4BMZA

Structure of futalosine hydrolase mutant of helicobacter pylori strain 26695
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
230
structure length
230
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISNNADEEANMSFDAFLEKSAQTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Enzymology of Helicobacter Pylori Methylthioadenosine Nucleosidase in the Futalosine Pathway
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords MTA/SAH NUCLEOSIDASE
total genus 83
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmzA00
4QAQA 4TS3A 1Y1SA 4EARA 4G89A 1PR2A 5F7XA 3GB9A 3OZCA 4MCIA 4F3KA 1A9RA 1JE1A 2QTTA 3KVYA 2OC9A 4NSNA 3FOWA 2A8YA 4KN5A 4X24A 3O4VA 1RXCA 1U1FA 3OOEA 2B94A 1PKEA 1Z5OA 3OZBA 1JDUA 4WKPA 1JP7A 3GGSA 2A0WA 4D98A 3T94A 4DA0A 1Z33A 5KB3A 4G8JA 4WKNA 2AC7A 3EMVA 3O6VA 1PW7A 1Z34A 5EFOA 5CYGA 3LGSA 2ON6A 3KVRA 1I80A 4U2KA 3C74A 1YRYE 3P0FA 1TD1A 1ODLA 3E9ZA 5F77A 4ECEA 1JDSA 3EUEA 3MB8A 4MCHA 1Z5PA 1Y1QA 1SQ6A 1K27A 1K3FA 1RT9A 5F76A 1RCTE 3DF9A 1NC1A 1ZOSA 1TGYA 2AI2A 5F78A 5F7JA 5F73A 5CYFA 1Z39A 1OTYA 4RJ2A 3ONVA 1T8WA 5I3CA 3BL6A 5CXQA 2I4TA 4QATA 4R2XA 1WTAA 1OUMA 1ECPA 3QPBA 3K8QA 4EB8A 5CCDA 3E0QA 4OJTA 4DAEA 2I8AA 1RXYA 3PNPA 4M7WA 4TTAA 1ZL2A 1QE5A 1LV8A 1PR5A 5DK6A 4JOSA 3PHBE 4L5YA 1A9TA 4GKAA 4OEHA 3IOMA 4LDNA 1JYSA 4MARA 4NY1A 1TCVA 1PR0A 2QTGA 3D1VA 4GLJA 1VHJA 2HSWA 3UAZA 3LBAA 4GMHA 2QDKA 4D9HA 4M3NA 1JPVA 4FFSA 5EUBA 1Y6QA 1V4NA 3PHCA 4M1EA 4L0MA 2OXFA 1Y1TA 5B7GA 1ODJA 1U1EA 1Z35A 1JE0A 1VMKA 2BSXA 1T0UA 1YQQA 1ODKA 1YQUA 1JDVA 3UAWA 4TYMA 1RFGE 4DAOA 4K6OA 4BMYA 4TTJA 3UAXA 2RJ3A 1RSZA 2HWUA 3UAVA 5JPCA 4I2VA 3ENZA 3DP9A 3MMSA 4BMZA 4QASA 1U1GA 2IQ5A 4L5AA 1PR1A 3P0EA 3NM4A 4F3CA 3NBQA 2HN9A 1NW4A 1T8YA 4WKOA 2OC4A 3BGSA 4LNAA 1VHWA 1Z5NA 2QSUA 3K8OE 3KUKA 4TXJA 1T8SA 1PR6A 1ULBA 1RXSA 2PGAA 1T8RA 4DA6A 1PBNA 5IFKA 1PK7A 5EPUA 5IU6A 3IEXA 1CG6A 1Z36A 1Z38A 1A9QA 1ODIA 3NM5A 4TXMA 5C80A 4OF4A 1Y1RA 4UC0A 5B7QA 1OU4A 1TGVA 3TL6A 4TXNA 1VFNA 3E9RA 4DA8A 4QFBA 1B8NA 4YJKA 1C3XA 1U1CA 3F8WA 5F7OA 4OGKA 4GLFA 1RR6A 1JDTA 1NC3A 4P54A 3DDOA 5ETJA 1A9PA 2AI1A 4OGLA 3UT6A 1FXUA 1YBFA 4IP0A 2A0XA 1TCUA 1V2HE 5CCEA 2A0YA 3KU4A 1SJ9A 3FUCA 1XE3A 4QARA 3EUFA 1SD2A 4TTIA 2H8GA 3OF3A 2QPLA 3OZEA 3EEIA 4LZWA 1LX7A 4PNPA 5B7NA 3UAYA 3OPVA 4G41A 3FWPA 4TS9A 2AI3A 3PNSA 3KHSA 4BMXA 1OTXA 1Z37A 3FB1A 1CB0A 4TXLA 5B7PA 1M73E 2XRFA 1V3QE 1ULAA 1RYZA 3KVVA 5F7ZA 1PR4A 4F2WA 2ISCA 3FNQA 3U40A 4R31A 4JWTA 4D8YA 1OVGA 3SCZA 2P4SA 4NS1A 1K9SA 2Q7OE 1A69A 4D8XA 4PR3A 4LKRA 1U1DA 4H1TA 1V45E 3DJFA 4YMLA 4YNBA 3FAZA 1PWYE 3INYA 1G2OA 4BN0A 5CXSA 4DA7A 1PF7E 4R2WA 1SD1A 4DANA 5FAKA 1Q1GA 3NM6B 1V48A 1N3IA 1YR3A 2HRDA 3OZDA 1RXUA 4D8VA 1B8OA 3ODGA 4F1WA 1Y6RA 3BSFA 1A9OA 1PK9A 4DABA 4F2PA 4TXHA 4LNHA 1JDZA 3DPSA 4L5CA 4OY3A 3LA8A 3OOHA 4JP5A 2GUWA 3OCCA 4WKCA 3BJEA 1V41E 1A9SA 4QEZA 5K1ZA 1OV6A 2OECA 4L6IA 4DARA 4WKBA 1LVUA 4E1VA 4YO8A
chains in the Genus database with same CATH superfamily
3RV4A 2ST1A 3NNNA 4WAUA 3G89A 5JNLA 2XWSA 3K1TA 4ZN6A 2I78A 3EHDA 5TT1A 3ZGLA 1NJ5A 1OT3A 4W63A 1T9DA 2O3JA 2PKQP 4IMIB 4QFMA 4RENA 1XUOA 2V96A 2E0IA 3HN2A 4QWMA 4XX0B 1YK0A 4IIVA 1FIUA 2A4MA 2ATCA 4FK8A 1PS9A 3WV4A 5H4HA 3KHTA 1D2CA 2DMRA 3OZCA 3RJ9A 2W2VA 4TT3D 4D4LA 2FAXA 3RBXA 2XZLA 4C4PA 3NASA 1CIVA 4LJYA 4C7KA 1CD5A 2QRHA 3VYSB 2WWFA 1TLFA 1L7PA 4HMQA 5G0SA 5B3JA 4D3ZA 5CFQA 2X0NA 4YP9A 1KTVA 2O54A 1ZC3A 1ZN9A 4KXWA 1XHLA 4NSNA 4A0QA 1TMGE 1V5WA 8AT1A 1R0XA 3B1XA 4PZ9A 1I30A 4UUNA 2FOLA 3U7EB 1EUZA 3FOBA 3FMIA 4URFA 1NBME 1UT5A 5YASA 2P3LA 1MC4A 1TKBA 2WYIA 1Z5OA 3OZBA 3NQ41 2WFAA 2X8WA 3DDSA 3Q5EA 4YJ3F 4IH9A 5FOSA 4YUXA 1EK5A 1C9KA 2EV9A 3M4JA 4YECA 2G40A 3CCCA 1B6GA 1E2JA 2PM8A 3GGCA 1KS9A 1AO0A 2PMDA 3QVWA 2AJBA 2ZG6A 1IH8A 1U7TA 3AESA 3DFIA 4WX2B 4TQGA 1UEJA 5JZVA 3LT2A 4FDVA 3OZTA 4OXXA 2VH5R 4PG8A 1DWPA 1K7XB 2NZVG 4BVAA 1G8SA 1A4UA 1THTA 3RQSA 3OMXA 1BMTA 4M1WA 2ZUCA 1NKVA 3CKKA 4OHOA 4F6LA 1FQOA 4NP6A 3H11A 4G4SO 1SVNA 1ZJJA 4HDKA 4U7WA 2ZUTA 4G8JA 1E1QA 3W2TA 2SKEA 2CJWA 5FHRA 4D3XA 4BLRA 1CR4A 2LBPA 1GN9A 1FVFA 1I6LA 1XEAA 4WCVA 4OSPA 3WL6A 4Q0MA 5CYGA 4M1SA 2Q3JA 2W98A 1PZMA 4MRRA 3SZRA 2X3UA 5L4SA 4PNHA 3L4EA 1NOJA 1WZIA 5BQ3A 2ON6A 3HHPA 4CV2A 1UQTA 4P4SA 4ZOLF 3LX4A 3FYHA 2EKZA 4AJPA 3UJHA 4YI5A 3PYMA 3I92A 4KJZA 3NBFA 1N5OX 5F77A 1VG8A 4B71A 3EUEA 3K0AA 4F3TA 2ZANA 1R6AA 1HRKA 2PQ2A 3MB8A 2HX1A 3MUOA 4IJVA 1EDOA 1UP4A 3ZE8A 1V6SA 1NIPA 4AG6A 2J3DA 5BY2A 4O2AB 2CCKA 2HJ9A 3CLTD 3FAKA 3QP9A 1G0NA 1CQIB 3M7IA 2PSDA 3DDZX 1NXPA 1OCEA 1AZSC 2QRKA 3LF1A 1TGYA 1IN5A 3BHNA 2R97A 1G6Q1 5CDHA 1DC7A 4U0KA 2HMVA 2YWDA 2J9FA 2FFQA 3RSZA 2ZRDA 4E03A 2GCOA 3SF8A 1A71A 2ZGVA 4TSKA 1CJVC 2ZIGA 1L8OA 1M2JA 1FNCA 2P2SA 1L5RA 3IAM6 5LQSA 4YJFA 1OTYA 5H80A 4OI1A 2GS9A 3RHSA 3STHA 4HVCA 4O4IA 2WU0A 4CFZA 4HDSA 4KLCA 1GKLA 4WVFA 1GPBA 3GA7A 2J87A 2GJ8A 4K9LA 4HLCA 3I6IA 1KAGA 3LUDA 5DIZA 3H0CA 4DADA 1FZQA 1KDVA 5SY4A 2Q0HA 4L0CA 2J0QA 1QV6A 1ECPA 2BUBA 2VF7A 3T1QA 4X91A 1HV8A 5KOYA 3DE0X 3OCZA 1JNXX 1Q84A 1XCBA 1Z6GA 2QNBA 4J43A 1KO8A 3U0BA 5AD1A 4R69A 3U7IA 5L3ZA 3T8YA 5JBIA 3HB9A 4TTRA 1T15A 1YB2A 3DBHA 4NOLA 2AYXA 3O2SB 1GKKA 2X4IA 2YQ5A 1E2UA 1Q91A 2VH1A 4GR5A 2NZWA 4IDNA 3F5FA 4RADA 1M6EX 2G7ZA 2IW3A 4E0BA 4ZGWA 4NENB 1CBUA 3CF0A 2FZEA 3JD0A 3BFPA 4OB6A 3EZNA 4PLCA 2F1KA 1VSBA 4KRGA 3T34A 2FZCA 3ELWA 2PZFA 5HOEA 2BGWA 1KMQA 4OK5A 1UDRA 2X2FA 1VHJA 3PNYA 4KBGA 5DGDA 1UKEA 3RHFA 2YDXA 3U3DA 3K9FC 3KK0A 2LIPA 4QE3A 3BMQA 3T0IA 2EBWA 2VP3A 3EC1A 5A6SB 8LDHA 1U8FO 3PWTA 3B7PA 5THXA 3REQA 5JAPA 2UZ3A 2XDAA 3IQWA 4QQKA 5D6OA 5BWNA 2NP7A 2FPIB 4LY3A 4QODA 1XEWY 4D9JA 5CXUA 1WHTA 5LNK6 4CL3A 3R5JA 4Q4LA 1XPUA 1GNPA 3BCSA 2B78A 3WIOA 2CLIB 5IMBA 4HWRA 3DSRA 3UMCA 3VKVA 2PSEA 16PKA 1BVUA 1NBAA 2JFHA 3V2UA 3FPFA 4F9TA 3HBMA 2JEZA 1Y1TA 4Y1RB 2PMEA 1XQVA 3ANXA 3OOYA 5T4EA 1VMKA 2GBCA 1T0UA 5DBOA 4AROA 1UOPA 2IOYA 2P41A 1J0BA 4A10A 3TTUA 4C0HA 1ODKA 2WHQA 2RBEA 3KQKA 1YASA 3G1WA 1ZRNA 1JTEA 1WM1A 4TVOA 3M4ZA 1KP2A 1WR8A 5KREA 4PYLA 1H42A 4X8OA 1RKXA 1KYWA 1V8BA 3DAGA 4MVYA 3UAWA 1KOGA 4ND3A 4JC4A 2NVBA 4ZVQA 4RLSA 4Z9AA 1X94A 2PUFA 1K06A 1NF8A 2ZUEA 5E1DA 1QP0A 5ALHA 4Z1MD 2YJ4A 2J09A 4DUZB 2CVQA 3I0ZA 4ZWNA 4CG0A 1R1DA 2Z9DA 2PE5A 4UKDA 2I76A 1JSZA 1ZNQO 3GUUA 1FU8A 1SPXA 4TYYA 4R1SA 3SN6A 3G1TA 1I2AA 1NBEA 2J0UB 2WF7A 2YMQA 3EEYA 4ZEVA 5CA1B 5KTRA 2P3SA 2C2WA 4JKYA 2EFCB 4P9NA 2VQ3A 1FFXB 3IDSA 3AFGA 1HQCA 1E3JA 2NZXA 4FWIB 1NY6A 2Z3ZA 4RIFA 4R9RA 4ENWA 3QOWA 5EMNA 1Z2OX 2QD3A 1F4LA 3QE4A 4XQEA 1PZXA 5LU8A 5KSPA 5CJPA 4Y2HA 5JJ5A 1ST2A 4GRIA 1P0QA 1VRWA 3GUYA 3SFTA 5ALGA 1U6IA 1YFKA 3V80A 1H94A 1V5FA 1JHDA 2XDQB 4R5MA 5CPBA 5LBTA 3HSKA 3KSRA 1Y9ZA 2FCAA 2P91A 4EG0A 2I9KA 3LGAA 1YXMA 3FSEA 4Q4HB 4GXNA 1I2CA 1CY7A 1MB2A 3R7SA 3ILSA 3OE4A 2WSMA 4GFDA 1KDOA 3T7AA 4Q9HA 2DLNA 1FQJA 3KZ1E 4ISCA 4ES6A 1Y8CA 1QS0A 3GEEA 3TGLA 2BFPA 1BO6A 4K9MA 1N2EA 1NYLA 4Q4JB 5JBQA 3DHYA 4LYYA 3PVSA 3W6ZA 3VPDA 3CCFA 1R2QA 1Q16A 2EX4A 3GDWA 4HDOB 4Y2QA 2D06A 3SXUA 2ODBA 2PD3A 4GOKA 1B6TA 1BMFA 3GH3A 3VZSA 3KWJA 3ZIAD 3LOQA 3D4IA 5K6TA 2EL9A 2PV0A 2VDQB 1OI2A 1IHXA 1SOMA 1YCHA 3IEXA 5HA5A 1ONSA 1TEXA 2E4YA 4KH0A 3B5IA 3EPHA 2EEZA 4HDRB 2F64A 2OV1A 3GJXC 4M0UA 1ZXBA 1Q7TA 5J40A 1LC3A 4QGFA 4YRNA 4KC0A 2VYFA 3FOZA 2RCNA 4E08A 2FSHA 3RC3A 4MUBA 4M21A 5AHWA 1ZIDA 1Y7PA 4K40A 3TOSA 1C1YA 5E8RA 3D6AA 1NULA 2OBYA 3JCZA 3TE7A 1YNSA 1T9HA 3I32A 4RXMA 4FB4A 4G0OA 2O8FA 3GRFA 3RIMA 5IXSA 1XTQA 4W1PA 5JAOA 4JYZA 2C7BA 1Q92A 3KB8A 1ZJ5A 4PSCA 1UFKA 2FW8A 4B6OA 3GAAA 3IYLW 2UDPA 3VDXA 3INNA 1LI4A 3WBFA 2QD1A 4LHWA 1BHJA 4Q18A 3NO4A 3IPXA 1R27A 2FETA 4ZDKA 4BEJA 1JWLA 4CEHA 5FLEX 5ENDA 3QG1A 3QOXA 2PGNA 3B3AA 1P2UA 3ESXA 4OXRA 2QTZA 3DV0A 2FQQA 3U39A 3D5TA 5BW8A 1KSFX 3O4IA 1A9PA 3FLEA 4JZKA 4N5NA 4OGLA 4RLFA 3TLGB 5M29A 4OJMX 5FPPA 5IMSA 5F2EA 1JR6A 5ALPA 1FS5A 3CH4B 1B74A 4F4IA 3RW9A 4YAIA 2HMYB 5GTDA 3TUZC 3O47A 5JYEA 4RM3A 1FYWA 3GVIA 1ICIA 2FPPB 2LDXA 1QO9A 2J33A 2YQZA 3F96A 1V2GA 1VYUA 1YFZA 3QQ5A 3ED1A 3W9UA 5KHAA 1HXHA 1MAVA 1YDWA 1EAYA 3QVGB 1K2WA 2F2TA 3CNHA 3M4YA 3T3IA 2FFRA 1NR5A 1QH1A 2PXCA 3KT3A 3ZCSA 5K8CA 4JODA 5LJLA 2H2HA 4C0SA 2AQHA 1JEOA 3TQQA 4QPCA 1TVKA 1VGRA 2PT6A 3OC0A 5AKJA 2QHXA 3V1NA 3VR6D 4DLWA 1RQ7A 1G9XA 3WIUA 2VJPA 1P1IA 4C30A 3DVAB 3TZKA 4RXTA 5BQ5A 4BFXA 3N2KA 4EB6A 5BORA 4UU8A 1MABA 3UM9A 1WL8A 1WMAA 1KEZA 2JDID 2PIAA 3IHKA 5HNKA 3RPEA 3R6WA 1DZ3A 2C2ZA 1DIBA 4JITA 3I9NA 4KBFA 3E23A 4M60A 5BN4A 2RDMA 2RI6A 1UMDA 3P71T 1NG1A 2J85A 4FDTA 3ZHTA 2QTFA 3FB1A 2DPGA 3HFGA 4INZA 1QAMA 4HLNA 1RJWA 1ZJZA 4NS4A 3I0MA 5GOTA 2ZWVA 1NVEA 3TXXA 4E7OA 3N0TA 4EFMA 3IOEA 1KEVA 2QYSA 4Q4CA 2X9VA 3AM1A 1EM6A 1G66A 2P79A 3KUCA 1FA9A 3JQCA 4A8TA 1PFWA 2R11A 1E1LA 4RKFA 1JJAA 3MSXA 1NI4A 3ROMA 4DGQA 3R5KA 1KY4A 4CR7A 3DYBA 3KZKA 3RSSA 3MJRA 1EK1A 1PR4A 2R25B 4N54A 4F2WA 1COWA 3Q8LA 4RDCA 3MYRA 6REQA 5I48A 2WHRA 4MJXA 3H2HA 4OHZA 5ITSA 1ECCA 1V95A 4HB0A 4WACA 4N76A 3CF2A 3I2GA 3FHCB 1J7JA 1K92A 3NTLA 4FGLA 4BAUA 2JAQA 3IELA 3D02A 1U7HA 5H9VA 3VC7A 4AYWA 1JG1A 4KR9A 4Q7LA 1H9BA 3L6EA 3UMVA 1Z6TA 4G5RA 3HU2A 5JRZA 4JYAB 1L7OA 4G4IA 1ZMOA 3IMFA 1JQBA 4NVRA 4O0LA 5FR2A 3FZGA 2W2KB 3T06B 4DZTA 1E1YA 1PI3A 4XWKA 1O97D 2B2NA 2GAAA 4NNPA 4QBHA 1NMYA 1OX4A 1QIFA 4UBMA 3SHQA 4UFNA 1HYHA 3EXEA 3CX3A 1SXGA 3KKNA 3D4PA 2LKDA 4KMSA 1BWQA 2QP3A 2WFZA 2Z2KA 1P29A 2E4ZA 1KORA 1R12A 2FW6A 2WI8A 4P80A 4Z8XA 4CCYA 2VN8A 4UMDA 3ZGXA 4EQ6A 4Z4EA 1H3EA 5J43A 5CLGA 4DA7A 4HNHA 3DTVD 1ZZGA 1GG2A 4ZU6X 9ABPA 2EBUA 5LYJB 1IWOA 3OZ7A 4N7BA 4V1CA 4RS3A 1UP6A 3N3AC 4LWPA 2VPYA 5KJ1A 1QFJA 3LVRE 4CF6A 1WOYA 4YLGA 4XB6B 3OQ1A 1W73A 2NWQA 1H4TA 2C3MA 3I8SA 4R68A 4U6NA 4WE3A 5AM1A 5LFAA 5CIYA 1G60A 4CV3A 3AL0C 5AVXA 3GEDA 4RIIA 3QXXA 2XQKA 3AFNA 1CULC 3MGCA 1U02A 1NONA 3DHWC 4W1SA 4ARSA 1YR6A 3RR2A 3FVVA 3UJ9A 2JKYA 4RPJA 3BK1A 4JYMA 4PFKA 3AFHA 1NE7A 2GXSA 1PW5A 1UJ5A 3H5OA 5AK6A 4A2CA 3WAGA 3SYKA 1KS2A 1QH0A 4I5GA 4CM1A 5C7IO 1D2MA 1DBIA 3OEEA 1VTKA 3CZCA 1YMUA 1WU7A 2XMGA 3QUQA 1Z12A 4A0SA 4CF4A 2GJ4A 4EAQA 5ITZA 5M2QA 1XCPA 2W2MA 3E35A 3KPYA 1GUFA 1NF3A 3BB1A 3RK4A 1D5WA 5A3QA 1WXEA 2GJSA 1YR2A 1U11A 3BL8A 1I8TA 4ZAFA 5BUQA 2NUPB 3Q4GA 4QO8A 2B35A 3FF1A 3LZCA 5ALDA 4KWEA 2ZI9A 4NDAA 3PFCA 1E7RA 4LXUA 3LBHA 2X8AA 2C5AA 4KQKA 4QJBA 3PFNA 4MHTA 5IM5A 2C84A 4S0XA 2R48A 1MW8X 5CA1A 3CB2A 5DTEA 4GZ6A 5CB4B 2F1HA 1U6KA 1L9KA 3F5MA 3WWEA 1X8LA 1HE5A 4M8SA 1SBQA 4R3UC 3ZZ0A 4Z9XA 4FR0A 5HS6A 2QAIA 3Q8WA 5FUVA 1K68A 1V16B 1RI2A 2BW0A 1YZUA 3SSMA 5DNCA 1F0PA 1LVUA 3K4QA 4IIJB 3T35A 3ZH9B 5CA0A 3GNTA 4BZZA 4N5MA 5HIMA 5J2TA 4TS3A 2YY6A 4V3BA 4GC9A 1FW8A 2VYQA 2NSYA 3QBEA 1LK0A 2Q21A 2M6RA 5HQ3B 1RWNA 4KUEA 1EJBA 3F9IA 1KJ9A 2Q5EA 4YBRA 4MMZB 3MAAC 1P19A 4HUQA 1MAUA 1Y4SA 3V1YA 3UK0A 3K32A 3C97A 2H0QA 3D8RA 4WJLA 5AVQA 4CUZA 4TV9B 4EY3A 4DV2B 2IP4A 3MRVA 3ZD6A 1JJFA 1QGUB 2SHKA 3DO5A 3I83A 3LWZA 3MEQA 3WBJA 2NO0A 5B6IA 1QS0B 3OJWA 4H2DA 4L3VA 3I3OA 1CW2B 4HPXB 1UEXC 2PU5A 1E9BA 5AI8A 5JOQA 4X24A 3B89A 1BOOA 1QO0D 1UKVY 3MMPA 4WLOA 3PSAA 2XMRA 2P5YA 2PL9A 2X1LA 3PUWA 4KO1S 5BN3B 1JXMA 2FDRA 5IKOA 4B3IA 2QLBA 3VJRA 1LBHA 1ZG3A 1PTKA 1N9ZA 3KD2A 1XCJA 4J94A 3OX2A 4PIVA 3ZDQA 1FLVA 3N7AA 3ZY2A 5JARA 3GLGA 3M6FA 4X5OA 1QIDA 4HI0E 4FHDA 5GAJA 2XHEA 4EQ6B 4ZDJA 2LP4Y 2QWXA 1XX6A 1Z6AA 1G3QA 2CJYA 1GT6A 1J0DA 1FS4A 4BWYA 5KNCA 1WBBA 4O5AA 3C6ZA 5DYWA 4KMMA 2Z8XA 2PO7A 4J76A 3STUA 1R37A 4MI1A 4Q1EA 5K3OA 2X5JO 4PNZA 4OAQA 4LEIA 2QQEA 2VEOA 2P2LA 2NSHA 2J3JA 4FFBA 3DVLA 4UMEA 1ZI8A 1KWGA 3EVFA 4UMFA 1M33A 5EFZA 5LMUB 4MKXA 1KETA 1V3VA 3O82A 3QFCA 4R9VA 3S0JA 1B4DA 5AI0A 4DMUB 2WJJA 2XTJA 2ZSEA 4UNNA 2FMKA 3PL1A 2XV1A 1SBIA 2WSIA 1HOTA 2C7QA 5C1IA 2YVQA 1TEHA 5C8YA 4ALKA 3LP6A 2RMKA 2JRCA 1GO2A 3EAFA 1T6XA 2B1IA 2FP3A 4G3XA 3RM3A 5KYXA 3QW2A 1GAEO 2Q3MA 2VKQA 4OQ4A 4DNPA 1V8ZA 2CXOA 3DB2A 1PJTA 4OB7A 1XT6A 1BXKA 3FBWA 3H13A 4ECEA 4UUBA 5K9ZA 3K6JA 5FOUA 7MDHA 1DJMA 2XUIA 3H5LA 4IJWA 4JGBA 3B2QA 1XHFA 4R01A 2F3PA 4LOAA 1XYGA 3WNVA 2O2GA 2WA2A 2ECOA 3EWNA 3U9LA 3WLQA 1ADGA 5IVDA 3FWKA 1N3LA 4FGSA 5ALUA 4UD2A 3FHJA 2GD6A 2JHAA 4FR2A 2DOKA 2IYEA 5KYWA 3DZDA 4CLOA 5IG2A 1X1QA 2CDRA 2XBUA 2QVXX 1KZYC 3IEUA 2HHAA 3HXLA 3N6RA 2EKPA 4M1ZA 1GPWB 2VYVD 1BVRA 3HGMA 5H0IA 1N77A 4LG1A 2HA2A 3Q8MA 5FR1A 4YMUA 1PLJA 2FPIA 3IQZA 3LKDA 1I3NA 1YKSA 4FGZA 4IJKA 4JL8A 5CVJA 4BFYA 1E5VA 2RHWA 4GOXA 3DF7A 3X1MA 4MV5A 2OM2A 5IC6A 2IXEA 3GGOA 2YBEA 3MQFA 1Q0UA 4JU8A 2XX3A 1RM3A 3E2MA 2XNJA 4RJ2A 5ILQA 3SG0A 4D9IA 2WNSA 2GT1A 4II7A 2ZIUB 5FORA 3A1VA 3FLAA 1FDTA 2IP1A 3FNIA 3QVJA 4UBKA 1RXVA 1DWUA 4RHCA 1Q83A 3ORQA 4II2A 4U2EA 5I7VA 3K16A 5J4YA 2QMQA 5SZIA 2ODAA 2PUHA 5IJAA 3IGFA 3TDNA 1OUMA 3RTCA 2DM6A 1J8YF 1I1HA 5A06A 2DE0X 4ZCPA 2AOUA 3B36A 1RPJA 3MD0A 4FDAA 3WBKA 4WN9B 3MGGA 4ZHSA 2A1TR 1NPYA 3DAHA 4WSOA 5B12A 4UHHA 3N76A 2PAFA 4M1MA 4P31A 4AP5A 1XKLA 1YJCA 2YWCA 3SLKA 3VTZA 4C89A 3OPYI 5KPDA 4DUPA 1SCJA 2B30A 3PNPA 4DDTA 4GMGA 4QKQA 4EECA 3HDHA 4GL2A 1QG2A 1XQYA 2AN4A 4J16C 4BKQA 1R6TA 5CLJA 3OAAD 2ET6A 3DCYA 2ZYHA 4L4RA 4OQQA 4N3CA 3TLCA 3U4MA 1N6RA 4B6JA 1T5TA 2WR8A 3QXGA 4EI2A 3EX7C 3ZCUA 3ESZA 3FBGA 1UODA 4BPBA 3RT1A 8ADHA 1N6HA 1Z0SA 1IZ0A 2ZQ5A 5BSKA 5BQOA 4X61A 2X15A 3HCCA 1IATA 2QSJA 4KVAA 5FPSA 4AAYA 3LZ6A 4OQPA 4RJKA 4HWGA 4Q82A 2XDWA 5CNMA 4MP6A 5GZ1A 3QNWA 4GM1A 4LHYA 5L53A 1LTKA 1UMDB 4EDHA 1N8SA 2Q1XA 3SWWA 1W5FA 4O4HF 1MGPA 1VE3A 5EUBA 5HJ7A 2WJWA 1B7GO 2R62A 5FI3A 1KXZA 1Z4NA 3MWLA 2DULA 5CIQA 3W4IA 1FX0A 2HJSA 3JAKB 1BAPA 5C5DA 3HH8A 2X4DA 3BKWA 1P6QA 1N6PA 1TNDA 4JA2A 4Z99A 5FFMA 4OLFA 5I9SA 1G0OA 1NASA 2FFJA 2WAMA 4H7JA 1G2PA 4QVGA 5HZGA 2NACA 2WHXA 3Q5DA 3LWBA 1O08A 3BS4A 3LL7A 1T26A 4NC9A 1JMKC 2Y99A 3Q0EA 4MI3A 4RL4A 4UATA 3TPFA 4ZZ1A 2KE5A 5EUMA 5A2GA 5MHTA 4LXQA 1F60A 1ATZA 3NDPA 4DNOA 4CTJA 1NXOA 4ZVLA 5B57C 3U19A 2A57A 3MT7A 2ACKA 4E3ZA 1UC8A 1C9EA 3EDYA 4PZUA 1HURA 1OI4A 1Q0PA 4A2WA 1HDRA 3FUWA 3GFVA 4TVKA 1A77A 3C3DA 4P7JA 1KVRA 5IVPA 1J39A 4DSUA 4JBXA 3AJAA 3H9CA 2VQ6A 3IXLA 2UVPB 3O8LA 1DQZA 3WWYA 2OSBA 5IH3A 4AG3A 3L1VA 4YV0A 1TXGA 4A1OA 4A82A 4B33A 1KDYA 4IMRA 3CJQA 5U9CA 4KOEC 1UJNA 4FFVA 3T9BA 1X14A 3CRQA 3KR2A 4I2VA 4NNJA 1XD2A 3NZEA 5MFZA 1YC2A 2PKRA 1L3CA 4K9QA 4M87A 2QQ0A 1E9RA 3HUTA 1X15A 3HCBA 4BNDB 3O92A 5KI6A 1DCFA 3TH5A 2YC4C 4F11A 2WUGA 2VDWB 4FFOA 2JFNA 2M9MA 2Z8ZA 4FHFA 2OCPA 3V4ZA 3OBBA 1JQDA 1LJLA 4WBSA 4PN7A 4Z6KA 3NYWA 4J7UA 4D9EA 4S1WA 2HCTA 2HN9A 3BXFA 4UNPA 1OT5A 1C9MA 3QRWA 3ETHA 4RY9A 4CLXA 1NW4A 4O2BB 4BMDA 5JY1A 1XXLA 4YCMA 2DHDA 3UUGA 1HMPA 1TQHA 5BR1A 1E7YA 1P39A 2OV3A 2AB0A 3PQFA 3QPAA 4O4JB 3JYPA 1LZKA 3V8NA 1EEXB 2XMPA 3DGFC 4JOBA 1T8SA 2IYYA 1CUHA 2QRJA 1P5JA 4I4TF 3L7AA 4Q3LA 5DNVA 4G0MA 2XGGA 1XZGA 2C8LA 2HV9A 1IY1A 1HTBA 2RIPA 5B2ZA 2DFLA 5B36A 1SQGA 1PK7A 2AXPA 1MX5A 2W0MA 4GU5A 1KI6A 3ESQA 3FCUB 2PLWA 3KEQA 5C32A 4BATA 4UZSA 2EJUA 1W8IA 2C0QA 3EQ7A 2BEWA 2C2GA 3EB9A 5IDWA 3H2JA 4HJRA 2ZBEA 4PC3A 5EXSA 5IU6A 3DZCA 2JPDA 3TRJA 1RXWA 3H65A 3ZWVA 1G38A 3VISA 4YY3B 3G2PA 3LHKA 4BBJA 4Z2AA 4CM4A 4EKIA 2D0DA 5H9WA 4HTFA 5IANA 1A9QA 1J8VA 1HETA 2D3TA 2F1OA 3SYLA 5GADl 1Z6PA 2B9EA 2PVSA 2ZE5A 1UWLA 1PGJA 3OWOA 3B9BA 4J90A 4WVLA 3DKKA 4DLBA 2HRZA 3ITEA 4NYJR 5DGCA 1I5RA 4FP9A 3LWDA 3WTCA 8MHTA 2CE2X 1R4NA 2LNDA 4CEJB 3C1OA 3L82B 2NV0A 1CQJA 4YPFA 4D42A 1OU4A 2CBXA 2OR3A 2WYVA 3RSHA 3OE7A 3WOHA 1ZLYA 2PWBA 1F06A 3ZJVA 2OVFA 3TFWA 4EUSA 1ZHFA 2H5JA 1JG2A 3EGXB 2OSVA 1E7WA 1PEAA 1QGDA 1R74A 1UDBA 2PLAA 2ZI7A 4BKRA 5HW0A 3MSCA 3U44A 3LFTA 3AVYA 1CQPA 3KLBA 4YJKA 3S8YA 4JLPA 1W4RA 1T8UA 2W42A 2C8KA 2G0TA 5FBKA 1T9GR 2XUFA 2JLYA 3WHKA 1SBHA 3WLKX 4DPKA 1SNYA 3NOOA 1ONPA 4XM2A 3ZQ4A 4CLRA 1J24A 4ARAA 4YAJA 1BH2A 1TF5A 4FSHA 4WXEA 1ENPA 3V7NA 4XOUA 4Z3OA 1AKQA 4LRUA 4FCTA 2IDJA 4J3NA 5KC8A 4WN9A 1IM5A 2ACEA 2X41A 2PZBA 2C0PA 4IP0A 1Y1LA 4Z0PA 4AMZA 4GOOD 1IONA 1NFQA 1RRVA 3QBTA 4U7FA 4KPFC 2Z8YM 3SIPA 1SELA 3ENVA 4R40A 3VC1A 1NBWB 3IIJA 1XE3A 3ZX4A 1DRUA 1F17A 3PXAA 4RIGA 4W1QA 1KJNA 1XVVA 1NVKA 3A4NA 4O4LF 4WBXC 5C8XA 4P53A 2Q2WA 1RWWA 3KYBA 1AGYA 2DC1A 2IKSA 3TX6A 3VR5D 1JJVA 1M5RA 4XGRA 3QVOA 3RVRA 4B73A 1MQ9A 5J3JA 5ENZA 2QTCA 5K0GA 4UUAA 1RHRA 3SE0A 1FC0A 1WW2A 4J91A 1YRAA 4XGQA 3RHZA 7ABPA 1FJGB 4FIZA 2PH3A 2VJNA 4L16A 2J46A 3QWAA 4C0AC 3QBDA 4LXIA 3VNBA 5FULA 2AMVA 2FWMX 2OHOA 3LY5A 5AXAA 1B76A 4FCWA 5EWLB 3UJCA 3R3WA 2JJ2D 1L9XA 1MNQA 2VHWA 3DEFA 4RM2A 4WK0B 1FVOA 4C7JA 3II6X 2C4HA 4NBNA 5AJZA 2WWYA 4Z4GA 2RGNA 4H0NA 1VKNA 1N2JA 3SQOA 5K3EA 4ESHA 3A2LA 1YR1A 4EJSA 1N1DA 3KE8A 4MUIA 2BMWA 4BLOA 3I23A 1E1DA 5FT9A 1T91A 2B6NA 4KDFA 3I6ZA 3RG8A 4KIWA 2IX3A 2ZRGA 4TVSA 4FE7A 2V7QD 3DPIA 5GWXA 2VDUE 4Z4FA 3K0EA 4I8IA 1FYEA 3WDMA 5KNDA 1TEZA 4DV6B 4AJHA 2Q46A 7GPBA 5BNWA 3OLVA 4NZZA 4RFLA 5AI9A 1WRBA 4JOQA 2E18A 2NU7B 4UNQA 4CI0B 1VG1A 1OZ0A 3WA6A 5K5EA 3HJFA 2RJNA 3T0FA 1E3TA 2J3LA 3AM4A 3DOEA 4TV9F 4ZV7A 4NXMB 1WSWA 1Z28A 5EHIA 3NATA 2QTMA 3CUYA 4GMKA 1N75A 3CYFA 1EFPA 3C5EA 3M5CA 4QUKA 4FQ5A 4MMXB 5H3LA 1OZFA 3SMQA 3V4PB 3V8PA 4D80A 3I4CA 5CEEA 5AUPB 4PN3A 2DERA 3VYUB 4NDNE 2DSNA 1KL7A 4BWVA 1Q7GA 4B45A 1I10A 3DJFA 4G0ZA 3MWJA 2OD9A 3MBKA 4BO1A 4CIWA 2PUBA 3DO6A 1PWYE 3OETA 1KVSA 1E66A 4QEKA 2JLAA 1FJ2A 4FLEA 5L6MB 5LUBA 2RKOA 3INYA 1ISJA 3L49A 5F5NA 4CBVA 2B1RA 4NFHA 2TMGA 2W71A 4CLEA 4OU4A 4ZT3A 5LXTF 4QHYA 4C4ZA 3CR3C 1JVNA 3W9SA 1NJ6A 1J2RA 3VRHA 1PKXA 3BMNB 1O58A 4G1BA 2MSNA 5CNKA 3DBVO 4TYQA 2O2EA 2OESA 1EGQA 1GL3A 1YB4A 4C88A 1TB4A 5ALNA 1RJFA 2ZTHA 1PJAA 3FA2A 1YBHA 2BSQA 1PJZA 2I3DA 1JEAA 3ADCA 1TOAA 2P5UA 3PC6A 4URYR 3RRFA 3S2SA 2PBFA 3EGOA 3R75A 4BN5A 3NHLA 1H5UA 2VWHA 1BHSA 2B1QA 3IDQA 3L18A 1RI5A 3SYMA 2Q6OA 3U6BA 2JNWA 2QRLA 3ZHOA 2IZ7A 3ZKAA 2WM2A 3ESYA 4EW6A 5BUZA 5KKNB 2XZOA 1DC3A 1PK9A 1FUEA 3C87A 2QRVB 5CLHA 3KS9A 1KEEB 1B93A 1P2VA 5G2OA 2OMEA 3PNQA 4GOJA 4GPZA 1D8AA 2VDLB 3CZPA 2N0SA 3FTQA 4KFSA 3H9EO 5K7SA 5I51A 1CT9A 2WTMA 1M74A 1Z7BA 2R5FA 2J0EA 2CUZA 2ALJA 3H16A 3HU3A 4BQRA 3ZUPA 1TPZA 1A96A 3H5AA 3ZK8A 3BQ9A 4AD8A 3EWIA 4HXGA 5DMXA 4ARCA 1QU2A 1M1NA 2OBXA 3AEKA 2HA5A 4H4CA 4XEUA 2NN3C 3H8SA 2WVHA 3ZUGA 1G8PA 4G56A 1A72A 3QU9A 3J80A 2EC5A 3PXBA 1U31A 4L15A 3H3XA 1SMKA 4YCCA 4Y9RA 5EJ8A 4N5HX 3M83A 4A8HA 2GWHA 1J4AA 4XD7A 4QAQA 1Z2PX 2JAHA 1EB8A 2VBGA 3WRYA 2NAFA 4N6NA 1QYCA 1Y1SA 4BCCA 1WWKA 1R8SA 2VZ0A 1LF0A 3A9CA 3QYJA 3W78A 4RV4A 1UBCA 1I36A 2AR0A 2WFLA 3HGTA 1JECA 4HVAA 4Q34A 3RVDA 4D0GA 4Z4QA 1LDGA 4CDGA 3L6UA 4G8CA 1TTTA 1JAIA 4MQMA 2FMTA 3CINA 5G41A 4F3KA 4DRXB 2ZI3A 2QY6A 2PDAA 1A7AA 4NICA 4U4AA 1AIPA 4IX1A 5E4JA 3HKBB 1PYOA 4FE3A 2QN9A 2GNOA 4HNAA 1SC9A 2M6LA 1FYFA 1AQ6A 2CNBA 2DBRA 4BFZA 4MUJA 2ONJA 1ZOOA 1YUBA 4OJQA 5CDFA 3Q9LA 4Y18A 5AVZA 2VDVE 1U1FA 4ZVVA 1A5AB 1PDOA 5AW8A 3NWBA 2YOHA 5ES4B 4C5BA 1B6RA 1CS0A 2YIJA 1G7TA 2YZNA 3MS4A 3Q87B 4FJ0A 1P1HA 4NCNA 1SUWA 3IP8A 3ORYA 2W8ZA 4H3SA 4PHFA 1NL3A 3QYFA 2ZRIA 4HAOA 1U0TA 3CR7A 4OFZA 1KSJA 4ZTBA 4DUYB 2DH6A 2KWIA 5DI3A 3ZE9A 1SC6A 2Y9PB 4H0FA 4TL7A 1LY1A 1KPHA 4X1YB 1CJMA 4F45A 5HKKD 1BMDA 4G63A 4YA6A 1EFLA 3T7JA 1PBTA 4NONA 4RIEA 4RJLA 5K8VA 2IS6A 2PTGA 2C98A 3GT7A 4QU5A 1J1IA 2Q99A 3KT6A 3HJTA 3TLBA 1MJHA 1BDBA 5FWDA 3MFYA 1Z33A 3AHDA 1LQUA 1U9IA 3QFRA 5KB3A 3GD5A 3EWAA 6ABPA 3IV7A 4OGFA 2I4MA 2VSQA 4WNAB 2UKDA 5TT0A 4R1OA 3D6MA 1G2QA 4CKYA 4EMBA 3LDGA 3FYUA 5I6DA 3C3CA 3PE6A 5AJHA 3W3AH 2IU6A 3WYEA 2ZAGA 3CNOA 5G3YA 4X7PA 3H5RA 1Y89A 2RGAA 3G2JA 4RESA 1EFRA 3VO1A 4P4TA 2EP7A 1GSAA 2C1XA 1S8AA 1NXQA 3C98A 3KR0A 1SUSA 1NI4B 3HXTA 4OL0A 3ROQA 1DXQA 2R7AA 2X8BA 3AJRA 4JK3A 4JLVA 1EESA 3FUXA 4UDXX 3K5HA 4LJLA 3RSGA 1N6LA 4MW1A 4UU0A 5EJ6A 3OZXA 5FWYA 3EVEA 1Y1QA 1XP8A 4HDRA 1BD4A 4NABA 1NMQA 2QDXA 4EA6A 3FLMA 3WGKA 3KAQA 2XMZA 1QGED 1R00A 4HS4A 3KOZA 4BNNA 5T4BA 3WBBA 1TMYA 1N2HA 1XPJA 2IL1A 4EJ0A 5JECA 3RYIB 2UYQA 3HJCA 3B20A 1Y80A 4QYWA 1OFUX 1QH1B 3HSYA 3JW8A 4Z1OA 1LRKA 2G9VA 2O23A 2QTVB 3NFYA 4MLPA 2CXSA 4KACA 3MF4A 4UHBA 1SHLA 2D3WA 2ZJ6A 3N39C 4MUFA 4UTXA 2NM0A 4UVHA 4BU1A 4BNIA 5AM3A 3BEDA 1F2UA 5DWQA 2LTAA 1C3EA 4DJEC 1VKOA 2XYVA 4EHAA 4NZYA 1CUYA 1VPTA 4R8VA 5JVDB 1MHPA 3T6KA 1HM5A 1O97C 2C99A 2ZB2A 1JJBA 1NOIA 3CFYA 3VC2A 3LW8A 3WLRA 4C4XA 1E1CA 3K53A 4EA8A 3UV3A 3PQ7A 2OV2A 4BGVA 2RD2A 1L5MA 2V1UA 3CLRC 4KX3A 1Q1AA 5J5CA 4COOA 2MSEB 4L7VA 4RVOA 3DV0B 3OPYA 1VHDA 1NVAA 1O95A 1OU0A 3A37A 3GPDG 3M6VA 4OH7A 4R1UA 4Y6LA 4EBBA 1Y5NA 2VJBA 2YXNA 3I5UA 1VG9B 1R15A 3KSAC 2MOKA 2IHTA 3P32A 3TR6A 3MTDA 1NUUA 1J9GA 4I08A 3LOPA 3SIWA 4YJHA 1VA5A 3EDRA 3KDSE 3L41A 3WC4A 1H66A 2W6CX 4FW8A 3QKTA 5EE3A 3L77A 4QUHA 5IKEA 3CRRA 1CEYA 2ZJ2A 3GMTA 2BFFB 3OQ6A 3LWNA 1NVDA 1PVDA 2AEEA 1VB3A 1M0EA 2QZZA 4Q19A 3LV8A 5FUQA 1BYIA 1C4WA 2Y1FA 5FBZA 1VJDA 4IVNA 2IXTA 3GRPA 4HFMA 4YFVA 5C9ZA 4QXPA 2HOQA 3NIDB 3PDIB 2OCKA 5DNUA 1AURA 5F9HA 2TMYA 2ZLBA 4G0WA 1SKBA 1CZOA 2V9ZA 2ZJBA 3I04A 3ILVA 3GV0A 4JEUA 1JR3A 4U6QA 4WFQA 4PG4A 5E4FA 4CLHA 4CL8A 4G6ZA 4DIFA 2BTEA 1XRSB 2BRUC 3DUFA 3QFTA 3IULA 1W85B 5DTJA 1IRXA 2XUZA 3C43A 2H9YA 2QMOA 2W37A 1M1NB 1IG3A 3AEKB 1JI3A 3E5NA 3GXBA 3PKIA 4KAFA 1KZHA 4D0LB 4WBNF 4MPRA 3KQTA 1T0IA 4G0PA 4IW3B 4RZ3A 4Q3CA 1DELA 2WF8A 4EB6B 1QAOA 3LYUA 2V45A 1F2DA 3HY6A 3OQBA 4HR7A 1YI0A 1GKUB 4IIJF 1XYVA 2ANBA 3PJGA 2VKTA 5TMDA 3KKMA 1XDSA 2OXFA 2R6ZA 3WNQA 3PNKA 2G8NA 4NRDA 4IBOA 1EDDA 3AF2A 3ZV7A 2OLEA 3F73A 1VL6A 3LIIA 3PRJA 5HQTA 1Z0UA 1ONOA 2OFPA 1G55A 2QP9X 2OUKA 1NF2A 1W4CA 1WD7A 2AZDA 2GETA 2ONKA 3LUKA 3R6LA 4EHJA 4S05A 3ZVNA 2YZMA 4Q4JA 2O2DA 5C7LO 4XD2A 1M2VA 4LKOA 1MTZA 2JGMA 1OKKA 2Q27A 3F9RA 4IZIA 5JR3A 1E3SA 2DY0A 2OLKA 3I9OA 2PGXA 4AKHA 5B37A 4EGCB 3RDPA 4MA0A 2BI4A 2VXCA 1GY8A 1QPBA 2BM1A 3GCWA 3NG1A 2WAYA 1L5ZA 4G0XA 2WWVD 4RQUA 3TLGA 4QWWA 5HE8A 3O8QB 3ZJ5A 2R9VA 4BX0A 3TQHA 2XWQA 2DTEA 3GR6A 4GYYA 2WOOA 1EFPB 4UVGA 3PFBA 3NWEA 5BV7A 4BKMA 3OOSA 4U9IS 1JFVA 3KTFA 1GPAA 4G5QA 4XPIB 5K6RA 4CV1A 1XMJA 2X0KA 1HK7A 1M0SA 5CPFA 3UG7A 5KTOA 4UTOA 1EIWA 4G26A 2PSSA 3UENA 4XUEA 3ENZA 1TYCA 3S7TA 4RF4A 1KEEA 3MMSA 3NBXX 5AVTA 3PFHA 4RVFA 4QASA 2ZULA 5IYZB 1Z2CA 2CD7A 4QL3A 5FOVA 1WW3A 3HCAA 2ZWIA 4YJ2B 3ZU5A 1IB6A 1JEJA 1UMKA 3GW8A 3IQGX 5EKTA 2IYNA 5GY7A 3JS5A 3VR6A 3RS9A 1WBDA 2PHZA 1P3Y1 4WL0A 2Z30A 1R0ZA 2BCEA 5HYVA 1NATA 2QU7A 2PXAA 3RGGA 1HNNA 1LGYA 3ANSA 3IEPA 4MVJA 3M3PA 4IV5A 4MKIA 1WXQA 1CZHA 3ZOZA 4F3CA 3MVEA 4MRAA 2NPOA 2PRKA 3EZ7A 4HQOA 4Z49A 1YDGA 3K72B 5DW0A 1EB9A 1UZLA 3CTPA 3QXSA 2ZYWX 3AOGA 1F5NA 4DMMA 4NAVA 5G4LA 4MW0A 1EWYA 2AFRA 2ZI4A 4OXNA 3TQFA 1JLHA 2QYHA 3KVOA 3IC5A 1DE0A 5T5QA 4UOZA 3FSRA 4XB1A 4D6PA 4PF1A 1SG0A 2B4TO 3DUWA 3LMKA 4Q9NA 2IU3A 3EISA 1TX4B 3CN9A 2YUIA 2I34A 1VE6A 5L51A 1B2LA 1Z08A 5GJWC 4I1OA 3PFKA 4X20A 3DBOB 2C78A 2BYTA 1ZUNA 2ZVPX 1XTTA 4U2DA 1DO2A 2ERCA 4G1CA 3G5LA 3WRVA 3DHNA 4NBKA 2PBZA 2WD9A 4JEIA 5K01A 4GOMD 3H1EA 4U5QA 4BWGA 4PRLA 4DLLA 8OHMA 5D5QA 3ACBA 5C8ZA 3FJ1A 1E1NA 3PHHA 1CP3A 1CUIA 1EWKA 3FPAA 3WGLA 4C0WA 2F59A 5EJMA 2N46A 4N39A 3GJSA 4F38A 2W6QA 1SXHA 2EJWA 3AIKA 2G72A 2DLDA 4UM7A 5TSDA 3RHTA 3O0DA 1RKBA 3B38A 3FUUA 4FILA 2IC5A 4D6XA 1HRDA 1N1GA 2XQJA 1TO1E 2Q2OA 3BXZA 3I34X 4GI1A 2AOWA 2L17A 4Q3KA 5TQ0B 3V7WA 5IYZA 1JSLA 4LQLA 1FTQA 2IELA 5MGBA 1B23P 1T4DA 4W8HA 4ZT5A 1ZA2A 3WRXC 3M1AA 4EMUA 5TGTA 5CFLA 3W7AA 2XIQA 2J67A 3N8KA 2AJLI 2WU3A 3ZDEA 4F6RA 4LI3X 3RFCA 1QX4A 1D3AA 4N41A 2O57A 1U3FA 4DS3A 1XBTA 1RP1A 2GPBA 4RKRA 3B6JA 1W4LA 1QH9A 2H1HA 1K4MA 2B20A 2C3PA 3ELBA 3GAZA 3JQFC 4L73A 4ASUD 2PCJA 3S1AB 4D6YA 1NDHA 4DYHA 1S3GA 2ZAOA 1JG3A 3WGHA 3C41J 4EL5A 3W1WA 3DAYA 3CH6A 1X42A 3C2QA 1N2CE 2F90A 2WE8A 1MG5A 1QFMA 4FNOA 5TDHA 3OVMA 5ALYA 2XPCA 1VYHA 4K6KA 4RJIA 3QEMB 3RK0A 3VSDA 4BC0A 2CSXA 1YGYA 2BGJA 3BWBA 3NBUA 1U28C 2DF8A 4WOKA 5HHTA 4LF7B 3R9XA 1B43A 2X22A 4EA7A 4RHEA 5EL0A 5AW6A 5HWSA 1RYNA 2ZKLA 3C3JA 3IOYA 2CFCA 4WUTA 2GCOB 3DZ8A 1WCYA 5D5PA 4Q7EA 1RWBA 4XJXA 5H82A 3CHYA 1JDPA 5I4BA 2W8BB 2IF0A 2FEKA 2HADA 4CM5A 4NMWA 1LPAB 3KG2A 4CM9A 3ABSB 2IYRA 4DIUA 1KIFA 2DGDA 4LZWA 3QG5A 4EGFA 2QGNA 5SYMA 2J3HA 3BJRA 5KQRA 2A9OA 4CMIB 3R3ZA 4MPJA 3CNEA 3LP5A 5K51A 2BSAA 4DT1B 1IM8A 1G3UA 4PHGA 2BUAA 2FG5A 1DG1G 2H18A 1FP4A 4QIHA 1ZDMA 1BC5A 2X2OA 1U3CA 1ULZA 2QTAA 5DP1A 4F97A 1OILA 3L0SA 3EYWA 2Z4RA 5B30A 4HG2A 3NAMA 3T5GA 1RZRA 3DEZA 5IWAB 2P2DA 4BIIA 4QUEA 3MXTA 2YHUA 5K0LA 2WK1A 2X8JA 4N03A 4LJKA 3UHJA 2QJRA 4BVKA 2GB4A 5BOSA 2MIIA 5I9LA 2NOAA 3HA5A 4FTWA 4ILEA 1W7AA 5JS8A 1IXZA 1QHEA 2X77A 2ZOSA 2GCIA 3CT4A 2CJWB 3E9DA 3KKQA 4L9WA 4FFPA 3SQDA 2UZ0A 3GN1A 5DN9A 4FU0A 3HP4A 5GMOA 1P2TA 3LQYA 2D8MA 3KVVA 2AJTA 2GPTA 4P4SB 2WY2D 2JL1A 4KQCA 1R50A 4X00A 1A8IA 1GFWA 3RIEA 3NIFB 3FRJA 1AA9A 4IJ5A 3TLMA 4YDQA 3IKLA 4XVUA 3SVZA 4IRUB 4JWTA 1K4YA 4R31A 1NJ2A 1F38A 3WNCA 5HVNA 5FNZA 3SQWA 1TAUA 3CVUA 2W2OA 1IOLA 1WDKA 4DIKA 1F8GA 2BWJA 3N1UA 3DVSX 4CKBA 1VXOA 4HDMB 2R79A 1RJEA 3RYCB 3DXFA 2R2GA 1AGRA 4BVFA 4HLDA 3LHIA 3B8EA 1XCMA 2VCEA 1Y9AA 5I7HA 2IUUA 4YALA 2H1OA 4MROA 1OQAA 4JLKA 3OD1A 4KXYA 1LLDA 1I32A 4MW6A 1YS9A 4K6CA 4XXHA 4ZALA 4YMLA 1XGKA 4YNBA 4U8GA 4MWEA 1SPBS 4UVEA 5J23A 2EVWX 1GM5A 4C01A 5T3UA 1ZH4A 5TPWA 1YAHA 2HDWA 3NHRA 3ON5A 1YDEA 3GGJA 2XMSA 2J5XA 4WN3A 1G2OA 1NM5A 2GLUA 4BP3A 3IEVA 1J56A 4ED9A 1YZTA 3RANA 4YHBA 4GRAA 3D8SA 3JZAA 4LCJA 4NIMA 3ZLJA 1OC4A 2Z6AA 1TKAA 3FCAA 3MJEA 1KYZA 4TT3A 4LCEA 3RE1A 3T3EA 3PTLA 1O6GA 3R8CA 3PX3A 4AM8A 3OY7A 2YHIA 1BU5A 3AJ9A 4P0TA 3KKPA 4BASA 4N8SA 1F0KA 4JUAA 4G67A 2FMUA 3SC2B 4W6QA 1G42A 3K09C 1GRCA 1DMRA 5DLPA 3MT9A 4OLAA 3SR3A 2ZE7A 1RXUA 1L3BA 1OPRA 2BFFA 4UAJA 3ZI4A 4LY0A 4R9NA 3ZNQA 3PZBA 2QLMA 1VECA 2Z9CA 1DIHA 1TYAE 2VT3A 1NUTA 3GFFA 3CVYA 1PP4A 1T36A 2V59A 3IIIA 1KH2A 3L7MA 2C9OA 4YN3A 2Q5LA 3CISA 4IO0A 3C6XA 1ZJYA 3LT4A 4IIEA 3V8QA 3LUJA 4CE6A 3Q8KA 2AG1A 4JLAA 1UDCA 4G65A 3M9LA 2CLCX 2WSLA 3Q3HA 4PZPA 1V7CA 2XA1A 1QIMA 5JMWA 5FO0A 4TMTA 4PAMA 2JK0A 2I54A 3OOHA 2BD0A 4JP5A 1R0LA 1RXIA 4MJ7A 3OCCA 2CFTA 4I7EA 3SJUA 4BVEA 2BFMA 1GD1O 2BGKA 2ORYA 4F91B 4HC4A 2OLJA 2DTDA 4F85A 3RWOA 1L7VC 1J0XO 2L42A 3A4MA 3IB3A 3TTVA 1PT5A 1PT8A 4JELA 1VHTA 1KQPA 3ZE2B 4BUZA 1AU9A 2INGX 1HX7A 5FUWA 1YQDA 5IT4A 1YJAA 3FNHA 4WT7A 3T3HA 3GFGA 2ZXFA 2FZKA 2OXEA 1WZCA 3BRWA 3ZVMA 4HATA 2CJXA 2NV2B 4D96A 3ZI0A 1I5OA 1ZO8A 2QN6A 3TNFA 3MCWA 5BWOA 1V96A 2ZM6B 4QECA 4LFCB 4RL6A 1ZVJA 1IY8A 2WTBA 3DYVA 3I1JA 2G1PA 3FVWA 2ZR9A 3ZHCA 3ZWNA 3HFRA 4A92A 3A36A 3FPEA 1OXTA 3ESCA 5CH5A 3RFTA 2VHZA 3W5VA 4IKEA 3PHGA 1SK8A 4H08A 2AX3A 3A1NA 3NPAA 4MB2A 3E81A 1TKRA 2XCRB 1S4MA 1F14A 4X7MA 4LHZA 2BFAA 4BZWA 1K0FA 1DXYA 3K0CC 1ADBA 5DGTA 1RM5A 4FNGA 2AZTA 2YMLA 3PPVA 1W85A 3HACA 1E3EA 1CC1S 1U7DA 4Q4AB 2EG5A 1D4OA 3PHIA 2BCGY 3ZHRA 4D0NA 3GUCA 1RZVA 1Z2EA 4AJ9A 1X9IA 5LQRA 4RW0A 4D9MA 2CN1A 2VK1A 4ZOCA 3D6JA 4ZCTA 2HTEA 4GSYA 1G5HA 1T4MA 5CB4F 2QV7A 2R4TA 5ANRB 1QTNA 2RC6A 1NA5A 5ER9A 2HYIC 2ETXA 4AZ3B 1PHPA 5JMOA 4GR9A 1OY1A 4YR7A 4KLAA 3GGSA 1DBPA 2FPXA 2TMKA 4R8LA 1RM0A 5IUJC 4F5YA 2NMVA 4YACA 2IOFA 2V1XA 3PQ8A 1BG6A 2ZYRA 2GRJA 3A32A 4KN6A 3WJ7A 4EKEA 2F1JA 1A7JA 4MV1A 4OAPA 2XCSB 5DZSA 4PNEA 1VLQA 1C7RA 2H2FA 4P4LA 4DCMA 2ZTSA 4A26A 1N2IA 1ONBA 1XAGA 1RTTA 5AI6A 4FQ8A 4MGEA 3ASYA 2X0DA 4G1FA 3U3XA 3UK1A 1YSCA 3E6AA 2HNKA 3UKOA 1KYYA 1E6EA 3C6KA 1K08A 1JHRA 1D0VA 3D0QA 1CERA 3QMPA 4X7RA 3U80A 4CM8B 1XPOA 1G8HA 3EXHC 4M9ZA 4P84A 1DIRA 2XODA 1CY8A 1Q3HA 3K4PA 1P9WA 1MBZA 1RZ3A 1E9SA 5E6RB 2Z98A 3LDAA 4DVJA 4TN1A 3DEKA 3K8ZA 5CVCA 4F4CA 1XFDA 1WVGA 2VBFA 2XE8A 3O8RA 2PYZA 3P0FA 1HDEA 4FVTA 1T5OA 4MVJM 4FHGA 1GDTA 4ZI3A 2NUBA 1Z5PA 5KTYA 3UJBA 2MJLA 2CHVA 1UM9B 2TRSB 3BMXA 3Q15C 4FFMA 1JHYA 4D4MA 1QPZA 1I3LA 3MIZA 3PA8A 1K75A 1IXYA 2WAAA 4Q6BA 4FYJA 3KQYA 1NVMB 2RK3A 3B8HA 3L6BA 4J0KA 3EC2A 2GVZC 3K71B 1GZ4A 3FZEA 3DD5A 2PQ0A 4PQGA 2RIRA 2JGDB 4D5GA 5EE9A 4DJFC 4ZO6A 4A03A 2C58A 4BBAA 2D1YA 5DX8A 3AW9A 3U48A 1DAIA 2A88A 3BDIA 1IAQA 3DEAA 5DTMA 4Z1MA 2R7KA 5HE9A 1SRQA 1NBIA 4IVPA 5F73A 4BXOB 3ROTA 1K63A 5E1OA 1LWOA 2X6RA 4MI9A 2FWRA 4ZDIA 1XJCA 2YV4A 3AEUA 1DLIA 4YT8A 2R6DA 3KB2A 2OWEA 1SKYB 2RGDA 3L9WA 3ER9A 3GGPA 1JXOA 2QM8A 4XPZA 4ZQEA 5AW0A 3K9QO 4YRCA 3ISTA 1RQNA 1UBKS 1RCFA 2B92A 2VL7A 3EY4A 3IFSA 4M9QA 4XQ9A 5F52A 3W7VA 4Q16A 3RVQA 3QF4A 5BVGB 4KUGA 3K2EA 1T43A 2XKKA 3PUVA 1N7JA 10MHA 3JQ7B 5FV7A 3R7WA 3W2EA 2HPZA 3ICEA 2JASA 1UBOS 1K7CA 2A2ZA 1KYQA 5HKOA 3OQMA 1FOEB 1R6VA 1C3JA 4R0VA 3RODA 4RZSA 1YB7A 2APJA 3DYIA 1EX6A 4BVBA 2ZXUA 1C2TA 3ZCVA 1YS6A 5CTJA 5HJ2A 3VDNB 5EJ4A 4MEAA 1PL8A 1AS3A 1PR5A 3GLIA 4CEIB 3PXGA 2ZYAA 4HX2A 5DK6A 4JOSA 3A11A 5HQ3A 4R1TA 4FZVA 1FZTA 2VNJA 1NR7A 5TMBA 3X43A 1X80B 1N5DA 2AA3A 3AF3A 1JLRA 2IOQA 1DG9A 1V5GA 1ISRA 3E7XA 3GYBA 3OE1A 4JUFA 5EJAA 1AN9A 4TZ6A 3UWKA 1L7EA 2WD7A 3UB2A 1C50A 4CIBA 4BNJA 3UG6A 1BEUB 2X0JA 3FOEC 5JASA 3NXSA 3WDLA 3VOSA 1A7UA 4FN4A 3RJ5A 3LE8A 3LNCA 1JKJA 1AY0A 1GTG1 1OB2A 3D4BA 4FR5A 4DKXA 3G6KA 5C1OA 2PEZA 3I2IA 3GVCA 3KAKA 3RYHB 1XVAA 4MIKA 2DH5A 2OHIA 5C51B 4MUGA 3AHFA 5IBRA 2DU8A 2PYIA 3SS7X 1KY3A 3T4EA 5GV8A 2COUA 3UBMA 4PQYA 4X8HA 3ZLUA 4K9NA 2XNDA 3U3JA 3HO6A 3GLHE 4JI2B 1SBNE 4GX0A 4I4TA 2HGSA 3HWRA 3LPCA 3EXG1 3PBKA 3STVA 4KRFA 2J3MA 4WZZA 1FRNA 2PKWA 3RFFA 1R0WA 1E79D 4F71A 1MCZA 3R7LA 3R4VA 3ZDZB 3B52X 1EXNA 1HLDA 1A1VA 5IT9A 3TOXA 4KGZA 1L7MA 1OLXB 1XZLA 4XYGA 1GGFA 1V4VA 1LBTA 1UBJS 3R0XA 1C0KA 2G0AA 4U9UA 5JY6A 2J9XB 1HLPA 2DR3A 3SDZA 3OF2A 2BI8A 3KJNA 4H7KA 2YRWA 2ILVA 3N5KA 5AUQA 1QHHA 3R1IA 2QVGA 4RGVA 2PL3A 4URXR 3PKZA 4BFTA 2CL0X 1FTNA 2GERA 3GJZA 5HDBB 3TMKA 1YB6A 4FMPA 1PU2A 1JA0A 2O3QA 3RLIA 3WGJA 2JCXA 2FQ1A 4IR7A 2RJ3A 1YZKA 3SDBA 2R1VB 3AF6A 2QE7D 2YRFA 3KL2A 3X2FA 1HE8B 1Z18A 5EZSA 3RSLA 1ZSVA 1SBZA 3OTHA 2VDKB 3A4TA 1CTQA 3HCPA 2IUFA 1RQXA 4RD3A 4BMZA 1NVUQ 4H18A 3QUTA 3AEUB 1HFJA 2GO1A 2DYKA 2XE7A 5E3HA 3DL7A 3EMDA 3VNQA 4CCYB 2EJTA 3A9WA 4A36A 2NXCA 2XYGA 2FR8A 1DHRA 1T5SA 1YHYA 2LUOA 3F67A 3ZKWA 5HP4A 2AEMA 5DGHA 1ZMBA 1DKPA 2F4VB 3MM4A 3NVDA 2CCJA 3UQYS 2GF0A 1U5BB 3FR8A 4JP1A 3PC3A 3QLVA 1WEHA 1WV0A 4BRZA 1HT3A 1TC2A 3EOBI 3FNEA 1S1CA 1I7DA 3OM8A 3EEQA 3NEPX 3KYDA 3PL5A 3S99A 1OROA 2CKMA 2REBA 3AVOA 1J8QA 3ETDA 3FJOA 4ITRC 2FJPA 5EWMB 1YRLA 1Z5NA 1Y3CE 4YRJA 4B2IA 1GPNA 4HFJA 4L0DA 5ALSA 2GEJA 1G64A 4EFLA 1EX1A 4X65B 3WIBA 3BDVA 4M98A 3Q7EA 2X5XA 1GITA 5IFKA 1F12A 1OF1A 1UK9A 2PX2A 1DCTA 3MGBA 3CE9A 3MIIA 3RTGA 5THKA 3Q3CA 1L5YA 4G09A 2G77B 5TR9A 4US2R 3EH2A 3VI3B 3GLHA 4LC0A 1PDVA 3OKPA 4YAFA 1J0EA 3WYDA 4D81A 2O8BA 2A5YB 3FMOB 3A1UA 4CL2A 4HZGA 1M6HA 2YZ7A 1F20A 4FYKA 2K7ZA 3PF8A 4LQ4A 1G20B 3C85A 3KUUA 3K1JA 4GI3A 3ZIDA 1K86A 1V1MA 1DZIA 1N5LA 2Q1UA 3ZHUA 1WMEA 2Y1WA 4RS4A 5AO9A 3IRVA 1M2GA 2P78A 1HOXA 2FQXA 3B53X 5CBKA 4RTRA 1NUHA 1J9EA 1U2DC 3AP2A 1FRFS 4NARA 2GRAA 2Q6LA 1AS0A 2QRUA 4NBLA 4G5HA 5IC4A 1AKNA 5TS3A 2XKAA 4Q3BA 4CTKA 3WE7A 3DEJA 4AT1A 3HB7A 3V8EA 3ZV6A 4EF5A 3UATA 3CPEA 4OJNA 3S2EA 4AJ2A 2HHLA 4BMOB 5F7OA 3Q7SA 2XTNA 1VKZA 1TUEA 3NC0C 4OGKA 5BUCA 5A0VA 2GR9A 4W8OA 1QV9A 4HAVA 3FI0A 5D51S 2GN1A 3HKDA 4S2EA 4BVLA 3GWZA 4F86A 2OFXA 1DKNA 2B69A 3MT0A 3RKSA 3UOGA 3D2AA 2JLUA 3PFIA 3C39A 1Y6FA 5EKXA 2O1SA 2P1DA 1OLUB 4I4IA 4LF6B 1LK7A 3VXKA 1VIMA 3EULA 3BRWD 2B82A 2X0FA 2WILA 1AF7A 3MPUA 3TQRA 4RELA 1QHNA 3B5EA 3OA0A 1YDHA 1NJ8A 2VFAA 5A62A 1C4XA 1CE8A 5K05A 4JROA 3P5SA 3D4OA 1SG9A 4JBYA 3FUCA 1Y34E 1X1SA 1ISIA 3K92A 1OOEA 1OAOA 2Y2VA 2ZK7A 4PPNA 1JQEA 2JI8A 3X1KA 1G21A 4QGGA 1VL1A 2BLNA 2EL7A 2XT6A 3TOCA 1Q17A 5IC5A 2XEXA 3TUIC 1GRQA 2QMEA 4BO4A 4LMPA 1EUDA 4D46A 3FD8A 3LY8A 1W2GA 3GJ8A 3HBNA 4W7HA 4ALLA 3MBOA 5EN4A 2P9BA 2ZDHA 2YHAA 3DQZA 3C24A 1OBHA 4DV4B 3DGEC 4EY5A 5KOJA 2WJ4A 4G86A 4MYCA 5JNTA 3IL2A 3RIHA 5EKSA 3AFMA 5K0TA 4MUNA 2C4VA 3LPAA 3H17A 5AW5A 2CVZA 1XD2B 3T5PA 1FX1A 1F0YA 2CHUA 1W34A 5ELMA 4UFOA 2C9DA 3OCJA 4Q02A 3OHMA 2F1IA 1VPLA 2C8VA 2IE8A 4IILA 4ZVKA 3G0DA 2IWRA 1LDNA 3KJGA 1XRQA 2ONZA 3G9UA 2B9VA 2BZGA 2Z5LA 1V6AA 2BI7A 2PWPA 5F64A 2PH5A 3AHEA 4FE4A 1WP9A 3G2MA 3OFJA 4NMLA 2FE1A 3LBYA 4BRUA 1CNEA 1NYQA 1C3LA 4PFJA 1UMBB 3LC1O 4C20A 2CKDA 4HXYA 1LCIA 3DKVA 1KDZA 4QJ3A 5DLYA 1W48A 4PZ0A 5LA6B 4H1WA 5BP7A 2XGJA 1UBFA 5SY9A 5MF6A 3C7CB 2OCYC 1A50B 1CZLA 2YXPX 3QWBA 4KQEA 2ZS9A 4BVJA 4XYBA 3TW4A 5F1PA 4GG1A 1OYWA 5B58C 1E7QA 2R0QC 4MRMB 1IZ8A 3HJBA 3ICOA 3ID6C 4AO8A 2GTHA 4Q48A 1PV1A 3E05A 3H1AA 3R3XA 4LKRA 3SR0A 1U1DA 2D7DA 3PRKE 3JAKA 3B9PA 1NW9B 4MCJA 4TTVA 4ZV9A 1J49A 3GA5A 4B4OA 4V0ME 5JRJA 4PZLA 1JL3A 1YULA 2VK4A 3PGKA 1MC1A 3GH1A 3KSMA 3UJPA 1UDXA 4AJEA 3DO8A 2PLRA 3WSVA 4EYSA 4E4RA 2JIOA 3EBOA 1C1DB 4C21A 2I3GA 2RBGA 3TEMA 2QN3A 3LC2O 2YVLA 2JHGA 4MR8A 3PNMA 4Q3AA 4RGYA 2VJCA 4I1PA 3O26A 4HNGA 2XNDD 2GD0A 3K9WA 3V42A 4I9GA 2MYUA 5A5DA 3FTNA 1Z26A 3SX2A 3N2EA 1CETA 2V5UA 5CG1A 3E7PA 4ROSA 2ZITA 5K3BA 1PZHA 3FKJA 4R2LA 1TQ4A 1OTHA 1YS4A 2YV2A 3B82A 4LRXA 3W05A 3A4IA 3MOGA 1PUXA 4JHXA 3OG9A 2ZRAA 3DDHA 4TQAA 1OXXK 1XLTA 3DVQX 3GPLA 1VJ5A 1U80A 1A5TA 1HFKA 1YIDA 1XD9A 3ADOA 5KNDD 3RD5A 2JA2A 3OM1A 4HQLA 4C6TA 4V24A 4X0EA 5CFOA 5I7RA 3FY4A 4A0RA 4B3XA 2CLKB 1XU7A 3GHYA 3VR6H 3R0IA 1ZYUA 2EYQA 3ODGA 2A3NA 3PC4A 4KQ1A 3VPHA 4PYOA 3ZDDA 4AKGA 3VZCA 2QJTA 1QQAA 1FDOA 1Y6RA 5IAOA 2WYHA 3GLQA 1F0NA 3QVSA 2XITA 4I1SA 5C5IA 1XALA 4M36A 2Y1DA 1VMEA 3D4NA 1F8FA 3LK7A 2Y4NA 5EP3A 5ALVA 1AHPA 3RTEA 4QSHA 3ZWWA 2Q45A 4E70A 3WB0A 1P9RA 2NYVA 2FWPA 2NU6A 4QLAA 4WFJA 5B58T 3DLBA 4KNYA 4HAZA 4RE5A 2O8BB 4X63A 3JPWA 1ADYA 4GDMA 4OP3A 4REMA 5EIAA 4GI7A 5DT2A 5F1YA 5A2QA 3EASA 1S4QA 2XA2A 4FPXA 5TARA 1JAHA 3FWHA 1GJRA 1ZK4A 1U2EA 2POQX 3N8NA 3SI7A 1SZCA 1KRHA 1U6JA 2RHGB 3C5HA 2Q3CA 2W7TA 2RHJA 4H15A 4JT9A 3NRJA 2O7VA 3UN1A 4L6IA 4YTEA 2P9HA 1NBHA 2FOXA 4P36A 1U5AA 3HWWA 1ECFA 2R6JA 3AEZA 1E79A 4CG1A 2VWPA 5PNTA 5EWMA 3V2HA 4LJ9A 4DWJA 2H8KA 2GHQA 2OG2A 3TZCA 4YMHA 1XEXA 4YDHB 5EIEA 5DSTA 1UADA 4EARA 4HMOA 4TROA 3NAQA 5E6SB 4F5EA 4ZZ3A 1EZ1A 1T13A 2GZ2A 2VZ8A 3LVBA 4CQMD 4BQEA 4ENSA 4G97A 1ZIOA 3KJHA 3WQBA 5F7XA 2NU7A 4D9CA 1KHHA 1WDTA 3GLGE 4YQEA 1BNCA 3OJEA 1CS4C 1QK5A 3A1CA 3DE5X 2IHJA 2E9SA 3G79A 3RS0A 4LRTB 3IAUA 4D97A 3M34A 1PG2A 3C7TA 4P81A 5FTJA 5KJEA 2QTRA 3CLSC 3OFSA 4YI3A 2IYUA 4EG8A 2L0XA 5HPYB 2IS4A 2O8DB 4KV7A 4OSOA 4EUHA 2R1VA 3DCJA 1OBFO 3NAGA 3K70C 1P0MA 2M1ZA 1PG0A 1GQSA 4G5OA 1KJIA 3FNRA 2R84A 4IQ8A 2FA9A 5D3MA 5HMMA 4EJSC 3I5AA 2H07A 2OZLB 1JLSA 1J7KA 2D1RA 3ELDA 3WGIA 1JH8A 3RUFA 3TR0A 4C87A 4FFNA 5B1YA 3E3AA 5HKKA 2XLBA 1VSVA 4X20B 4LYEA 4KQHA 5EIWA 2O48X 4LOLA 1H6DA 3V48A 1RHMA 1Z2DA 3VSBA 3PICA 2X6QA 4K9SA 3ODPA 4HADA 1TUBB 2BY4A 2ZT6A 2CK3A 2AUNA 5FI5A 5K3AA 2NU8B 3WKEA 4MWDA 1W47A 4B6RA 2ZSDA 1IBRA 5CH8A 5LZ7A 1GARA 3ONNA 4G1MB 3RJTA 4AXXA 4EKNB 5JZ9A 3H3JA 4FT2A 3W4KA 4YB8A 2FE4A 2VF5X 2ZTLA 1LTHR 1YL6A 2CFIA 1GG5A 3G5TA 3S2ZA 5K0BA 1S1MA 1U3VA 3CUUA 1KDTA 5BVHA 1ULTA 1CZNA 4QOJA 5JAQA 5GINE 2P7HA 1RHKA 3GLKA 2JFYA 3CQ9A 3E61A 4DFDA 4XIYA 1QWOA 2FSIA 3MUNA 1GT91 3FTFA 1F4VA 1YRBA 4R71A 4MJ3A 2QM0A 3QLEA 3HDYA 3Q0IA 4WA7A 1VBFA 1I3CA 4MKFA 2RH5A 3RRZA 3OO0A 1T0BA 3LVFO 5EIOA 2AE2A 1QHXA 2GBLA 2ZWPA 4KOAA 5D84A 5EPOA 3WLSA 1E4YA 3A6GA 2J3EA 3TIVA 4NEHB 4NYMQ 1GV1A 1Z06A 4BKUA 4HVTA 4RVHA 4EUFA 5IJWA 4XFKA 4GSKA 4HV4A 4ZZIA 1CUJA 2VPTA 4KQ2A 3AVUA 1ZU4A 2DEUA 1R5BA 5L3SA 4NPAA 3KXLA 4UBOA 1U0RA 2VZEA 2DQYA 5LD2B 2HLDA 2GZDA 3DEIA 1YO6A 3DF9A 4KTVE 1RIFA 4KXUA 3ER8A 3OQNA 2ZJ8A 3O84A 2JHCA 1NMXA 4YGXB 3OOWA 1U2DA 2YNMC 1WJGA 1L1FA 2DPYA 3PE3A 2D2VA 4CMGA 1NTOA 1QKIA 5JE8A 4AY4A 1OX4B 5KX5A 4OO3A 1U8UA 1VBKA 2RGNC 5T8KC 1B0AA 2H92A 3C7DB 2IXFA 3MTAA 2GZ3A 1CLUA 4YRTA 5FEMA 3FFXA 5JO0A 2EFYA 2UUBB 2EF1A 1EHYA 3WMXA 2G07A 1W29A 4QAJA 4FEYA 2E4UA 5EMLA 2CLMB 3JRNA 3NC1C 2O50A 4BOYA 1TT5B 3MJFA 2VXBA 4EY8A 4AZVA 4ENRA 5FPKA 2P5TB 1EFAA 4FLFA 1JR2A 3LXMA 1LQTA 2VP0A 4JJEA 3ST7A 5BWCA 1HKHA 5ALOA 2O7QA 5FLYA 2DCMA 1SIWA 3UEOA 2EKDA 3VUFA 1M34E 4WCFA 4Z7NB 6REQB 5LZ9A 4IHAA 1Q7EA 2SNIE 2OENG 4KK3A 2BFBA 1DOAA 4GQIA 4JVOA 4MWTA 5ALWA 1ZBDA 1PHRA 2OYSA 5T7BA 2AW5A 3KSZO 5A5FA 4M7RA 2WE7A 1USGA 3T52A 5JCXA 4TS4A 3HG7A 3EEOA 1KOFA 4MO9A 5A4FS 5FFFA 1JNYA 1A97A 3Q9SA 1G5QA 1KAEA 4J8PA 5J63A 4CHGA 4DUGD 1A4RA 2IH5A 5A4IS 1QV7A 3A26A 5U1PA 1XVUA 4ZCLA 4BCDA 2N1BA 3UC5A 2I3AA 2YVKA 2OCGA 1W52X 1JR3D 2AG0A 1IN8A 3WXMA 1N0WA 1TF2A 2PWZA 2CUTA 3VBCA 1UQRA 4Z0NA 2VCHA 3QTBA 4GLJA 4K0RA 3ZHZA 3N2KB 1T0JB 1TFUA 3EFOA 3D31A 2OGWA 1UBSB 1NHGA 3LBAA 3R5TA 2P9GA 4FFDA 4G9GA 3SS9X 3F6BX 4XIFA 3THWB 2AD5A 3NVKI 5KKAA 4D43A 3OJOA 3UGKA 1T2UA 1V3UA 3NT5A 1FVHA 2WIJA 1TQ6A 2ZIXA 1YA8A 3C3XA 4KH1A 4MYTA 4QNRA 4ZT7A 3EXHA 4AWXA 4DCVA 2OCAA 2FG6C 5GIOE 1A2QA 4YMGA 1ZWLA 1NXVA 1SKUA 4KG7A 5F35A 1IUPA 2P1ZA 3O8CA 4QSMA 3HR8A 1N0UA 1EA7A 1Z47A 1JR4A 2QR3A 4PSDA 4C4RA 1RMYA 1GTRA 2GDJA 2YWRA 1KSGA 5B7GA 4M89A 2OOKA 3SIXA 2B2CA 2ZPAA 4N0PA 1J22A 2WA1A 2OZVA 1JDNA 2E1RA 4I5DA 2V7QA 3ZW9A 1K66A 3DZGA 3SEQA 3QUCA 2FPMA 4Q3OA 1QR6A 2IYWA 1JIQA 1MQ8B 3LYAA 1MU0A 4JUIA 4RA6B 4EYKA 4KK4A 2O1WA 3PUIA 4WDQA 3D3WB 3KFLA 5JZBA 2GFQA 1SB8A 1QDLB 1KZ6A 1ZM9A 1E1MA 3L04A 3PPWA 1QIHA 4L9RA 4JL5A 4TYMA 3P2MA 4CU2A 2DX7A 5CK5A 5IN4A 3GYGA 4W1RA 2D2FA 4GL4A 2MMCA 4OXQA 3BTUA 3EIOA 3FGPA 1ODFA 2KX7A 4UAGA 1SXJA 2QR5A 3PR2B 5IAEA 3RBVA 7ADHA 1R6BX 4QPNA 2Q9UA 2D13A 2QMZA 1H8HD 1IJEA 3FIUA 2X7HA 2BF4A 2X9QA 4URWR 4KV9A 4ZOLA 1JZSA 1NR1A 3ELUA 3OLYA 4JDPA 3CLUC 5D00A 3T0GA 1V11B 1WG8A 2RH4A 2QX9A 3TGWA 4DA9A 2I7VA 5BPFA 3QV2A 2VF4X 2XOEA 1LWNA 1E9VA 4XUDA 1YTUA 4NZOA 1TIPA 1UXKA 4LTMA 4BMPB 1TVCA 2KS6A 4H35A 4ZD6A 1I7NA 1RQ2A 3QENA 2AC4A 2NNWB 4HF7A 3R5SA 3IT3A 2YFKA 1ZK2A 3G82C 4B0OA 1X1EA 4GXRA 2CHFA 3AUSA 1BJKA 4RPCA 1CJSA 3JQRA 4B4KA 5MN5A 4HN9A 4LZPA 4JB0A 5K3FB 4NH0A 5TJ9A 3JTMA 1TD9A 3HKDB 3U1BA 5ECDA 5BNZA 2YL2A 1IHYA 4PO9A 4LHSA 3H2YA 3SBOA 1NQ5A 1U0SY 5DLQC 4L9AA 3U6KA 4AUKA 3AHIA 2DBVO 3CONA 5FBWB 1E6MA 3TKLA 2RJOA 1Q77A 1YVEI 3A6JA 5LBIA 3T7KA 3ICQB 2JF0A 5JQGF 1NXSA 2YJ6A 5TF4A 1X6VA 5EC8A 3SSOA 3AYZB 2MINB 2FCRA 1G9TA 2D1FA 4EPVA 5AOCA 1K97A 2CNDA 4MAAA 1C9JA 1E20A 1XQ1A 2YWJA 2GARA 5EHGA 4XR4A 3IHTA 3Q8XB 1ZXXA 5DBGA 5JDCC 3RYFA 1CUUA 1Q12A 4WUVA 3BWMA 1HDIA 4RV9A 3RQIA 4LZNA 4CCAA 3JWPA 1EI9A 5AH0A 1EUDB 3AOEA 2FSSA 1ZCJA 1QR2A 3KQPA 4BNZA 1VHLA 5HXAA 3CX7A 3B7GA 3TD6A 5JYBA 3H83A 4D3FA 3T95A 1OLOA 4HAUA 1RRFA 5E4YA 4B40A 1KEKA 2FMIA 1XIVA 4IQ0A 3KTDA 1WUHS 3EG9B 1PL0A 1Y3IA 3LQKA 1QRRA 5A4JA 1W94A 3Q10A 2AYYA 5I3ZA 1ENZA 4KFTA 3PD0A 1G5TA 2VQEB 4HSGA 4WLUA 1RYMA 4M38A 3HYNA 2LVBA 1BJTA 4O3FA 4UVIA 1T2EA 1T1RA 1UC5B 3EA5A 3PCTA 4FZ5A 4MLCA 4BX8A 1AG9A 1TZKA 1YZHA 2FUG6 3E9EA 2YXBA 3CT6A 2WUVA 3GOQA 4JBGA 1B8NA 1KQFA 3NYRA 1OZAA 1U1CA 2WDPA 1FS6A 5I4KA 1YU9A 2CLSA 4YMSA 5JXHA 5GONF 1TF7A 1RR6A 2CW5A 3WP1B 5AVSA 1RJGA 4I9FA 5REQB 2GRUA 4E4YA 1SOUA 4BMSA 1GZ7A 3CWQA 4QQRA 3COSA 1JIKA 3IP6A 4DCJA 4MKHA 3NRCA 4MP8A 1TCBA 3HKBA 3EZ6A 3AIIA 5KQGA 4B44A 3D43A 2XF8A 1NUSA 4IICA 5AM2A 2VYCA 1G16A 5BQFA 1E0SA 1ELOA 3A3YA 1Z62A 1ZITA 3AH8A 4WK2B 4I1YA 1R5NA 1ECLA 3FFBA 3EUWA 3USZA 2VHCA 1MGOA 4AY3A 1K8RA 1VCHA 3AINA 4H17A 2HLDD 4Y6OA 3K96A 3GZNA 1U9ZA 2RARA 4CM9D 5BYKA 5IVKA 2QKYA 5FHQA 4K8RB 1PEKE 3EJ6A 5LP1A 2YV1A 3H7AA 3IV6A 4WW0A 5FTKA 1PNRA 1O89A 4J0EA 2XMCA 3QGMA 3EEIA 4WY5A 2Q1TA 1MZVA 3P4YA 1O9GA 1ZCZA 1LX7A 4Q47A 1OXSC 1AK1A 4AKSA 2IU4A 3MWEB 3U62A 13PKA 3JQFA 1U0HC 4RGQA 3QMVA 2ZIXB 4CNBA 2ZBRA 3NVAA 3OICA 1D1PA 4IXDA 2O1EA 3Q88A 1W76A 4MS4A 3LC0A 3CG4A 2QA5A 3AWIA 3WHIA 3UMYA 4LDAA 2VHVA 4XDGA 2QL5A 5EKUA 4C5AA 4Q9AA 4BJ3A 5EYPB 4E09A 3BERA 1UWKA 3AF1A 4C3VA 3CEJA 1I3MA 3K0FB 1E3LA 3EQ8A 4ZRMA 3I62A 1N1EA 1P7ZA 1RC1A 2JFXA 4W7IA 5IJXA 2JI6A 2BR3A 2G9ZA 1EDEA 4QBKA 2WV9A 5KJ6A 1Y4DE 1XB2A 1YU6A 2NZYA 1SC4A 5JS6A 1LTQA 1UJ4A 1QPGA 3ONDA 2Y6UA 3I64A 1FMFA 2NPIA 2PG3A 3GBSA 1SC3A 5BMVF 2A1TS 3FNQA 1RDFA 2LDBA 2PZMA 4OIFA 3H05A 2N47A 3DLAA 3L8YA 1Y4ZA 2OAQ1 2OQ2A 1GTL1 3LBFA 3OEWA 4GF5A 4PFSA 3MHTA 3U16A 4Y1EA 4C4TA 2I4OA 4NR0A 1MIOA 5GQSA 5KNDH 2IHUA 3QLUC 2VBCA 1P75A 5CDUA 4D25A 3HE3A 4J2HA 1EVEA 4IWNA 3FPHA 2ZUDA 1UINA 2JIBA 2YY5A 3VU8A 4C03A 3GGDA 2QL9A 2OK8A 1SO8A 1NQXA 2GYYA 1M2KA 3VHLB 1EM8A 1X74A 1X7YB 4V39A 4CKEA 1LSSA 4D3SA 4EH1A 3LP8A 5JSKA 5CAEA 5F98A 1DADA 2R3SA 4ND4A 4JGIA 3R40A 4BEBA 1OGYA 1VL5A 1IQPA 3BVPA 2IA5A 4GBMA 4CRWB 3ZXSA 4IFIA 1VOTA 1MXHA 4ALMA 2ONYA 2V7TA 2ZJ5A 3FMFA 1HTWA 2YWBA 3VHXA 4CLDA 4CTMA 1KSHA 5AOAA 1M3SA 1OJ7A 4Y6GB 4DW8A 5FYDA 3FNFA 3H7IA 1X0XA 3IKMB 2I7XA 1KR5A 3CZ5A 2P0YA 5A71A 4JT8A 3VDQA 1V48A 1XMXA 1NXWA 2DHCA 3OPQA 3TMAA 4NJMA 3LAWA 3AVTA 2H2DA 2XDQA 1JHMA 2Q4DA 2X0RA 2XWPA 5IRCD 2QZSA 4J7CA 3EIQA 4O4HB 3ZYZA 5F23A 5D6NA 4V0SA 1OASA 3T99A 1ZNXA 2X5OA 3RS8A 3V8MA 1ZESA 4X3OA 3B48A 3QA9A 3ZZTA 4DUGA 4A8JC 5EIXA 2ODQA 2F48A 2PH7A 3W77A 4FC6A 3NTUA 3IUMA 2MINA 5C35A 5JXIA 2C4KA 1UDAA 2A1UB 2JVIA 4KQFA 4RSGA 2CL6X 3T1TA 2PLFA 1HDXA 3ZZNA 1AE1A 1JFFA 4X92A 1QTIA 2E21A 1RAGA 3CKYA 1Y3AA 3IPAA 1X7WB 1U4SA 2QUBA 2OHJA 3AR9A 3F4KA 4AKTA 3KB6A 4LDJA 1KZ9A 1NM5C 1JDZA