4BMXA

Native structure of futalosine hydrolase of helicobacter pylori strain 26695
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
225
Chain Sequence
b'HMVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNSFDAFLEKSAQTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH NUCLEOSIDASE
molecule tags Hydrolase
source organism Helicobacter pylori
publication title Structural Enzymology of Helicobacter Pylori Methylthioadenosine Nucleosidase in the Futalosine Pathway
pubmed doi rcsb
total genus 76
structure length 225
sequence length 232
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmxA00
4YJKA 3PHCA 4F2PA 1OTXA 3GB9A 1TCVA 1TGVA 2A0YA 2HSWA 4L6IA 3FOWA 2QDKA 5CYGA 2QTGA 3O4VA 1ULBA 1TCUA 2AI1A 4YO8A 4OEHA 4E1VA 4BMZA 4BN0A 4R2WA 4PNPA 3EEIA 1K27A 1Z39A 5B7PA 1VHWA 1RCTE 4TTIA 1TD1A 1Z5NA 2AC7A 3O6VA 1N3IA 5CXSA 1G2OA 2GUWA 2HN9A 2Q7OE 4NSNA 4TTAA 3UAVA 4LNAA 4M3NA 5C80A 3OZEA 4L5YA 3KVYA 2I8AA 1PK7A 4GMHA 4DAOA 1U1FA 3BL6A 1Z36A 1RXUA 5CXQA 3INYA 2I4TA 2HWUA 2HRDA 1JPVA 4TXMA 4JWTA 3ONVA 4NS1A 4L5AA 1PK9A 2AI3A 4UC0A 3ODGA 3SCZA 4PR3A 4TXHA 4WKCA 5IFKA 3KVRA 4F2WA 4D8VA 1ZOSA 1Z38A 1OVGA 1PWYE 1A69A 5K1ZA 3K8OE 4DA6A 4H1TA 5CYFA 4DA8A 3KVVA 5F76A 5B7GA 3OCCA 4M7WA 3EUEA 1B8OA 1JDUA 3LBAA 1JYSA 1T8WA 4X24A 4QEZA 1V3QE 1VFNA 1Y1RA 4I2VA 3FUCA 1OU4A 1Z33A 1LVUA 3NM4A 1U1CA 5EFOA 1T8RA 4OF4A 5EPUA 1TGYA 1SD2A 4QASA 4D9HA 1A9QA 3LGSA 2OC9A 4QAQA 1Z5OA 3FAZA 1Y1SA 4DA7A 5F7ZA 4F3CA 1K9SA 1JDZA 1JE1A 4WKBA 1CB0A 5F7OA 4MCIA 3U40A 4M1EA 4DANA 3KUKA 1VMKA 3BGSA 1I80A 1WTAA 4TS9A 3OOHA 3OOEA 1T8SA 3MMSA 4OJTA 1A9OA 1U1GA 1Y1QA 4GLFA 3MB8A 1V41E 3UAZA 3PNSA 1ODLA 1PR1A 1Q1GA 4IP0A 2OECA 4G89A 5F7XA 1SJ9A 3NM6B 1V48A 1PR6A 4GKAA 1PR5A 1Z5PA 1U1EA 3FB1A 1JDVA 3D1VA 1QE5A 4G41A 3OZDA 1B8NA 4QATA 5F7JA 2RJ3A 3OZCA 1ULAA 3E9RA 3T94A 1PF7E 1PR0A 2ON6A 2QPLA 3LA8A 4U2KA 4F1WA 1ECPA 1RXSA 4EB8A 3K8QA 1PR2A 1PKEA 3E9ZA 3UT6A 1Z35A 5CCEA 2H8GA 3UAWA 3DDOA 1RFGE 4NY1A 2BSXA 3QPBA 4BMYA 1ZL2A 1K3FA 3IOMA 4TXNA 4K6OA 2ISCA 4QFBA 2P4SA 3DF9A 5B7NA 5B7QA 1OV6A 4LZWA 1RYZA 1A9RA 3PHBE 1M73E 2A0WA 3KHSA 1YR3A 4FFSA 1NC1A 1Z34A 5EUBA 5JPCA 3ENZA 1RR6A 5FAKA 4LNHA 5ETJA 4LDNA 4GLJA 4MCHA 3OF3A 5F73A 1JDSA 4TYMA 1VHJA 4OY3A 1XE3A 3UAYA 1LX7A 2AI2A 2PGAA 5I3CA 4P54A 4L5CA 1OTYA 3NM5A 4MARA 1T0UA 2OXFA 1YQUA 1SD1A 4D98A 4ECEA 2XRFA 1A9PA 1LV8A 1RSZA 4EARA 4DAEA 1OUMA 1CG6A 3FNQA 1C3XA 5KB3A 3KU4A 1Z37A 4YNBA 4JP5A 4DABA 3BJEA 1V2HE 1V4NA 4F3KA 1NC3A 1RXYA 3C74A 3NBQA 1YQQA 3DJFA 1RT9A 4TTJA 3E0QA 1A9TA 4D8XA 1PW7A 4RJ2A 3EMVA 1YRYE 1FXUA 4YMLA 4DARA 2B94A 1NW4A 5F78A 1SQ6A 3DP9A 3GGSA 3FWPA 1ODJA 3F8WA 4WKOA 1ODKA 1Y6QA 4G8JA 4TXLA 4R2XA 4DA0A 3PNPA 2IQ5A 3P0EA 1ODIA 1V45E 2A0XA 3DPSA 4JOSA 2A8YA 1JP7A 1Y1TA 4OGLA 5F77A 3TL6A 1A9SA 1JDTA 1YBFA 1RXCA 5CCDA 3EUFA 4WKNA 5DK6A 5IU6A 4L0MA 4BMXA 4WKPA 3OPVA 4TS3A 3UAXA 4D8YA 2OC4A 3BSFA 1PR4A 4TXJA 1U1DA 4LKRA 1JE0A 4KN5A 4QARA 4R31A 1T8YA 2QTTA 3IEXA 3OZBA 1Y6RA 1PBNA 3P0FA 4OGKA 2QSUA
chains in the Genus database with same CATH superfamily
3AU8A 5FLYA 3AM5A 5BRAA 3TKLA 1MB3A 4NCKA 4K8RB 4K0RA 1VIMA 2PPVA 1JBKA 4EECA 1ND6A 1D6JA 1ECBA 3HWSA 3ZVMA 2OA0A 2XIJA 2YWDA 1HH4A 1P7YA 2ZEJA 3GJ6A 4PANA 2BLNA 2ADOA 5ICFA 4EHDA 2NACA 1FDIA 3A10A 3PRYA 4F06A 2IF0A 5KJFA 4W5TA 3O4VA 3ANLA 2SKDA 3JZDA 1TCUA 4YC7A 5HFAA 5JZSA 2W6CX 3AVOA 3LA6A 4RF2A 4TS1A 1CS4C 2G67A 1V35A 2NP6A 4EF5A 1NNI1 3REOA 3KDAA 4AZ3A 1IEXA 1ZP6A 2G88A 5FNVA 2ZYWX 1W48A 4I9NA 4M1KA 4ZVOA 3MJSA 3SF0A 5CBKA 1N2JA 3NMUF 3QWIA 5HKBA 5KHOC 1NUQA 5IK2A 4GZ6A 1EWKA 1XZBA 2PZ8A 3A6EA 3LPLA 1GQSA 1Z39A 3COZA 5ARDA 1F1BA 2PUCA 3ZV4A 5FWDA 4R0VA 1V7QA 2W4MA 5ICMA 1C30A 3V2GA 1U2ZA 1V6AA 2W7TA 3W3AA 5DM60 1WCIA 4DIEA 3ZLJA 1VPLA 4UM5A 2X1HA 4FCCA 2VPWA 4GNRA 4DJFC 1LDGA 1WEKA 1B0PA 4R01A 4WDQA 5EHQA 3OX1A 5J2UA 1ESEA 4Q00A 4WW0A 1GGEA 3NETA 1EUCA 1NQOA 2YHIB 4JL8A 3LT4A 4TN5A 5LCXA 1UJ4A 3V46A 4I50B 4Q21A 5AO9A 1ZSYA 1UPCA 1LK5A 3KSAC 3TZQA 4CGYA 1UDWA 3BHNA 3HCOA 2FSSA 3HL4A 3R09A 5LLDA 5CPFA 2GYYA 5DGXA 4P4GA 1EVYA 2VDWB 5LYJF 4A82A 1TQ6A 4RVDA 1R0SA 3SQNA 3ROKA 1MIOB 1W36B 4NAUA 1KHTA 4L5YA 1ADBA 4MW2A 1NW6A 3RV3A 3WP1B 1RWMA 2YHUA 2DG2A 4YCLA 1XNRB 3UW3A 2QUBA 1ISPA 1YJCA 3MQ4A 1ZIDA 4UREA 5K3BA 4BX3A 2WD8A 3HEMA 5DGCA 1ETHA 5SYMA 2B9VA 2NWQA 2UYHA 3EGXB 1ZXXA 3DMTA 4XD7D 3WRWA 1MO3A 1A5AB 2HWYA 4KSCA 3ELYA 4BU0A 4JI7B 2E4WA 2MMGA 2ZR8A 3IAHA 4Q34A 4KUEA 5BSGA 1W1IA 3AG5A 1SUSA 1G2QA 2AC2A 2O20A 3DMYA 5SY4A 4KMRA 3UC5A 4MCJA 1TM2A 4G8BA 4EFNA 1XU4A 1EUQA 1RJWA 2AMVA 3V8EA 1I3NA 5HRCA 4R2LA 3OTOB 2P1RA 2J4FA 5LQSA 1VKJA 3NTRA 3MLEA 4IDDA 4LCEA 2IZ1A 5TV2A 1R6TA 1AUPA 3ODGA 4NG5A 3KKNA 4L8WB 4ZMBA 1WCV1 2EFJA 2FLWA 4PR3A 5BN4A 1Y5RA 1VMIA 2ONYA 2HQSA 3DTNA 3AIKA 1ISFA 2YYYA 3ORHA 3T7JA 2ZLBA 4YRIA 3OZAA 4HQLA 5KTOA 2WVHA 3O8OB 2DTEA 3R4VA 1JIJA 4MWGA 1E79A 1RZRD 3AVQA 3JD4A 5B1SA 4Y7CA 2ZIUB 3MCTA 5KUTA 3ZDBA 2AQHA 1MX3A 1ZOSA 2AJLI 2YUTA 2XUGA 3L0DA 2J9XB 5DI3A 1RWBA 5G2OA 4BCDA 2HT1A 1N2CB 1PJ2A 5CDFE 4RTOA 5HRUA 3FROA 1N6HA 5ED4A 1L1QA 3HRKA 3DYVA 3GDWA 1GXSA 3A3KA 3D3WB 3IHWA 4WESB 3H9BA 4GMGA 3TGPA 1ECJA 1T29A 3UHJA 1RMYA 2M6RA 4ZRDA 1B8OA 2CMDA 4B17A 5I45A 3GGPA 1PP4A 4G1VA 4WGFA 2PTGA 3RODA 3UAGA 1P0MA 2I2DA 2YJTD 3A3OA 2FDXA 2VHCA 4KFSA 4RJLA 1HOTA 4QEZA 4DV2B 1UXIA 1DEAA 5KNDH 1JDPA 3G5AA 3KYDB 5IAGA 4M0FA 2VDNB 1NSYA 4NCXA 1Z17A 2H7CA 5I4KA 2ZRBA 1QYCA 4N5MA 1R0XA 1GN9A 3LYHA 3L7JA 4J0GA 5B1DA 4NPAA 4ZICA 4Y6GB 3AESA 1U3GA 3Q98A 4B82A 1YFLA 2A0FA 5A3RA 1AC5A 4LVCA 3AJRA 4UAVA 3WMEA 3AHEA 4UM9B 2IP2A 2VSXA 5B58C 5L4LA 1A5ZA 3JQ6A 1IJKA 5KHAA 1LBEA 4WMLA 1AKEA 2PHZA 1SWVA 3PF9A 4Z4IA 1I10A 3IIEA 1E6MA 4RGYA 3HP4A 4C05A 4YJ2A 2H7XA 1XEAA 2A0KA 4OHXA 4R69A 1SUCA 2F43B 1A9QA 2CYCA 4I9GA 4YLYA 1SAYA 2QW8A 5AWFC 2RHDA 1QHFA 3BSYA 4ZWNA 4YPFA 5H8WA 4HWKA 4Z8XA 5IAJA 4KR6A 4JC0A 2BLLA 3TH5A 2YXEA 2X3YA 1KAHA 1X7XB 4X61A 5EESA 1K9SA 2H9YA 1G291 3UGQA 2I2CA 4BO6A 3CVXA 1GG8A 3MLAA 1Z4OA 3GVCA 4WKBA 4OHZA 3EZ2A 4YQYA 4I4CA 2D06A 2NW6A 4IZIA 2BMAA 3W7BA 3QX3A 2CUNA 4RK6A 1DV2A 5F7OA 4NJEB 4KEAA 4QXQA 2G9RA 3MD9A 5E9JA 3CUWA 3ZDQA 3THXB 3EARA 1XF1A 2WOOA 4X8HA 1Z08A 5ALYA 3ZI0A 1G60A 4YASA 4M4SA 2GHTA 1E60A 2W2OA 4EW1A 2IDMA 2J87A 1W30A 2WG0A 2CLDX 4OQQA 3MHPA 1W8DA 1J2JA 4Q66C 4IXWA 2WABA 4F5EA 3RAPR 3HY6A 1M76A 2YIJA 1B74A 3ND9A 3ZJYA 4DLLA 2RMKA 3V6MA 4D6PA 2GF2A 3C6KA 4A8JA 4EQ6B 2FMTA 5EWLA 2VIIA 1SA0B 1UAAA 1P7PA 4ZIRA 3ANXA 4P22A 1U98A 1Z7BA 4AMBA 1FSPA 3VZPA 4DMLA 1V41E 1D2RA 2YW9A 2J3QA 4JMPA 2Y1KA 2ZVDA 3F46A 1XLTC 4BFXA 1NMZA 3GK3A 2R66A 2X4DA 3O1HB 1DUSA 5JMPA 4CG1A 4CDNA 5EIXA 2G9UA 4MV1A 4PEVA 4BKRA 1RFLA 2IYQA 1VSQA 1CZLA 1EUDA 3Q88A 4RACA 2ZJ8A 5HK8A 1IWPB 4D9EA 2ZM6B 2FRDA 3CRMA 1G5HA 2AB0A 3B82A 5HSGA 1XVVA 4QUDA 3AQ4A 2QRJA 4PGFA 3KPJA 6Q21A 4CU5A 1NG9A 3G0HA 4A4DA 2C2HA 2W98A 2YQ5A 3SJ7A 1IZ0A 1V7CA 4KO4S 1SUEA 1R27A 4H7JA 1KEVA 1CZRA 3SQOA 2GZHA 2X3FA 3FTPA 4ID3A 2OXEA 3BIJA 4QDZA 5BNFA 1A8UA 1M2VB 3NVAA 5ALDA 3U37A 1W46A 1YGPA 1VIAA 2AX4A 2QEQA 4OK5A 5BURA 3UJPA 4G07A 1ULAA 3AEQA 3NH9A 3H42B 3UH0A 1P2DA 2B98A 1YRAA 4Q4JB 2XJ4A 4U2KA 2I76A 2WJWA 3IRVA 4B5LA 1JPUA 3UJ3X 4WCFC 1F7UA 1CZHA 1DI0A 1X7HA 1Z8HA 5KHLB 1UXJA 4ISCA 4L78A 2CLEB 4HD8A 2ZWMA 3LKVA 3R0JA 4FW8A 5CT8A 2G70A 3D6NB 3GMDA 2O1SA 3FOAA 4FHDA 4UTZA 3ZZNA 3FX2A 1U65A 2DULA 3OEHA 4EYOA 2SNIE 5A4MS 2NQ8A 3BIOA 1A1VA 4D96A 1DEHA 3W3ZB 1EWRA 3QEKA 5DISB 5BT8A 5AI5A 5HYVA 5KNCA 2PV0A 4IDOA 3HBJA 4PFSA 4IVQA 1VKNA 1YZGA 1N9ZA 1P7VA 2YY7A 4KIFA 1C3OA 5BOSB 1XRPA 1MFPA 2FEMA 4JT8A 4NY1A 3B9PA 3I34X 4F97A 3CYFA 5KTPA 2BGWA 2ZRJA 2R8RA 3N2KB 1FOEB 2AZTA 3CRVA 2VQEB 3KHKA 2PZMA 1X0XA 3C39A 4KVZA 4K6OA 5G0WA 4BBZA 3THRA 3SQDA 2PUDA 5JS2A 4JC4A 4XRRA 3HUFA 3DF9A 4X93A 2NXEA 2HO4A 2PKWA 1SXJA 3IURA 4IM7A 1WMAA 4Y1GA 3K0EA 2PXXA 4L16A 3O7MA 1NP7A 5AKEA 1MH1A 1WP9A 3ZDFA 4NXMB 1P80A 3L77A 1I4WA 1PDWA 3V7YA 1WR8A 1YONA 3A6LA 1V9LA 1YS6A 1GU0A 1YR9A 3F96A 2BFNA 5GJCA 2LCQA 2Q6KA 1ZZEA 4X63A 7ADHA 4CWAA 3SJBA 5ALXA 3NOOA 4YRNA 1C4XA 4EAQA 5GONF 4LCJA 1NC1A 2GBFA 1KC1A 5KJCA 1O6ZA 2F64A 4B7ZA 5JPCA 3MQFA 1V96A 3DAOA 3K9BA 2HYIC 2EW1A 3DEIA 2IY8A 2P90A 3HN7A 3E7WA 1FFWA 3FLEA 3W1VA 1D1QA 1L8OA 3JAKB 3ANTA 1DBIA 2Q2QA 3IH5A 4J3NA 5CBPA 4G25A 1SU8A 3NATA 2CXNA 5BSRA 1DIRA 1IC6A 3DKPA 3T3MB 5IULC 4OTZA 1IHOA 2E5LB 2ZYRA 4MCHA 4BLRA 4KPEC 1EDBA 1P2SA 1B4DA 3F9CA 4MGEA 4NCIA 3RUFA 1VHJA 2GERA 5HF6A 5EMJA 2MR5A 3UXMA 2PXAA 3OUZA 4F3YA 5LWHA 3S1LA 3D1JA 3K4HA 3QHQA 2FZEA 3SYRA 3K1JA 5CLHA 2V55B 1FP4A 5TQVA 2VXCA 1T8TA 5TRTA 2XNHA 3BGOS 2PX5A 4NJMB 2WG1A 3PIIA 4J90A 1X3SA 4ZVSA 2WM3A 3TRDA 4OSEA 1WCYA 4A8JC 3ZBUA 2PD4A 4BRSA 5JBQA 3H1AA 2D7JA 3E3MA 1Q20A 2OXFA 2CSUA 5JD6A 1ZOIA 1EVLA 4D3FA 1X2BA 1IN5A 3RFTA 1NBEA 3LLCA 2RGWA 1AQLA 2AVDA 2RGGA 4IX1A 3RIYA 1XJWA 2JAWA 3L4BA 3M3HA 3PL1A 4UUQA 2ZUEA 1L7XA 1PGOA 4MVYA 4RFSB 2E4VA 2PGIA 4RCVA 3THOA 1T91A 1AKNA 2NX2A 4WZBA 1P45A 1E1CA 1X7ZB 2CJFA 3QPCA 4A10A 1X8JA 2J9FB 5DTQA 4QT4A 4OI4A 5DBIA 5ALHA 2C5SA 1Y3HA 1I3KA 1SOMA 1UKAA 1FDUA 3BJEA 1MOPA 4JN6B 2H1OA 2TSYB 3QMVA 4TPKA 1MT3A 4X1KB 4LOAA 3WLEA 2Q6TA 3KJNA 5AVRA 3G2MA 3E3AA 3JV7A 3NBQA 2REOA 3W77A 4R98A 5DLDA 5I7VA 2D6FA 3FWKA 3LL4A 4KQ6A 4Q1BA 2DTXA 1TZJA 3EC1A 1QYXA 1D0SA 2NZUG 3HV2A 3PT5A 1VJRA 4Q03A 2GDZA 3OMLA 3UJAA 1THGA 3WISA 4RVHA 2MSEB 1CD5A 3UZUA 3ZHBA 1WM1A 3ICOA 4HZIA 4AJ2A 2CZCA 1R4MB 4LTMA 4YAEA 1GPJA 1NV9A 2DLNA 4Q9KA 1E66A 4ZDJA 1JA1A 1EJ2A 1U0LA 5E3IA 2XV1A 4DSUA 1WQ3A 4F86A 4LF5B 1RVV1 2O6HA 2E18A 1U9IA 2V9CA 4KI7A 2O3TA 3TRIA 3MTBA 5CFQA 5BRJA 2I9PA 2CLLB 2RKBA 4L6AA 1J1IA 3FA2A 2VTEA 3GGSA 2BFPA 1G5FA 4NU6A 4V2IA 5LBTA 3AEZA 2QRUA 3KZCA 1U0TA 2RHOA 3M1AA 3C16C 3GJ4A 1XCPA 4LRTB 1Y6QA 2PMCA 4XCXA 5AW8A 3RS8A 4MV4A 4BO5A 2AOTB 3OP4A 1V2GA 3GRZA 2ETXA 5CHEA 2JGDB 3MMZA 1C3OB 1UUFA 4RGQA 5BOSA 1Z29A 4GOKA 3GLGA 3JYQA 1NVTA 5JLAA 1WVGA 4NCJA 4QUEA 5CDFA 2AYZA 4U9IS 4MKGA 4HN9A 1WHTA 4X85A 1SCBA 2H4ZA 2JHGA 4KXWA 4YT2A 2VRBA 1KYVA 3BWEA 1EK6A 4QNMA 3FJ1A 2OYRA 3LKZA 4YPVA 2BHSA 4I1VA 3USES 4BDSA 1DBRA 1WE2A 3I42A 4PZLA 3TL6A 3UJBA 5REQB 1GZ7A 1E5LA 3MNFA 3PHGA 4CL8A 1S8NA 1G0OA 3IR6A 1PJTA 1T26A 1QQ5A 1S3IA 2C3UA 2X2PA 4M1TA 5CVJA 4DTCA 2Y1XA 5M5BA 5I3ZA 4RA9B 2LIVA 3H9GA 1EB9A 2OV3A 2UU9B 4ZC1A 1NXWA 1BKDR 3NI2A 3IAXA 1O87A 3W4JA 5GINE 2GETA 4MEAA 1GD1O 1WETA 2HWWA 4LXQA 4O2BB 3LLUA 1E1DA 4FYWA 4HJRA 4BASA 2GTHA 2PRIA 3JATB 4ZT2A 1CUFA 3N2ZB 2OC4A 3BSFA 5KVAA 2H1SA 4GYWA 1GAQA 4IHAA 5JVDB 2AKYA 4JYMA 1P9WA 3A4IA 3C3CA 1QKJA 5LU9A 3R0QA 2C2ZA 2J6CA 4E2XA 1II8B 4MGIR 2O8BB 2BFOA 3HZZA 4MMXB 5ALEA 2GUGA 3T5DA 1GG9A 4ZZ1A 2NO6A 3W5IA 3QA9A 1V25A 2ILVA 2QN1A 2B6HA 1LQ2A 3GJQA 4L4YA 2GBIA 2Y1LA 3RS5A 4G1UC 2UXBB 4X84A 4L74A 2CFTA 3HBFA 3T34A 3WDMA 3AUKA 2O8DB 4AC9A 5CD9A 3URKA 2PN1A 2WSSD 1SFRA 2EW8A 2NADA 2PSFA 2QP3A 3S1AB 5EUQB 4CKWB 2IYWA 3KFXA 3MIZA 3W1WA 5AESA 5JNWA 4FIZA 1XD8A 3A1EA 4AG3A 1XTIA 1UBHS 1T5SA 5E7MA 4NE9A 5B2ZA 4BQRA 4WBSA 1C7ZA 1F8XA 2NIPA 1E69A 3ISJA 4RLFA 3WIUA 2DR0A 1CEXA 4DIFA 2EF1A 4EW3A 2O7SA 4OHFA 2HWXA 1GKLA 3QXXA 3U3RA 3NBKA 4RY9A 1N32B 3DE4X 3RC2A 3CHYA 4HGYA 3RW9A 1TFRA 1IXYA 2JGIA 4IUBS 2LWIA 4I14A 1SM4A 2AZMA 2W6ID 3PGJA 2BGRA 4TV9A 2MT9A 3KLPX 3ZXXA 2C7PA 1NHGA 4OXYA 1C3EA 1U7HA 2DHCA 5A5GA 3ES9A 1GL3A 2XOKA 1F5NA 3HJRA 1X14A 2L42A 2VYNA 4B7AA 1R8SA 1WPRA 1ESZA 2BC9A 1ONPA 3UQYS 3HKDA 2WWHA 4M1QA 3ZBPA 1RAIA 4OIFA 3FPJA 1GNTA 2M6SA 3EQ9A 1J6UA 5GADl 1KO8A 4V3CA 1N3IA 5KOHA 2BKXA 3ZK7A 1VRCA 3VZBA 4D9JA 1QE3A 5C1OA 2PKYX 3IMEA 4P3OA 4LV6A 3LWNA 5D2CA 3KQWA 2XTZA 3TNYA 1S2OA 1K4YA 3B9BA 3ET5A 1US8A 3GI1A 2WJHA 3GT7A 2OTCA 3HFGA 2GHIA 2I71A 1M9NA 1QMPA 1CY1A 2D1QA 4J4HA 4ID9A 4KHZA 3D8NA 4AP9A 3IQZA 5DMXA 2HSDA 3I0NA 4R3WA 4TSKA 4WEQA 3AGPA 4J07A 1DMRA 3LO8A 4WLFA 4GOND 5T67A 2XXAB 4LNAA 2ZRIA 3N53A 3R0IA 3REQA 2Z2KA 2YV1A 4FHZA 1AQIA 1R0BA 5L3QA 3WNVA 2JCYA 1WOYA 2HQ1A 2ZYDA 3Q7QA 4V3BA 2B7LA 4EPWA 1SVMA 4MUAA 1N1EA 5LJIA 2XLBA 1NXPA 5JAIA 2QUHA 2R85A 5LIRA 3HNRA 4X6XA 3ZWQA 3QVXA 4MKRA 4YJFB 1DMSA 2A88A 2Q3MA 1EHCA 4XUGB 4CMHA 5A6SA 1XMVA 1W0JA 1BRTA 4QDJA 3WKEA 2XQGA 1M1YB 4YJ3F 2NU7A 1QVVA 3QGMA 1INLA 2I4TA 3DDSA 1TM4E 4JQOA 2PBFA 1H1TA 3HSYA 3Q7SA 5IDYA 1UK7A 5TLSA 4QOGA 4YAIA 4G1CA 4RJJA 2AQ8A 3KQOA 4PYNA 1PBTA 4UOZA 3EE6A 3W5DA 3OQMA 3FTCA 1N6LA 1V0JA 1V16A 3QOFA 1QIJA 4I1OA 2A58A 2F8LA 4GPEA 4KRXA 1SIOA 5LD2C 1RBQA 3OFND 4PHHA 3IPCA 3BB4A 4KOAA 2X77A 4LY0A 2IU0A 2QTHA 5TDHA 3R7WA 3WLMA 3BILA 4OIMA 2Q4OA 3IPRA 3QP9A 5FTWA 1Y5IA 2HA2A 4FILA 2R6HA 2BVNA 3K1ZA 2GEUA 4MB6A 2V7QD 3LPDA 4OPMA 1CCWA 4YUXA 1QH8B 2FI1A 4TVKA 4D9NA 1COZA 4QTYA 3AQIA 4Q3EA 2O7NA 4B48A 5KTKA 4D8VA 4LXHA 4YPOA 4YEDA 2HA7A 3N86A 3ENQA 5AVTA 1RJEA 1R0YA 3UNXA 3AVTA 4ZALA 2WHRA 4UHDA 4H1TA 4CQMB 5EHGA 4LJ6A 3OTIA 3LBFA 1CQZA 1TQDA 1E1RA 1P1KA 1XYGA 4DQDA 3OZFA 2QUAA 1NP3A 3R9XA 1GL6A 2YS7A 3E9YA 1EU1A 4QHYA 1P4JA 5A5DA 3T3OA 1LJUA 3NDPA 4FDLA 1FSSA 4HLUA 3PLAE 2DCUA 2EWVA 4B6EA 1U0BB 1AZWA 3OFNA 1VRVA 4NXNB 5SV2A 4QM7A 4EY7A 1M7HA 4LGYA 4HLCA 1X8KA 4G23A 3F47A 1PNQA 4J0QA 4F2DA 2GEBA 5EE3A 3IVXA 3DKIA 1AH2A 4MS1A 4N39A 4LVOA 3HVUA 1M34B 5CW1A 3EULA 3EVAA 3EXIB 2X7HA 1WW2A 2HGZA 3NT4A 3EF1A 3M8KA 2Q5IA 2I6TA 1NN1A 3QVWA 1Z82A 3BRSA 2FCAA 2GO7A 4QT0A 3O75A 1EK5A 1SKYB 3GFPA 4DF3A 1UEJA 3OEED 1A1SA 4FD2A 1HQYE 4ENPA 5A06A 1A8PA 1JILA 4R8SA 5DDIP 4ZVVA 2PU5A 2CVZA 1LBHA 1K6MA 2BGMA 2PZLA 3WKDA 2WIGA 2GRJA 1ZJYA 1KMHA 1JHZA 5ICEA 1HF3A 1XAGA 3ADPA 4HFNA 4NCNA 5ECWA 5HE9A 3SJUA 4DRXB 4DYHA 1TVKB 5F2KA 3QLVA 5F52A 2NNWB 3CTMA 1W5EA 4DV1B 4URUR 5IJZA 4BJ6A 3ZQKA 1EHYA 5H02A 4A0FA 4I36A 3IBTA 5EZYB 2P2SA 1JDZA 1OWMA 2G8NA 2Q3JA 5IF9A 1NBWB 5K03A 1Z8NA 2BFBB 2ZUCA 4UXHA 5E6UB 2X8LA 3CPEA 1QK3A 4Z2YA 1F20A 3EHEA 3FOBA 3CF0A 4BMVA 1I9CA 1SU6A 1FEZA 4IRMA 4KRYA 3NC0C 1SHLA 3AHGA 3BL5A 4IJUA 4M1YA 3ZKWB 4AQDA 7ABPA 2NYUA 3LY9A 3AFGA 4DDUA 1J39A 1MG0A 4JVMA 5JXJA 2C31A 2VL7A 2F7SA 3ROPA 3M4ZA 1M10A 1OBCA 1Y37A 2EFEB 2RH9B 1QHGA 3FBWA 5B37A 3DE0X 3DOFA 1AKYA 1CKEA 1MBZA 3QTLA 1VMEA 1QGDA 1TQ8A 2JHFA 2JATA 1EPUA 3ITDA 4R51A 5C31A 2Q9UA 1NE7A 2JLCA 2Q2OA 4EYGA 3T15A 4TKVB 5KSOA 5JUWA 4DPMA 1F6WA 3U9LA 4GQBA 4AKEA 1MJGM 2Z5GA 3GJYA 3VU0A 1OW3B 4LXTA 1OY1A 3F6CA 1X7WB 3MT7A 4A7PA 3G2JA 3JY6A 3FVQA 1Z4QA 2AKAB 2P0EA 2Q4RA 2BTQA 2Q5EA 4ZA2A 3G0GA 4GR9A 1GYPA 2J5RA 3T3GA 4HB3A 1SUIA 3R5KA 2KQUA 4B34A 2P2LA 2OECA 2RGAA 3ESBA 3HNOA 2HCJB 3VI4B 8MHTA 5CB8A 1JQBA 1E77A 4B9AA 3CB2A 4M36A 4K0KB 3KQLA 4XSHA 5GP1A 3R7LA 2OQIA 1RLMA 1TNDA 2O8FB 3JU3A 2IODA 1E8NA 1W85B 3BS4A 3LOUA 4XJXA 4LSWA 2XD4A 2BFDA 3CC8A 1RXWA 3DBVO 3GZTB 4G41A 5KX5B 3F5SA 2CD9A 4EA9A 1HNNA 4DA9A 3CZ5A 1F0YA 5BPHA 4IXNA 3PIDA 2RJ3A 3LGXA 4RV9A 521PA 5KTMA 1ZUIA 1UT5A 3BZBA 2CL5A 1PL8A 4LPKA 2IEIA 1LNSA 4HH0A 3U4CA 4CL3A 5B6JA 5T4FA 4XIIA 5LPNA 1FK8A 4U2DA 5DTEA 1IM5A 2D1YA 3NTVA 5J2UF 1MABA 4KXFB 2C94A 4XZ3A 3BL8A 3WHPA 2BGTA 1GNRA 1HQCA 4ARUA 4B71A 1QIGA 1OJ7A 4AZWA 4BLUA 4JIGA 1UBKS 4PYOA 1NXSA 5ILQA 4MW9A 2NTNA 1F38A 2CBZA 2P7IA 2VPQA 3C6BA 4S1VA 1KRWA 2JFGA 4H4EA 4F4FA 3EIOA 3UWDA 1RCFA 3W79A 2MU1A 1NQXA 3H3JA 5DBEX 2MSWA 2JLVA 4QUIA 4QGAA 3UMRA 5LWQA 3H9UA 2XMDA 4AJ1A 2FSFA 3IE0A 2AVNA 2CLHB 3R75A 1P1FA 1LLUA 3JXEA 5EIEA 4MYUA 3K53A 5C53B 4KXQA 1VKHA 1O4VA 2FWBA 4MS3A 3MGBA 4RBNA 3CUKA 4F3NA 5B55A 5EJ5A 3D43A 3E1SA 3OT4A 4J16C 2O8EA 1E3QA 4HVTA 4O2LA 2P30A 4JP1A 3KKOA 3ADCA 3V2HA 1RP7A 4RMNA 3S70A 3IERA 3VAZA 1JKXA 1ULZA 3P0IA 3IHLA 1RI3A 3IKLA 4WBNA 4CT4B 2HIMA 3EZ7A 4FEYA 2CHUA 4FONA 3KT6A 3R3WA 2Z08A 4PM4A 5ENDA 3LLMA 1HDYA 2O2EA 2QYHA 3HCEA 1O96A 1GCIA 4ZXFA 1GJRA 2ZI4A 3VOSA 4DSNA 4EO4A 1KI3A 3EA0A 4IJWA 5GQSA 4PIVA 4FDAA 3VMMA 5CCXA 1I32A 1QP4A 4GLJA 5CFOA 1IN8A 4REMA 3EVNA 1YJAA 3QBEA 2H59A 4ND8B 4E5VA 3H9CA 3E48A 1GTSA 3HYNA 1YTUA 2XTNA 1Z47A 3T5TA 2H18A 2GPAA 4NESA 1QZZA 5K6AC 1W19A 4U2BA 1I6MA 4BP9A 5FH9A 3ZE7A 4RVGA 2ZJOA 2AKEA 3ROZA 2W6JD 2W22A 5EMNA 3PHIA 2OFXA 4XGIA 1BN7A 3LQ2A 4RMGA 5HQTA 3S0JA 1EHIA 4XGQA 1QG2A 1OTYA 1N3YA 3GZJA 4KH1A 5IKMA 4KN9S 3KOZA 4X91A 2XMCA 4GE0A 4ZOCA 4GECA 5M2QA 2CJWB 3U3DA 1P4AA 1J5XA 2BT4A 3B7PA 3PCXA 3C3JA 4L72A 1FYDA 2GM3A 4PLCA 5J63A 3PFIA 4BNDB 4EHLA 2FP4B 4NE2A 4EHNA 3JQAA 4FLFA 1WDLA 2D0DA 3AKCA 3G79A 2HA6A 2HCBA 1X74A 1EQAA 2ZAYA 4OYYA 4R1PA 4B46A 4ZCRA 2XNJA 1T5TA 2OZKA 2NU6A 1CUDA 3P9CA 3L07A 1D6MA 1RM0A 2CV0A 1EG2A 3TLGB 1OU0A 1A95A 4TM7A 5DH9A 1GFSA 5T4EA 1D4AA 2V74B 5IZCC 3LUBA 2ZUBA 5L3SA 1VCMA 4NNOA 3K6KA 1JJIA 3TOSA 4EYKA 3OLYA 3FVRA 1NBOA 5AI4A 4GPAA 1YZ3A 2OHXA 2EP7A 4RVSA 1NMQA 4U7JA 3C3YA 1X1BA 2A6PA 3EMKA 4LZAA 1KBZA 4UM8B 3ULKA 1REQA 4KYVA 1XMQB 2FN8A 1Y9AA 2I29A 4PRLA 3GX1A 4H7IA 3V55A 3SM9A 3E7PA 4EUFA 4OFXA 4FHEA 3NPMA 2Y1FA 4CIVA 1XDUA 2GD6A 4D4GA 4EY5A 1PWXA 2CYAA 3LX4A 4TTPA 2QTAA 1XQVA 3F9IA 1MABB 4I4IA 5AKGA 4QXAA 1O0CA 4N3AA 1YCHA 1BAPA 3O4HA 4RETA 4P8RA 3CH4B 4HDKA 2YQZA 4PHTA 1JKFA 4C0LA 3PXAA 2QW1A 5JXWA 3WNZA 3HA5A 1EFUA 3ISVA 2IYUA 3FI0A 3NHYA 4ZVRA 4YJGB 1EGAA 2QL7A 1RLJA 1RKQA 2Q27A 2ZVJA 2ZYSA 1GPKA 2F59A 4IVPA 2JH9A 4Y9UA 5K3DA 4C30A 1NJGA 5C8DA 3TG2A 2EDCA 5INTA 5KU1A 3V1UA 3JWEA 5ECGC 2ZRAA 4IOKA 2PX3A 3MXOA 4U6NA 3FPCA 3OCYA 3KZMA 1GDHA 4QULA 1E9EA 2I2AA 1VYTA 2QRZA 4EKDA 2QM7A 3ZHVA 2PIAA 3LUDA 4OA8A 2CVOA 4PGGA 3DZFA 3MT8A 4MR8B 4ABYA 5L4SA 2IC5A 4TT3D 4PO1A 1BVUA 1Y1TA 4YCCA 3UUGA 1NKVA 1ZOLA 2PH5A 4G65A 4XX0B 3L18A 5JLJA 4XTRA 2BEVA 1P2FA 3OPMA 4L7VA 4N0PA 4O4LB 3F2IA 1Z3CA 4P7JA 4WN3A 1MPXA 4ZO9A 3SF8A 2JIPA 3QYFA 2WQ7A 2MYPA 3Q9LA 4TLMB 3IQIX 1KAEA 2H3HA 3BTVA 4MUNA 2XYPA 3IUBA 3UFXA 2BE7A 5ADVA 2ZJ7A 1IVNA 4PAMA 2BD0A 3GFFA 4C0SA 4MVJG 2XCUA 3ND8A 3TSZA 4AMVA 4UCXA 5FBZA 2UVPB 4CPDA 4G0WA 1YGYA 1L7NA 5AK0A 2WWGA 2X76A 3OLXA 3SU8A 3SZLA 1H5QA 3FKJA 2XNDA 4FYXA 3FG9A 1M6WA 4M98A 5GVRA 2CL0X 1J8MF 3DO5A 3HA3A 2FOLA 2GPNA 1UIRA 2YCLA 3WR5A 3ZHXA 2XW6A 5ES3A 4YMUA 1SGWA 3H5VA 2CUKA 1P3DA 2DHRA 3GMSA 3OC6A 4PCLA 4ER7A 1JEYB 5ER6A 2MYUA 1IQ0A 2TS1A 5KWIA 4NF2A 2YN0A 4Y2PA 4WZBE 1JKIA 1ISHA 3PYLA 2GOYA 2IYLD 1EGHA 2A14A 3DLIA 4OU5A 4YP7A 4OXXA 4TMXA 4QDKA 3S8YA 3HSKA 2I80A 1UBTS 4LMAA 1LPAB 2ZJBA 5J58A 1IXKA 3VNUA 1L4MA 3LQFA 3QYAA 2CD7A 4Y0AA 3F1KA 3CLUC 1XDBA 2QG4A 1CULC 3O8QB 3CT4A 4RF3A 5CA0F 4TMVA 1J0AA 4LV5B 2GEDA 4ML3A 5CYGA 1IJFA 1XHEA 3F2VA 3CCFA 3M6WA 2BW0A 4TM8A 4TV9B 3EC2A 1JAHA 4ZEXA 4B87A 5IAOA 1KZ7B 3KAQA 4RS3A 3PJRA 1NJ1A 1NMSA 2EKDA 3DCJA 3ZHSA 2XZLA 3FFAA 4OEHA 2KM1A 3S2GA 2YZ2A 3O4IA 5ELXA 3KSBC 2X0KA 1NN0A 3Q7EA 2FZLA 1FS6A 2YL2A 2P8SA 2QP4A 4RPHA 3WTCA 1ABFA 4I50F 4YQEA 2IE0A 5BW4A 3AILA 4HLNA 2WMOB 3Q9UA 4NBUA 2TMYA 1VKZA 1N78A 4ZHQA 2BGLA 2QUKA 5TMBA 4HDNA 3KXKA 1X2EA 3EPRA 1QG6A 4NFYA 3QF7A 3K0FB 2V3WA 4XOUA 5IZCA 1MVLA 2CXPA 4IL5A 4TTIA 2Z9CA 4CRWB 1E2MA 3VTAA 1COWD 3PEUA 1YJQA 1ZU5A 3D6JA 4KQXA 8LDHA 3CZQA 1CYDA 2EX0A 3P2YA 4MYSA 5HIAA 4PQEA 3HI4A 4JR0A 2WTEA 4NJMA 3FOEC 2WJ3A 2PJRA 4BEJA 2AE1A 3VR5D 1ZRNA 4LYJA 3NKFA 4E30A 4OAPA 3CLRD 1V8FA 3K20A 5IG2A 1C1XB 4WK0B 2IX9A 3BX1A 3RSLA 5CNJA 2CUZA 3M6AA 4MS4A 3VH2A 3OQIB 3AXSA 4UJ5A 3K71B 1NXOA 2ZT6A 1OHHA 3WFIA 4BVEA 4MVJI 4EUSA 2QBYB 3HQ4O 1D2EA 1F4VA 2WG2A 3HDYA 2H17A 4JDPA 2C9CA 3OZEA 4OP1A 4XCVA 3SP1A 2D59A 3MGCA 3IXQA 1MNQA 2XIQA 4M53A 3TVDA 3B1WA 4OHYA 1OBOA 1ZXLA 1VJ1A 2OQVA 3A9RA 4C7VA 1KJ9A 4CW7A 3OKPA 1PZFA 3VOAA 2FSVC 1YR1A 4HB4A 1RWKA 3N8HA 1SZDA 1P61B 2UAGA 3P2KA 5HCNA 3ZTYA 4AMZA 3P9IA 1ULUA 1T6BY 3IB6A 3OETA 1CDZA 2DP4E 3UK2A 1QFJA 2OD2A 2BSQA 2A5GA 2N46A 3IUJA 1GNPA 1NQTA 2Z2JA 2QTCA 3DBHB 1AVTA 3UMVA 4EP1A 5F3WB 3CG4A 3TDKA 4WOJA 1CZOA 3QTBA 5C51B 1I24A 2HJ9A 1Q11A 2YXDA 4LZPA 4Q1FA 2G80A 4NS1A 1URPA 2ZIZA 1PL7A 2GKOA 3KWJA 3PFNA 1KEWA 2HB6A 4EKEA 2GFQA 5HX7A 1FTSA 2DUNA 3ANNA 3TBHA 4K87A 4LJ5A 5HK9A 4EGQA 1QRDA 2A9QA 5CXXA 3KTFA 2CCKA 3IIKA 3FSJX 2A5YB 2QTWB 4N5HX 4TXHA 3E2MA 3PV0A 5EVJA 5B1EA 1KH3A 1AKVA 1XRSB 4F91B 1BH6A 1HYGA 2ZSAA 1IQUA 2VK8A 3SBOA 2GTIA 1Z22A 3FN4A 1CQPA 4FR5A 3SHVA 4LXGA 4MJLA 2YHAA 4L8GA 1E2HA 2ZXFA 2E48A 1X86B 2O3JA 5D00A 4DA6A 4DLSA 5LIPA 1L5YA 1CJCA 4FBMA 2OCPA 1KK1A 4KO2S 3GLIE 1ND5A 1VXRA 3FJYA 3HYCA 3KFLA 3Q3JB 2O19A 1E62A 4FMBB 2QLNA 5DB4A 2OD7A 2RE8A 3TMAA 1PZGA 1W52X 4EI8A 3AO0B 1C0PA 2Q4BA 5IANA 3CURA 3ZK8A 5EWJB 2GEJA 5G40A 5BMOA 5MFZA 5FUBA 2XBMA 2AWNA 1QGUA 3DTVD 1WSBA 2R1VB 3OE7D 4KJZA 1USUA 5IH3A 4B2LA 4DL9A 1VFNA 3LK7A 1U81A 1VIDA 1ADJA 2ERYA 3F4LA 2PMEA 4CNQA 3FIUA 4ND2A 3ZN2A 5HJ7A 2F17A 4K26A 2ATEA 3LPAA 1ESMA 2W90A 4IUCS 4L07A 4JLAA 3GNSA 3AEQB 2NYVA 3QU5A 2O9JA 3L7CA 3P19A 2IZZA 3NONA 2FHSA 2MINA 1PUIA 2ADMA 2UUOA 2XWPA 7MDHA 1MGPA 3K3PA 3MBOA 1Z33A 1YB5A 3EW9A 2PX2A 3N58A 3NM4A 1DC5A 2ANCA 3H2GA 3QWHA 1ZONA 3IOCA 3A9UA 5EFOA 3PSHA 1A8HA 1VBKA 1Z6AA 2XI4A 1Q2XA 1UZLA 3WE7A 4BV8A 1ICIA 1DC7A 4HGOA 5LUBA 1WPXA 3LTEA 3JATA 4YRCA 5E2AA 2R0QC 2JK0A 2JASA 2BDUA 2V9PA 1PN3A 1R10A 1C29B 2FSVA 1YULA 4XJVA 3C3MA 3PDHA 4KK4A 4J7XA 1IZZA 2XBUA 3LZCA 3RH0A 4C3OB 5F21A 3L41A 4GFDA 2QZJA 2NU8A 2PWBA 5CFMA 1U3CA 5BSKA 3V4VB 1BHSA 5EZ5A 3I2HA 4ZHQB 3PQFA 1Y3BE 1ZIPA 3U48A 4JLSA 2OLKA 5KYKA 4MUHA 3MGGA 1VBFA 3P5BA 5JZOA 1EFPB 1OI4A 2QR2A 5EKXA 1P0FA 2ZM5A 1SCUA 4MNTA 1KSJA 3TAHA 1UMCA 4QIHA 3O2NA 1R0KA 4UHCA 1FFYA 4CM6A 5BT9A 3UJ8A 1GZVA 3QKTA 3R20A 4U9UA 3CEJA 3LX5A 1T6YA 3BRQA 2J7PD 3K7EA 3PDCA 1GR1A 1I4EB 3LQKA 3EFHA 4L76A 4NBWA 2XKAA 4MR8A 3KOOA 1NOJA 2J9ZB 3N8IA 5E4FA 4Z3OA 1QDUA 2VDMB 4C3ZA 1XVAA 4J0CA 1K4KA 1YBHA 2ZVQX 4RQTA 1A7AA 1KFJB 5BYAA 4GYJA 4F6CA 5JAMA 4PQFA 4N48A 4B09A 2EZUA 3LGAA 2V5AA 3MB8A 1L5QA 5FTJA 3PGMA 2DGDA 3TTTA 3T35A 5KIAA 4DSOA 1G7RA 5FOXA 4X7RA 3EGDA 4WJZA 2GLUA 5AP9A 5LXTA 4M9QA 4WH0A 2I2XB 1TTHA 4P7BA 4G9EA 2YH2A 4XPIA 3HABA 1Y4DE 3V8QA 1SC3A 1VP9A 4G89A 4O1MA 1VL5A 3DM9B 4BZXA 2JZCA 4BRUA 3KVOA 1J7JA 1LW6E 3TVTA 4C6HA 3Q9SA 3CRNA 1SVWA 1GUZA 2ZQZA 4OG2A 4TSRA 3RDPA 2BFDB 2W0MA 2Q3BA 4HNQA 4IG4A 4IUYA 1VG1A 1XCGB 4BRZA 4ZYWA 4JZKA 4FU0A 3TJZA 2H31A 4EO9A 3PNLA 1ZJZA 3SDSA 1PWHA 2APJA 2R6GA 1IY0A 3H6GA 1K7XB 1ZGCA 2Q8QA 2FF5A 3LF1A 3EIQA 4GM1A 5EQDA 1L4YA 2PL5A 1LBIA 4TUYA 3O8BA 2WTUA 2I4OA 2VA8A 4KWIA 1TZ2A 1QIKA 2PO5A 3DHYA 4Z8YA 3KRTA 2GNOA 1BDBA 1L3BA 2PZGA 3GJ3A 4GRDA 4JD5A 2B1JA 2JIQA 2B8WA 1N0HA 4G5GA 1V1MB 1Q95A 2BRUC 3IQHX 5CNMA 1L1FA 4CETA 4MYTA 1QIEA 3GNQA 4JLVA 1SXJD 5F51A 4MWZA 2NSDA 3E22B 2ZETA 2WSYB 2R44A 3ELBA 4D9IA 5I7RA 2AFHA 1GUBA 1MT0A 3D4PA 1BE8A 1SQ0A 2JGJA 3B8HA 3GAZA 3CX6A 3B3FA 3DUFA 3K9LA 3P0HA 4BVJA 1UANA 2GBLC 2PZFA 1U2SA 2ZBFA 3OAAA 4KSBA 3GLFA 2X8JB 4EVIA 4IOJA 3HUTA 4OYRA 2GILA 3V8VA 1JAXA 1D6NA 5EQJB 4F9GA 5JSZB 1MPTA 5IABA 3QVVA 1JLSA 1QAOA 3GOQA 2H4FA 3EEQA 3FCSB 2OILA 1OXUA 2VS1A 4JJ7A 4W1RA 3WFZA 3P9YA 1Y42X 1VE5A 5LSAA 2JI8A 2SKCA 3KP1A 4O02B 4PHFA 3G2IA 4J1QA 3WG9A 1KAQA 4ZGGA 1DBPA 2ISCA 1UWKA 2Y93A 4XM1A 1E2QA 1JHUA 3VPGA 1Q84A 3L7NA 5JCZA 1R6UA 4Z5XA 1TJYA 1UBJS 2C82A 3UF0A 3EH1A 2WRZA 1ECFA 2NZ8A 4V0NA 4EUKA 1OIWA 2OXRA 4RWZA 4TMZA 4JLPA 1RRKA 4W7SA 1OYOA 4F4DA 2XBLA 2FXVA 1P7WA 5DSTA 2CHEA 1BZYA 4Q3DA 3KHSA 1ZA2A 1KJ8A 2UV8A 3SIPA 3DR5A 2BMVA 2QZ9A 4JB8A 1UC8A 1NSFA 2BM9A 5B3KA 3TB4A 2IW3A 1JWLA 3BB1A 4YCAA 4FYMA 4JJKA 1T5DX 2GZ2A 4DR1B 2QTZA 4OJMX 1IEWA 2BP7B 1JEJA 1SQ5A 2F3RA 3FPBA 3BHIA 3DTVA 2EX4A 1JDBC 1TYZA 5J1SB 4US1R 4D9KA 4JYZA 4UZEA 4OYLA 2Z9DA 5KWVA 1WB4A 1K8QA 3BMQB 1NYRA 3QKRA 4TQUS 2PLAA 3ERCA 3Q10A 1R4ZA 4PN7A 5JCPA 2O1XA 2YFHA 4WD3A 4AS3A 1PEDA 2QRKA 2G36A 2G9NA 2HQRA 1LPMA 3H99A 2VT2A 4TYMA 2C61A 1ADGA 3ZOZA 1RAGA 1TYBE 5CVUA 3GLRA 2YBDA 2OV4A 3M6UA 2UZ0A 4QYWA 1E5XA 3SMVA 1XR3A 3VHRA 4QU8A 3LXXA 3UAYA 1T1SA 1LVGA 2J0VA 4C4SA 5A7FA 2G1AA 5CR9A 1Q77A 1ZY2A 4L4XA 5E2BA 2R79A 4XAQA 5AKYA 4P54A 1DQZA 3EASA 4ENSA 1RPTA 2ORYA 2WFLA 3E7XA 2X42A 3H13A 3PQ6A 2C2GA 5BSWA 5EJGA 1YT5A 3EVBA 4P83A 4YRSA 4DV7B 2GBLA 4DGQA 3C1TA 2J7KA 4EEZA 4B43A 1A9PA 1M5UA 3GGCA 4YAWA 1LDMA 4O59O 3AL3A 4LY6A 4EARA 3K6SA 1ZVMA 2VO1A 3FNQA 2BGGA 1GGVA 3H05A 3M1YA 4MAAA 4FEGA 2ZBPA 2JG3A 4DMMA 2BFAA 4LRYA 4O4IB 1WUYA 3DVAB 1Q92A 3BAFA 4E5UA 4RGVA 1IN7A 4BAZA 1S6YA 1HTBA 4M6WB 3MCZA 1P5ZB 1UBGA 3UIEA 4EG3A 2VSNA 1MRSA 2HMTA 4V0RA 2B6NA 2Y1OA 2YIDA 5JC8A 4W9MC 1Z0KA 1YDGA 2XDWA 2QVCA 2IYAA 1V8DA 2HHLA 3H86A 4V38A 2B4QA 1OI3A 4XVHA 3T9CA 3ZWXA 2ECPA 2I65A 9ATCA 4TTQA 2YVQA 4X1OA 2IV3A 3M5DA 2C0CA 4Z99A 1FMFA 3PB3A 4C7JA 1T1GA 2B92A 4QELA 4CUJA 2ACWA 3PWTA 4FX5A 3MTQA 4IR7A 2ZWOA 1K8ZB 4B2YA 4P32A 4ZI7F 1FPMA 3GQVA 1W25A 4WK6A 5HKKA 4JOCA 4EKYA 5HWSA 4DNXA 5A04A 1YO6A 1F8UA 1QIFA 4KB5A 4ME6A 5JDCC 1NUAA 2H92A 3GUYA 4II7A 1LNZA 2Q07A 3AWIA 3L4SO 3LOQA 3SC6A 1U04A 5DP1A 4CQLA 4ZCPA 1Q1BA 5EL0A 4BMOB 1WIWA 3INNA 3S99A 2H0QA 4V0LA 4DWOA 5K9ZA 3C7KA 1UXGA 2GPYA 1CY6A 2O8NA 4P5EA 1N2SA 1ZISA 5KVVA 1ODJA 3G8CA 3ONDA 5KO2A 3AVUA 1FFBA 1QZXA 1TLFA 2V7UA 4UPVA 1U6JA 3RFXA 5E3HA 1TIBA 2YY6A 4IHQA 4RZXA 4ASUA 1I1HA 3FHTA 4NBKA 1EFHA 3PDWA 3OWHA 3K1AB 3AHJA 5LDDC 2LW7A 2PS3A 3QWFA 1JMYA 3SS7X 3ON5A 4O2AF 4U1RA 1R00A 2WEKA 2QTLA 4V0KA 4PAQA 2OK7A 4ARSA 4LBZA 4HVAA 4EDFA 2P9HA 1UPBA 3R9WA 4D8WA 1IK6A 2YC4C 3V2IA 5A03A 3GRYA 2FOIA 4RNCA 2I34A 3NHUA 1RQLA 1HSZA 2ZYIA 3AUSA 4JJEA 4B85A 4ITRC 2DB3A 1FTYA 5IJXA 3R9KA 3GP8A 2XE4A 4G09A 2H48A 4JLNA 4MINA 4UW9A 5KNBA 3H16A 2CEAA 1CQWA 1M8JA 3EUFA 1EP9A 4HN2A 1OXMA 1RPAA 2E3JA 4DUPA 1E3TA 1GV1A 3BGIA 3MFYA 3ROEA 2RGDA 3OIWA 1C81A 4GNKA 5H3HA 3L7KA 3VU9A 1IHUA 4O3FA 3OPVA 2O0MA 4AU1A 3H2YA 2VHEA 2VWPA 1WTCA 5K4AA 2ODQA 4D25A 5CB4A 3HP1A 3GGDA 1A9XA 1U8FO 1QRAA 1H2WA 3OJFA 1TK9A 1K2VN 4YGXB 1C1DA 2OLJA 4QPJC 2V98A 1E1RD 4DRXA 4PGHA 2RI0A 1JE0A 1E20A 1PFKA 1K4MA 3GEMA 1CFJA 3LY5A 1DKMA 4WASA 5CTJA 1T8YA 3DXXA 4OX9Y 3Q0EA 4DIDA 2FZWA 2ZB8A 3U3MA 4RFLA 5BQ3A 1G5RA 2WD7A 1G6OA 2K87A 2DE0X 3MINA 3WLRA 3ONWA 2FTKE 2P2GA 4GBJA 1VTKA 3FPGA 1VLLA 1XP8A 3L0PA 4U5QA 3U1TA 5SY9A 3OQHA 2W2PA 5HMMA 2P6NA 3G0IA 2WSSA 1EBBA 4DR2B 4BFVA 5GZ1A 5I7FA 2BUBA 4I55B 5EP2A 4AG5A 4F2GA 4W8OA 4EM6A 1BKYA 2BAGA 2QXUA 5FR2A 2Y05A 3TIGA 4INAA 4ZOLA 3AVWA 3C43A 2C9DA 2FWIA 4YV2A 1Z8FA 1KZGB 4Q9IA 4ZMSA 4W1SA 5DRTA 4CCWA 2IHNA 1I3CA 2IGTA 4LDPA 4QEKA 4GKKB 2ZB4A 4KBFA 1ISRA 2WM9B 3R0VA 1L8LA 1IBLB 4G0VA 4DSZA 1WY5A 2PQ2A 2XY4A 4HG2A 2F2TA 2VJNA 3EBPA 3I4CA 3C7AA 4HYEA 1DXQA 5HP4A 1KSGA 4UM9D 4I6EA 5EMMA 4V1CB 3QBDA 2XB2A 4BNVA 4IOMA 3E22A 1JLKA 5AW2A 1KVRA 2XGGA 4XB6B 3GAMA 1EQ2A 3IB3A 1K06A 3AI3A 5AKLA 3VJLA 4DLKA 4BVAA 2OL4A 1C1HA 1FYVA 1CUHA 4BFZA 5AK4A 1CY8A 3JD1A 4O08A 5EJ2A 3U7QA 2H51A 1QRRA 3KWMA 4OH1A 3WGQA 3GY0A 1WL8A 4UUBA 4L2IB 4BO7A 4DJEC 3IL2A 2CNBA 4X1IB 3MINB 5MGNA 3QX7A 1H69A 3OBBA 5FAXA 3ZX5A 4BKOA 3GD7A 1FUKA 3KXLA 3O9ZA 3PGA1 4LC1A 4ERNA 3OPYA 3ZU5A 3L7MA 2RARA 1YI1A 2RCNA 1V5IA 3EBLA 3SQWA 2Q6LA 1J9ZA 3W2TA 4HQKA 3CEAA 3RTBA 4AMUA 2Q6IA 2E87A 4JHXA 4QJIA 4ZOLB 3R8FA 1PNOA 5EZQA 1GLNA 4YDQA 1FUIA 2QJRA 3F4KA 3J81A 4H6XA 4TSFD 2N3ZA 3G3EA 4CDMA 1TD9A 4L51A 3I2JA 4BZQA 4DJAA 4YALA 2ZJ5A 2BSAA 3RUHA 5AUQA 3RLIA 3VSBA 4PCAA 3KKQA 3KVYA 4L0DA 3UOGA 1NF3A 2HNAA 2X23A 2W2LD 5DV9A 2VTVA 2AYYA 2GJ9A 4KXVA 3BL6A 4CTJA 3H17A 5FNVB 1UIMA 4MA4A 2ZS7A 3ELDA 3CTPA 1ORTA 1QHNA 2IUYA 3ZXIA 4K40A 4AJHA 4NWIA 3JD3A 3ECAA 2QV7A 3I8OA 3DWFA 5BN3B 5J2UB 1D2GA 2FMXA 3SJCA 3L6OO 3V7UA 1Z0ZA 3ABOB 2HRDA 1O97D 2FW0A 5EJ4A 4HRAA 3NBZC 4UD2A 5FFFA 2OOKA 3OX2A 3ZKWA 1YS9A 2I3ZA 2YIMA 4WLEA 5FBQB 5CLLA 4FBGA 3HWRA 4H0CA 4L15A 5HIIA 1KE1A 1YFKA 4Q1EA 1ZBDA 3KDPA 3HB9A 1QANA 5G53C 1RMQA 4QGFA 1AKQA 4X92A 3ZWYA 4CCAA 2HZBA 4UU1A 1FU4A 2VXYA 1WXXA 5A4JA 4G5XA 1MIOA 4IICA 2BR4A 1X39A 4MJXA 1T8PA 3NEAA 4FUTA 4HDMB 2PUGA 5F1PA 4F4HA 2NSJA 1V9CA 3EQ8A 3H5TA 2X40A 1TYDE 3WB1A 1G4UR 2IPAB 4NKRA 3C97A 4KQKA 1X8XA 2OYSA 3K31A 6REQA 1PWYE 1A69A 3AZPA 4NYJR 1NM5C 1UPXA 1Y1LA 3NJ8A 5BW6B 1LTQA 4JI2B 3H6HA 1F4LA 4RY0A 5JWOA 3FF1A 2QA5A 1RYYA 1X7XA 1ATZA 1Q0SA 5F76A 3FCCA 3SDBA 3HR8A 2VWHA 3WGLA 2YWCA 1CRLA 2YJNA 1XZPA 4L0CA 1P77A 3ZEIA 3EUEA 3NUGA 4PZZA 2Q5HA 1HTWA 2B5WA 1JDUA 1EBUA 3T4UA 1E6LA 1TAGA 3P7MA 4O1IA 5T8KC 3R74A 5AKHA 3ZWAA 1J00A 1JQEA 5KWJA 3GPIA 3MG9A 3KL4A 4X24A 1PCXA 1SBTA 1JKJA 3AHIA 5JO9A 3OLWA 3SHOA 4Z49A 1FPQA 4G4GA 4RPLA 3B7WA 5FQNA 5BSMA 8ABPA 4S1PA 4LQDA 3WLPA 2R8BA 1XBTA 1MA3A 1NPDA 1Z2DA 2I4LA 2QRVA 3I6YA 3NZEA 1AGXA 4I2VA 4Q16A 4XUDA 5EN4A 3SEAA 1FRFS 5JJ5A 4GI1A 5IBQA 2ZTUA 1MFZA 2KBFA 2ZFUA 4TRNA 1TAHA 2A67A 1JMKC 5LA6F 4ZFNA 4Q7JB 5AVZA 3CLVA 4XQEA 3EOAI 2NYAA 1TEXA 2JCXA 1NX6A 3PTAA 4QRHA 1PQYA 1U1CA 2XGOA 5JJKA 2WWXA 2ZPUA 1SVNA 4WXMA 4Y2GA 1JXQA 3D2BA 2YX1A 3LUJA 5GZ6A 5LDGA 2CXUA 1G7SA 1ICEA 2WY2D 2VK2A 3GHYA 2JFZA 3D6VA 2HM7A 3WYNA 1OYYA 4B35A 5AVQA 1YK0A 1MJNA 1F14A 2X1LA 3VKVA 4WCFA 4V24A 1BYUA 3DE6X 2FDCA 5D6NA 3NGMA 2C0PA 4ZTBA 1IE3A 1TQ4A 1QZTA 2J33A 4KQGA 3GFBA 5TQ0A 4Q12A 4CMAA 4E08A 5JARA 3D3WA 1U0FA 4BNFA 2Q5QA 5C8XA 4B1FA 3NIFB 1LXCA 1YOVA 1ZD3A 3RF6A 1JIVA 1CRWG 1JE1A 2RONA 1UT6A 1EFKA 4ZPXA 2XYHA 3SEFA 4YXFA 3PX7A 3RVSA 1WXHA 2AFHE 1PSWA 1OXTA 1RE0A 3AESB 1Y5MA 1TJNA 3FUTA 4MWSA 4DMHA 4MWDA 5JJBA 1QORA 3K9QO 1QYWA 4AROA 4JI8B 1XMIA 1G20E 3HK2A 5FA5A 3OM8A 2Y0PA 3UMJA 5LKAA 4Q1VA 1FY2A 3AL0C 1P18A 3ADBA 2ZZNA 3P9KA 2Y2VA 5EE9A 5IJ0A 1H2HA 1Z68A 3OOEA 2WYWA 1U4NA 3QY0A 4BUCA 3U2QA 4O25A 5FYDA 3RB8A 1QQAA 2JFXA 4DC0A 3N75A 1C4KA 1LPOA 3CSDA 2Q0QA 1ZIXA 4GSKA 2A3RA 3MVEA 3JTEA 4H59A 3TQHA 3ZWCA 4ER0A 1P2TA 5TGDA 1XZDA 3ZGXA 2DLDA 2XSZD 1Y7IA 1FE8A 3RYHB 3M0EA 4KAXA 2PT7A 3R41A 2XR1A 1J5PA 4URZR 3ZVNA 2V7EA 1UXKA 1Y8RA 4PYRA 3BRWA 4H1HA 4QVGA 3I39X 3JYNA 4W8HA 1XGKA 3AZQA 4IP0A 4CXMA 3VOBA 4YJGA 1PVOA 3HZRA 4L28A 4MWEA 2QN7A 4UAUA 4HHEA 1IPHA 1ECGA 3BXFA 1AXEA 1JHVA 1VHDA 2FPXA 3WLJA 3HXQA 1GILA 4DCCA 4BC1A 2DPYA 3O0DA 2J46A 3T99A 4JFRA 5LP6C 1ZD2P 2ZTMA 5AYVA 2OCKA 2J6IA 3Q6MA 1Z5PA 2XVAA 4M0EA 5CM9C 1DADA 4C3UA 2EVWX 2GCNA 1JDVA 3NRJA 2H1WA 2VP6A 3N2GA 2JLWA 2GM5A 1CS0B 3HSSA 1HQKA 4O1HA 4ZKDA 1RBZA 4OM7A 1B8NA 1UC9A 3T7IA 2I3DA 1VG9B 2YMLA 1PAUA 3KOUA 3W7VA 1UKCA 5F7JA 4JL5A 4IJVA 3PJFA 3VPBA 3J7TA 1DO8A 1JNXX 3WX0A 2WV7A 2FB9A 1UPFA 3ZE0B 1PEAA 1H0HA 2GMWA 3PGKA 1RM4A 5BV8A 5KOJA 3TUIC 4N54A 3U4QA 3AM1A 5AW3A 4D3DA 2Z5VA 4C1BA 2PT9A 2HZ7A 4XCQA 3DMGA 2ISSD 3A1FA 3A28A 3L2OB 1KERA 2P4HX 4JOBA 4PY2A 2AXEA 3VH1A 4E5PA 3DJYA 3C5VA 1U7WA 2C58A 3S68A 1TU0A 2C5GA 2PVPA 3C87A 3HXTA 4Y2HA 5C1BA 1NWCA 5NLLA 3BK2A 4FIDA 4ZI2A 1A2QA 1NVDA 1NAHA 4HDAA 3QUAA 4BB5A 2F4VB 2M2IA 4GSYA 1J07A 1L5ZA 1VL2A 3E3LA 3MJFA 5T8KA 4F5WA 4RULA 4FE4A 3SFTA 2PLWA 5JSUA 4J43A 1KYIA 2IEGA 1YZUA 2GSWA 5JO0A 3IAM1 3OUTA 2Q4EA 4DLTA 2QQGA 4PTYA 3I1YA 3I0ZA 2QD4A 3TBKA 2XT6A 5D5QA 3RABA 1E2KA 2J3DA 3E81A 4MP6A 4NI5A 3VHQA 3FKSA 3IOMA 2CXXA 5I9SA 4BNIA 2QRVB 1DGQA 1FP4B 2V8OA 4IDPA 2IEZA 4TLBA 4YRZA 4Q0MA 4D5EA 3DLTA 3OFJA 2HXGA 4WVLA 5AQEA 4DQLA 4CUKA 1E7QA 3AY7A 1ZLXA 1E64A 3RSSA 3UJDA 1CDOA 4AJPA 1Z7YA 2XUQA 4CDGA 5JTUA 3NHSA 5DM4A 3IEVA 5KOJB 1V8PA 4PQYA 2OCGA 5THXA 2XMZA 3I1IA 4AO6A 1RHJA 4XUCA 1V3TA 1NHWA 1J4AA 1YR3A 2K2WA 4QPCA 4MVXA 4QUAA 2LCIA 1B6SA 3LRXA 4AJ4A 1NRXA 3JSXA 5JXGA 1OLUA 3FCAA 3W6UA 1AHIA 3RKUA 2L82A 2C97A 3FR7A 1CNMA 1K3UB 4ZAZA 2FPSA 3OQPA 4RKQA 3LYUA 3QFFA 4TRJA 4ZVNA 2VHZA 4JU9A 4MQFA 4X1YB 1Z4IA 3Q7PA 5HBRA 1RLIA 4JLBA 3PBKA 2CXHA 2OV8A 4JGIA 4ON9A 3VVMA 3M70A 3A14A 3GLHB 5EE1A 2ECQA 4TV9F 2E49A 4EHJA 1HBJA 1KZYC 1MO6A 1DLIA 2BL4A 1KIMA 2IHTA 3BHJA 2RGEA 3GG2A 3GRUA 3P27A 1JDSA 4OBXA 5KNCH 3T12A 4MVCA 2FPPB 1JG1A 1GLGA 4KFUA 3AVPA 3FTQA 4GBMA 3WA6A 2F3TA 4U7GA 2D7CA 3WL4A 4C4YA 4EFKA 2G8LA 4G9BA 4W7IA 3BFJA 4DNFA 2FFHA 2ODBA 1D07A 2XE7A 3DFUA 2RK4A 1BMFA 3K2IA 4P31A 2QUIA 1CUAA 1YQDA 4L5CA 3T9BA 3T5GA 5L9AA 4PXSA 4L7QA 2CV1A 3O4RA 2ICAA 4R0MA 2GBPA 4R54A 1E2DA 1D4ZA 3OLQA 2GO1A 4HUJA 4JKOA 5MN4A 1E4EB 4QTUB 3TOCA 4HH4A 1XVTA 1HE3A 1NWHA 1ECCA 1TC2A 2C00A 2HQOA 2XITA 3H6KA 1KJYA 2C04A 2P9QA 3I3OA 3KIPA 3KEOA 1J20A 4BBPA 3KJQA 1RHRA 4DAEA 5KQSA 4O63O 2RI1A 1GTL1 3I30X 1VCHA 1C9JA 1JTEA 3PNQA 3WLQA 4ESEA 4OXIA 2HLNA 4TVSA 3H19A 3RSOA 5KU7A 1WULS 2R84A 5AI9A 2DETA 4NENB 4XDYA 5DBGA 3MT0A 4AN0A 2BEWB 2JJ8A 1AZSC 2CBXA 3JQAB 3PQ5A 4EI7A 3K32A 1G64A 2X4IA 2D62A 3MTIA 5EGNA 1EM6A 2GLTA 3E2IA 2IYTA 3PPXA 3W05A 3WYAA 3ZWVA 4BTEA 4OATA 1SUAA 4EZEA 1CS0A 4Z51A 3GFOA 2YDYA 4N18A 4NQZA 1L6IA 1J33A 1R37A 4P53A 4RVFA 1Q7CA 3BYZA 1MX1A 3MAAC 4LNUA 4MV3A 3WJAA 1E59A 2H57A 3MCUA 4DLUA 3MS4A 2AN1A 1VE7A 3COVA 5BN5A 1IZ9A 1Z07A 2IFTA 3KAKA 4QPPA 4LYGA 1O94A 2OGZA 3OUUA 5CNKA 1MO4A 4MA5A 1RP1A 3WK5A 4AIIA 1JIQA 1OXKB 1H4SA 2VBGA 3E61A 2VRCD 5TF4A 4KYIB 1P60A 4ABTA 2Z56A 1GL9B 4YMLA 2AUMA 1XDDA 3LCUA 3OFKA 3VX4A 1KI6A 2R3SA 1K8YB 4WFQA 5H9VA 5CH3A 2NT4A 1UODA 2GX6A 2Q9AA 4H17A 4M1ZA 4RZHA 2FUCA 2FR1A 1SKQA 1FRZA 4QAJA 1JAIA 2ZUWA 3OZWA 4ZOEA 4LMRA 4XJSA 5F35A 3COPA 3N2YA 3B2QA 2OCBA 2YVUA 3T1VA 2NV6A 3PTZA 4RIEA 5COAA 3KSZO 3SBXA 4BNNA 4MWTA 3EIHA 3A36A 4C4ZA 4QBGB 3VGJA 5SY6A 2PV7A 3DOJA 5FOQA 4UUOA 5FL7A 5TT1A 5M29A 1PZMA 3ZI4A 2QMHA 3L1VA 1QQTA 4YRBA 5ALRA 1L0BA 2GF0A 1AGRA 2YWRA 3PNBA 4OK6A 1SC6A 3EDYA 2HHCA 2EFCB 1GUFA 2JPDA 3EGCA 2R86A 4FT2A 2VSQA 2C59A 3C6QA 4W1QA 1CUIA 5E0KB 3P4UA 1HRDA 2ZT7A 3C6XA 3CG0A 5LB4A 3KB8A 1CRQA 4FFPA 5AKJA 1T9ZA 1BU8A 3IMFA 3VU1A 5IWCA 3JYHA 4EL0A 4M1MA 3JASA 3UV7A 5IW8A 4BKPA 1BW9B 3OX3A 2FPGA 2J30A 4BKUA 1RC8A 5A02A 2DKNA 4GMKA 4WKNA 3WGGA 4W7HA 5C4IA 3HDGA 1E6CA 1NTOA 3KJIA 4M46A 1Y7PA 2QHXA 3IULA 5ERYA 4YT4A 3PU6A 4RHFA 4I8IA 2RGUA 1RIFA 3Q3GE 2IXDA 4KMSA 2QK4A 3PXXA 4TYQA 2N47A 4FWBA 1WVMA 4TLEA 4D8YA 1ZHHA 3P2JA 2JFOA 3QKUA 4M2LA 3VTFA 2DWOA 5AIAA 2QN3A 5EIFA 1W76A 2L2QA 2KE5A 2O1WA 1N2CE 4OQLA 3HN6A 5DPMA 3SPXA 3VDNB 3UGJA 1F7VA 3AR3A 3K0KA 1KXZA 2LUOA 2QTTA 8AT1A 1EK2A 1GYRA 1K98A 4JKIA 3EG9B 2OM2A 4JI0B 1PBNA 2J1LA 1H66A 2CY0A 3CX7A 2VBFA 2PRKA 3K8YA 4P4SB 4PSDA 4G4SO 1GEEA 4FI3C 4BEBA 3NKLA 4A8TA 2DHDA 1TUGA 3EVEA 5KTRA 4XFJA 3LSYA 2FPPA 3HY3A 2JGMA 2XGSA 2QROA 3QKSB 4TMWA 1U0JA 4CYMA 3B53X 1ANKA 1UFVA 2IUUA 4R5MA 1X13A 2H4WA 4WA7A 4OHUA 2WP8J 3GJZA 3TW0A 1RCUA 4JBXA 2I87A 2Y4OA 3OPQA 5JQGF 1N6RA 4OJKA 3WB9A 2ZUDA 3DLCA 4B5KA 5LQMA 5GIPE 3HB1A 4R8VA 3K09A 3ZDZB 2V58A 2AZXA 4HDQB 3UBMA 3SOPA 4K6KA 4HXEB 2OSVA 1QCYA 4JEUA 4KE6A 4FE3A 1SC9A 3N8NA 4I50A 4OXQA 4OP2A 4U7PB 3D3QA 2PKCA 4HH1A 3FCEA 2POCA 1JJFA 1I7PA 2W2TA 1RNLA 3IKVA 1TEVA 1FSFA 2O14A 3ITNA 3H5NA 4HXFB 4KPYA 4NENA 2PNFA 5FB3A 3O7WA 2O8DA 5WRFA 1BE0A 3CO0S 5CDYA 3BGVA 3DVSX 5JXHA 3JVVA 4BNTA 1PG2A 1VZ2A 4IMIB 5F9FA 1TJ5A 5D5HA 5I9TA 3UT5B 5I9IA 1OV4A 4OUDA 2OGWA 2CHGA 5KPDA 3NBAA 2JKVA 4HC4A 4XE5A 3ZLTA 3M9LA 4JT9A 2PU7A 2VF8A 5AQ1A 3KCQA 3WAJA 2AUTA 5MHTA 1WKBA 3PQCA 4R9RA 4LG1A 4ZEVA 2HOQA 1PR3A 4NOJA 5FA6A 4TQ9A 2FPIA 1X92A 2KWIA 4MR9B 2J59A 2FQ1A 2C8VA 4IIGA 3B3GA 4RE5A 4UTRA 1JFTA 2FSHA 1KP2A 3AY3A 3NV9A 4CM9D 3I05A 2EXXA 5L3VA 3B1JA 1KI6B 1KEUA 3HCFA 2P78A 5JDCA 2XEXA 2NV0A 2IYZA 1I2MA 5E95A 1WABA 2VT3A 3KT8A 5BUCA 4M60A 3PE3A 1M8PA 3PRHA 3DMNA 1QC5A 4GSLA 2ZYVX 2GEKA 1DEKA 2FX3A 2ZSDA 4HQNA 1IZ7A 3DHNA 1E79D 1PFUA 2WHPA 4KR9A 3OC0A 3FE2A 3RVBA 2EOAA 4N6NA 3EOBI 3PUVA 1BS2A 1J9GA 1Z36A 2F1HA 2PGLA 2C7VA 2V6GA 4G5OA 1NN3A 4XYGA 5G0SA 3CM0A 1WLSA 1DAGA 1W4AA 3ZS8A 1YZNA 3A6HA 3L92A 2FLVA 4LXYA 3IGFA 4DRYA 4K5QA 2EYQA 5GM1A 1EJ0A 1NKSA 1H2AS 1JPVA 1VP3A 2Q29A 3IX7A 5HGJA 1BJTA 1WAMA 3J7AC 4M7OA 3FNGA 4IKOA 4DIOA 2Z2IA 1GRNA 4ZV7A 1J8YF 1WXQA 2FEOA 1DBSA 3F49S 221PA 1ZW1A 1J09A 4MV8A 2I3BA 1B6TA 1T9GS 3D1LA 5I48A 2O7QA 2P3OA 3QE3A 5A1JA 3V6LA 1K6IA 1G20B 3SBEA 1ZKDA 3E5RA 4LE0A 4CEIB 1IUKA 1GZ5A 1WW8A 1D2CA 3NORA 4HSGA 1VL0A 1YUNA 3ZK9A 3HKEB 3KEMA 1MO5A 1U99A 3T5PA 3PPVA 2HJSA 5AOBA 3TCXB 1GPAA 2LZ0A 3KVVA 1CC1S 2DMRA 4HF7A 1RC0A 1QS0B 1DQYA 1UF9A 5AXBA 5FBVB 1EEHA 1FVOA 3G23A 3Q2IA 1Q74A 2AG6A 3OCCA 1WMFA 2HXYA 2PTHA 4R1NA 4E15A 4IGIA 5KJ1A 4OJNA 4DLAA 1VSUA 4BWYA 1V8BA 1JEAA 4QDOA 4YJ3B 3V8MA 2DTDA 3M7IA 1CNEA 2GWHA 3V8PA 2YZMA 5CGZA 1Z62A 3BD7A 3GGOA 2AGVA 3FPHA 4MV7A 1RQ7A 1SN7A 2PZKA 3NHRA 3QW4B 4JAVC 1VPEA 4GLOA 4QOIA 5HEKA 5T3UA 2QN2A 5IKEA 1WXGA 1S8AA 1G8GA 2W2XA 4HRYA 3GVXA 5JISA 4JQYA 2WDPA 4DYVA 2DU8A 1YDMA 1BHO1 4I4TB 5B53A 5JANA 4P33A 2F3SA 3DQPA 3L40A 3S2EA 2RHRA 1OU4A 4HBGA 4W82A 4ACAA 3L49A 4NJEA 3VC3A 3HM2A 3SYLA 5CLJA 1QONA 2RGNA 1KO1A 2DHQA 4MI9A 2EZ8A 5IDVA 3RE1A 3YASA 2YDXA 1MHPA 5ALGA 3VNVA 2J5XA 5PGMA 2G1JA 3FPLA 3SXUA 2BRUA 4X54A 3UHFA 3X2SA 1FMLA 1FFAA 4Z9YA 3WRXA 2J7PA 3BTOA 3R77A 4B9EA 3FWHA 1G9TA 1QYRA 2F1IA 2G09A 2V0NA 3PYXA 5ILGA 2XA1A 1TGYA 4BO9A 4X8LA 1ZW6A 3R6TA 2HEIA 2B3TA 5B30A 4D0RA 3QPVA 1YAJA 3HKEA 3LCVB 4MMYB 4MRMB 1YKGA 2XKKA 1Y9ZA 2MJLA 2R4TA 3D2AA 5HW0A 1JHXA 1KVTA 2H54A 2IA5A 2QJFA 2V9ZA 3FMVA 2CE2X 3F4BA 5DU2A 4E7PA 1YC5A 2BFEA 3IDZA 2OKCA 3GT3A 5M04A 3ETNA 3SZRA 3ZE6A 1XK7A 2BMWA 4CKZA 3RFUA 1KFEB 5G4LA 2GS9A 3TR6A 4KW7A 5IBRA 1CVRA 2ZJ2A 3V1YA 4DIMA 1Z8DA 2I0FA 1BFDA 4H3SA 3VDMA 1E0JA 2AW5A 2E2WA 3D8SA 3ICWA 4W9NC 1NP6A 3I45A 5FPPA 3TW8A 3W2IA 2WIFA 1XZJA 2A92A 2NXWA 2WTNA 3B1FA 3IEKA 4R6XA 1F2UB 4DANA 2VZ0A 4NOKA 2PKQO 1M1NB 5EKTA 3I2IA 1ZM4A 2P41A 2ZR9A 4I4LA 1RC1A 3SFVA 3VKGA 2WF9A 2PL3A 3OIVA 5FTLA 3N05A 2Z98A 1DZ3A 3BK7A 1ONNA 3B20A 4M9CA 1KTIA 4GI2A 2EP5A 1SQSA 4AKIA 2V8BA 2H5EA 2YN2A 3NTLA 1AD2A 1NOIA 1PJZA 2HAEA 4ZDWA 1U2RA 1EVQA 1H4QA 3H2BA 4GLFA 3DZBA 1RWQA 4EB3A 4AF8A 2HIHA 1G3RA 3AR5A 3X0DA 1LFAA 2JJQA 4JJZA 2F9LA 5JC1A 3AETB 2BR3A 2C78A 3PI6A 4Q18A 3LE8A 1QHHA 3S6JA 2Q5OA 3LVRE 2JVJA 3L0IB 4L8YA 4EJ2A 4JVSB 3WHLA 5DWQA 3ZD6A 2X7JA 3NFYA 1AIPA 4ZOBA 1ZNWA 1ZEJA 1GIAA 3AERA 1N6KA 2JFQA 3TTXA 3WGNA 3HCRA 3OD5A 1N9KA 1T36A 4KAJA 2BUAA 4JLKA 5IJAA 4G8CA 5FV7A 1T9AA 3MOIA 1B3RA 3O82A 2W2QA 2P5YA 1OI2A 3O83A 4B79A 1RPNA 1DBVO 3K1AA 2XQFA 3FB1A 4LZNA 2C57A 4Q3BA 2HTEA 3GFQA 1E6KA 1G5IA 1TCBA 1X1EA 1YR6A 1UK6A 4JASB 4PZCA 4XPZA 4UOEA 1RS0A 5K4HA 1X87A 4DV3B 2DBQA 4D9GA 4ZJPA 3GCXA 2G71A 3L0ZA 3WYCA 4CMEA 4FFMA 2J31A 1Q15A 3MB5A 1UQTA 1V3VA 2HA5A 1OC4A 2VDQB 5DOVA 3T1HB 1Z45A 3UK7A 2ZSIA 3PQ7A 4L73A 4PZYA 2NXJA 5JECA 1KPIA 5DBFA 1VIYA 1ZQ9A 3NC4A 4C4TA 5MN5A 3GJ8A 4HGNA 2QLTA 3H5WA 1VLHA 3KEQA 4HGPA 3B9RA 5ICCA 3LT5A 3EY4A 5FPYA 1AKMA 2GKSA 2KBEA 1AGPA 4JSRA 3BH6A 2WAYA 4P4UA 1SXJE 3DD5A 4DR4B 2ZI3A 4CMJA 2IYRA 4WI1A 4MVJF 5AKIA 3X2EA 1FC0A 4NICA 4J4BA 5I7UA 5DWVA 1EUYA 2HI0A 1FTQA 5IUJC 5TQ2A 3C4QA 2KHZA 4LJSA 3VHXA 1C0KA 1YDEA 2NM0A 1KS9A 2JGEA 1OFGA 1VLVA 5BYKA 2P6UA 1XLVA 3NGXA 5BN3A 3HV0A 3IILA 3LY8A 4Q3OA 1IM8A 5JASA 2F55A 1T36B 3NQ41 1KZ4A 1VPTA 1UWVA 1JB9A 1RWXA 3UVEA 1EAYA 1O7JA 2B4KA 2WF5A 5IFLA 3R6DA 3L7LA 2G83A 3EPJA 2JFFA 2QZZA 3IEMA 1EQUA 3UT5A 1RLTA 2IU6A 3HLYA 4XVQA 4E4YA 5B7NA 2QN8A 2C4KA 4UCFA 2QSYA 3HDJA 3ZE2B 2EDAA 2XDYA 4MZXA 5A5FA 2E37A 1M7BA 3IV7A 4IV0A 4K9PA 4L85A 4LQLA 2VQSA 4M22A 2GSDA 1RADA 4EY8A 1J2EA 1OYVA 1U7DA 3RCBA 2AXQA 3ZWPA 1DCFA 4BQFA 1QTIA 4DV4B 4CF3A 4FCWA 4DN6A 3AB8A 5DN9A 4FFSA 3WTBA 5HQJA 1EUZA 2NXNA 2NT3A 3RYCB 2HCFA 5CH8A 5A4DA 1RXEA 4NFLA 4MUBA 2B5OA 4NBTA 1HA3A 1RLOA 1Z2PX 4FW9A 4CF6A 1T2CA 5F4ZA 4HWPA 1U8XX 3G49A 1M75A 2EP8A 3CUEF 4MB2A 2FE4A 4OI0A 3I2YX 4FWIB 3WYEA 5FPKA 4EJ0A 1H0RA 1FMCA 3B6KA 1IATA 3U3KA 2HF8A 1J8FA 1MJHA 3IQDB 4FZ3A 3SC2B 1R16A 3MTGA 4AD8A 2AQIA 2QY9A 1G66A 1AQNA 4RPKA 2RG1A 2IELA 2JBWA 1E1CB 2AXPA 1ZQ1A 5D8DA 5JHGB 3LX6A 1M0TA 1GT6A 4LSMA 2CFOA 4L8FA 4P0QB 2OEPA 4C78A 4KR0A 5ALSA 2I6XA 3OU6A 3A1VA 4U7DA 1NNUA 4FGUA 4NOMA 2YN4A 4M1SA 2P91A 1NU8A 1YB2A 3RUAA 2JLRA 3VC2A 1R8XA 4RHXA 2X0DA 5E8JA 4CLOA 3ONFA 3EZ6A 3DXYA 4R40A 4R7ZA 5TVGA 4ALLA 2Z6QA 2CV2A 3FETA 3QKWA 4Q6WA 3NKVA 4AF6A 1SUDA 2GZ1A 2IOYA 2WFMA 4ONEA 4WPGA 4Q3KA 4R41A 4QX6A 3WL7A 1O96B 4DC1A 4OQMA 3VUEA 1MB9A 1FU8A 6LDHA 3STTA 5ICGA 4JY7A 1J2RA 4MYRA 5KCZA 3RYFA 1BE1A 1SG0A 2HUNA 2VH2A 1TUIA 3I9JA 3DKVA 4QYMA 1C9DB 4HPXB 3V7NA 3DNMA 1U28A 2A1TS 2V0CA 1D2MA 3LBNA 4Q1DA 4URWR 3WWCA 4WXEA 1EX9A 1KXJA 3IRUA 1TFUA 4Y6SA 4H7PA 4B7CA 4P3KA 3NOXA 2W2LA 4C0KA 1H65A 3RVLA 1V2HE 4YJ3A 3BE8A 4LOJA 4WBXC 3W5UA 4HB0A 4ND3A 3IJPA 2C98A 3PICA 4JUDX 3ROQA 3GLGB 3O4FA 2C54A 5CDTA 4DDWA 3LDGA 3DZCA 3ZCPA 4IGFA 1DOHA 4F93B 1W2GA 3D7KA 1JECA 2W2VA 3GWGA 4GE3A 2I2FA 4OHVA 2VJMA 1XQ6A 1IYZA 2PQ0A 4TUYF 1UC4B 2VG8A 5FNVF 3DHVA 4Z86A 1XZNA 1BMDA 2Y0DA 1NW9B 4GM0A 4Z9BA 1IIRA 1RKXA 4PBSA 1FXUA 2CNWA 2X0NA 1G21A 1QFZA 5A9SB 3Q3HA 4IGKA 4DARA 2CDAA 3BWDD 5FULA 3VPCA 4WLOA 5F78A 1S5PA 2H1HA 1NULA 4BE9A 1NBIA 4YWHA 2Z58A 3H11B 1E2IA 3Q1LA 4HB2A 2VPZA 3F8WA 2A1TR 1GPMA 1Y7HA 5AW4A 2GRUA 3W6NA 1YA8A 3BEOA 2PWYA 2VNKA 5DZSA 5DIZA 1FYFA 4NIMA 3GMTA 3INGA 4Q02A 4ACBA 3NHBA 4W5WA 4A3SA 4BO1A 4GOOD 3R76A 5LU8A 3N74A 1JHDA 1SHTX 1Z12A 2I22A 3OHMA 1R6BX 2GPWA 3DO8A 5CVVA 3F73A 3ZY2A 3RGWS 1YS4A 5H80A 2G06A 4XXHA 4KVAA 5HILA 3KPYA 5F1YA 3CRW1 4KDEA 4QC2A 4U2EA 3CBGA 5IKXA 5CMLA 3VSEA 5LMUB 1Z16A 4HV4A 4HPJB 1WRBA 2ZYHA 4CM8B 2VZLA 2P9YA 4BVGA 5CDHA 1E9SA 3IT2A 4L02A 3TNLA 1WB6A 2GJ4A 5B5SA 1YU6A 3V32A 2MYNA 2VJAA 5KKNB 4S2UA 3TFOA 2XRYA 2G7MC 1T10A 2ZYGA 1JDTA 2LNDA 4OBEA 3W04A 1WF6A 5KWEA 1K7SN 3SVTA 3WGMA 5IU6A 2J0QA 3LZ6A 4C6TA 3JQ7B 3EK2A 4J7AA 1DG3A 2IHUA 2CC2A 1VJ5A 2X2EA 5I51A 1QRUA