZA 3OZTA 4LDZA 1YTLA 4DA8A 1C1XB 2A0WA 2J67A 1GZ4A 1IBCA 1T4GA 2YQ5A 1UXHA 3D5QA 1XCJA 2YWGA 3JQQA 1DBPA 3LBYA 3MBOA 4FS8A 4HEA1 4HAOA 1QIMA 4TSFA 5FXMA 1RE0A 4LXGA 2PSDA 1ZN2A 4V1CB 5HGXA 4GS5A 1KZ4A 3Q1LA 2GKGA 4K6KA 2AR9A 1YWGO 1NZJA 1YT5A 2R79A 4PIVA 3SLRA 4G1VA 5EKSA 4Z4EA 1U3WA 3KVRA 3D9QX 1BOOA 4PG4A 3NTLA 4MIKA 4BFWA 4E11A 2GHQA 4F11A 5TV2A 4RXTA 5B36A 3IBCA 2B36A 2AB0A 4QPPA 2XQGA 3MMSA 3WHLA 4B3GA 3C16C 1MBZA 2VXBA 4JUBA 1O89A 4QBIA 2ABWA 4H27A 4Z8YA 4B83A 4ZO6A 2VYND 4N82A 2NT3A 2OB2A 5INTA 4DQVA 5JVDA 4DR2B 3U3OA 1ISFA 1KDPA 1Q0ZA 4AG5A 5KUTA 1X1QA 3SQXA 4C30A 2A4MA 3EVGA 4KRFA 4TMTA 4Q4LA 2OCDA 1SA0A 3AVTA 3UMCA 1VTKA 1POWA 1EWYA 3ZX4A 1ISRA 3D8SA 5A5EA 1T8PA 3KALA 5LR6A 1GSAA 4ZU6X 1GP2A 1U7XA 2UKDA 3A31A 3DGEC 5CIWA 2OZPA 5E3JA 4S3MA 3SHFA 1OB5A 2QTHA 3IDZA 1D07A 4OMCA 4JP3A 2ATXA 2Q50A 3BXEA 3M70A 1IZ7A 1E79A 2EW1A 2BJVA 4FUQA 1NXWA 2CBGA 3V3TA 2D2XA 5D00A 3KUXA 4WLOA 2NV6A 5CFQA 5DLYA 3KOOA 4Z1OA 2QDXA 5HP4A 1OFGA 4ZI3A 1TAHA 3M1YA 1Y82A 4XCQA 3R8FA 2QS9A 3T9EA 3HNOA 2A5GA 2J07A 1ZLXA 5ALYA 4CW7A 4E21A 2C7OA 4BP9A 1Y81A 2JBHA 2GN9A 3FHLA 1G8AA 1V8DA 4TV8A 1L6RA 3FUCA 3HCDA 3LYLA 1FRFS 1WF6A 1Z73A 2QB5A 4H1TA 4NV0A 2NOAA 4WXYB 4WY8A 5FFMA 4RA6A 4Q9IA 4ALJA 5BN5A 1LW6E 4C7MA 4H17A 4O2BB 1W76A 5B4TA 3L18A 3MN1A 3L0BA 4UVDA 2FV8A 3D4IA 5LUBA 3T61A 2NAPA 4YCBA 4DQKA 4GDMA 3B7PA 2BFEB 1P2DA 2P62A 4IM7A 4Q7KA 5JRJA 4CODB 4TKMA 4C4XA 4AY5A 4DIBA 3I9FA 3LT4A 4BV8A 4U2KA 4D4LA 2F8SA 4K2HA 1T0HB 2RI0A 4XD2A 1YAHA 3CPEA 5I4IA 5MFPA 2JLVA 3FKSD 2ZUSA 1PFYA 1TKAA 3MUNA 5AJZA 1GU1A 1G19A 4BO9A 3N3BC 2RBEA 4BVLA 2NUTA 4TROA 3G7NA 3RLFA 4GLFA 2XTZA 2N1MA 3KUCA 4M9SA 1XTJA 3DLCA 3MWJA 1LVUA 2ZR0A 5DCUA 5DPMA 4XWKA 1ID8A 4DA0A 4R9RA 5TPWA 5L45A 1XMVA 5CW2A 5C1BA 3A14A 1ECLA 2AX3A 6CHYA 4AM8A 1JR3E 2O7VA 1HEIA 3NANA 4AJPA 2V3WA 1JLKA 4HX2A 2JD1A 2QVBA 4EJ0A 2JFYA 1F8FA 3QG1A 3NDPA 4NQZA 3K30A 1JQKA 3QE3A 3CRQA 3JZDA 3BMQA 4ZYWA 1G6OA 1ODKA 3ZCRA 2TMYA 5JI3E 1CEXA 3CJRA 5CEFA 3DAYA 3W4KA 1PL6A 3V4VB 1GUFA 4LA4A 4A5SA 2J0UA 1Z2CA 4D82A 5SY4A 3NWBA 4XJSA 4KX5A 2ACWA 1VGQA 1USWA 4A1OA 1YQTA 3WNBA 3L8CA 1EG2A 3FY4A 3HM2A 1CVIA 1RPAA 4DCPA 1K6JA 1OI4A 2QM3A 5EE3A 1Z5PA 3FOWA 2OENG 3HU3A 4ZU3A 2EGUA 4QFDA 3QLVA 5ECYA 4DLAA 1Q91A 1WQ4A 4HVTA 3KB8A 4NG4A 4DRZA 5B12A 5IABA 1RZRA 2XCSB 4K3UA 4JBWA 2GJ8A 2ET6A 2P2GA 1BU8A 1E4EB 2OO5A 1MPXA 2F1HA 3KEMA 1TFRA 4MQLA 2AE2A 2JJYA 4Q9AA 1BH2A 1QQ5A 3LECA 1AKYA 1LDMA 4M1QA 3M2TA 1ID1A 4I8IA 4GOMD 2O5RA 4E2WA 4QARA 1IHUA 4XR4A 1P9WA 3QKUA 3WGYA 4MRMA 4RLSA 4C0HA 3LOQA 3W2TA 4C07A 1OV4A 2AJLI 2YJ4A 4DLPA 4KC0A 4F46A 4DVJA 4QM7A 2L82A 1OYWA 3GJTA 5FRDA 2JIMA 4F8JA 1M3SA 5FWYB 4BVHA 1YGYA 3RYIB 4AROA 3AONB 3BD8A 4XAQA 3PFHA 2WYHA 4KQWA 4DS3A 4C0LA 4EGCB 5FL7D 2IEIA 1AMOA 1JYEA 1KP9A 1Z82A 1Q77A 3A06A 4R84A 3M6WA 1C4XA 3K6KA 3ODPA 3T0FA 3GDWA 3VDQA 2QRKA 1APBA 4EJSB 2ZM5A 1CQJB 2IHTA 3WLSA 3P5BA 4CU2A 3EJWA 4FFMA 1QNLA 5E2AA 3W2IA 2OQVA 2BR5A 4A8HA 3T5CA 3LCJA 4D45A 3IOMA 5IJ0B 4L27A 3VH1A 4G41A 1RZ3A 4OGLA 4AUNA 5TE9A 1C8BA 2O0LA 1GPKA 3TD9A 4C4AA 5P21A 3MCZA 5A6VA 5JH7B 2PRKA 2VS1A 4LYYA 2W0SA 3PXXA 5GZ3A 3D5EA 4LJ8A 4OA5A 5BY2A 4HNHA 4M1EA 3U60B 3L0CA 2BP7A 3UOGA 1SBYA 3R3HA 2ACKA 3FCXA 4HQRA 3COVA 4O4HB 5LYYA 1NBME 3GX1A 3L8YA 2QP9X 2EP8A 4YACA 2WTXA 1VZ2A 3K2BA 2V9PA 1ZUNB 1K6IA 4L8VA 5CXSA 4ESOA 1CLEA 1W9HA 2RAVA 3T5BA 3O8RA 4GP7A 2WOJA 1L4FA 3ZU5A 2KQUA 3FRIA 4V0KA 2CFSA 2PV0A 3DL4A 3IKJA 3TKYA 1K7SN 1P1RA 1QKJA 3DMDA 4P92A 4FHFA 4FCWA 3I0MA 4OUDA 4CLXA 4ZQEA 5I7WA 3FYCA 4C43A 3U7RA 4MS1B 1HT1E 3P2MA 1PAUA 3QVXA 4FUTA 1DT3A 5YASA 1LC0A 3PQCA 2VT7A 5F9MA 5DGHA 4WNYA 4I5FA 2DUMA 4DN6A 4K3VA 5ALWA 5J2TF 1GQ2A 1H0KA 1WMDA 1SHZA 1MG0A 2I4LA 3C85A 1JZSA 1WUJS 2BKEA 2QLJA 3BWVA 4J16A 1W25A 5HF5A 3WMGA 4NCAA 3QVMA 2VH5R 3H11B 4QU0A 1OFUA 1A1SA 2W48A 3O0DA 5EIBD 1BX0A 2C03A 1F6DA 1Z4KA 3ETHA 3GELA 5F21A 3ZWKA 4DJEC 2NAFA 2EATA 3BORA 3DOCA 5F3WB 1AJEA 3JATB 4M1ZA 3TM4A 1YMUA 2OHFA 2C77A 1SQGA 1BOFA 1L4GA 3QF7A 4DSTA 2P9JA 3THXA 1Z2DA 4FKMA 4BN4A 4EGAA 2PXCA 1E96A 3ZY2A 1NVBA 2BHSA 3IDQA 2CVZA 4JBIA 3MINA 3RARA 5BQXA 1DKNA 4B33A 4HDRA 2UYYA 1CQWA 3ABZA 3JZFA 2Q5FA 3ND9A 2DPGA 4WKCA 5LD2B 3HCCA 1JH9A 2RH8A 1V9CA 1EJ6A 4D56A 3RQSA 2C00A 2OBLA 1AO0A 3PHJA 7GPBA 3IHLA 1Y8RB 2ECKA 4RVNA 4ZVTA 2Z56A 2Z3WA 1V3QE 3JQRA 2WJ3A 2VEOA 2YWBA 4RHTA 4X20B 5K3EA 2CNLA 3TO5A 3I53A 4I1YA 1L7VC 4KLNA 4KFSA 3IUEA 2CK3A 4GAEA 1UXIA 4Q34A 1AC5A 2WMDA 2XE6A 3DP9A 2FHSA 2AFHB 3IAXA 3OFNA 4MS3B 1D4ZA 1IAVA 2GZMA 2J3MA 4EYKA 1GG2A 5KQGA 1L7QA 1R8SA 2QT1A 5AM4A 2A9KA 1CJSA 1NQ5A 3E1GA 2Q1WA 4KXLA 5FCDA 4E08A 1MO6A 4QHYA 1ZNXA 1BNCA 3NP9A 1RE1A 2QTGA 4M0DA 3L77A 5HUJA 2VZ8A 5CIYA 4R8RA 1I6WA 1K66A 1S0UA 4O2AA 2B1JA 4RZXA 2C1EA 4QX6A 4S1OA 1YSCA 3FNFA 3WGGA 2HN9A 1P2BA 2Y9PB 4KO2S 5B55A 4MP6A 4AKGA 2LKDA 3E84A 3OKFA 4EGJA 3B53X 1JR3D 3NYQA 4N48A 1NMYA 3EN0A 4KH0A 2QLBA 3AYZB 4ZJYA 1A9ZA 1I3CA 1EZ1A 3AM1A 3ANXA 4PPGA 4BL5A 1P6UA 4IIJF 3UXHA 4J91A 3ZE9A 3S27A 3Q6IA 1CQIB 4YP5A 2CUKA 4M1WA 5DGXA 1L5LA 5L53A 4C5BA 1T2FA 3INRA 3QE4A 3D3KA 1B43A 1RWVA 1L1QA 1E32A 1MJHA 1YU9A 1ZOSA 2NTEA 2XI4A 3G5UA 3ISVA 4B81A 3I2IA 1S3GA 5FPSA 4EZEA 3R7DA 1FDOA 3F8SA 1IJFA 3HUUA 1UPUA 2WG1A 3F4LA 2IXDA 3TTUA 1MJFA 1VRWA 2B99A 2BLLA 2VWPA 3ICPA 3ZDRA 1GKIA 3L06A 4MIYA 2QGZA 3GEHA 3SQDA 4YAFA 1MG5A 1PR9A 1CUIA 1O6ZA 1T9BA 2AJCA 2P1RA 3GRAA 3NBQA 4F4CA 1XKTA 4EFKA 3E27A 3IP5A 4HN4B 2HQRA 4YASA 4XX0A 3ZGVA 2ECQA 3NHMA 1Y7IA 2VSFA 2D59A 3I0NA 3AEKA 3JQGA 2X2FA 3QLUA 3P9IA 4PQEA 4N12A 2LCQA 4ARBA 4DMMA 5CDTA 5F35A 1FXUA 2OHHA 5IT9A 5D3ZA 1QHIA 2Q5LA 5DMXA 2PYDA 3ZY3A 3DAGA 2CDBA 3LA6A 2AFIA 3PNLA 4Y9TA 3JWGA 2NXNA 4CT4B 2X0NA 4ZHSA 5JNSA 1FMFA 4IV0A 1BQEA 4P3XA 1BGXT 4GMDA 2E6KA 2YV5A 3ZU6A 2FVXA 3MSXA 3FXAA 2PWAA 1UWVA 4K9DA 4ZK2A 4BN5A 4J7CA 3NUGA 3H8JA 2FX3A 5HOQA 2J6HA 3GLGA 3UO8B 2TRSB 4W1SA 4U7HA 1MC8A 1GQOA 5KDDA 2WB2A 1N6OA 1EKXA 5EI5A 2D7DA 4DANA 2P4SA 5KOYA 1I2MA 1ENPA 5FPHA 2WFZA 3MUOA 1YULA 5HEKA 5K8JB 1VB5A 3TECE 1NVUQ 1Z5ZA 2RI1A 1XRRA 3CNQS 3E0XA 4IHJB 5C7OO 2IH4A 3R3WA 3W5JA 2NZXA 3ZQ6A 4CV1A 4N0MA 1TYCA 5NLLA 1O97D 3UWMA 2RHMA 1JBEA 5JWRA 1HR0B 5IM4F 3DEKA 1RMQA 2XVZA 3QPBA 1XRLA 3UFXB 1BFUA 1QQ6A 2A14A 1C8LA 2CWWA 4HYEA 2EBFX 4DZTA 5L51A 5D85A 3UOWA 4RAQA 2XRYA 4X60A 1C9YA 1R12A 4Y0AA 5BVGB 3EIFA 4H60A 4N65A 5CPFA 1YIOA 4HB2A 3BEDA 2CMFA 4WNCA 3UAWA 3RIYA 3ZX5A 4CM4A 5FOVA 3GGGA 3CN9A 2R9VA 1E3SA 2I6FA 2QVYX 1PGNA 5K2OA 1OVGA 3Q6NA 3QH4A 1MDFA 2ATVA 1GL9B 2VYVA 4JBLA 4F8EA 2ZVQX 1V47A 3RAEC 4AXXA 4QQRA 5FLEX 2LBPA 4UHJA 2NO6A 3CVVA 1VOTA 3MGGA 4QEZA 2GF9A 2AN1A 1UAAA 2YZ7A 1NZFA 3FPKA 3WLJA 4N9QA 2O2ZA 3AH8A 3RIHA 4UXHA 1GSOA 4Y9UA 2OD2A 2P8SA 1JHOA 4W7IA 1PSDA 4KK3A 1PK9A 5EIOA 3VHQA 3VAYA 2QV7A 1U8EA 5K05A 4RK4A 1JYSA 2QX9A 3OLZA 3H0KA 5FWDA 1OYYA 1F51E 2COUA 1QHEA 3GT0A 2A9QA 3HFGA 2VKQA 3Q40A 4HZGA 4QE3A 4QD3A 1RWWA 1X7DA 5EP4A 7ABPA 3BB4A 4KDFA 4TLDA 1EBFA 1M83A 4HDAA 3VI4B 1C4OA 2A58A 8MHTA 3ZGYA 1U3TA 4V0MA 1QHSA 1E0DA 2EU8A 4COOA 4N6GA 3LNCA 3PJFA 3LBFA 3O8NA 2OCIA 1JSZA 2XAUA 1IPEA 4FOTA 4JSYA 1M2HA 1P77A 3LT5A 2GYWA 2YHIA 3RRNA 3HEMA 3ZDFA 2FE4A 4X3PA 1VHQA 1MH9A 1WHTB 5FL3A 1FL9A 2J5KA 3NG1A 4HWTA 3F9RA 1DHTA 1VB3A 4B3CA 4AY3A 3GP3A 3LC2O 1ANKA 1ZWLA 3CRNA 2JGRA 3CLVA 3M49A 3VPGA 4BRSA 1X15A 2NTNA 1ZYUA 3CA8A 4QT0A 4N0DA 1IN7A 1BX1A 3FMPB 1XJ5A 3RTCA 1CG6A 1H2XA 4DDVA 5KWJA 5EP3A 4OLJA 1PFQA 4JB3A 4EZBA 1KRHA 3VUFA 4C2TA 4POAA 5EQTA 2D4HA 4PWYA 3R3SA 3G2NA 3OQPA 3KXDA 2HMUA 4FEGA 4I3GA 4UNQA 5A4AA 4GW3A 5JXJA 1M7HA 1DV1A 1IN4A 3R5TA 4O8ZA 1VJ0A 1BJTA 1U7DA 2MDTA 2QHXA 3A9VA 4FFPA 1M7GA 4IZ6A 2NV0A 1NN3A 1VJRA 4UBJA 1GG9A 1FRVA 2IEDA 1KBQA 2HRZA 2C4VA 2DHRA 5E95A 3ZI0A 2UYQA 4QO7A 2QTFA 3EFOB 1LBHA 1QXSA 4X7MA 2WHQA 2XYHA 3E2IA 3WHPA 4Y18A 4MGEA 2ODAA 5ALLA 1XWWA 1QO7A 4ONEA 1H1LA 5GZ1A 4F1JA 1ACLA 3HJAA 3QQPA 2VJBA 3N3AC 1U3GA 1IBRA 3ZWDA 2FPPA 2ZZNA 1QOZA 2FA9A 3V1UA 1HA3A 3HWWA 3HB9A 5KOJB 2MR5A 1Z8FA 1JDBB 2IEAA 2V1XA 3QMVA 4HDKB 1IOWA 1C1XA 3WXBA 1FUKA 1ZWKA 1KK0A 2VDUE 3QW4B 2H4YA 2WU0A 2FYTA 1SCJA 2YXNA 3CU5A 5HIMA 4Q66C 1KTVA 1J7KA 3P0RA 4EUSA 4U3JA 1GY8A 4QECA 2GF0A 3GLQA 1K88A 1TEVA 4EY5A 4EVRA 4V1CA 2P9CA 5C35A 4MV6A 4YRGA 2V6BA 4X95A 5C0OE 1EBBA 4A26A 1ZGGA 3AESB 3NM6B 4YRQA 3JYLA 4L8GA 1QP0A 4Q9KA 4WNAB 4TSRA 1JEYA 3GEDA 1D6SA 3AZOA 3BE8A 3BXHA 3BSYA 2UZ3A 2A1TR 1MX9A 2Q2QA 3NS7A 5ERYA 2Y1KA 3EUWA 4Q93A 3F3MA 4HQNA 3AF2A 1A5ZA 4JUAA 3GAZA 4JC0A 4O3FA 3PUKA 2X2OA 4FLEA 2V5VA 3G7UA 2XKBA 4MWSA 2HR1A 2FPWA 3GV0A 3S55A 1A5TA 1VIAA 3UTCA 4WX2B 3FR7A 4DOMA 2DUUA 5JI2E 4F72A 1HZJA 2X5OA 3MOIA 2PBZA 1N2ZA 3GMSA 2X5NA 2CFOA 4MS4B 4YDSA 2OHXA 2CYAA 2J5QA 4GUAA 1JDUA 1RTTA 3OH8A 5F52A 5C1DA 2FN8A 5F77A 2H08A 5DTJA 2D8AA 1LSOA 1E4VA 1V8BA 2XDWA 1E63A 2I54A 2VJLA 4YT4A 4BJ6A 2VZLA 4YRTA 3GYBA 3Q15C 1QU2A 1TUBB 1JJIA 1O95A 1WY5A 2LRHA 4GZLA 1II9A 1RCUA 2QE7A 2ZVJA 3D3WB 4OYRA 2D62A 1PUIA 3OWXA 5CK4A 4EA9A 3QVOA 4CTOA 1FNSA 1SZCA 2PX6A 3QLJA 1NLUA 1Q1NA 1O5OA 3NC1C 5JXGA 4CUJA 5KHOC 5EXDA 2BMEA 1JIVA 4JJ7A 3M6AA 3ZGOA 3OJEA 2YXDA 2CKDA 3CW9A 3F4KA 3Q41A 4GMKA 3GFPA 5DT9A 1R0ZA 3W77A 1PR6A 4B6SA 1N6PA 2J9FB 1W0CA 1GZ5A 1PR5A 3H65A 4HH4A 4G07A 4LECA 4C21A 1YB1A 2GJAA 1HWYA 3FAZA 5IAOA 1WM1A 5CXQA 4O2BA 3BRQA 1FRNA 1U0OC 2BM0A 1EGAA 3E5NA 4HMPA 5CVVA 5SYNA 2GPNA 4D80A 1W36B 4JI8B 3UENA 2I55A 4JCCA 3MUFA 4M0PA 2BFEA 4QYIB 4YPVA 1IATA 1KI3A 2FSHA 4UE3S 4EFLA 3S2UA 1HDYA 2PA3A 4N9WA 3WXMA 4DLKA 3OQNA 1LX6A 4WZBE 1YA8A 2IITA 3WYBA 1Z8DA 2QRQA 3ZIAD 3N70A 3SVZA 3CRRA 2DQKA 4FYMA 1FFCA 5FF9A 2D5CA 4M7WA 3TSCA 4OM8A 3B1XA 2DFVA 2XBLA 4KWIA 4JOQA 4C7OB 4PVDA 1IL0A 2P4HX 4EI9A 3HNRA 4KRYA 4IX1A 4YAIA 4C4RA 2GQ0A 2LDBA 2GYYA 2AVDA 3CX8A 4ZEMA 4ETWA 2JJ1A 2RD2A 1QV9A 3MZ0A 3ER6A 3BL8A 4HLUA 1CUDA 4J7XA 2DHEA 5B53A 4CCYA 1NAHA 2HAEA 4WH0A 2E1RA 2HBQA 4IHQA 4UU0A 2Z2IA 3KQQA 3LQKA 1U8TA 5BMOA 3L7CA 1WBJB 5G1PA 4A03A 1O6CA 1XZMA 2OYRA 4BCCA 5TIIA 1NXPA 2FPIB 4F3YA 4A0FA 3E18A 3OPMA 5CYFA 2X0EA 1PJZA 1F8YA 4IQ0A 5F7OA 1BVHA 5EFZA 3SG0A 5C2JB 3PWSA 2CF6A 4LHYA 1GV0A 1K3UB 2WF8A 4RORA 4B71A 5BW4A 3Q8KA 4DDMA 3TOXA 2QM0A 4E7PA 1FLVA 2B7LA 1VFNA 4QSHA 1SULA 2JKYA 3R0VA 5CH8A 1QQ7A 4DF3A 1DXOA 1ZM3A 4CF7A 5M04A 2PUBA 1SC4A 4IINA 2CB9A 4AY6A 1FNBA 4KQ2A 2R86A 2G0AA 1ZD5A 3L41A 4DYHA 3JR7A 3P9SA 4GPIB 1PDVA 2FPMA 2P3LA 2VPTA 3AJAA 4BFLA 3U44B 4G26A 4ABTA 1I9CA 4BATA 4QGHA 1R4AA 5GQSA 4D9BA 1IXYA 1Q84A 4HWSA 5JALA 3DP7A 3MMPA 4ENUA 4JXXA 3VOTA 2GHIA 2ZUUA 1CULC 3KPJA 2BFNA 4P31A 1HT3A 3OTQA 1V4BA 2JJ2D 3AVOA 3QTBA 4MK4A 1GRVA 4O5OA 1BDMA 5IAEA 3WMEA 2X8AA 2FJPA 4ND8B 1MB4A 2Q4BA 1BMFD 1UKEA 4ZEXA 4F2HA 2GHTA 1E4EA 1GN9A 1RABA 2X1VA 3MK31 2Q5EA 1QTQA 4AO7A 1SBZA 3JQ9A 3RHTA 2C0PA 2RGNC 3QKTA 1NOIA 4GQIA 2MJLA 2G1KA 4Z6KA 3I73A 4TXNA 1P17A 3BC1A 3QIVA 1B8VA 5KAPA 1BJRE 2FJ0A 2Y3IA 3I3OA 1BRTA 4B3IA 3KETA 5KTSA 2ZJBA 2TYSB 1JIJA 1Z34A 5FWYA 1RD4A 1XHFA 1GA1A 3IBFA 1K3TA 3PUYA 4MWZA 3RYIA 2PUGA 3LPCA 2IXBA 3FDFA 4H6VA 4YRFA 1N9GB 4PSCA 5ALDA 1MOQA 5I7RA 2G9ZA 3O3OB 4CG3A 4OH1A 2FW7A 4ZZ1A 3GEPA 5L40A 3CZ9A 3QVSA 1S3SA 2DQ4A 2D06A 4PAMA 3V34A 4B4VA 3QY9A 4G2NA 4EJSA 1CQJA 3H2ZA 5LNK1 2YWRA 3OPNA 3LG2A 4NCKA 3KK0A 3NRJA 5JC8A 2H2WA 2JVJA 2NP7A 4Y2PA 5ES3A 2Q6TA 1KAMA 4KEAA 2HK8A 3AI1A 5FYDA 4Q3BA 2TECE 5IJ0A 2E4ZA 4G5OA 3ABQB 4TSKA 1X87A 1O7JA 4FGUA 4Y8VA 3OJWA 1OA0A 1T3GA 2PLWA 2WYOA 5JH7A 3NDRA 4CBVA 1E58A 4IIXA 1PQ4A 1YDEA 2JCGA 2QQEA 3MPOA 3FTCA 4UTXA 4X85A 1UKAA 2H1CA 5EQDA 3LUAA 4CM7A 4D3DA 3FMVA 2GMWA 3LDFA 5DHTA 2Q0XA 4HEA6 2C8JA 4O4HA 3FNQA 1ZG3A 1I2AA 2WIGA 4GYWA 3BZWA 2QZSA 1ZUNA 2CDRA 5IZCA 4BKRA 3LY7A 3ZIDA 2ISSD 5C4GB 4R98A 4AS3A 4PINA 1C7EA 5GZ6A 1ISHA 3ZGLA 1R0YA 4KR6A 3V7WA 1M6NA 1EWRA 3C14C 2C3YA 3K4HA 4OOFA 1U2GC 1RAGA 3G02A 5IBCA 2Q3DA 1IWPB 4K28A 1W4AA 1EB8A 1K7XB 3ZZ0A 1YL7A 2C3UA 2VBIA 3M4XA 2A86A 1CJMA 1KK2A 1LY1A 4MYCA 5TMPA 4J1NA 4MS1A 4R2MA 3ROPA 4TUYA 2HEIA 1E1LA 1FPMA 3K16A 3RVQA 1U0FA 3OCXA 5B3JC 5CBPB 3H99A 4D02A 4UQLA 1YDGA 2PXXA 4LOIA 3CY6A 2XA2A 3LRXA 4FS3A 2HSZA 4HVCA 1T1RA 2GT1A 5KYVA 3J7AC 4MDHA 1KEPA 1KVUA 3H11A 2FWIA 1K5PA 3DFMA 3DVSX 3DMTA 3OPQA 2VZ0A 3DPUA 3K5IA 4RK5A 1ZVVA 1E2DA 4MI6A 5TDHA 3SZRA 3NHRA 1M74A 2JAXA 4KQKA 3VPFA 5F2EA 3LDGA 3LI2A 1PI3A 3JATA 1IXRC 4F21A 1ZUIA 1IIRA 2PMKA 5EJ9A 4JS0A 4MWBA 4B4UA 2PJDA 2R7KA 2BONA 1RYBA 4P4UA 1WMEA 5A9SB 2EFHB 3F5DA 1Y5NA 4KQ6A 4WXRA 1IJEA 2ZB4A 1E2PA 5DW3A 5BT9A 3VQTA 3STWA 2V55B 4ALLA 3WNZA 1RRGA 1PS0A 1WMSA 5HK8A 3EB9A 1JHMA 1TMYA 4FOOA 1L4EA 5CYOA 3TEJA 2EVWX 3K6SA 3BCSA 2PRYA 1AF7A 5LB4A 4MVJH 1KZ1A 3DOEA 4OHMA 5BW6B 4LSGA 3N2ZB 3VR6H 3G82C 3JPWA 3OPYB 3HBLA 3K05A 4FFWA 1Y8RA 2DSNA 3JRXA 2ZBPA 1NI4B 3GZTB 2ZJ3A 4DJDC 2VYCA 3DE0X 4G2TA 4GBED 3WLAA 2DBYA 5D1HA 3PP8A 3B3FA 1QB7A 2P9GA 4PVCA 4YYEA 3W04A 4TYYA 4D8WA 3UT5A 1XLUA 3DXZA 3WWDA 4ETIA 5IAGA 1DAOA 1ONNA 1JVNA 3LXUX 2O8CB 5IULC 3Q0EA 4MS3A 1J9EA 2AFHA 3MS4A 4ZOQI 5CA1F 1V1RB 1EFAA 5AW9A 1NSYA 4EB6A 4EGFA 1QQTA 1SRQA 3I9LA 3TCKA 5JAHA 3PE3A 2QDKA 2WJPA 2XYVA 1W5EA 3FBGA 3BHJA 4MUHA 3U2QA 2ZIAA 2VPZA 2FWBA 3W8EA 3OCYA 3H8WA 2ZIUB 3IJ5A 2KJQA 1UZNA 2PKWA 2WWFA 4RENA 2HO4A 3AUUA 5BV1A 5LYJB 3OIFA 5LXTF 4MUIA 1N2JA 2C8LA 4Q3KA 3NGXA 2ZULA 4MUJA 3U39A 3F3YA 3DFIA 1DFIA 1T5LA 5F51A 2W2KB 4PG8A 4AXBA 5KJ1A 2K2WA 1BS9A 3BCUA 4Y6QA 4PQYA 2PBFA 3MCAA 4QGBA 3VSDA 1N4AA 2TS1A 1HH4A 2NUAB 1G38A 3R9WA 1UP7A 3AF1A 4JUFA 1Q22A 3NTQA 4YO7A 1QQBA 4MRNA 2Y05A 4GU5A 4DAEA 1HXHA 3OMXA 1Q0SA 4G6ZA 1CQIA 1E8MA 3IKVA 2VOEA 2J48A 3GH3A 2Z4RA 3D3EA 1L8LA 2EV9A 1SXHA 1UAYA 2HRQA 3W1WA 1NL3A 2KB0A 3FYDA 4HUJA 3BWYA 4JR2A 1Y6ZA 1NR1A 4XJXA 3O0TA 5JS7A 1J0BA 3AVVA 3PGKA 3U6KA 4X6UA 4QBGB 3CZ4A 3URMA 1L5MA 5BWOA 3TDNA 4W7HA 1B2RA 4LEIA 2EKPA 2R1TB 2DOKA 3AHEA 2V4UA 2H16A 4CCSA 1GR1A 5GOTA 1DOZA 3RV4A 5CBKA 3AM4A 3O82A 4UU1A 4XUCA 4EGSA 1PVVA 1U9YA 1B0ZA 4JQZA 1T6BY 4P3YA 4DKJA 3K09C 4WDRA 1D2GA 1UFOA 3B8HA 5LU8A 4R3WA 4RS3A 1EGMB 3IQZA 3WQHA 1QH8B 3TI7A 4N7JA 1DIAA 2OCKA 5FNZA 3C1OA 1ZH2A 1CF2O 3F6BX 1OSNA 3L0YA 1V9LA 1XSEA 3KAQA 1U3VA 2BEWB 3W5IA 2C3OA 4DE5A 4F9FA 5JHGB 1VMAA 1A4XA 4I8DA 5EJIA 3TX6A 4M0UA 3VX3A 1OV6A 1XIVA 4LG1A 2HBZA 1OLSB 2P2SA 4IVNA 5AXBA 3BHIA 3QUCA 1UMDB 5BMVF 2XMBA 4NMXB 1WTCA 3R0XA 2C1XA 1NDUA 4HRVA 3VYVA 3HY4A 2LPMA 3VNAA 3GAMA 4OU5A 4RZQA 1LCIA 1FDUA 3D54D 2GEFA 2HD4A 3F2VA 1E1YA 3GDHA 4G0ZA 2RHBA 1E3WB 2XOKD 4FNOA 1NQTA 4IH9A 1YI8A 2XMRA 4IHJA 4KYVA 5F12A 2V03A 3P20A 4FYWA 4H1UA 3QWBA 1YS7A 4BOYA 1KEWA 3K5WA 5EVCA 3W8NA 4K9KA 3NJ4A 1NV8A 4LC9A 5AI5A 3UC9A 3WGJA 3E7PA 5DNUA 1N32B 3DZDA 2WJWA 4MQFB 3W9YA 4BEVA 3PL5A 2VSOA 1P2VA 2FUKA 2Y8EA 1NKSA 4IH1A 4UU7A 3RU9A 3UFXA 3UCFA 4CMEA 1LTHR 3CCBA 2N9UA 1N0UA 2RGWA 3CF4G 5L3RA 4A3SA 5IFLA 2HPVA 1T1EA 2PGOA 1E9FA 1N5DA 3WV5A 1EB9A 1GAWA 3ROXA 4ZKDA 3B1YA 5BVGA 3IXMA 3EVDA 3DBVO 4GWGA 3D0QA 3AKZA 1GTMA 3FIJA 3DMHA 1JSXA 5EA2A 1F2DA 3CSSA 3M9LA 1PFKA 2YFKA 3L7YA 4RPKA 5EERA 5BW5A 1RJGA 1IG0A 3O93A 4KLAA 3S1AB 2RDMA 2QW1A 6GPBA 2C0CA 3MHTA 4OQ4A 4IRXA 4JFAA 5JCJA 1Z6PA 3PLNA 1NOKA 5DHRA 4KU4A 3ABSB 1ZNQO 2IYAA 5K0ZA 2VJOA 4IJUA 1E7YA 1MENA 1T5OA 1CIPA 1QIKA 2ID4A 4ZPJA 2IXGA 3FVRA 1VQ1A 1Y6RA 1WV0A 3OD5A 4JKOA 4YAOA 1ULUA 5TJ9A 3ZBPA 2CVPA 1E6WA 1M5TA 5AVVA 3LD9A 3EZGA 2AH5A 2K2QB 1OBFO 1QFSA 4UQOA 3OBBA 3R5SA 4RC9A 2F67A 2O1EA 5GAJA 4RDIA 1KNXA 4KKXB 5CLHA 5M29A 2XTMA 3D7KA 1HFEL 2GERA 3CIFA 3CR8A 3KKPA 1ZVKA 1GILA 2NZYA 2QKYA 4HV4A 2JAPA 2ZSBA 2HWYA 4MWCA 3KSRA 1GAXA 4LC0A 3ZZMA 3QOYA 3I2JA 4IV5A 4WLEA 1JNYA 5DASA 5ER6A 5G4KB 5T3YA 3RABA 3X1JA 2LR0A 3EC1A 4CLRA 3CZRA 5T4HA 4AD8A 3FPSA 5FFFA 2QTNA 3LDHA 5BVHA 3QVVA 4C7JA 4Z9BA 3ZWPA 2XGOA 1R9GA 1WHTA 4MUFA 5AI6A 1YIAA 3LQYA 3V1MA 3EZ7A 1CZLA 4NC9A 4TZ6A 1HDCA 2QG9A 3DT6A 3NTUA 2HLDD 3QTLA 1WZEA 1TF2A 2JKZA 5HWSA 1P9LA 2KBFA 1Z33A 2PSHA 4HATA 2BF4A 1FMJA 2ZJ4A 2VPQA 3TN7A 1K08A 4QPCA 3ZDDA 4UTRA 1J0XO 5G0WA 4QDOA 2V6FA 2XSZD 3QJYA 4Y9SA 2WJIA 4FYKA 4F4IA 1N3IA 4KAJA 4S1NA 4MP8A 3VPDA 5TQVA 3DDZX 4R2JA 4BX8A 1ODIA 4CF6A 3PT9A 1G3RA 1RM5A 5CLIA 1SWVA 1S4QA 4OJMX 1XPUA 1P6XA 1CV2A 3KWJA 4ZVRA 1N7GA 2VWQA 1VSQA 3DAOA 3DFKA 4LTDA 4WI1A 5CU7A 1AMNA 4B7ZA 2QK4A 3EFOA 3UMSA 3FNIA 2C83A 3K3PA 4ZCPA 1JLLA 3RANA 2ZR7A 1GL3A 1VKRA 4QHTA 3T52A 2CEAA 1DJMA 1FLAA 1GNPA 3EMVA 2XODA 4LHVA 4MUNA 3VR4H 2YTZA 4NCHA 1T9ZA 5AM1A 4F96A 2WM8A 3CUVA 3WC4A 2FWAA 2JGFA 1M8FA 1YKFA 3D43A 3O8QB 4TM8A 2DTDA 3ROEA 1EUDB 3OC6A 5KOJA 4FFDA 3RYCA 2B61A 4HDKA 3LVBA 4TQAA 4MR8B 3ZZTA 3ZDXB 4IXDA 4X65B 1BE8A 2F8MA 3U4QB 2WTUA 1K0FA 1B15A 1EDZA 1I4OA 2PX2A 1GGMA 2BJHA 1Y9EA 2EX1A 2QVGA 1CE8B 2PGXA 2PGJA 3UNXA