4BMVA

Short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
256
Chain Sequence
TLPTVLITGASSGIGATYAERFARRGHDLVLVARDKVRLDALAARLRDESGVAVEALQADLTRPADLAAVEIRLREDARIGILINNAGMAQSGGFVQQTAEGIERLITLNTTALTRLAAAVAPRFVQSGTGAIVNIGSVVGFAPEFGMSIYGATKAFVLFLSQGLNLELSPSGIYVQAVLPAATRTEIWGRAGIDVNTLPEVMEVDELVDAALVGFDRRELVTIPPLHVAARWDALDGARQGLMSDIRQAQAADRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Alcohol Dehydrogenases from Ralstonia and Sphingobium Spp. Reveal the Molecular Basis for Their Recognition of 'Bulky-Bulky' Ketones
doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
molecule keywords SHORT-CHAIN DEHYDROGENASE
total genus 94
structure length 256
sequence length 256
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bmvA00
4JBGA 1JU9A 3DZBA 5G2OA 4HP8A 1ENPA 3DTTA 4BNNA 4QUKA 3ROPA 4CLXA 3DEYX 3M2PA 2R00C 5B12A 2DFVA 5TLSA 3ULKA 1LC0A 3DHEA 1PR3A 3H5RA 4R01A 4U6SA 4RVHA 1YE3A 4IJUA 3WBBA 2UAGA 1A7AA 1BVUA 4GI2A 4EJ6A 1D1SA 4ZQGA 3H65A 4D3DA 3AUSA 2GD1O 3L4SO 1UP6A 3OICA 1P33A 2ZJ1A 2DQ4A 3KTDA 5IFLA 3PQDA 3RU9A 4PLTA 3UH1A 1M6WA 4PRKA 4DIOA 4I9NA 1LUAA 1LI4A 3FF4A 5ENDA 5JY6A 3I6IA 4I9UA 3X2FA 3H6KA 1IHXA 2C2XA 3ZHBA 4FQ8A 4L4RA 4JXKA 4G5HA 5KJ6A 1B15A 3E6AA 3ZNQA 5L9AA 2GLXA 1OFGA 2NUAA 4YDRA 4W7IA 1JWAB 1K5HA 1YH3A 3PYMA 3AUAA 2R00A 1PS0A 4R1NA 4BKQA 4BNUA 4CMAA 1RM3A 1BWSA 2X58A 4B4WA 4MPDA 3U3XA 2QRJA 3GZNA 3ROMA 3OETA 2E48A 3ZWAA 1DFHA 1DIRA 3WX0A 4FOSA 3RUIA 1K0UA 4GL4A 2J3HA 3EZYA 4DLAA 2DBZA 3D3WB 2AEJA 1GYPA 3B1JA 3V1UA 2OOSA 3T4EA 3D3EA 2AQHA 1K6JA 1Q7CA 4ALIA 1LJ8A 3RFXA 4Q3BA 3AK4A 1KVUA 2GUGA 2UUPA 2ZB3A 4JCOA 3E1KA 4YQYA 5CDTA 3JQAD 4UAGA 1Y8RB 2NVUB 1QYWA 4OH1A 3OIGA 1J5PA 4DQXA 2ZYDA 3AW9A 5JCJA 4RORA 1NPTO 3JQGA 2Q4EA 5JXWA 4S1VA 4DC0A 3ORFA 5L51A 4DWVA 1MXFA 3L6DA 5CDUA 4I5FA 3WNQA 4NBWA 2IXAA 3I9KA 4RF3A 2X0IA 1IZ9A 1MA0A 1QRRA 4Y6RA 3FPLA 4C7KA 4J1SA 1DSSG 3OF2A 5CEJA 1UDAA 4YJGB 1LSJA 4NG5A 5KKCA 4J2HA 4FW8A 2OMEA 3RD5A 3LT0A 5A05A 1UXIA 2WEKA 1GEGA 5L4SA 1C1DA 3T4XA 3AUUA 3FWNA 4DPKA 1Z74A 3KLPX 4GLOA 3HG7A 1GL3A 1C0KA 1TT7A 1R4NB 1DFIA 1DBVO 2W98A 4FGSA 5TJ9A 4J4HA 4GSKA 4BO8A 3PJDA 4MVJA 4IBOA 1B8UA 3BMCA 3GAZA 1U3UA 4UVEA 2HK8A 1NYTA 3CZMA 4QT0A 2ZK7A 1PZHA 4R1UA 1I0ZA 4ID9A 2ZATA 5GZ3A 3INTA 4OM8A 4AICA 4KUEA 3SJUA 4ZQHA 2OP0A 2HCTA 3KLMX 4ZRMA 5B4VA 3JQ8B 2EGGA 1NVGA 2OORA 3LYLA 1ZJYA 4PLWA 1MC4A 3PDJA 1ZBQA 1D3AA 1HDXA 4XA8A 4AJHA 1EK6A 1GYQA 4E5YA 3JV7A 2VOEA 1DOHA 3DWFA 3O03A 2I65A 4FS3A 4XWYA 3G79A 4BHTA 3ABIA 2HK7A 4BOYA 3BHMA 2DTDA 2I66A 2I76A 5A03A 2FN7A 5IF3A 1J0XO 3FHLA 3K5PA 3GEGA 1ISJA 4YAKA 1KY5A 4PFJA 2WDZA 4NR0A 3S2FA 1Q0LA 3WG9A 2JD0A 1ZW1A 5LDGA 4XD2A 3OQ6A 4JGBA 4PG4A 5JAMA 4CM6A 1K2WA 1DAOA 1Z73A 4CMBA 4LMRA 3ZU3A 1BW9A 2AW5A 4GPD1 4FR5A 1QYVA 3BZUA 5EQFA 8ADHA 4TVOA 5JC1A 2OXIA 1Y9EA 2PD6A 4PLVA 3JYOA 2EKLA 1QLHA 5IJZA 3DZIA 5K6AC 4YAEA 1QYCA 1N9GA 4DVJA 1HKUA 4KP7A 4RF4A 5LCXA 3TZCA 4A7PA 5AXBA 5C5IA 3EW7A 4TZTA 1JN0A 3KZVA 1FDVA 3LSYA 1BXZA 1PJ3A 1N92A 3GHYA 4II3A 1TVEA 3E48A 1ZK2A 1NP3A 1ADBA 3C8MA 4FCCA 3Q9UA 2O48X 1QP8A 2D2IA 4EUHA 1I5RA 2DC1A 4AJJA 3W4IA 5DZSA 5A02A 2O4CA 1LNQA 2QZ9A 2Y0CA 3O8QB 3JYLA 2HK9A 2ZB4A 4MVJM 1PZEA 1MG5A 3OJOA 5A9SB 1BGVA 1ZJZA 4JROA 3RKRA 1IYZA 3UCEA 2YV2A 2D4AA 3NDRA 2Z1NA 4IZHA 4XGKA 5KKAA 4E3ZA 2PR2A 3BMOB 4YJHA 1OC4A 3QWIA 4ROSA 1NQAO 4MIEA 4I5GA 3V2GA 1PJ4A 5IDWA 2EKPA 4IJKA 2G5CA 3A06A 2IXBA 1WZEA 5IAAA 2JL1A 2CVQA 3KSUA 4Y98A 1JW9B 3GGOA 1EQ2A 2B35A 1PJSA 4XIJA 2X8LA 4D45A 1T2DA 5EIOA 1ZSYA 4IM7A 1HDOA 5C3MA 4FPXA 1I36A 5F5LA 4WJZA 3RC7A 2QQ5A 3INRA 3F46A 3MOGA 4E5PA 1ISIA 3OA2A 2FR8A 3ZWNA 5JAIA 4HBGA 2ZTVA 1TI7A 1NR7A 4IY1A 3IUPA 3QQPA 2HU2A 4W6ZA 3E9NA 4BV8A 4BMVA 5F3RA 2XXBA 5A1TA 3PHHA 4LN1A 2GZ1A 3PVZA 4XYMA 4D43A 2DM6A 1LX6A 4CQLB 2J3JA 4EJ0A 5KJFA 1C1XB 2P9GA 4M8SA 1F12A 3MZ0A 4ALJA 2UUOA 3CPSA 3GEDA 1NAHA 1PQUA 2NQTA 1Z75A 4ZRNA 3WGQA 1HRDA 1U3TA 1LBEA 1HZJA 1JVBA 1ONPA 5TNXA 3Q9NA 3RJ5A 3TZHA 2HAEA 3PWKA 2CNBA 2PTGA 3K30A 1FDUA 3ZHZA 3EDMA 3V2HA 5IXSA 4RPGA 1BRMA 1EEHA 1HE2A 1U8FO 7MDHA 1R4NA 1XSEA 3CEAA 4BB5A 2IEDA 1BVRA 4BNTA 1Q0HA 4A03A 2C7GA 4W7HA 2WD7B 4RDHA 1YO6A 3ZWPA 1DC5A 3ZV6A 1ISGA 2C20A 4DLLA 1Q7BA 3ZDFA 1SZJG 5JCJD 4ZQFA 3HDJA 1LSOA 2GDZA 3GDOA 4P38A 1GADO 4BQPA 2PZKA 1DJQA 3AM5A 3PTZA 1QV7A 1UUFA 3GZ4A 3WS7A 2CDCA 4MVJF 1SEPA 3DDNA 5CAEA 5KIAA 3VZSA 5B4UA 2HJSA 3AWDA 1KIFA 2JFFA 4ZQBA 3WGYA 2Y1DA 3MJ4A 2W90A 4OKNA 1P1KA 3N58A 5JPIA 1YOVB 1ADGA 3GN1A 3JD4A 4WCFC 2AG8A 4L73A 4D46A 1UZNA 1KVRA 5AYVA 2ZQYA 2UV8A 4IDGA 3LC2O 4NBUA 2PKQO 3WYEA 4M54A 1EVZA 4KWIA 2F1KA 3UOGA 4WE3A 3KETA 3L6EA 3OEYA 4JNKA 2P91A 1CQIA 2GYYA 1SBYA 3K6JA 4BO9A 4TRJA 2VUSA 5C7OO 5KOIA 1P74A 1KERA 5HS6A 3TNLA 3RAJA 2C29D 1HLDA 3QLJA 1HWYA 3ONEA 3BMQB 4P4GA 3UFXA 3A4VA 1PJCA 4E13A 5FYDA 3U9LA 5KVCA 4WNCA 3B1KA 4B7CA 4IDFA 1DC4A 4P8RA 1BXKA 4XRGA 1E7YA 1EE9A 2FRDA 2GSDA 3ZNOA 3ZV4A 4D42A 3OA0A 3WIDA 4CUZA 3D5TA 3KYCB 1EBFA 4XYLA 2Q3EA 3RQSA 2IRWA 3JTMA 4KOAA 1N8KA 1YQDA 1EK5A 4J7UA 4YAJA 1PS8A 3BHJA 4RCVA 3WGTA 3C1TA 2GN6A 4RQTA 4Z9XA 3G1UA 2VYNA 5JDCC 3C24A 3K2EA 1MV8A 1XU7A 2QIOA 4LGVA 3TZQA 2V6MA 3RUDA 3FBGA 2GN9A 2X0RA 4U6QA 4BKRA 1BXGA 3KYBA 3QHAA 5IZCC 3ZWYA 3SC4A 3P2OA 5IDQA 2ZQZA 3OSUA 3CMMA 1UDCA 3DAFA 4G81A 2X0NA 1F14A 3GC6A 4YRAA 4U5QA 2XPCA 2D8AA 3DHYA 3MJTA 3WJAA 2VYVA 3HN7A 4CMKA 3OQ1A 4N7RA 5BSEA 5THKA 1H5QA 4WGGA 3BTOA 5L7YA 2PH3A 2NSDA 4URFA 4BKUA 2YJZA 1UXJA 1ISHA 2VWQA 1AE1A 2PA3A 5DDIP 5ER9A 5T57A 1SB8A 1D7OA 3BIOA 3AU8A 3DTYA 1Z7BA 1I3MA 4HX5A 4QX6A 1BHSA 2VT3A 3DOCA 3I9MA 3NTRA 4WUVA 1R37A 2HLPA 3P5SA 1YL6A 4YA6A 2GO1A 2H1SA 3AI2A 4MKXA 4YVFA 1EDZA 3ZWMA 1M75A 3F4BA 4PG6A 4OO3A 3VZPA 4GGPA 4AFNA 5KJ1A 2BMAA 3LF2A 2DBQA 1A4IA 4XQEA 3D64A 2JFGA 4MOWA 2HDHA 4BNHA 4BKOA 1LRKA 5COQA 1WWKA 5AXAA 1YJQA 2NU9A 1A5ZA 1ADCA 3D4NA 3S2EA 3KM0A 4J1QA 2VRCA 3OBBA 1R4MA 3VH4A 3Q6IA 4UEJA 1LDYA 3RASA 1A27A 3QP9A 1EQUA 1J49A 2YV1A 4YT5A 4CM9D 1EVIA 4E33A 4Z0HO 1HYEA 3BA1A 2VQ3A 5DP2A 3VH1A 4KTTE 3ZWXA 4QO8A 1DEHA 1HDCA 2EG9A 3E82A 2B69A 1M67A 3K96A 3O8QA 4OOEA 4CM4A 3I1JA 5TJHA 3K2BA 3NT5A 4BO3A 3AUTA 4RZIA 4RQUA 5TX7A 2AHRA 1Z82A 3WQRA 2O3RA 3TOXA 2Y99A 3EAGA 1NFQA 3GN2A 4J0FA 1XU9A 2FHSA 2OHXA 4TRMA 4EGFA 5JY1A 4GKBA 1QYDA 2DVMA 4YJDA 3LZ6A 1QORA 1XR3A 3U0BA 3WFJA 4GSLA 5COAA 3CH6A 3KOUA 2Q2QA 1AHHA 3JQFC 1O0SA 4FFLA 1AHIA 4QFDA 2A35A 1TB4A 3GA0A 2BLLA 1WPQA 1Y5RA 3HWRA 3JYPA 2ZCVA 4E30A 2NVUA 1NPDA 1UP7A 4UVHA 1W4ZA 4Q9NA 1YL7A 4Q3AA 2A4KA 3PI7A 3V8BA 1R15A 5CDGA 1VPDA 4YTEA 3PEFA 1ZK4A 2FMUA 1M2WA 3SBOA 3WNVA 4OAQA 4A2CA 1PR9A 3TFOA 3IQDB 2CZCA 1YONA 2VTDA 1GZ6A 4I9HA 1J6UA 4GKVA 4ZHSA 2P9CA 2QW8A 4YT2A 3WB9A 4LVUA 1L7DA 2IZ1A 4RL6A 4L8VA 4EI2A 3NGLA 2H5LA 3L6OO 4OL9A 4K28A 2BFPA 4R1TA 3WLFA 1X1EA 1PJLA 2YHIA 5G0WA 4ZA2A 3IS3A 3WWZA 2X5KO 1DC3A 3I9LA 5I9NA 2H63A 3K8ZA 3WBFA 2G82A 3WGZA 3FR8A 4YXFA 5I7VA 2JJYA 1GPJA 1PL7A 4LRTB 2QYSA 3STHA 2QX7A 3E9QA 3QW2A 4IDCA 4AVYA 4Z6KA 3HDQA 1LLUA 2Z1MA 3W6UA 3C85A 2GASA 1OC2A 4XQGA 4BB6A 1XA0A 2X9GA 1DLIA 3JD0A 2BKAA 4GLLA 5J23A 1XWFA 1LXCA 2EW8A 4D41A 3EVNA 3IMFA 4JX8A 4HKTA 1U4OA 4NMHA 4BQRA 1E77A 2BI7A 3NX4A 3SLKA 2C5AA 3BMCB 3MCVA 3NYWA 2X5JO 2P9EA 3GVPA 3PHJA 4GH5A 4NNJA 5JAQA 3GAFA 2R2GA 1KEVA 4J7CA 1UXHA 1VL8A 4NK4A 3F4LA 4MVJP 1HE5A 1YB5A 1IE3A 3LU1A 4ONEA 2C54A 4EDFA 4NQZA 4Z3DA 2GNAA 4OSPA 5CPBA 4FBGA 4PRLA 2CDAA 3IP3A 4YPOA 5JW6A 4OXKA 5HS4A 3RWBA 4RPHA 2NVBA 3QIVA 2NV6A 3BXXA 3ZNNA 3ONDA 1H2HA 5KNLA 2NVWA 3DBVO 3WWYA 1SC6A 1T24A 5KJEA 5EESA 3KXDA 3TF5A 4EBFA 1RYDA 1KOLA 4JBHA 1KVTA 4BO7A 2WD7A 4DPLA 1CETA 3ZCXA 4J9VA 3QWBA 4BNYA 3PXXA 4ZQEA 4R16A 1ZK0A 2J6IA 2PKRA 4EJMA 4CM1A 1YL5A 3TZ6A 4B7XA 2Q46A 3AOGA 3S1LA 2ZCUA 1JWBB 2ZTMA 4FC7A 4DQUA 3GUYA 1HT0A 3I6QA 1ZCJA 3GOHA 3GNSA 3QVSA 4KUGA 1V8BA 3HJAA 5T8KA 4NFSA 2ZJ0A 4XYBA 5ILGA 2IYOA 2DPHA 1RM4A 4LCJA 3JQCA 2I5PO 4CLOB 1NTOA 3GEMA 3I23A 3PQFA 4DREA 1PGOA 5G0TA 1ZEJA 1JKIA 3EMKA 1CQJA 1HE3A 3ZHYA 1R66A 3HNPA 2I67A 1E3EA 4XKJA 4FJ1A 4TKMA 4OQYA 1OBFO 3H9GA 2BGLA 5B1YA 3W8EA 1H6DA 3EGOA 3AI1A 3FCOA 4E12A 1YQXA 3G3EA 3WGIA 5BSHA 1R0KA 3PP8A 1XHLA 5JDCA 1WVGA 3SC6A 4EEXA 1HL3A 1Q7GA 3TRIA 3BHIA 4B8WA 2Q1SA 4I8XA 3E5RA 1W0CA 4R3NA 4CV0A 1YKFA 1H2BA 4R9SA 4HFJA 4BGVA 3L4BA 3VPHA 2Q49A 3CZRA 3OHSX 3UICA 3PYLA 2EIHA 1XQ6A 1NM5A 2EHDA 1NQ5A 4JJGA 4GQAA 2O3JA 1NBOA 5DN9A 1I2CA 4ND2A 1SEVA 2DPGA 3RJ9A 1EFLA 3GVXA 3R3SA 4N5NA 5T64A 5JC8A 4Z9YA 1PGPA 4E4YA 3GY0A 1SOVA 1ZKMA 5C7LO 4R1SA 1ONOA 1ZMOA 1C3VA 1N9GB 2BFOA 3AU9A 3KYDA 4S3MA 3RUCA 5MGBA 5G0SA 4AJPA 3VTZA 1U8XX 4IS3A 5EN4A 4J90A 5DOZA 3GFGA 1DRWA 4MDHA 3HDHA 3I5MA 5IN5A 4YT4A 2O3UA 4W99A 3JQ9A 1MP0A 1ZZEA 2PFGA 3C7DB 4CR8A 2O7QA 4FSHA 5TGDA 3HB5X 3SX2A 3T7CA 5ILOA 5CPFA 4CM9A 3ENNA 1CDOA 3MJSA 3F3SA 4W9NC 4IPTA 1P44A 3L9WA 3LT4A 1P3DA 1Q2XA 2QZZA 1K6IA 2X9NA 3NUGA 4OXYA 3ZW8A 5GMOA 4XR9A 3U4DA 3VZQA 4BS9A 4FFOA 4WLVA 4CPDA 1ZEMA 2WYWA 2C0CA 1R12A 2HMVA 5IN4A 2JAHA 1P77A 2HJRA 4L9RA 4CLHA 5H83A 3JD2A 1TT5B 1H0KA 2GZ3A 4JQCA 4II2A 3RI3A 3OIFA 3TWOA 2DFDA 1U5AA 3NEPX 2IODA 3PJEA 4JJIA 1IB6A 2ZB7A 3HB4X 4F46A 3U5TA 1EDOA 4NI5A 2Q50A 1RYEA 2TMGA 1ISMA 1PWXA 3ROQA 2HUNA 1MLDA 4WEQA 3W4JA 4IGFA 4Z9FA 5H82A 1GV0A 9LDBA 5HTOA 1DRVA 1AXEA 2Q2WA 2RIRA 1I3NA 4CLRB 2VZ0A 1O9BA 4A5OA 3O38A 5JCXA 3JCZA 4ZICA 1T1SA 2AEMA 4DC1A 5I8ZA 4WECA 3PGJA 3DAGA 3U4IA 4AJNA 4DA9A 4C7JA 4E5MA 5ES3A 3CE6A 4OGWA 4KZPA 1QR6A 1XKQA 3H5AA 3AI3A 1VM6A 4J1NA 4MVJH 6LDHA 4CMHA 4GX2A 1WW8A 1LQUA 3WOHA 1PL6A 1GCOA 3V5NA 3BMNA 4CMIB 4M1QA 2V65A 1CEQA 3JQBC 4OYRA 4GX1A 3LLSA 5EJ2A 3L9XA 4Z0TA 3RKUA 3WFIA 2QG4A 1O5IA 3ZWVA 1E6EA 1EVJA 2P4HX 4J7XA 1VJ0A 4XYEA 3F5SA 1U3VA 1PL8A 4KQWA 2Q2VA 3TOZA 1S6YA 4R5HA 4YWJA 2AG5A 4BO1A 3K9QO 2BFMA 3C1OA 4QSMA 1FMCA 1LLCA 2B4TO 5H81A 1WP4A 2ZB8A 4YCAA 4R54A 1FF9A 3CIFA 4L76A 2HMSA 5U9CA 4MVJD 4HNHA 1AUPA 4J2OA 1PGQA 2AMFA 4UULA 3UW3A 5DOVA 5F1KA 2GPTA 3GG2A 4Y67A 3EK2A 2D59A 4IJVA 3DZJA 3ZGYA 3UF0A 4Q3EA 1W73A 3QA9A 3HFGA 3Q2IA 3TL2A 3GQVA 1A72A 4WPGA 1E3WB 1LSUA 4PIVA 3UCXA 2JD2A 4CM4B 1MXHA 3AOEC 1PIWA 1DXYA 3K73O 1PJBA 2DBVO 1E3IA 3MJVA 4R9RA 3VKVA 3RU7A 1PX0A 4WLUA 2Y1OA 3RFVA 1A9ZA 3KV3O 4H7PA 4G65A 2JHGA 4GAEA 1LQTA 3F6YA 3VAZA 3ZHXA 4AG3A 1D8AA 4Y8VA 4HFRA 3WXBA 4ZJUA 1E1NA 2VHXA 4F3YA 4Y9DA 1PJ2A 5HBRA 5TS3A 1RWBA 1N7GA 1PJTA 3JQDA 3CXRA 4DMLA 4W82A 3WGHA 4J49A 3COSA 1ML3A 3HE3A 2BI8A 3LLVA 4CQMB 1B3BA 4M49A 3ICCA 3U49A 1NFFA 1PGJA 1XEAA 3OJFA 4FN4A 3GR6A 4WLEA 3DOOA 2H9IA 3EUWA 1JAXA 2DTEA 3RSHA 1TEHA 5CFZA 4YAGA 1DHTA 3AM3A 4R3WA 1EBUA 5FF9A 4RVSA 4DRYA 2X86A 1YB4A 2VNSA 2HMTA 1I10A 4BO0A 1XDWA 3PDUA 5L4LA 3VPFA 1WZIA 1U1IA 2RAFA 3ZW9A 3UGKA 2ZIZA 2DUUA 1B0AA 1HDYA 3VDRA 4Z3KA 1EMDA 4LMPA 2GGSA 3DBLA 2SCUA 1I33A 1H6CA 2UVDA 2C59A 3JQAB 2X4GA 1P1RA 2VYND 5BT9A 5L7WA 1Y1PA 5T67A 4DQVA 2C2YA 3O9ZA 5CEEA 2GF2A 3FNHA 4GWKA 3GGPA 4WCFB 4NDNE 1WDMA 4UUPA 1F06A 1YB1A 3FBTA 1GZ3A 4GMFA 4CMGA 1IZ0A 1Z6ZA 4K9DA 1H6AA 4R41A 3PRJA 5CDYA 4LSWA 2HMUA 4MINA 3HDYA 1DIHA 3IJRA 3VVCA 4OIMA 3H3FA 4E2WA 3SVTA 3GNQA 4MVJI 4WNIA 3G49A 3ON5A 3QSGA 4D3FA 1YS4A 3VHRA 4HV4A 4BNZA 1ZXBA 3BTSA 3PWZA 5I7EA 2RH4A 1E7SA 4UVDA 1NHWA 3V2UA 2OBYA 3ZI0A 4IQGA 3DBLB 4BGIA 2PWZA 3H8VA 2EERA 3QV1A 4KDFA 1OOEA 3ZU4A 1F8GA 2CD9A 3ANLA 1TLTA 1B14A 4YB8A 3UVEA 2QRLA 3I9NA 4ALMA 1A71A 1WXDA 5EERA 4WCFA 1KETA 5DBGA 2X9VA 4BNIA 1A9YA 1RM5A 1XLTA 4FDAA 1NWCA 3A28A 3KUXA 1RKXA 1ARZA 3ZZNA 2FPIA 4B3IA 5TIIA 3OH8A 3WQQA 2EF1A 4MJLA 3S2IA 1RPNA 4BUCA 1LDBA 3NKLA 1R6DA 3VKUA 3ANMA 4PGFA 1FDTA 4NFHA 4J16A 3E03A 3U62A 4CM8B 4YACA 1GU7A 1QLJA 1N5DA 1JTVA 1U7TA 4JBIA 1U2DA 4DTIA 5G0UA 4F6CA 2JCVA 4YRDA 1K89A 4ZGWA 1U3WA 3AM4A 3DZFA 3N7UA 3DMYA 3VPGA 2YHIB 1NR1A 3PIDA 4HWKA 1NQTA 1ZUD1 3PGXA 4NIMA 1B3RA 1V3UA 3NJ8A 4WEOA 3ROKA 4CUKA 2X7HA 1BSVA 1C1DB 2BHLA 2NQ8A 4IINA 1CJCA 1LLQA 4YEDA 1HDRA 3L77A 4U7WA 2VHYA 2WYUA 5DT9A 1YRLA 3SEFA 5K9ZA 1Y7TA 4JJFA 1ZXLA 2Q45A 1EUZA 4N18A 4PLHA 3QWHA 2O3TA 1VL6A 2I3GA 4HNGA 4IXTA 4EZBA 4TQGA 6ADHA 4NU5A 2E82A 3IJPA 4BNFA 3SLGA 3ZWBA 1O89A 2AXQA 2NACA 1FXSA 1P1HA 4FFPA 3UHAA 2O23A 2ZYGA 4E2YA 2HRBA 3DBRA 2D0IA 5JDIC 1UP4A 5ICSA 3GDGA 1PGNA 4L4XA 4N5MA 3CTMA 4YJFB 1N7HA 1E3WA 2VUTA 3Q3CA 1UXKA 3WYBA 1SMKA 1P45A 2AQIA 4L74A 3Q2KA 2FOIA 4AJ2A 3D4PA 3JSAA 3H4VA 4TRNA 2G17A 1YDWA 1I8TA 1FDSA 2J5QA 2ZYAA 3QVOA 5L7TA 1PTJA 3PHGA 3BAZA 1EUCA 2VRBA 3D3WA 4PLPA 1E7QA 4WLFA 1MG0A 4CQLA 4FD3A 2IZ0A 1PJQA 4YJFA 3OEWA 3K92A 2Y05A 4RPKA 5T5QA 1IY8A 1JKFA 2Y1CA 3OQBA 4JLWA 3WTBA 1ULSA 3A1NA 1VKNA 4RO0A 3GVHA 3S2GA 3VC7A 3VOSA 4PZDA 3JYNA 1Y8RA 3WDSA 5AOVA 2HKIA 5A5EA 4IZIA 1VE9A 4O59O 4OKIA 4XJSA 1XGKA 1KYQA 1H94A 2XAAA 5DULA 1N1EA 3L4BC 4I1IA 1UXGA 1X0VA 2G76A 3A9WA 1IL0A 1C0IA 1X0XA 2IDZA 3JQ9C 1GUYA 4B3JA 3DR3A 1O94A 2DTXA 4U8GA 4CMEA 3BMQA 3HUDA 4WCDA 4B4OA 1T2AA 3AY6A 3EZLA 4PCVA 1FDWA 4D7AA 4EW6A 4PLYA 3ASUA 1I3KA 1N1GA 3RCBA 1EUDA 4KWHA 1I2BA 3T7EA 2FZWA 4B3HA 4H15A 4FJ2A 2PY6A 4JP2A 2VHWA 5DBFA 1WAMA 3RC2A 3WMXA 2D3TA 1IOLA 2B83A 2X22A 1HF3A 2JCXA 4EUEA 1YGYA 1E92A 2ZTUA 1ZSNA 2OP1A 2PGJA 3IDSA 1VRWA 4MKRA 4LVCA 1FK8A 4L4SA 2TMDA 2YYYA 4GWGA 4XJTA 2WJPA 3DHNA 1NXQA 5EL0A 2Z5LA 5FFFA 3ZNPA 4A26A 1KY4A 1PZFA 4FFNA 2BGMA 4E0BA 3OJ0A 1E5LA 5JYEA 3FTNA 4WLOA 1R16A 1I30A 1JDJA 3RC1A 5IXYA 2HMWA 5FI5A 4A10A 4B8ZA 1V0JA 5A5FA 4RF5A 3WGOA 4OMUA 2G0TA 2NU6A 3MTGA 4PZEA 2YFHA 1U5CA 1P9LA 4IMPA 2JHFA 1T2CA 2I99A 3TDKA 4BNMA 5FEUA 1BTOA 3GRKA 1SNYA 4FFMA 1I32A 4XRRA 1Q1NA 1GV1A 1W8DA 3E9MA 4R5MA 4Q3CA 5F5NA 4YT8A 1GCUA 4UVGA 1X14A 3F1LA 1PEDA 3KEQA 4WOKA 5JAZA 4PG7A 3KYCA 5KCZA 5JS6A 4GBJA 1VSVA 4Q3DA 3INGA 4FFRA 4CUJA 1CRWG 4GX0A 4YAIA 1MFZA 3FI9A 2EKQA 3KVOA 1O95A 3MTJA 2OO5A 2RBEA 4UUNA 5JMPA 1BDMA 2B5VA 3HHPA 1K3TA 1C1XA 4RPLA 2I6TA 3OP4A 1DIBA 1GAEO 2FP4A 3P19A 5JDIA 4R51A 2AE2A 2B4RO 2ILTA 1NWHA 2BFAA 3P7MA 4LW8A 5JNLA 1XELA 4IQ0A 1E7RA 3DBHA 4FGWA 3L07A 1YQGA 3UKOA 3DFZA 1IULA 1DDOA 1S7CA 3FNGA 2C5EA 3F47A 1VC2A 3PFFA 2WE7A 4OHUA 4I08A 2NTJA 3NDIA 2EP7A 1H9AA 4AJIA 1UDBA 2NLOA 1HETA 1HSOA 3R0IA 3M1LA 1GZ4A 4F6LA 3WTCA 3KSDO 3PK0A 3I9JA 2WTBA 4A73A 2CUKA 2P4QA 1XIVA 1ID1A 4NJMA 3F1KA 3MJCA 2OFPA 4AJ4A 5U1PA 4DXHA 3E18A 3FN4A 5T6BA 1KBZA 2HSDA 4UEKA 4L0QA 1DO8A 5FWNA 1HXHA 2OZPA 1WMAA 1PSDA 2E49A 4E31A 1GUZA 2V7PA 1MUUA 2P2SA 1HE4A 4MKZA 4AJEA 2BELA 4DL9A 5DBIA 5IG2A 3RROA 3ENKA 1ISFA 4FOOA 1HYHA 5CP8A 3X2EA 5G0VA 4NPCA 3WLEA 3JQBA 4KTVE 4X54A 2EWMA 2A92A 1SCUA 2YUTA 3E5MA 4PG8A 3NJ4A 2Y93A 3ONFA 2GR9A 3KEOA 3TPCA 1I24A 4RZHA 1LRLA 2Y67A 3SXPA 3R3JA 4D3SA 3ETDA 2BH9A 2FSVA 4IDDA 3HADA 3GUCA 4BNWA 1UAYA 1OMOA 2X6TA 2XF8A 3PQEA 1YWGO 2VUUA 2E4AA 1UR5A 2VZ8A 4MP6A 4AJKA 2DU8A 1B8VA 2DUWA 3LK7A 3WR5A 1KEWA 2VTEA 3PWSA 1BW9B 3CSDA 4Q39A 4QFCA 1M66A 4CQMA 5JSFA 3DXFA 3N74A 3I52A 1NFRA 2EGHA 1LSSA 3DAPA 1P0FA 1ZK3A 5MDHA 3BTUA 3PHIA 4IDAA 2W2LD 3B1FA 3GG9A 1G0NA 1QXSA 3ANNA 3DMTA 3D4OA 3QJ5A 1PQPA 2JFHA 1LC3A 1YBVA 2Q1WA 3H3JA 3L0DA 4ZD6A 1DJNA 1EZ4A 1XQ1A 2QRKA 1GTMA 4WOJA 4TMFA 1GD1O 2HO5A 1H9BA 8LDHA 4OOFA 4TKLA 1PU2A 3RUEA 4KUHA 1WDLA 1IHYA 1SPXA 2VRCD 3H9JA 1HSZA 4CL3A 2YHUA 3KHUA 3DBRB 1XG5A 5AVOA 4CMIA 1Y5MA 2FWMX 1IPFA 5ICMA 1E1MA 4E5KA 2CF6A 3BTVA 4NBVA 2YW9A 4MVJE 4E2ZA 4TVBA 4IIVA 1MC5A 4J1TA 4KQXA 1V3TA 3E8XA 2YY7A 1NVMB 4A27A 2PK3A 3Q1LA 3H7AA 4HXYA 4MO2A 3LF1A 1I3LA 2YQ5A 3ZWOA 1NNUA 3LT2A 3KSZO 4ILKA 3VTFA 3DZKA 2EV9A 5JE8A 5HM8A 2NTVA 4CLRA 4DYDA 3ST7A 1HDZA 4MP8A 2J3IA 4XCVA 4GMGA 4RPJA 4WLNA 2VZ9A 4Y6SA 3SJ7A 5F1PA 2BF7A 4DBZA 4C4OA 1ORRA 5LC1A 1YXMA 4O63O 1CERA 4PLGA 2UDPA 4RV9A 4TSKA 4BNLA 3BMNB 4GVLA 4FIZA 3M2TA 2C82A 4O5OA 3MWEB 4B4UA 4EEZA 4CV1A 1O6ZA 5KTKA 4EITA 2X23A 4BKPA 3UXYA 1OAAA 1V9LA 4PVDA 1E0DA 2NU7A 3OMLA 3ZV3A 3CINA 1B7GO 4H3VA 2IYPA 3PJGA 4XGNA 2NTNA 3QVWA 2CVZA 2O3SA 1GEEA 3GGGA 5IZCA 2GCGA 2QYTA 3TQHA 3RBZA 1VKOA 4LK3A 4B4VA 2OBNA 2EJVA 4JN6B 4CLOA 1ZFNA 1PWZA 2I3AA 2WWRA 1CIVA 4BNJA 2PGDA 4RF2A 5KVVA 2IEBA 1DHRA 5I9MA 3KRTA 3ZU2A 3HFSA 3OECA 2QHXA 2PV7A 2J3KA 5AXDA 1QV6A 3DBHB 5JLAA 1IUKA 1VLLA 4Z0PA 5L45A 5A9SA 1EFKA 1B8PA 4D0SA 2EJWA 4XDZA 1TT5A 2DAPA 3GF4A 3GZNB 2V6BA 1E3LA 3GFBA 2EXXA 3TFQA 4YQZA 3MEQA 2P5YA 1GDHA 2WYVA 3HSKA 3LT1A 1OZAA 5ITWA 4M87A 2OGUA 2P68A 3I4CA 2AE1A 4RVUA 2PZMA 3EC7A 2GN4A 3ITKA 2W8ZA 4EYEA 4NBRA 2I9PA 4ZU3A 5EMHA 2VN8A 4CM7A 4XEHA 5DP1A 5CDSA 3JQAA 3RC9A 2Y66A 3GVIA 2CVOA 3WSVA 3G1TA 3ASVA 2O7SA 3R1IA 4BNVA 4BO5A 1O8CA 1DB3A 2BGKA 1Z7EA 3LC7O 4CMJA 1E6WA 1ZVMA 5A4DA 3JQ7B 3FWZA 4D44A 4RLSA 1DRUA 5TT0A 5JO9A 1LTHR 4FC6A 4OQZA 4J4BA 3BYZA 2Y1GA 4DGSA 5KJCA 4A0SA 2VT2A 4B79A 4B7UA 5FI3A 5HA5A 4BNKA 2V6GA 4YJGA 3JQ8A 3TL3A 5T8KC 4CODB 1T1RA 3D5QA 4BL5A 3PLNA 1OI7A 1MX3A 1GQQA 3HQ4O 5CHEA 3RVDA 3DQPA 5TT1A 4IGEA 3QVTA 3IKVA 4OXNA 1Z45A 3LVFO 4WKGA 3W8FA 1PQWA 1T4DA 4J9UE 5BNIA 2VOJA 3W8DA 4LRSB 3KO8A 4DBVO 2VNAA 4CM5A 2CY0A 4ND4A 1P1FA 3IOYA 3DFUA 1YOVA 3CUKA 4ND3A 2GERA 3C1AA 4L75A 2Y1EA 4CJXA 3AY7A 3VVBA 4ALNA 5JBIA 3UAGA 2O50A 3D0OA 1ZO8A 1MGOA 3FPCA 3JD3A 2FR1A 4GX5A 4BGEA 4IJWA 4P22A 3PJFA 4XDYA 4BO2A 5A3JA 4YRBA 1KVQA 1V3VA 1F8FA 3FD8A 3WMWA 3ZWWA 4YR9A 2DBRA 1AGNA 1ULUA 3QWAA 1G6KA 3DL2A 2AEFA 4UEOA 3RUHA 2DKNA 4XB1A 5BNFA 1YJ8A 3PPIA 4IXWA 4PLCA 4M89A 2IE0A 3JD1A 1E1LA 1U4SA 4NFYA 3I3OA 4TRRA 1ZSVA 1SOWA 1HDGO 3OJLA 3G17A 1ENOA 1F17A 3GDFA 4NH4A 2NU8A 4CLDA 5DCWA 4BO6A 2B4QA 9LDTA 1BXGB 4J3FA 2BD0A 1DFGA 4UUOA 4BMNA 2YV3A 1BG6A 1ZMTA 3TSCA 2XXJA 1T2FA 2HQ1A 4O6VA 5EQDA 5HRUA 2Y1FA 1ENYA 2ZTLA 4HFNA 2G1UA 4IQ8A 3D1LA 4MP3A 4RDIA 3W4KA 2YDYA 3EVTA 3R6DA 4AJ1A 1CYDA 1UZLA 2WMDA 4LISA 3ADPA 4CR6A 4OJNA 2VHZA 4BNXA 3OFSA 4J6FA 4O1MA 4INAA 4RLHA 2Y0EA 2VWPA 5AXCA 1LDGA 1E7MA 3H9QA 4CV2A 2PZLA 3CMCO 2A94A 3DZHA 3I4FA 1IPEA 4KMSA 4QO7A 3AFNA 1H93A 2RH8A 2ET6A 1U28A 1A4UA 2WD8A 1B16A 2RHRA 4UVIA 3VPSA 2ZKLA 4J4TA 5KVSA 3K31A 1EVYA 4BIIA 5DCUA 2FPGA 2B36A 1R4MB 3DC2A 3H9EO 1DLJA 1F0YA 4QECA 3ZWCA 3AJRA 1VI2A 4CMEC 3GH3A 1LDNA 1D4FA 1HEUA 1LDMA 4R4JA 3NT4A 4UUMA 5G4KB 1Q0QA 5BSGA 4DIBA 1A7KA 4I5EA 2NM0A 1DIGA 2J5KA 3GMDA 3UUWA 3ETGA 3FNFA 2EEZA 5GY7A 3H5NA 1CF2O 3IC5A 4RJTA 1X7GA 3EHEA 3JQFA 1X7HA 1X1TA 2BRUA 5C7IO 1C0LA 3U09A 4PVCA 2PLAA 1DPGA 3UCFA 4EUFA 1XCBA 4MVJG 1B2LA 1GUFA 4XR4A 1RM0A 3B20A 3S8MA 3GRPA 4XQ9A 4HUJA 5HWSA 3PLRA 1NX6A 5G4LA 2HRZA 2VHVA 2FY8A 1NQOA 3DO5A 3G0OA 1YDEA 4GGOA 4TROA 3VH3A 1ONNA 2A9FA 2B5WA 5CEFA 4XZ3A 4PN3A 5DF1A 5A04A 4GVXA 1JLLA 1YBAA 1B26A 1LEHA 4XQCA 3ZV5A 2PNFA 4FB5A 5TQVA 5BQFA 4DYVA 3GLQA 4J91A 4W9NA 4XB2A 1T25A 2W2KA 4E2XA 2PH5A 5BNTA 1DIAA 1KC3A 2EW2A 2VCYA 4BO4A 1NVTA 4IMRA 3Q0EA 1LDEA 1C14A 1TA4A 3B6ZA 1E5QA 1CWUA 2FZEA 1AN9A 4FJ0A 5B4TA 1UZMA 5JO0A 2RHCA 1QMGA 4M86A 4J43A 3OIDA 5K0ZA 1QYXA 2C07A 2E6UX 4YBZA 4O0LA 1E3SA 1AXGA 4DLBA 3VZRA 4BVAA 1EE2A 2Q1UA 4JP3A 2YFQA 2Y68A 4PLFA 4CM8A 1VSUA 4CMCA 3IL2A 3M6IA 4W4TA 1QG6A 5ER6A 3RUAA 5CG1A 1LA2A 4U0JA 5IDXA 5A3VA 5L3ZA 2GZ2A 3IAHA 7ADHA 4K26A 1JQBA 2LDBA 4N5LA 1ENZA 1V35A 2X0JA 2POQX 5ITVA 5L95A 5L40A 3ITDA 1GFSA 4U0KA 4UREA 4R68A 1L1FA 3LDHA 3FRJA 4TZKA 1TXGA 2W2LA 3JQ7A 4XX0A 4DPMA 5DNAA 3EYWA 1Y9AA 2D5CA 5KWEA 3ETEA 3W6ZA 1JA9A 4ZN6A 5JYDA 1WDKA 2PKQP 1HZZA 1V6AA 1ZIDA 3F9IA 3WYCA 1ADFA 3QWFA 4H16A 3I9OA 2D1YA 3DMTC 1DAPA 1T4BA 2JAPA 3QE3A 3RFTA 2X5OA 3RIHA 1NAIA 1E7WA 5C37A 3DONA 1ZK1A 2YQ4A 4RVDA 5KVQA 4ESOA 1Y8QB 4IDEA 3HN2A 3IKTA 3MOIA 3WIEA 1P0CA 2Z95A 2RCYA 4DMMA 2Q1TA 4YJHB 4D0RA 4NZ9A 1M76A 3WSWA 2O3QA 3H2ZA 4QTZA 4ND1A 4Y6PA 2UYYA 5A9RA 2AA3A 2EP5A 1T2EA 2VYVD 4RGBA 1BDBA 3GT0A 3KBOA 3DOJA 3JQEA 3V1YA 1BMDA 2W2KB 4MIYA 4XGIA 1GY8A 3DZGA 1WMBA 3TN7A 4K6FA 1KEUA 1C0PA 3QVXA 1NPYA 3IP1A 4LSMA 4IDBA 1GR0A 2NNLD 1P31A 1U2GA 3MWDB 3P2YA 4BNGA 3C7AA 5JFOA 5G4KA 4E6PA 2V6FA 3C3XA 4NU6A 1SO8A 4P4LA 4G2NA 4QQRA 4CL8A 4CR7A 4E5NA 3PFWO 3F5QA 5TF4A 4P4NA 3U4CA 5BR7A 5ENVA 4BGUA 3V1TC 2R6JA 4HADA 1M6HA 1UH5A 4ITUA 5TSDA 3LC1O 4IUYA 4F45A 2W4QA 4NHEA 2J5RA 1LRJA 1VJ1A 3GNTA 1GPDG 5K6AA 4BMSA 1E3JA 2VWHA 4IS2A 3FR7A 2C7VA 1QSGA 2Q4BA 1SAYA 1PS9A 3UN1A 1HLPA 1ZNQO 3EY4A 3GK3A 1G1AA 1RJWA 1MB4A 2PZJA 2WM3A 2CFCA 2CSUA 3NGXA 5JMWA 4K6CA 3TJRA 3AFMA 3PZRA 2PD4A 4JK3A 4JIGA 4J0EA 3H2SA 3NTQA 1FJHA 1U7HA 2OUIA 4ZVVA 3GVCA 3PZBA 4NJMB 3NAQA 5F21A 3H9UA 5L4NA 3M1AA 3S55A 4N54A 4AJLA 1T26A 3FSRA 3O26A 5I7FA 1Y8QA 1G0OA 5A06A 3MJEA 3RBXA 2IZZA 4Q3NA 5AQ1A 5EPOA 1R0SA 2FR0A 1VL0A 1WLYA 3NV9A 2PD3A 4WK6A 4LCEA 4R69A 1KC1A 2B37A 1HYGA 1JVSA 3D7LA 1KVSA 2JCYA 2WE8A 4DUPA 2WSBA 3NRCA 1VJTA 4QEDA 3VPXA 3GPIA 2D5AA 2J8ZA 2X1HA 1P1JA 2JKVA 4NK5A 3NDJA 1GQYA 5A9TA 3JQ6A 4E21A 3AY3A 3KB6A 4I5DA 3ZN2A 3AOEA 3VDQA 3PHLA 3ZU5A 1QKIA 1LLDA 3JYQA 5ADHA 1GQ2A 4ALLA 1UJMA 1SB9A 2NWQA 3OM9A 3DB2A 4DIFA 2E37A 2YDXA 3WICA 4CLEA 4QXMA 3Q11A 1YVEI 1X13A 5TRTA 3ZH2A 1UAGA 2Q99A 3IIEA 2B0JA 4IIUA 2PGLA 1E1KA 1N2SA 2Y0DA 5TC4A 5EINA 4NJOA 5IZ4A 4NBTA 4MIOA 2DLDA 1Y81A 2O2SA 4M55A 1KS9A 3C7CB 1H6BA 2F00A 3LQFA 5GZ6A 4XYGA 4CM3A 2O4UX 3RBVA 1I2ZA 1X15A 5LDHA 2P5UA 5BSFA 5I9LA 2O2YA 3BMOA 1J4AA 1K6XA 1JKJA 1R0LA 2CDBA 2JD1A 3GPDG 5THQA 3WJ7A 3RUFA 1PZGA 2XOXA 4WASA 4TWRA 3KYDB 1NASA 4PG5A 1GYRA 3B70A 5U4QA 2FPPA 3A14A 3I83A 3JQGB 4PLZA 1DC6A 4CQMD 2AQ8A 4CV3A 4OSOA 4YYZA 3PIIA 3O4RA 5COBA 2GRAA 5L53A 1MFPA 1ZH8A 4ND5A 5F1OA 4AL4A 1P1IA 4HFMA 5DCYA 3ICPA 2CMDA 1Y6JA 1E6UA 2GN8A 4HY3A 4D79A 2H6EA 3WGGA 5CG2A 5I7SA 1YBMA 3NTOA 3NT2A 1D1TA 5IDYA 4KDEA 1KEPA 1JAYA 3U4HA 3HZZA 2OL4A 2YZ7A 3VH2A 4E32A 3TZKA 2VWGA 3CKYA 2CF5A 3QRWA 2AQKA 1WNTA 3GMSA 4PZCA 5I8WA 1W6UA 2FSSA 3QY9A 3PYXA 1HTBA 1LU9A 3GHHA 3WQSB 4BV9A 1L7EA 4K1LA 2LDXA 1X7DA 5GZ1A 3ADOA 4ALKA 1U9JA 2NADA 3FNEA 4XIYA 5B37A 3W1VA 1XYGA 4RVGA 3FTPA 3IUSA 1I01A 1NHGA 4AJOA 3OJEA 4RVFA 2DT5A
chains in the Genus database with same CATH superfamily
3IVXA 1JU9A 1EU1A 3DZBA 3DGEC 3I6ZA 4TKVB 5G2OA 4HP8A 1YGPA 5A7GA 1Z7WA 5E2AA 2GPSA 4QUKA 3K6SB 4KPEC 4CLXA 1O0BA 1DKLA 2OGTA 3JWIA 1NY6A 1SUDA 3CUVA 4RK1A 1T6BY 2DFVA 3ULKA 1LC0A 3DHEA 4JLDA 3H5RA 1E6MA 2JA2A 1JFFA 4RVHA 5KOYA 2UAGA 4R05A 3FDJA 5DWVA 4Q1CA 4WFJA 2DHRA 1DZ3A 3H65A 1XAIA 3SQMA 3ZH9B 4DEVA 4WL0A 3VAAA 4ZCRA 3R6WA 4ETMA 1N2IA 3AC0A 2GEDA 3KTDA 1CR2A 5F7ZA 3U9TA 3PQDA 3RU9A 3E23A 4PLTA 4R84A 3TTYA 2O8BB 1EFDN 4EENA 1ZA1A 2EBFX 1Z33A 2O6HA 1QIJA 2VJPA 4PRKA 4LY3A 5K05A 1I1NA 2QN8A 1XNQB 3NUZA 2QQEA 1LI4A 5ENDA 1IJBA 4JI3B 4TWJA 4MR7A 5B6PA 4H1UA 1KO5A 2P79A 1G8GA 3B3AA 4NAUA 5F7OA 2J6HA 2Z2IA 4CIAA 2G3YA 2VNIA 4QICA 4C4PA 4FQ8A 1RQGA 3N2KB 2GFIA 3WLPA 4HTAA 2XKKA 3UWOA 1QQTA 4XQ0A 3E6AA 5EUQB 2WJWA 1CEEA 3HJRA 5AK5A 4HGRA 3HVHA 3A27A 4Z4EA 2NUAA 3KEMA 3HYLA 4WKBA 3U3MA 2XNDA 1K5HA 2ZWAA 2VQEB 5HFAA 1DBWA 1Q74A 1QHGA 1YH3A 3G5TA 1XZDA 1XNRB 4CMAA 2WAOA 1R0RE 2Z6VA 2ZAYA 1UKEA 4EUSA 3U3XA 1N6KA 1M5TA 5EPEA 2JGLA 4ECAA 3EASA 3LQ2A 3WX0A 3PQ5A 1YNOA 3LZCA 1L5NA 1KHTA 2KWIA 4NPHA 1VJGA 3ELYA 3EMVA 5AUOB 2AEJA 4X1IA 4H3KB 3B1JA 2ACKA 3M4ZA 3O3CA 4U2GA 2ODPA 2E6KA 3NDBB 4EHDA 1U9IA 2A9RA 2PEYA 3ME5A 2HA5A 3HNRA 3Q7SA 3UYKA 3IURA 2UUPA 3LIIA 4MV5A 4HDOB 1LPOA 1YQWA 4H7IA 4JCOA 5AKZA 3KSBC 1W9HA 1M6EX 4UAGA 1XTIA 3GPBA 3DKKA 3K9HA 4Q3OA 1K66A 1J5PA 2XRMA 3KXIA 4DQXA 1YFKA 1IUNA 2ZYDA 3DEFA 4G6ZA 4NYMR 4NOKA 1NPTO 4RORA 4UUAA 3ZVKA 5FORA 4S1VA 2IY9A 1RAHA 4PTLA 2QBYB 4TYYA 5CT6A 1VIDA 1FW6A 4JR0A 4BWFB 3PCXA 1VJ5A 3I9KA 3DFIA 1PYOA 1IZ9A 3FIJA 2DFNA 1ABFA 4ZAXA 5BMVF 3A0RB 2AMVA 4Y6RA 3QG1A 1BJTA 4FHZA 4XSHA 5IC6A 2G67A 4R8KA 5BSRA 3U1VA 2WR8A 4C7KA 2HBZA 4ER3A 2V3CC 2C4KA 4EO4A 1FNNA 4NRDA 1SUPA 4QM7A 5CEJA 1UDAA 1R7RA 3BILA 3B5JA 5ALYA 4JV5B 2LZ0A 1CW2B 3E61A 1QQ7A 2RGAA 3LO5A 3P2EA 1VJCA 1DAEA 2P62A 1WXFA 3SDBA 4EYQA 4FW8A 4FWTA 2WWXA 1FMTA 2OCAA 3LT0A 1YDGA 3H2IA 4ISCA 3UJDA 1FS4A 4R7ZA 1ZLYA 4MRMB 4B76A 5I4IA 4EF4A 1FOEB 2D54A 1OZGA 3PE6A 3AUUA 4RU1A 1R1DA 3KLPX 3LHDA 3HYCA 2HOQA 2GPJA 2P2GA 1GL3A 1XRRA 5FBQB 3T3GA 3HGMA 1R4NB 1YV9A 1TK9A 3GP3A 3VKWA 4F3KA 1EINA 1DBVO 4FGSA 1BGWA 1KDRA 3IAM6 3PNMA 4PQGA 5TJ9A 4DCVA 2A1UA 4NICA 4ZDIA 4BBAA 4LI0A 1LI5A 1B8UA 3QSYA 3NKFA 1TVKB 1U3UA 2ADFA 1NYTA 4FFVA 5K0BA 2JLVA 5DNDA 3SDSA 1IEWA 4A8PA 1MN6A 4E3WA 3EFBA 1AM4D 4F8JA 2W6NA 4KUEA 2C3PA 1RHJA 4GBGA 5B58T 5I3CA 1GJRA 3EG9A 3WNCA 3WYGA 3KLMX 5B4VA 2WNSA 1CDEA 1S3SA 4DSTA 2J7PD 1JZTA 3WNZA 3ADDA 3MGCA 2IS6A 1I4TD 2R7AA 5GINE 1LJUA 1VFNA 5IJWA 1ZBQA 4GKJB 1G291 2GH1A 4XA8A 2JZOA 1FSZA 1QX3A 4ZCSA 1A1VA 2WG2A 1QO7A 1H4VB 3V8EA 3HHEA 1U9CA 2A8YA 3LUDA 4DDWA 3L4JA 1M0EA 3A1UA 1AQUA 5JRDS 2I80A 3BHMA 2WJGA 3P20A 4UTXA 2LVBA 3C5CA 4XH9B 4BFVA 4DHWA 1PNRA 1V41E 2Q5CA 2DTDA 1V1JA 2I66A 2I76A 3FXAA 3Q3VA 5A03A 2H4JA 5KTSA 3OLVA 3G23A 4YNBA 3HK2A 4JLOA 1MIOB 4R2IA 1ZU5A 3KQHA 1ISJA 4B7ZA 1Z7YA 2WDZA 4EKYA 1Q0LA 3M6VA 2P3SA 3WG9A 1XKTA 4DDVA 1U0BB 3MMNA 2W2VA 1DIOB 1USWA 4LOJA 4XD2A 1S01A 3ONNA 4XIFA 2WG0A 4CM6A 3PXGA 1K2WA 5JAMA 1KI1A 2PLNA 2VT6A 1BW9A 2MWMA 4FR5A 2A1TR 3BZUA 2CGEA 2FW0A 2FVXA 4HR7A 1JLSA 2J48A 1DQPA 2QRMA 1RWMA 3HBLA 3MWKA 1Y9EA 2GRJA 2PD6A 2XDAA 4MKHA 2OXIA 1E8MA 3A37A 3MBIA 3SS7X 5KX5A 3THYB 3CQ9A 1QYCA 4IUDS 5PNTA 3VYRB 4RQBA 4KP7A 1HTWA 1W9MA 4MYCA 4TZTA 1EKXA 2E0IA 1JN0A 2FSUA 1KI3A 3EVFA 2V4UA 3QPWA 3UMRA 2AXEA 1N6PA 3KJZA 1BOOA 1JQEA 4MITA 3VHXA 2Y92A 4DWWA 3AUFA 1XHEA 3KPUA 2QN9A 3GHYA 4II3A 1TVEA 4EI7A 2BDEA 4NX2A 5DU2A 5IHXA 2DJIA 1BA2A 2A4MA 5FWDA 1ADBA 1XWWA 2EFCB 3MYYA 2O48X 1QP8A 3CY6A 3Q9UA 4HGQA 2PWYA 3GA5A 4HF7A 4P82A 5G3YA 1LFAA 1VMIA 2NGRA 1Q0ZA 1JDZA 4W5RA 1GNTA 1FTQA 2J9ZB 2O0HA 2XTZA 3LY5A 1FNSA 5DHQA 4YJ3B 1E2MA 5LIPA 3W78A 1TEZA 2Y0CA 2QZ9A 3MLBA 5C8ZA 4IWYA 4YY3B 3CZPA 2J67A 2HK9A 2BRUC 5BUSA 3CW9A 3A7DA 5T41A 1GPNA 2QDXA 4JROA 3KDSE 2O2HA 3EDYA 2AWNA 1IYZA 4D5EA 4XGKA 1S2LA 3KJEA 3EZ7A 4IZHA 4NYJR 3O83A 4Y1RB 4AKSA 4CFYA 5AVSA 4JDUA 3RRYA 1JQLB 1NQAO 1ZAKA 2J6CA 4OL0A 2BFEB 1QZZA 3C5VA 1KJ8A 4U3JA 3BFJA 2YWGA 4IJKA 3SNHA 1MDBA 2LPMA 2PL3A 2ASEA 1L5SA 1FP7A 3A06A 1QOZA 2IXGA 3OE4A 5LXTA 2CVQA 3KSUA 4JUAA 4DAOA 3LUAA 1YC2A 1L7AA 1FVFA 2ORWA 4XWGA 4C7VA 3HP7A 3WMGA 4D45A 4DM7A 4OB8A 1Z88A 2LP4Y 5EIOA 3UK7A 3DEHA 3ZDQA 1IUOA 1Y8AA 3ZIUA 5ALNA 1L4EA 2OBLA 4US1R 5F5LA 1KQNA 1VLZA 3RC7A 2SNIE 3FWKA 3WRXC 4ARUA 1WE2A 3F46A 4CHGA 2EVWX 4AKIA 5JAIA 2AOTA 2H1RA 2HF7A 2F6RA 1A2KC 3B82A 2JIRA 1AIPA 3VBCA 5C1PA 1R3DA 3H17A 4BV8A 4BMVA 1TYAE 3PHHA 4D43A 3R9XA 3PT5A 4WXEA 4KX5A 4EJ0A 2OV3A 5EMJA 1C1XB 5KJFA 4M8SA 1NKSA 4QBFA 4LFCB 1V2HE 2J0EA 2QPAA 1DKNA 1TECE 1PQUA 5FA5A 1MO5A 3WGQA 4DZRA 1EWYA 5BW8A 1DBRA 2VHEA 1JVBA 2ZUFA 4FHCA 4PS0A 1IMOA 3Q9NA 5FB3A 4H3SA 5FPYA 1EXDA 2IBTA 3CGGA 2BEJA 1I7DA 3CHYA 3K5HA 3PWKA 2ANBA 3L93A 1RJEA 3PPVA 4EI8A 3EPRA 3Q5DA 3EDMA 3PC4A 4GEGA 3ELUA 3FY4A 1BRMA 4F93B 4J7AA 7MDHA 3HEMA 2IU0A 3CEAA 2J9FB 5HGXA 3AO0B 1U99A 2IEDA 1S2DA 1ZQ1A 4NS4A 4KVZA 4MDYA 121PA 1Q0HA 3VNRA 1B2RA 2C7GA 4W7HA 5G1NA 4I55F 5ILQA 5BW6B 4RDHA 2DUJA 3RS5A 2Q1XA 4IDOA 3TNYA 4I3FA 2Q4RA 2QI9C 5JCJD 1PN3A 4O4IA 3FZGA 1HYBA 1QIDA 5B1IA 3V7NA 2GDZA 1DADA 1EIWA 4O4LA 4JD5A 4BQPA 1XTKA 2HJGA 3CLVA 4JLSA 2OFOA 1U31A 2VDWB 1SUFA 1YSCA 3GZ4A 4W9MC 2RIPA 4MVJF 4G0ZA 1XCJA 1TPYA 5EJ4A 4KNVA 1N2HA 3QE4A 4JJZA 2GESA 3WRXA 2I2XB 2YFYA 1R6VA 5B4UA 2HJSA 4M99A 3AFIA 2NXCA 1ZUNB 2X3YA 3AWDA 3GLSA 3H84A 1UBUS 3KDPA 5KOHB 2XVYA 4AF6A 1WPGA 2W90A 3BWEA 1LW7A 3FJYA 3ZY5A 3F9RA 4LTMA 1ZC3A 1BRTA 3DLPX 1UFRA 3JATA 4M1TA 1S2MA 3A3KA 3JD4A 4ZT4A 4OLJA 2XUZA 1M1YA 5K01A 1KNQA 1T8UA 2UV8A 4IDGA 2PKQO 4ZPJA 2P35A 4KQFA 4M54A 4KWIA 2C04A 1KI2A 3DVSX 2ACEA 3H87A 3HY3A 4FYHA 4WE3A 5JG7A 5K20A 3TECE 1DBQA 1JHYA 1V5EA 3AINA 3OEYA 4LK2A 2FN3A 5AW3A 1G5IA 1FX0B 3UENA 3IQZA 4BFUA 1WY5A 1W4RA 2GYYA 5GM1A 1VHWA 4BO9A 2C00A 3BE6A 3HBNA 1JFTA 3DVQX 2JI6A 1KERA 4PTZA 4HZGA 1W36C 4B3BA 1Y37A 4IJMA 2UUAB 3ONEA 1Q1QA 1U4NA 3S3TA 1U0SY 4LZLA 2JBWA 5LYJB 1QVWA 5JZ9A 2W4MA 1ZI8A 3K94A 3JRNA 3OE7D 4E13A 2PUFA 3MWYW 5E0OA 1G21A 1QIMA 1HLGA 1TCVA 3JASB 4L51A 4O0MA 4OGLA 4WNCA 5KVCA 1XCPA 4LFAB 1AKYA 4P8RA 4FIDA 1RHUA 1NL3A 1OB5A 1XMVA 1UK6A 2WZQA 1BXKA 1NOJA 2TS1A 1WKBA 4ZO6A 3MTIA 3DF7A 4AMZA 5DYIA 4BFWA 4I5IA 3AETA 1G16A 1ACMA 3TCKA 1RYYA 1XZEA 4ZCQA 1SH7A 3D5TA 4FYJA 1EBFA 1RAIA 3E5NA 4KBYA 3P0RA 4XYLA 1KY3A 1YRAA 1N2ZA 1Z5VA 5BWMA 4P33A 4KOAA 2IXEA 1A9OA 4EATA 4JU9A 4J7UA 2WTUA 4TL9A 1N5JA 3BHJA 1Z25A 3WGTA 3ZBUA 3A4IA 2BH2A 4KLZA 3FDXA 2C3UA 5BN3B 5KOJB 2Y1KA 3ZHTA 1DWUA 1MV8A 1PK9A 1XU7A 3H5LA 4FGKA 3O1IC 5DNWA 2G40A 2V6MA 1HT3A 3QVLA 2JARA 2GN9A 4H7FA 2NUAB 1BXGA 2W6MA 2Y4OA 2B3DA 4WIAA 5BSGA 2HB6A 1WB5A 2HFJA 2IHYA 2XD4A 5CTAA 2BHNA 1L5RA 5C31A 4BCDA 4ALIA 3QMPA 1UDCA 1G64A 3DAFA 4G81A 4F8YA 5KQMA 2X0NA 4UW9A 2D00A 1F14A 3ZXUB 4OYYA 4BRSA 4PX2A 4HLUC 4AX4A 5ALSA 1Q44A 1BCRB 5B3JC 1II8B 5BSEA 5THKA 4S04A 3BTOA 4W5NA 2NSDA 4URFA 5AKKA 1PSZA 4ADSG 5IANA 1ISHA 5M5BA 4EYSA 4U9UA 1D2CA 3EOBI 2JJ1D 3D2BA 5GONF 1SB8A 1D7OA 3I64A 4DABA 1EUYA 3ACDA 2H8GA 5K6RA 1I3MA 4HEHA 4ZAZA 3K9GA 3TKLA 1L7NA 5F73A 5JFTA 3I9MA 3NTRA 4M0LA 4Q05A 4OHCA 1R37A 3P1JA 3P5SA 2ANCA 4GECA 2H1SA 3TTWA 4UFPA 4YVFA 2PUCA 1M75A 4PG6A 3A1VA 5AM1A 3OMWA 1GNQA 1J5XA 4OO3A 3VZPA 1QH8B 4ABYA 1S7GA 5KJ1A 2F55A 3AGPA 3LF2A 4BMCA 4D57A 4BE9A 5HW0A 3N2IA 2HV8A 4V1CA 5FUMA 2I4OA 1YBFA 2PRKA 3T06B 3E9DA 1O6FA 1FTNA 4WY8A 3TX2A 1JFSA 3AF4A 4MOWA 3ZY4A 1A9XB 1LRKA 4CG0A 5AXAA 1A5ZA 1YZLA 1KAEA 3TDMA 1Y3HA 3KM0A 1VOTA 3IPLA 4J1QA 4F1WA 2AV6A 2D0OB 2QU8A 3Q6IA 4R31A 3QFFA 2F9MA 4WV3A 4WZAB 3GLTA 1A27A 1RJ9B 1EHYA 3QP9A 3RASA 1G3UA 4GM4A 4E33A 1MD9A 2XTAA 2F4NA 1E1QD 2XNSA 2ZBQA 2WKQA 2OK8A 4KTTE 4EHNA 4JT2A 4AY5A 1OA0A 3BOSA 3E1SA 4KQHA 2ID8A 4C6TB 2A58A 4MWCA 2I4LA 3E84A 3O8QA 2B69A 2ZSHA 1M34A 3I1JA 1XLUA 3K2BA 1SZCA 2G7MC 4ZEVA 3A1SA 4FEAA 3NKVA 3AUTA 4B6SA 3GP8A 3VX3A 2AHRA 4ARSA 1LV7A 3DDWA 3E81A 5IP5A 3EEBA 1PL0A 2XUQA 2IQIA 5JALA 4C7OB 4G24A 5DGXA 3PS9A 3AX6A 4LA4A 1AQLA 4K2AA 3ZZUA 1ULHA 3HDGA 3LG2A 5BR1A 5EKTA 2DKOA 4U39A 3UGTA 4C07A 2DVMA 4YJDA 3L8CA 1AXRA 3HYRA 4ILEA 1ESNA 4B74A 1GTG1 4Z9AA 3LVRE 5H59A 2BKXA 4FNOA 1J5EB 3AONB 3OC0A 1AHHA 1YTLA 1UPXA 1JXAA 5DNVA 2VJCA 2WSSD 4EFLA 4YUVA 1KRWA 2VXYA 2JLYA 1NUTA 1QIIA 1DO0A 1ZI9A 2GXQA 3ISTA 3SFTA 3TRHA 5ALHA 1WPQA 2EC5A 2IW1A 4E30A 2C78A 4UVHA 4EDHA 2G25A 1XYYA 3CUUA 3U80A 3PC8C 4ZT5A 2BIFA 3RPEA 2O2ZA 6PFKA 1ODIA 1VSTA 2FMXA 3GEBA 5KYKA 1HDIA 2HQOA 1TLFA 5J3JA 2FMUA 2FHPA 3R3VA 1F9AA 1O8BA 2VP3A 3MSXA 4RM3A 1Z3CA 3SKVA 1L9KA 3VV3A 3CNHA 1RADA 2RARA 3IQDB 2CZCA 1QO9A 4E07A 4I9HA 4E03A 4GKVA 3C6QA 4RKQA 3I12A 3V7YA 3C15C 1SBZA 1XZQA 1G59A 2WKRA 3W5HA 1SXJA 4P4UA 2QZSA 4D4JA 2ID7A 2CNDA 3GT3A 3H8WA 5K4AA 3NGLA 5SYAA 4RDCA 1U9IC 3DO6A 3L6OO 3GLFE 4AZ3A 1MAVA 4C6HA 1PR5A 5CIYA 1MCZA 4UASA 4IV5A 4HDCA 1PJLA 3FHCB 5G0WA 2VHUA 3AKDA 4YDHB 4ZA2A 3OZVA 5B7PA 3HLYA 1H4TA 1PV1A 1W5BA 2E4ZA 4U4AA 2B7CA 2GPNA 3G2JA 4DMCA 4RE5A 5I7VA 4ZDWA 3OZRA 4JWKA 4NC9A 2EX4A 3AYZB 2FLVA 5HIAA 3HYTA 3E9QA 3LPLA 4IDCA 5AR1A 4AVYA 5K0CA 3PI6A 1M8KA 5HEKA 1LLUA 1WPXA 2VPTA 3GUHA 3LYUA 6CHYA 5CM9C 2WTAA 3WYNA 1OVMA 3I9V1 4YCNA 1XA0A 3JD0A 5AW9A 5F7JA 5J23A 4CT5A 4QWWA 4OQMA 2B4AA 5DHUA 4GKKB 5JYBA 1YZVA 1ZGGA 3P0IA 2VS1A 3IMFA 3BL8A 4UTPA 1EWKA 4B7AA 4BQRA 3T3NA 2BI7A 2HNKA 3SLKA 4TWAA 3K35A 4LY0A 2C98A 3BMCB 4O4LB 1RI1A 4F6RB 1K98A 4NABA 3SEZA 2A3NA 5FWXB 3GAFA 3HCOA 2P0EA 1Y82A 4NV1A 3T7SA 5B55A 3NWJA 4KLCA 3TNFA 2ZE6A 4NK4A 2BT4A 4LBYA 4DN6A 3NOQA 1T5OA 3A36A 1YB5A 4MVJP 3AP1A 4F60A 2Y4NA 5AUPB 2C54A 1XA4A 2Z83A 4Z3DA 1K7YA 5IDVA 2BP7B 1ZM2A 1OH6A 4MCHA 4PRLA 1S9DA 2CDAA 3AXSA 4UOQA 1FLVA 2IPNA 4OXKA 4FBLA 5HS4A 1SVIA 2JAWA 1AA6A 1OQAA 2NV6A 3QIVA 4NF2A 4PX3A 4BVEA 5EWJA 2Q07A 3H6HA 2C9CA 5FFMA 3WSTA 5B2FA 1H2HA 5I01A 1GAXA 4ASUD 3WWYA 1ZYUA 2DH6A 3KD2A 4AXBA 5BV8A 4HTFB 4D02A 2XUIA 4RHEA 4EECA 4G9EA 5KJEA 2IL1A 4NJEA 3H16A 5EESA 3TF5A 1XTRA 2LW7A 5JR3A 1L7XA 2H1IA 5AK4A 5AOCA 5BR4A 4JBHA 4RELA 3PF8A 1AQJA 1VP3A 4G01B 2IHVA 3E9CA 4MYSA 4Y1RA 2IV2X 3IUEA 3OQHA 3ZI4A 2HLDD 2IUUA 1WA5A 2J6IA 3PNPA 1BD4A 1W2HA 4BZQA 5JXHA 5JCZA 4DR3B 4HEA1 3TZ6A 5D85A 1IBSA 3LH5A 5EZQA 3FWPA 1FPQA 2HSGA 5CT5A 4H6XA 1CUVA 4DPLA 3D6FA 2ZTMA 2R68A 2R4UA 2YZMA 4GXRA 4W1RA 2E55A 1RRMA 2C92A 3QVSA 3DCNA 3LPNA 1QP7A 3HJAA 4UQPA 1DJPA 1WUHS 1SBTA 2DPHA 4LCJA 3JQCA 1X7YA 3DR5A 3OX1A 2EWVA 2IW3A 1C9KA 5DSTA 3SXUB 5FAKA 2QJWA 2FWRA 3I23A 2GJ8A 3P45A 2AG6A 3O82A 3COZA 3ED1A 4QUJA 1JQDA 2O2GA 3S99A 4WZZA 3EXEB 2ECKA 4RVNA 3EMKA 4IG4A 5HK9A 2FWPA 2SKCA 3O7MA 4FJ1A 4PZAA 4WN3A 2JATA 1N1DA 3BRSA 3H9GA 5CA1A 1XZAA 1YIAA 3GCZA 3W8EA 1EB8A 1QF9A 2BFEA 2Q29A 3O21A 4E12A 5KU1A 5ALKA 3DWGA 1Z0JA 5E1OA 5FJIA 2H2GA 2JEOA 5IKEA 3GT7A 4BCBA 1HL3A 3A2LA 3TRIA 3BHIA 1GCGA 2FGKA 1G20E 3OCWA 4Q24A 3E5RA 1W0CA 4R3NA 4CV0A 1YZNA 4HLCA 3OCJA 4F8EA 1YKFA 4NMXB 3RIGA 1H2BA 2QVBA 1PT8A 2YN4A 4R9SA 5K09A 2FEAA 4NBLA 2R47A 4EW1A 1ZVQA 4UCXA 3VPHA 3UK1A 1DQNA 1SC1A 3OHSX 5L6MB 5A6SB 3M89A 5E4TA 1N57A 4WA8A 4B45A 1I7QB 4G1VA 5IT0A 3TMKA 4C3UA 4JJGA 1YJCA 3KUUA 4B6FA 5EPUA 2DPGA 4OGKA 5CIQA 2ZBEA 1X7ZB 3GVXA 2F1IA 3L1KA 4N5NA 4LXIA 1LBTA 3M6UA 1TQDA 1YR7A 4Z9YA 2YNMA 1CUIA 2BDTA 2ZWMA 1SOVA 1YKGA 2I0FA 2ODQA 1IY2A 1IY0A 5C7LO 4XARA 2AL7A 5HQJA 1ONOA 3LUFA 1DUSA 1C3VA 1JR2A 1MENA 3AU9A 521PA 1KEEB 3A70A 1WUKS 4HUQB 3DYVA 4D3XA 3K5WA 2HXGA 3VTZA 3A1DA 1T4MA 5JD5A 5DOZA 2JA1A 1T8TA 5KYUA 4LHYA 3I62A 3GFGA 4BFZA 3G68A 4LXTA 3C1UA 1Z8NA 1EIZA 1XDUA 3I5MA 3R0JA 3KS9A 4Q9JA 4CDRA 4F5EA 5HRAA 4QOFA 5CU7A 3THXA 2GPWA 5JQGF 4JBNA 4BWVA 1MP0A 3C7DB 5K0JA 5L3SB 2VPZA 2O7QA 4FSHA 3T7CA 3ZE6A 2Z4RA 2PSEA 5BQXA 1ZNYA 5LQAA 5ILOA 1FU8A 5CPFA 3MTQA 4DM4A 5CLQA 1CDOA 5HIJA 3F3SA 4W9NC 3I9FA 2AVNA 4IPTA 1A9RA 1NU8A 3EWIA 3IQHX 4MVYA 4NEQA 3CZ4A 3NUGA 4WK0B 5ERGB 3Q7EA 3I0ZA 3ZW8A 1N5IA 4BYGA 4R8LA 5GMOA 1Q14A 3VZQA 2R3SA 4PBSA 4F3TA 2YYSA 1ND5A 2H29A 4MXDA 4RKFA 3T34A 3LUCA 2HJRA 4FOPA 5H83A 1TT5B 3CZAA 3NBFA 2GZ3A 2XVZA 3RI3A 3MPUA 4HXEB 3AESA 3T0FA 3TWOA 1XJQA 1AQIA 2DFDA 1QB8A 1NXOA 3PJEA 4O4JA 3VU3A 1BQ4A 3DW1X 4FONA 3A9TA 3U5TA 3FW1A 4C5AA 4TPKA 2R6FA 1EG2A 1RYEA 4KO2S 4UDYX 1ABBA 1KRXA 3H5OA 1BKDR 1PWXA 1RRGA 3RSQA 2HUNA 4JMPA 3DL7A 2C9MA 3CM0A 4GM1A 5IW8A 3T1VA 5DM70 1MOSA 4KI7A 4AULA 3JQRA 1UKCA 1VL5A 4ZO8A 2B1QA 4Z9FA 2XKJE 5FOWA 2FTKE 1OTXA 1PJ8A 1IQUA 2Q2WA 1RZVA 5A6SA 1ORVA 3KZCA 1NURA 4BUZA 4TLBA 3U5ZB 1NC3A 2VZ0A 3OCUA 5FWYA 1O9BA 4HB0A 2OV2A 4D96A 1ODCA 1DG1G 2SKEA 2W6QA 4K0RA 3LFTA 3EVGA 4LECA 5ITZB 2K87A 1YACA 3N2ZB 4IIJB 1JA1A 1LPPA 3I42A 5JFGA 1RJGA 3K70C 3N7TA 4DC1A 3TVDA 2VYFA 1ZUNA 4PANA 4OVKA 4AJNA 4C7JA 3KQTA 2IH2A 2Q3FA 1KMIY 3PTAA 2WAAA 4UTNA 4F06A 4TKZA 1SG6A 1XKQA 4RJ2A 5KSOA 3AI3A 1VM6A 2VJKA 3HXLA 3IT3A 3DEAA 3NW9A 1SXGA 4Z7JA 5EI5A 6LDHA 4CMHA 3EBPA 1V16B 4QRDA 4YMLA 4NESA 5H4HA 1QTRA 1E1RD 3A4TA 2XECA 1GXSB 1U1CA 1Z37A 1YS2X 2V65A 3D8NA 4O2RA 4OYRA 4WK2B 4TS9A 1EESA 2XTMA 3LLSA 2VSNA 2YWFA 3RKUA 1U0LA 3GAAA 1NT2A 3HXOA 2BHTA 5DHPA 4IIYA 2B98A 2P4HX 4G1FA 2FZGA 2AJDA 3F5SA 1PL8A 4AG6A 4YRSA 3KOWA 1NZDA 2CCGA 3MS2A 4V02A 2WF7A 4R5HA 2WPDD 3M3PA 1CY0A 1L1RA 1S1CA 2PT5A 3EIHA 3JWGA 4I50A 4MLDA 3OZUA 5FLXA 3UIEA 5KPDA 1DELA 4MPRA 1UKZA 1MEOA 1SCDA 1SBHA 3GELA 2AOUB 4AY2A 1TUBB 4YUAA 4Q7JB 1THZA 4UVGA 3VC3A 2ZI6A 4YCAA 3NTXA 1FF9A 2J09A 1KYXA 2PZBA 1X74A 3CIFA 4R54A 1RRVA 2B8WA 4ESEA 1GU1A 1UMCA 2XTJA 5IPFA 4YP9A 5F1KA 4CXMA 2CXNA 5HIKA 3GG2A 4O2AA 4Y67A 4RTNA 1USKA 2JW5A 5I5GA 3VR2D 4EY4A 2PV0A 1YIOA 1V2GA 1PG2A 3MCTA 2ZRHA 3Q2IA 3H75A 3FDZA 4HTFA 4JYMA 4AN1A 5ICEA 5K3OA 1N32B 4PIVA 3WDLA 4F7DA 2AYXA 4CM4B 5L8VA 1V37A 2ZSIA 1MXHA 4OQNA 4A8HA 1PIWA 2HQSA 3GCWA 4PAGA 1BS2A 1CNEA 4BLOA 3BGIA 4KYUA 1E3IA 3GEIA 3MJVA 3RU7A 1PX0A 1Z36A 1NATA 2I6GA 2HEIA 2Y1OA 3UJPA 3IKJA 3RFVA 1JQ5A 2QT9A 3EBOA 4OCZA 4K9KA 1SQ6A 4Y8VA 3O47A 2C5GA 3OP1A 3PC3A 3TZEA 2IGBA 1IB0A 4N12A 4QDOA 1E1NA 3SG0A 3WK6A 1TA0A 3DULA 2QD3A 1PJ2A 1SQSA 1N7GA 5C32A 3CXRA 3Q3JB 3R23A 4H7DA 3FUVA 3I32A 1L4UA 4DLYA 2ZTHA 1E2JA 2A9KA 3HE3A 2BI8A 3LKVA 3LLVA 1Q50A 2RHMA 1KMMA 4HAOA 5EZYF 3TR5A 3ZKAA 4EJFA 2GK4A 1WXXA 1UM9B 4YPVA 2CUNA 3BJRA 2CHVA 2DB3A 4KIFA 1PGJA 2Q3HA 1T4CB 1CE8B 2YJ6A 4LHEA 1XEAA 4FN4A 3BWDD 3EJWA 1BXRA 2R65A 3FSEA 1J2TA 2OILA 3DOOA 2H9IA 1I9CA 5EQJB 2DTEA 4B31A 3GT4A 1IQRA 3EQ7A 1DHTA 3AM3A 3HH8A 3O84A 4NXMB 3E58A 4DRYA 1Y4AE 2VNSA 1HT1E 3AHCA 1A0OA 4L5JA 2A9JA 3GBPA 1RLMA 4X6XA 2JLXA 3CB4A 4NEHB 4QAQA 3RW9A 3VPAA 3VPFA 1WZIA 1O9HA 1XI2A 5KSWB 3VJKA 1EJ0A 3GD7A 4U3JB 1B0AA 3TW4A 4QG3A 1WJGA 4LMPA 1ZHFA 2FE1A 2W2NA 1XAGA 3MJDA 1SELA 3V1KA 1J33A 2SCUA 2GK7A 4BLRA 5DGCA 3JQAB 3BFPA 1P1RA 3A3NA 1TJ3A 2OQRA 3ET5A 3KYIB 3NOVA 3PCRB 5BT9A 3S40A 2PZGA 2ZYTX 1RR6A 2DPXA 3LGAA 3DKIA 3S44A 3W2EA 721PA 5KNDH 4ZV7A 4L6AA 4HMOA 2H9YA 1R5BA 2FFRA 5AVTA 5AJVB 1NVFA 2NN3C 4GWKA 5EHGA 3OSZA 3TNDA 1K88A 3MS4A 4I81A 4CMGA 3FBTA 1GZ3A 3GEEA 4M37A 1IZ0A 3WMEA 2QUKA 1PSWA 2AFIB 1Z4QA 3L7IA 4R41A 1C2YA 1KSHA 3NEAA 3CX3A 4RIEA 2Q0XA 1S4MA 2R1TB 3J7TA 1RW4A 4GKAA 4HNRA 3WKCA 1JAIA 3SVTA 1SXHA 4MVJI 1LLFA 1A5SB 1HE1C 4D3FA 1QUFA 3WLHA 4YO7A 1A5AB 1XKXA 1DKUA 5K3FB 3KKEA 2K2QB 1L5MA 1YRBA 2FMHA 3BTSA 3PWZA 1RPJA 5ESXA 5I7EA 2WVJA 4R7GA 4XCXA 3VPBA 4ENWA 1ORIA 3EA5A 1CS0B 1ZD9A 2OBYA 3CUSA 1QF7A 5DB4A 4E31A 3H8VA 5I7HA 1HNWB 1ZGZA 4OU4A 3R7DA 5FNVB 2OLJA 4KDFA 1J24A 3ONVA 4GLBA 1NULA 1A2OA 2CD9A 2ZAOA 4PGAA 1B14A 3LW8A 4YB8A 2A88A 4H9GA 4YRQA 1BNCA 4D0LB 4ZCIA 1VBMA 3PRYA 4ZQIA 4BXOA 4ALMA 2P9ZA 3PNQA 3LP5A 1CD5A 1KDYA 4PC1A 1KETA 2R44A 1CJTC 2TMYA 2GFQA 2J33A 3GQBB 4KXLA 4MUMA 1XLTA 3H2JA 5CVUA 3F5DA 3A28A 5IZ4A 3VISA 2F2TA 2HDWA 4RMGA 3R5KA 5BW5A 2PCLA 2Y9PB 2O2IA 5J2TA 3V48A 1TW2A 2G4CA 3P9IA 3QVMA 3WQQA 1WHTA 1SHTX 3S2IA 1CZNA 1X2BA 1LDBA 3M9WA 4GE0A 3BZBA 4PGFA 5KREA 2OLKA 2RAUA 5GOZA 2REQA 1XTUA 3EVCA 2AN9A 3E03A 4X9XA 4LGMA 3WK9A 4CM8B 2ECOA 4ZODA 4DQ0A 1V5IA 1Y98A 4ZMRA 1QLJA 1N5DA 3EXFA 4QREA 1U2DA 3EQ8A 4OPMA 3COWA 1NZJA 4IJ6A 4PSKA 4YRDA 3AM4A 4ANFA 4BNDA 4Y18A 4RA6B 5KSPA 2YHIB 3B36A 4UTRA 2OC4A 2F1RA 4H59A 1J99A 2CNWA 1ZUD1 3PGXA 4NIMA 4BPRA 1B3RA 1QJ4A 1ZD8A 1VHJA 3WHKA 4BWYA 1PG5A 3A26A 3K09C 1B4DA 1YASA 3AR7A 1GWNA 1YQEA 1LLQA 3G0GA 3PC2A 4NAVA 1HQCA 1NW8A 2WIGA 4PPQA 2J9RA 2J59A 4YEDA 3FCYA 2F8TA 3HBMA 3L77A 2J7KA 3NGMA 3BF7A 4U7WA 4V0MA 5BWLA 1EJBA 4YJ2B 1UM8A 3UH0A 3M4JA 4I50F 1G8AA 5J5AA 1N7IA 1BFDA 1YRLA 3SEFA 4JJFA 2ACVA 2H1LA 4PR0A 2P0AA 4HS4A 2CXXA 3L04A 4RA9B 5KEIA 1Y9ZA 3KZNA 3MXTA 1DQSA 3JZAA 4M21A 4UEQA 6Q21A 5LP6F 1T6NA 3BDAA 3P9CA 2L42A 4TQGA 2J87A 2LKCA 3I53A 4K3UA 4U7FA 1NX9A 4OX9B 1O89A 3AP3A 4LF9B 2OORC 3K1TA 3V2IA 1Q0RA 2O5EA 1D7AA 1FXSA 1P1HA 4YBRA 4FFPA 4N5HX 4N9WA 3UHAA 4MHOA 4R71A 3X1KA 3IYLW 1F8UA 4NOMA 2ATIA 5KU7A 3WZ2A 1KMHA 1QHEA 4YJFB 3VBEA 3FSJX 3MLEA 2XW6A 4FMCF 2VUTA 4ZZ3A 2YIVX 1AS0A 3P0FA 2QVCA 1CE8A 4GYKA 1WMDA 4J29A 3E2IA 4L8GA 2VSQA 1JG1A 1SMKA 4BE7B 2AQIA 1I7LA 2FOIA 3L18A 1FYDA 3D4PA 4AJ2A 3AVVA 2PGNA 3BA6A 1YDWA 2VVTA 3ZLJA 2MSNA 4WZAE 1HK7A 2D2EA 3QVOA 4WLFA 3BAZA 1EUCA 5CVCA 1QFYA 3TIVA 5A4FS 5IASA 4CQLA 2K2WA 2QD1A 3RF6A 4B84A 4YCSA 1FZQA 1IJKA 5K4HA 3QLTA 1KU0A 2Y05A 3OQJA 4FEGA 3QBEA 4UC0A 3TVYA 1ULSA 3AETB 1UC9A 2L19A 3A1NA 3HDVA 3VC7A 4ERNA 3VOSA 1TJNA 2HHLA 2ERYA 4HRVA 3TD9A 3O7WA 5EMLA 3C3AA 1P2TA 1MJNA 3WDSA 3PHCA 4C20A 3KKLA 1NLMA 1MO4A 2V55B 4ZTUB 1LPSA 3F49S 2YL2A 4OKIA 1TA9A 3NTUA 1JQ3A 1KYQA 2XAAA 1BYUA 2VRWA 2XEDA 3OCYA 3HO6A 1V7PC 5ALLA 3GPCA 3EW9A 2ONJA 1IEVA 2WV9A 1JEQB 4I1RA 4Z3OA 1IL0A 1RWWA 4KPGA 4YMIA 1VLQA 2W0MA 3JQ9C 5DV9A 2ZAIA 1E2EA 4U8GA 1KYYA 2GD2A 1NE2A 1Y3CE 3QELB 4BIMA 4CMEA 1WO8A 2B6HA 3THWA 5G02A 4B4OA 3FPGA 2OD9A 5CGZA 5K3EA 1MRZA 1NF3A 4I9FA 4KR7A 1MB3A 1T2AA 4I8DA 3IP5A 2C7PA 1L8AA 3OF3A 3QLUC 2VO1A 4ZYXA 4US2R 3HNOA 3KQUA 3FKSA 3HLKA 3T3MB 4KWHA 3T7EA 1I2BA 2AJCA 2ZVJA 1J42A 3O73A 2VK8A 2UXDB 1U98A 3BWYA 1V1MA 2P2NA 3HP1A 3K0HA 3M1YA 4K9SA 3GD5A 1WXWA 2GUWA 1ZC4A 2D3TA 1L7OA 1CVLA 3D43A 5ICCA 3UMYA 3TI7A 1Z63A 1E79A 3ADCA 1ZSNA 2OP1A 2PGJA 3H5WA 2ATCA 1VRWA 4RV5A 4LVCA 1WUTA 3LP8A 1ZXXA 2YYYA 1OI4A 2C96A 2WSIA 1SCQA 1SCNE 4MQUA 3B1YA 1GITA 2FPUA 4B32A 2ZWIA 4OHYA 2CW5A 3UC9A 5EL0A 5ICGA 1FTGA 3ZZ0A 2PEZA 2WYHA 1YFJA 1E4YA 1MR3F 3OD5A 4FFNA 4E0BA 3KAJA 5FUVA 4Q66C 5L6LB 3TUZC 1R16A 4BAGA 2AZ4A 4NSNA 3V8PA 1YK0A 5HUJA 3DEKA 1MAUA 2BKEA 3UWSA 1M3SA 1GTL1 4KO3S 4B5LA 2OCDA 4RF5A 4UNNA 2ZJZA 3CNEA 4PZEA 4KMMA 4PPGA 2BCEA 2YFHA 2YFKA 1U5CA 1VRCA 4P2GA 1KJJA 5A3SA 4IMPA 4BLVA 2I99A 3LYAA 4AZWA 1T29A 2P3LA 4N82A 3L8HA 1I32A 3LK6A 4XRRA 3VR0A 4B5KA 4E1VA 5K8UA 2QLFA 4XUCA 4M9XA 3E9MA 3FCSB 1XTZA 1GKIA 3B48A 1N8SA 1K68A 1TADA 1V6CA 2VAMA 3TQRA 4A16A 5LQNA 3BGWA 1IZ8A 1HYQA 1P9NA 1N2BA 2YY6A 2IGTA 3C8DA 4G5QA 2V5VA 1GSOA 2H65A 4KC0A 4PAOA 1FIUA 1PEDA 3KEQA 5D7BA 4WOKA 2YRXA 4D56A 5JAZA 1YFZA 4GBJA 1QAQA 1YQTA 4FFRA 5LLTA 4KSBA 1MFZA 4A4DA 3L7KA 2EDAA 3LQYA 1GRNA 4QHTA 3AB3A 3SHTA 3E7DA 4HAUA 4QE3A 7REQB 4I14A 1Q19A 2B5VA 1K3TA 1C1XA 2ZUWA 1SU8A 3HHPA 4UKDA 3C87A 2I6TA 4XPIB 4GLJA 5H9VA 5A0FA 2FP4A 1Z39A 4OTZA 4LJ8A 4R51A 2HF8A 2O9JA 5CVDA 2ILTA 3P7MA 1OZ0A 2QM3A 5EHQA 5JNLA 3GU3A 5KTTA 2XBUA 2OHJA 2GETA 2QSUA 1K63A 2WUEA 1VGQA 4UNRA 2OT3B 2ZBDA 4DUGA 2VKTA 3FNGA 5FD8A 1BVHA 2PUBA 1VC2A 3PFFA 5ARCA 4EG5A 4OHUA 2OCKA 2MR5A 1VJRA 3NDIA 4E4RA 1CZOA 1H8ED