4BN0A

Structure of futalosine hydrolase mutant of helicobacter pylori strain 26695
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
232
structure length
225
Chain Sequence
HMVQKIGILGAMREQITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNSFDAFLEKSAQTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Enzymology of Helicobacter Pylori Methylthioadenosine Nucleosidase in the Futalosine Pathway
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords MTA/SAH NUCLEOSIDASE
total genus 78
structure length 225
sequence length 232
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bn0A00
1M73E 1QE5A 1Q1GA 3MB8A 3KUKA 3BJEA 3C74A 4YJKA 3EEIA 5B7NA 1Z33A 1TCVA 4UC0A 4D8YA 5F77A 3T94A 4X24A 1JPVA 3UAZA 2P4SA 1I80A 3FB1A 4ECEA 3UAVA 1T8SA 1PWYE 5CYGA 1PW7A 1TGVA 4QEZA 1RXCA 3DPSA 4FFSA 3OZBA 5F73A 3E9ZA 4DARA 5F76A 1LX7A 1RXUA 4LZWA 4GLJA 3ONVA 4OY3A 1YQQA 1V45E 1Z5OA 3LGSA 3D1VA 4TS3A 2AI3A 4P54A 4K6OA 1U1CA 4L5AA 4G89A 3U40A 4M7WA 4L5YA 3EUFA 2HRDA 4MARA 4EB8A 5IU6A 1VHWA 3LBAA 5K1ZA 4EARA 4NS1A 3BGSA 2AI2A 3DJFA 2HN9A 1JE1A 1RSZA 3BL6A 4LKRA 4GKAA 4TXJA 3NBQA 1JE0A 5EPUA 3TL6A 4PNPA 1SJ9A 1RR6A 1ODLA 4BMZA 1ULBA 3K8QA 2RJ3A 1A69A 5F7XA 5FAKA 3IEXA 4WKBA 2QTTA 5CXQA 2I4TA 5B7PA 1JDTA 1PF7E 4DA7A 3F8WA 1ODKA 3UAWA 2QPLA 4DANA 1ZOSA 1V41E 1T8YA 5F7JA 3PHBE 2XRFA 5KB3A 1SD2A 3NM5A 5CCDA 1PR4A 3E9RA 4TTJA 3KHSA 1Y6QA 1YRYE 3KVRA 1A9QA 4TXLA 4F2PA 4JWTA 1U1EA 3NM4A 3OOEA 4D98A 1OV6A 3FWPA 4QAQA 4D9HA 3OF3A 1TGYA 4DA6A 4TXHA 4WKCA 5CYFA 2A0YA 3FUCA 1V4NA 3PNPA 1K27A 1NW4A 1OTXA 5CXSA 1Y6RA 1LV8A 1JDUA 1VFNA 1SD1A 1U1DA 4OJTA 3QPBA 4YMLA 1YR3A 4TXMA 1B8NA 4D8VA 3UT6A 5EFOA 1PK9A 1PR2A 3GB9A 4WKPA 4DA0A 3OOHA 1ZL2A 1ULAA 3O4VA 1A9TA 4TXNA 4L0MA 1RXSA 2H8GA 3SCZA 4R2XA 3MMSA 1A9RA 3P0EA 3KU4A 1JDVA 1Y1QA 4L6IA 2ON6A 4M1EA 3BSFA 2OC9A 2QDKA 4G41A 1U1GA 4DAEA 4F1WA 1T8WA 4RJ2A 1JP7A 4QATA 5JPCA 3UAYA 2AI1A 1PR5A 1ODJA 1T8RA 4R31A 2A0XA 3OCCA 4TTAA 3OZCA 4LDNA 4OEHA 3DDOA 1Y1TA 1V3QE 1JDZA 1RCTE 3OZEA 2QTGA 4BMYA 5B7GA 2I8AA 3OPVA 2ISCA 3LA8A 1A9PA 1LVUA 4JP5A 1G2OA 4H1TA 1WTAA 1U1FA 1ECPA 3EUEA 4F2WA 2GUWA 3PNSA 5IFKA 5F7ZA 4TYMA 4M3NA 1JDSA 1OUMA 4QARA 5EUBA 1PK7A 4OGKA 4I2VA 4F3KA 4YNBA 3NM6B 1T0UA 5C80A 5I3CA 1Y1SA 4DA8A 1NC3A 1Z5PA 3DP9A 4BN0A 4QASA 3EMVA 2QSUA 1SQ6A 5ETJA 1OTYA 4PR3A 1ODIA 4WKNA 4OGLA 4MCHA 2BSXA 1Z34A 1PR0A 2AC7A 4GLFA 3IOMA 2OC4A 1PBNA 1A9SA 1C3XA 1K3FA 1PR1A 1RFGE 1TCUA 3KVYA 2A0WA 1PKEA 2PGAA 4TTIA 3INYA 1V48A 3OZDA 1V2HE 4KN5A 4BMXA 3KVVA 3ODGA 1B8OA 4L5CA 4YO8A 2Q7OE 3FNQA 2OXFA 4U2KA 1OU4A 2OECA 4WKOA 1VHJA 1PR6A 4DABA 1CG6A 5CCEA 1Z39A 1RXYA 1FXUA 4JOSA 5DK6A 4GMHA 1YQUA 2A8YA 3P0FA 1A9OA 3PHCA 1JYSA 4D8XA 1Z38A 1RYZA 4IP0A 5F78A 1VMKA 3FAZA 4NY1A 3DF9A 1YBFA 3E0QA 4NSNA 1NC1A 3UAXA 3ENZA 2IQ5A 5F7OA 4G8JA 2HWUA 4E1VA 3K8OE 5B7QA 4QFBA 1OVGA 4F3CA 1RT9A 1XE3A 1Z5NA 1Z37A 1K9SA 1CB0A 1Z35A 3GGSA 1Z36A 4LNAA 2B94A 2HSWA 1Y1RA 4DAOA 4MCIA 4OF4A 1TD1A 3FOWA 4R2WA 3O6VA 4LNHA 4TS9A 1N3IA
chains in the Genus database with same CATH superfamily
1KU6A 5ECDA 5TR9A 1MAUA 3DNFA 1MTZA 3G0CA 4R01A 4MVJG 4DCNA 2AMFA 1TA0A 1DIOB 1G42A 3I2JA 4MP8A 5DK4A 1QX3A 4KN8A 4WLUA 2Q29A 4FI3C 1LPOA 2IYFA 3EEIA 3ZC3A 1K7CA 1X8LA 2GBIA 4B2IA 3EDYA 2X8BA 4FFLA 4E15A 3AUXA 3UXEA 2E1PA 4P92A 4OA8A 2IVZA 2OP1A 2CNWA 2WFLA 5AUPB 5JCOC 2LRHA 4D8YA 2R1VB 3B53X 5JSHA 3LJKA 5F77A 5A1TA 3KAKA 1NOKA 2JZOA 2VXYA 2W48A 3DZIA 3B9BA 4FCWA 4GI7A 1Z4LA 4IF4A 1SMKA 2AH5A 4DG5A 4ZD6A 1ZG3A 2SECE 2IPXA 2O4CA 2RGCA 5JNRA 1JDJA 1IQUA 1QYWA 1ZXBA 4H6XA 4DEYA 3CVVA 3CMCO 4MKIA 1THTA 3E4CA 4NECA 3O4HA 5DN6A 4AUMA 3BIWA 5JW6A 4Z4CA 1DEAA 1X38A 1AQYA 2B4KA 4LJKA 1KR5A 3F46A 1IXRC 1HT0A 1JG2A 1XYYA 2X1LA 2GVZC 1ADFA 3CF2A 2DB3A 2GD2A 2W6JA 1CU1A 3SSNA 4I4TF 2B98A 3L49A 4Z3OA 4UEKA 1RRFA 1SQFA 5BUZA 5KTKA 4LI0A 3V42A 2D2FA 3DMRA 3I5UA 3PUKA 4I66A 4GEGA 4I4NA 2OBFA 4TLCA 2G9NA 1I7SB 4QYIB 3LBHA 4UCQA 5ICFA 1DXHA 4PZPA 2GCNA 1I7NA 3KHTA 2FEXA 1ZGJA 3VKFA 1CHDA 2FE4A 1SU6A 2Q3CA 3EVGA 1Z5OA 5DBFA 2XD4A 1GAWA 1XD9A 3MCVA 1JR3A 2FEPA 4MKGA 3OPYI 3DTTA 1WZIA 3EPRA 3IXQA 4KXMA 4C6RA 8ABPA 2BCJQ 1WHSB 5AWFC 5BNFA 2P75A 2FPIB 2I2XB 4KFCA 4QM6A 4IX9A 1QB7A 2KJQA 4GXNA 5JE8A 1V39A 5DT9A 4PHTA 3TQSA 3AI2A 1WDTA 2RG7A 3OICA 4ACBA 3ZHSA 4JI4B 3CLHA 1NJ1A 1VHDA 2XX3A 2WUFA 4WGFA 5LYYA 3TM5A 3A1NA 4Q34A 4EHFA 5IKMA 2VRCA 2X23A 2VHZA 3CZMA 3IT1A 3LE8A 3U9LA 4DCPA 4KBYA 4DR6B 2VBFA 4BQSA 3OTIA 2XEDA 1ABFA 2MSLA 2PQ2A 3GFTA 4M8LA 1SKBA 3BGSA 2R8EA 1JIUA 4ZWNA 1B2RA 2QRLA 1DS6A 3OWHA 4HGYA 3T3DA 3BMCA 1I0LA 2H1IA 5IUNC 1Q14A 1M34B 5CJJA 2HADA 1ANKA 2C97A 3MTDA 1K3UB 1J8VA 3TLEA 2IA5A 4B3CA 2O0LA 5HM6A 2P3QA 4L78A 2G1UA 4E7OA 5AESA 3GPLA 1Z3IX 4J94A 2HREA 3WS7A 1XK7A 3KHKA 4QPCA 2B99A 1SH7A 1ZOPA 2Z2ZA 4TXJA 5HE9A 1EQAA 2DYKA 3EZYA 1QTQA 1VL0A 4N76A 3H84A 2QRMA 1M33A 3AI1A 3KZNA 1YFJA 1L5WA 2OFPA 4EW1A 2AW3A 3BXEA 4X8LA 3PK0A 5AVTA 3C1OA 5DHTA 4XLZA 4R1NA 4XJVA 4P4GA 3DL2A 3MGKA 4NPHA 4OG2A 3R7FA 4B71A 1LQ2A 5C1DA 2FPUA 4W5RA 3RC8A 3JS5A 4ZCSA 1E2UA 3W6NA 1Q0TA 2I33A 5CW2A 4C01A 4EW6A 2I4TA 4AXBA 1IULA 3OJCA 3FYDA 4FU0A 2QPAA 5HF6A 4ARUA 3UAWA 3GUYA 1L5KA 2M6RA 2X5OA 1YR9A 2EWVA 2H17A 4CWAA 2DHCA 1CUDA 2C3UA 3OLYA 4ZIRB 4CPDA 1CDOA 3CCCA 1SXJD 1DWUA 5M04A 1X94A 4W9RA 3U7JA 1V1JA 2BFEA 3U31A 4N01A 1ADBA 4UTZA 4EG1A 5LA6A 4QPJC 1B43A 1NDQA 1Q77A 4X64B 1GPWB 4E5YA 3I9MA 4EJ2A 3IT2A 5E3JA 2FWMX 1VSVA 1E94E 4GPBA 5EJMA 2Y1LA 3WR5A 4L9WA 1XTSA 2G82A 1W5TA 3KBOA 1OF1A 4IW3B 3SHVA 5GZ1A 4HRAA 4DBZA 2IODA 4TTJA 2RAPA 1KFKB 1SFRA 3LY5A 1X8KA 4OP3A 4RD3A 1YDHA 1A5BB 1RBMA 2IH5A 5LCXA 1G7TA 2C4KA 5JS7A 3IDQA 4HAVA 4JXKA 2VDKB 4S05A 3CU5A 3OOJA 5D5HA 1KNXA 3X1WA 3ZDEA 2CFRA 4WVLA 3WISA 1XZCA 5JISA 2X6TA 2ASEA 2ZQ5A 4RJTA 1MAVA 8ADHA 1IXSB 4ZI7A 2PMDA 2L18A 2IX3A 4UE2A 1ST3A 2Q41A 3B5EA 4WZBB 1CRQA 3FPAA 3MSXA 2C1ZA 1OROA 2EJCA 1H23A 2X3UA 4IVQA 3WRYC 3D3NA 3WLNA 1RZRA 4EFKA 1M8PA 3EULA 1JSZA 3GVIA 3UJ7A 2FMUA 4RADA 3T34A 1PK8A 2WU1A 4UPVA 3O8OA 2FPKA 5DNDA 2NVBA 2Q7XA 4NULA 5MGNA 5TSDA 1PFYA 3UBMA 3UGJA 1FSGA 2WE8A 3CPJB 1YAHA 2PUAA 4U63A 2EL9A 3B1XA 2P3OA 5B3JA 5JASA 2V9ZA 1DRUA 3AHFA 3SSAA 1C3EA 1LNQA 2W6MA 1QH9A 2PIAA 3DAHA 3RC9A 1MB0A 3WIOA 2ZAYA 4BFSA 7ADHA 2ZBEA 3OH8A 2YC4C 4OHFA 3II6X 4DGQA 1NWCA 4GBED 3FE2A 4Q93A 2BI8A 1EUQA 3WAGA 1Y42X 2PH3A 3AIIA 3ZDZB 1U0FA 5A3RA 1R66A 3FYUB 4UM7A 4U7FA 3QXXA 3PR1A 1Q12A 1MG0A 3WWYA 3T41A 3QV1A 2B4TO 5LQAA 1PGPA 2ZU0C 3O4RA 3QELA 4JVNA 1H2AS 1EWQA 2LD4A 5D6OA 1NV8A 5IP5A 3LIIA 3IC5A 1WMFA 3QYFA 2NU8B 5CX1B 1AZSC 3HCWA 2XQIA 1GARA 2CSUA 3GFRA 1USGA 3HB0A 1E20A 1YB6A 1FX0A 3PKIA 4M86A 5EJIA 1U7XA 2FP3A 4LDRA 4RJIA 4RIFA 4RW0A 3UWDA 1BKSB 4CMJA 3IAXA 1GNPA 3RLFA 1D8TA 2H9AA 2Z5VA 5I9NA 4BGVA 2R85A 2CHGA 4CFYA 5K0TA 4YCSA 1ADCA 1E3DA 2QD1A 4M0EA 2GTPA 2P62A 1DBSA 2BD0A 3DO8A 5IYZB 1YCGA 4DCCA 3E03A 2Z1MA 4BNUA 2IYSA 3K3PA 3RGWS 4F85A 3DWGA 1JF8A 4I9HA 1GGVA 2AFHB 3A04A 3CVXA 3IDZA 2GM5A 4JROA 1H1TA 4Z4QA 5AQ1A 3ZGOA 3D4IA 5GP1A 2NO1A 1NLMA 3PSAA 4JLKA 4J3JA 1E6EA 4BP1A 5E4YA 2DBRA 1M0EA 2HZ7A 3MWDA 5FO0A 2OYCA 2I03A 1CUVA 4BO7A 3S1SA 4GX2A 4GS5A 4UHFA 1PFVA 1SKQA 1SOWA 4HPXB 1JFFA 3WE7A 5A4IS 1EJ6A 3ND5A 5D3ZA 2Y1WA 3ND9A 3WO1A 4A0FA 2EG5A 3F6PA 5TPWB 3CZ4A 4EPWA 4QBGB 3NH9A 5DHAA 3RC1A 2AI1A 2GEUA 1MAWA 4UHHA 4YBRA 1PJSA 2GJAA 3LNCA 3LL7A 2W2NA 3O4IA 4HDOB 2BVNA 4LPKA 4QXOA 3PD1A 1OWMA 2EAUA 3HE3A 3K5IA 4H16A 5EXDA 5ULLA 4AQDA 5AVRA 2XLCA 4ZRMA 3SX0A 3K71B 4LQ4A 1U7TA 4M2LA 2VTDA 3ZV3A 3N5CA 3QBDA 1MXFA 3OIVA 3DAOA 4Q7KA 1K08A 3G2HA 3Q2IA 2C2GA 2C99A 5FPTA 3HBAA 4I50F 4EL0A 1EYZA 2CXTA 3N53A 1OAOA 4A8PA 4B33A 5K0FA 1O0CA 1ABEA 4TLMB 4MDYA 3TLXA 3TTSA 3ZXXA 4CF6A 1XDBA 3GELA 5IUKC 3K9FC 2B0JA 5AM1A 3L1UA 4P38A 2V7BA 2O2XA 5EHGA 2IZOA 2ZPTX 1HFKA 5AVSA 2QUIA 1PJZA 3EXHB 4YH1A 3UXMA 2JAPA 3BRCA 3FN4A 3KUUA 1YC2A 4H1TA 1FX0B 3FPSA 3LXXA 2VHEA 5F98A 5CK4A 5G1NA 1LNSA 4RHFA 1NP6A 1DJOA 3I12A 1PGQA 2IV7A 3N8IA 3WL4A 4V3BA 3AY3A 1THZA 3RFVA 2XDQA 4ZVVA 1X15A 1A1VA 4OB8A 1ZGBA 1UZAA 4KXUA 4QPNA 4DWOA 1U0RA 2A1UB 3H19A 2H85A 3LT5A 3O1HB 3PDWA 5EE3A 3TAUA 3F5DA 3GJZA 2IH2A 1A1SA 1U2ZA 3CF0A 1HDXA 1XUOA 1ZK3A 2LE0A 5GV8A 1OBHA 1T5SA 2GTHA 1D2EA 3R3XA 3M1AA 5FPHA 3HJAA 3ZNNA 2VDWA 5CUQA 3DVRX 5TV2A 4WK2B 3RR2A 1F38A 3IV7A 3WQRA 3I0NA 3ZU4A 1Z8FA 2O2IA 1ZJ4A 3R4CA 1H69A 1XEFA 5HDBB 3MAAC 5DGIA 1TW3A 5BSVA 3P2EA 3GGDA 5EIAA 5C80A 5I3CA 2X0IA 1UWKA 2XTZA 1N8TA 3L1KA 4BNWA 3HJHA 4P84A 4KXLA 2O8BB 1G4UR 3EC2A 1RWPA 1D0SA 3O7WA 3HU3A 1DUSA 1B3RA 1JJVA 4H7IA 3IVCA 5DULA 2NYVA 1Z0KA 3D2CA 3V1NA 1IZYA 1SIOA 2DWOA 1EBUA 4GYYA 1SHTX 5ALHA 2ZDHA 4R84A 5LBUA 3QIVA 4IZIA 4O4LB 3W8NA 1OH6A 1FE8A 5H82A 2BLNA 2MINA 3FVWA 4KO2S 1NVTA 5A0TA 3IUNA 3QVSA 3JW8A 1OFVA 3HSYA 2GEJA 1Z07A 1RM4A 4N0EA 3LOQA 2DT8A 3RREA 1I0IA 1IBRA 3JARB 1L8LA 4FC7A 5EP1A 3KJFA 1P39A 2C00A 3K70D 2REOA 4AECA 3X1KA 3UWMA 3HVUA 3IUJA 4HAYA 5L3RA 1ZH2A 4FM9A 4DCTA 1A7UA 1OFTA 1OOEA 1DCMA 2EGHA 2DF8A 3H86A 5C3UA 3RVLA 2IHNA 4F4JA 5CM9C 1TM2A 3RIEA 4ALLA 1E8MA 1LI4A 2YHIA 3NDPA 4RY0A 5PGMA 1CUJA 2G28A 1NJGA 2VPZA 2AFHE 4R68A 2VZLA 3DZBA 2F9LA 3PXXA 4G9GA 4MUIA 1JYEA 1NG1A 4UD2A 3RG8A 5DCWA 4FDLA 5B64A 2FN3A 4H59A 1VI5A 2C84A 4JITA 1BW9B 1F2UB 2VS1A 1S7CA 4P1ZA 1OB5A 2HT6A 2JC3A 3VAYA 5KQGA 1P4RA 1N32B 4J16C 3A05A 4HNQA 2Q07A 2XSZD 3IUMA 4EJ6A 1Q0UA 4C30A 2QY9A 4LE0A 1CJCA 2FZ5A 1T8PA 3AM4A 3BQNB 3L7NA 4ENRA 1JKMA 3ZNOA 1I36A 4JELA 4JLNA 3EXEB 3S7ZA 3K1YA 3I62A 3VKVA 4LRXA 3KPVA 3HFRA 4QQFA 3K0BA 3ISTA 5JUWA 4DVGA 1YJQA 4Y7DA 2IIQA 2HK7A 4XX1A 3QE0A 1N0UA 1OI7A 1DTWA 2PXHA 4YIHA 1RI1A 1UC9A 2DFVA 3ZE7A 1UBJS 3QE9Y 5FOWA 3OQNA 5FA8A 1J2JA 2ODNA 2OXEA 3IT0A 5F78A 3L8EA 1EX6A 2H9YA 3DBIA 4CIWA 1YNSA 1K8YB 1IIRA 3F4LA 4EGAA 5HKAA 4V0QA 5TXGA 5L3VA 1CYDA 4JQOA 1B16A 4U7HA 4POAA 4WDQA 1NN1A 3NVDA 4QIHA 5ALTA 1AXGA 2ZU6A 5E1OA 4ARBA 4I50B 2O2JA 2CMKA 221PA 4KYUA 1XJQA 5IVHA 4JYMA 3PNVA 3ZBQA 2GM4A 2IQ5A 5FA6A 5BYKA 3U7EB 1T36A 1QH1A 3IV6A 4I55A 5GONB 4E1VA 2VSOA 1V1MB 5BWLA 1X9GA 1GCAA 2HY7A 3GUHA 4PZZA 4DNOA 4Z2YA 1JHDA 3VOTA 4D0GA 3FTQA 2BFAA 2JBHA 4TLBA 4WRRA 2FDRA 2YWRA 3GAZA 4YI5A 3W5UA 1Q74A 2BKLA 2MSNA 5CB4B 2ZJ6A 1TO2E 4IFBA 3H4MA 1NUTA 2EU8A 4ARZA 2B82A 2B5VA 4LDQA 3EK2A 4U6NA 4RK5A 3AF6A 2CV1A 4X62B 4UTOA 1QWOA 2JS7A 4FCVA 1I1QB 1SCAA 4JVOA 5IXYA 1O9BA 2VDMB 4TV8A 1F06A 2QMHA 3NTRA 5AK0A 4R8LA 1Z25A 4RHEA 4K81B 3CJTA 1QKKA 1TD1A 4Q3KA 4B9EA 2BI4A 4F71A 5B3LA 1XZJA 5AXAA 3BX1A 1SBCA 3D54D 5CBPA 3DEJA 1CY4A 5AICA 5D7BA 1W4AA 3EIQA 5DRYA 3QU4A 5LB4A 3QITA 1KK3A 3ILHA 5HJ7A 2C9OA 3CZQA 7ABPA 1AQLA 2JLQA 4EA7A 1BW9A 3DKVA 4XYBA 4R54A 3DZCA 2IYAA 3GEPA 1G8MA 3OZGA 1A8SA 3A0RB 2CK3D 2HA4A 2AV6A 4UOQA 4OHUA 4LYDA 2MMGA 5CW1A 3PIRA 2HA3A 1EX9A 1NMZA 1PDVA 3EXHC 1DMRA 3V8EA 1OJLA 4ERNA 2DERA 3JR3A 4E5DA 1KQPA 1Z12A 2NU7A 5A7FA 3OJEA 3R5SA 3O1LA 2EF1A 3AY0A 3AHIA 3GLGA 1FLDA 2ODAA 1Z15A 3D7KA 1T0HB 4WZAE 1K66A 5K3DA 1Q0PA 2X19A 2X8WA 1VLLA 3PXEA 1RXIA 4OH1A 4ZP1A 1BXZA 2QVCA 1GLGA 1TADA 4G9BA 4MMXB 3LPAA 1UOOA 4X1OA 4YLGA 2FR8A 3C8UA 2IPNA 2R79A 3Q0EA 4XX0A 1BFUA 2WVGA 1UK9A 2QRHA 1GO2A 1BVUA 1QRRA 3BJIC 1QV9A 1H22A 1G6Q1 1JHZA 1X8XA 1B7GO 2J30A 2CVPA 4NZ9A 1IU9A 4PAWA 3ZCSA 1UOPA 3C3MA 4QJ4A 1GILA 2H1WA 3TNDA 3GCZA 5KVCA 4I50A 1Z75A 2QX8A 3VYTB 1P91A 1B6TA 5CYGA 5LYJB 2VNKA 1LU9A 3C87A 3SU8A 5GZ6A 3SHWA 1E3LA 1TGVA 3FDZB 4BMOB 4EKGA 3Q7SA 4B2LA 3PCXA 1D9ZA 3CX7A 2D54A 3FTNA 4A73A 5GMOA 1T5OA 4CV3A 4QYWA 1NI4B 1FSFA 4AJNA 4E4RA 4A0HA 1GKLA 3L02A 1AT1A 4X85A 5CK5A 4YXWD 1R5JA 2BF7A 4DILA 2CJFA 1DRKA 4P86A 3ZWAA 2G67A 3KWJA 4N5HX 4DM4A 2F1JA 1JLRA 3OCWA 4DCUA 1U6JA 3ESYA 3R6LA 1IY1A 3U2QA 1NLUA 1ZY2A 1J5XA 3LRXA 4DQLA 1ISRA 4E4YA 3HNPA 2J4CA 2YN4A 5LB2A 3LGSA 1E18A 2O50A 3LUFA 4OOFA 2IYVA 1SA0B 2A2ZA 3WLQA 2O5VA 5JD5A 3AFIA 3GRVA 1GCIA 2VKTA 3GEEA 3LQ4A 1K06A 1N2CE 4RVHA 1II8A 1TD9A 1TYEB 4PCLA 4Z9BA 5TGDA 2PUJA 3MK31 3QG5A 1XALA 2AD5A 4JBLA 4MCJA 5BSGA 3PXBA 4ZT6A 3O7MA 4E5SA 5LDDC 4EB8A 1D5CA 1OGJA 3Q98A 3MN1A 3BL5A 3VKGA 2RB5A 2FF5A 1XCOA 2XPCA 3OX2A 5ALDA 1EB9A 4EHAA 4LQLA 4P6VF 4PINA 4V03A 3WYAA 1K8ZB 1YGYA 3NANA 3PG5A 4XUCA 4BX3A 4EFMA 3WO0A 2P27A 1HFEL 2I7DA 3FPKA 1EVEA 4ZMBA 2VRBA 4IO1A 3IERA 4RESA 1L4MA 4Y2RA 3ZWCA 4YUAA 3OLZA 1PP4A 1PGNA 3QRWA 4LVOA 1IIBA 3H97A 2Z09A 3ZHRA 1FXWF 1G8GA 5AW5A 1I3OA 4I5FA 1F2TA 1CJKC 1YR1A 3QFFA 5F2KA 2XDWA 5ALIA 2EZTA 2BGTA 4DDHA 2FFBA 3UICA 5JDIA 3T3GA 1KY5A 3TW6A 4NAUA 1D4OA 1Y33E 2QZ4A 4LAFA 5T6MA 4E0BA 1RU3A 3U4MA 4JYAB 1TM4E 1U0HC 4DWJA 1BCSB 1JIKA 3N8NA 2ZAGA 1WX1A 3JZMA 1YRBA 1XVAA 4FQ7A 4KLCA 3VPGA 2AC2A 4PNPA 2BGMA 2HBRA 4DV7B 4E3WA 2O4UX 3BD7A 3A58B 3K6KA 3CZPA 1P0MA 4S1PA 4M0FA 4F5EA 4OLJA 1H8HD 3LC1O 4WIAA 3WFJA 1YQGA 1PSWA 1VKOA 3AF3A 4XEHA 2HT1A 4RZ3A 1NI4A 3H04A 3UAOA 4GZ6A 2IP1A 2PD3A 2Q6OA 3NWBA 4HEJA 4YT8A 1H2WA 1UDRA 2BHLA 3MJHA 2JAWA 4P4TA 5EXTA 8AT1A 3GZNB 3IEXA 1U0TA 1PTJC 1N6LA 3EGWA 5HJ5A 2HQBA 4F9TA 1PF7E 4MLDA 1Y1KE 3PEVA 4L3OA 2AFIA 5TVKA 3EIOA 5A03A 2C4TA 4K6HA 3G68A 3TB6A 5C9ZA 3RUHA 4GR4A 1KMNA 5KMGB 2Z5LA 3HKEB 1V6AA 3H2BA 3W3AD 5DNAA 1UBKS 3H7AA 5F7JA 4UCXA 2FWPA 3GLIE 2AX3A 1YDEA 1S8OA 4M6WA 1UZUA 4HWSA 2HF9A 3KETA 4UATA 3NH6A 3TZQA 4BECA 3MRXA 4JSTA 1G8FA 5CNIA 4AN1A 2AKEA 4Z0NA 4DBLE 1IPEA 3UWKA 3W5AA 2ORWA 5CFOA 1B76A 4FUQA 4PHFA 1EB8A 4PZUA 4W1SA 4YRJA 4BKUA 1EVYA 2A35A 2IPLA 2A7QA 4OXRA 2FX2A 1SB9A 2PL9A 5AW3A 1KO1A 2WHPB 4HDMB 1XAHA 2J7PD 5IEBA 3FIUA 3GK3A 5AK5A 1VCIA 2CHEA 4F2PA 4BLTA 1J0EA 4J4TA 2WV7A 4E5NA 3OIDA 5GADl 1OR8A 1VIAA 4GX0A 3KTAA 4EITA 2BKXA 3PUJA 4JWTA 2FPMA 2X2OA 2MSKA 3NM4A 3K20A 4K6KA 2IV2X 5LOVA 2WFAA 1IB0A 5KOYA 2VRWA 2ZJOA 1RYDA 1B14A 2NV0A 4UQLA 2AMJA 4DA6A 1MT0A 2QTNA 3VJRA 4EM6A 4FS3A 1NMEA 2HIHA 1YRHA 3RKUA 1LBEA 1KYVA 2YW9A 3EFOB 4IEIA 3BG5A 4LJ9A 4WJLA 2CHVA 1ULUA 1XF9A 1OI3A 4J0JA 3W9YA 4MS3B 1A8PA 5CH5A 2QLNA 1KYIA 1I2AA 2DVMA 4FCCA 3HS3A 5GWXA 3MHPA 3STTA 4AKTA 3OM8A 1Y6GA 1H4TA 2C58A 1SVKA 3BRQA 1SCKA 4MVJP 4UU0A 4L8FA 2Z95A 3E53A 5FR2A 4L0CA 2V7XA 3R7DA 4I1VA 3X1ZA 1LGYA 4WNYA 4A8HA 2GAAA 2PV7A 2GKSA 1OBFO 1PU2A 1RRGA 4M76B 2DTXA 2CVZA 4B4VA 1Z62A 1UK6A 3JXEA 1NSTA 4NBSA 2VSXA 2O2HA 4UEOA 5FXMA 2BMAA 2Q8QA 5J47A 5A7GA 1ZSNA 4RXMA 3DT9A 4HAZA 2RB4A 1W36D 4WXHA 3HKEA 4EHNA 4FKBA 1SK9A 2I6SA 1FDSA 4WKPA 4OFZA 2M6KA 4AZ3B 4HWPA 4ECAA 4B3MB 1RCFA 2V03A 3BTUA 3OO1A 3VH3A 4B9AA 3V3TA 3WRVA 1L7VC 3A6DA 3IOYA 3I52A 3JD0A 4K86A 1BIFA 3EY4A 1TZCA 4N5MA 3SQWA 2ZFUA 2QJTA 5DISB 2PUBA 3P9QA 1UXHA 3MW8A 4Y2UA 2ZI3A 5CB0A 3G8YA 4DDTA 3UCXA 2H8GA 1Y5MA 3IJ5A 4HNHA 5BNIA 3BHMA 5MFPA 2ZCVA 5LMZA 2AZDA 2Q2VA 4MS1B 1UQRA 2D8MA 3VOAA 4W5NA 1TO6A 2BHRA 2WI8A 3ZR4B 2FW9A 4F9FA 2B8JA 3VZRA 2BN4A 4QXRA 2ON6A 3RRXA 4E3ZA 1UH5A 3FSGA 4NAVA 4HLUC 3TE7A 3VYUB 2JIQA 3NXSA 1G19A 3L7DA 5JVDA 4NIMA 2PO5A 4DAEA 1FDWA 3NHJA 5B3KA 2WF5A 1SHLA 1E3JA 3WBFA 5AOAA 1G8YA 4YDSA 3L8YA 1T8WA 4IGEA 5JZSA 3ZDFA 1ENYA 4PM4A 1A5AB 1JP7A 1LBIA 1W581 2HRRA 2UZ0A 3HRIA 4RGBA 3J7AC 3TIXB 1K2WA 4CIVA 5CB8A 1G5HA 4LYEA 4ENPA 4PO3X 4ZT4A 2FXIA 3CUWA 4IKEA 1GSOA 3NRCA 3F1KA 1YI0A 2UVDA 4KQXA 2Z6AA 1Z8NA 4LDAA 4R3NA 2QR2A 5IXSA 4ESVA 3KKEA 4M0CA 1GP2A 2DHRA 4RY9A 4MKRA 4JLWA 1EX1A 1E6LA 1JQKA 4XIIA 5FT9A 5KYKA 1X6VA 4TLAA 1F1BA 2HCFA 4P08A 2CYCA 2ZJ0A 4GGOA 4QULA 5CXUA 1TNDA 4G5QA 1E5XA 2D0IA 3F6CA 3FJYA 3WJ1A 5CDYA 2HTFA 4YREA 3OC0A 4MRAA 2Z83A 4ZO7A 3T7JA 1AXRA 5FPSA 4N7MA 4E03A 4I6JA 4BBAA 1O96A 4BNGA 1KQFA 3A6LA 4DMKA 5HQ3A 4P80A 1D4ZA 1DWPA 3PEFA 4O3MA 3ADBA 1IL0A 1KVQA 3D0RA 2XV1A 3EHEA 4OJYA 2YY5A 2YN0A 4G01B 3ZD7A 4QGGA 1ECPA 3OPXA 3PT5A 4QLBA 4MW2A 1MJFA 1JQJC 1OGIA 5LC1A 3KV3O 4Y2XA 1ITZA 5BMVB 4CG2A 1GVNB 3D7RA 3B60A 2OFWA 3VZBA 4LOLA 1C0KA 1ORDA 3OKCA 4U7DA 3EEFA 1J2EA 5JG7A 1FQWA 3SHFA 2FSVC 4RF5A 1QO7A 2X7XA 2EWMA 3CLUC 2HCBA 4Q3EA 1N9GB 4Y6PA 4XQ9A 4EGSA 4JZYA 1J24A 2VFAA 2HH9A 2IGBA 2GAIA 2HIGA 4BX0A 3CF4G 2A4MA 1L9KA 1QZTA 3K2EA 1Q1NA 2H1VA 2X4IA 2VAVA 1NVVR 4F56A 5I48A 1IRIA 2P7HA 4YECA 3NNNA 4II7A 2OO5A 3OEEA 3WHIA 2XGOA 3SIRA 4BAGA 1UKYA 1FP4A 2J3KA 2RHRA 2C92A 2MIIA 4F60A 4ZCMA 2UU9B 4AJHA 2Q9AA 4HMOA 4TL8A 3C3YA 3GVHA 5B53A 1KAGA 1XCMA 3H5NA 5KC9A 5B4VA 1OB2A 3CT4A 1NR5A 3PXGA 1TDJA 2DUJA 2RSLA 4B3BA 4KQMA 4MUGA 4PR3A 3FNEA 4RSRA 5KQPA 1S8AA 3E8XA 3MT7A 1CJSA 3LT2A 4UHEA 1NF8A 2W5UA 4DSTA 1F6BA 4GM0A 5EP2A 1CUZA 4BN4A 4EI8A 1T4CB 2KI5A 3O8QA 2PKYX 1MGPA 4PYJA 4LX0A 5HILA 4FGUA 4MKHA 2XNKA 4P58A 4BV3A 1XLUA 3I09A 4N41A 2QG6A 4TMZA 1E2QA 3FMPB 4HTFA 2GZDA 4JL8A 2WFLB 3HGQA 2ZRMA 5DYTA 3I61A 2QUKA 2GCPA 4AQ7A 1OMOA 4FOOA 4QRDA 1TUBB 5FI5A 2WINI 3T7AA 3OD5A 3WNCA 4AJEA 4EGFA 2GTIA 2C0PA 2OGSA 4B6SA 3K05A 5DOZA 2Z4SA 3A4LA 1B00A 4XYLA 5KOJB 2JFBA 1O96B 2RK6A 3AEQB 2H2AA 3C70A 3NEPX 3PC3A 1GPH1 1SCJA 2AR7A 4LRQA 1PO7A 2GHQA 1S2MA 1SKUA 2B25A 2C2HA 4GQAA 3KZVA 1QQTA 2GFIA 3BFPA 3V80A 4CGZA 3RSGA 3ZJVA 3D6AA 2PJZA 3QZUA 3WGKA 1FVFA 3MS2A 3OZIA 4EPXA 3BE8A 2VBIA 2VUHB 3ONNA 5MFZA 3UPUA 5LUAA 2CLFB 3H18A 4TKZA 1FLAA 3SD7A 3A1SA 1S6YA 4U2KA 1MZPA 2CDNA 4LXUA 3I4CA 1PNTA 5A3QA 3JWEA 4FN4A 2QSZA 1VHJA 3KAJA 5JH7B 2CGEA 4KQGA 4IWYA 1KQ3A 3TXXA 4DABA 2BGUA 1GZ5A 3TD9A 1Q44A 2XMPA 3CVYA 4FHZA 4CM9D 2Y0PA 1WZCA 4ESEA 2ZYHA 2DBQA 4J9VA 2B9EA 3KKPA 4HNGA 4MPDA 2OHGA 2CWWA 2QT0A 3IR7A 4OK6A 2RE8A 4AUKA 4Q9AA 3VX4A 2G3YA 3WNVA 1X42A 1U2DA 1JBKA 4FOSA 1MRSA 1A9OA 2C54A 2SICE 2PH7A 3GEDA 1TX4B 1EJ0A 5K3BA 4PNEA 1OI2A 4V3CA 5EXSA 3ZDDA 3JQRA 2WTMA 3MCTA 1Y7TA 1HE5A 1G5PA 2O20A 2REQB 4Q4DA 3DTYA 1QFZA 4CW7A 4FYIA 3FYUA 1P5RA 2JFHA 3F78A 1K5GA 3REQB 1IBCA 4PXYA 1NUSA 2OCXA 3TI9A 4LJSA 2C7OA 4ZC8A 2XD9A 1N2XA 2QK4A 3RVQA 4LCEA 4BMNA 4EO4A 5A4KA 2YWGA 3QNMA 1R18A 2DFNA 2CDBA 3EQ2A 3EZ6A 1PEYA 3NAGA 4QTTB 2C2KA 4RZXA 1K7FB 4P98A 4R9SA 5DZSA 4UMDA 1XEWY 2X8AA 3WV4A 3U3KA 2K87A 3DW1X 3C6MA 2PYZA 4D3XA 1Y82A 3VRHA 4K8OA 3FYSA 2D7DA 3HBMA 3IUPA 2YV1A 2G09A 1WBJB 3M6XA 2G0TA 2I6QA 4G25A 5BR8B 1T2AA 2ZYIA 3MWFA 4YQFA 1KOGA 2V7QA 4HS9A 5IN5A 3OQBA 3UMJA 1M8KA 5ESWA 2JI7A 2FSHA 2E85A 1TF5A 2Q50A 2XLBA 1BA2A 4Y8VA 3TR0A 1L3CA 1S2IA 1R88A 4MTCA 5KYGA 2WBLC 3GJ6A 5B1SA 2DEUA 2CK3A 4FYVA 1HMYA 4HGZA 4B3DA 3VH2A 5LZ7A 5DNYB 5K4HA 2X8LA 3QKTA 3TSOA 3PF8A 4G0QA 3JQ6A 2E4YA 2VDNB 3FNIA 2D62A 3NXKA 4RPJA 4XYEA 3IKTA 2C8KA 4ZEWA 1QE5A 1NM5C 1C4KA 4A8JC 5CMLA 2QMUA 5GIPE 3HWWA 3KE8A 5DB4A 2PDAA 5IC6A 3N5KA 4L5IA 1UQUA 3C74A 3Q0TA 3SDSA 2GYVA 3ZS9A 4UQOA 4CNBA 4YRRA 2QQEA 3F4KA 1IQRA 2J48A 3VZDA 3W5JA 2C3YA 2YNMC 4JGBA 2ID7A 4NMMA 5CAEB 3FCCA 1N1EA 3HXTA 4PXSA 2BKAA 4B6RA 5F4ZA 1JBEA 3WNQA 1KS2A 1K4YA 1HTBA 2YL2A 4U2CA 4XYGA 2P3LA 2EEPA 2PA3A 1VCHA 1N6RA 1B2LA 2VPXA 3TLGB 1P6QA 4KQJA 3HN2A 4PIMA 4YJ2F 3DLHA 3L8DA 2BMVA 5U4QA 2ZPUA 1ISGA 5ICEA 1E6MA 4NDNE 4H6WA 3TJRA 4G2TA 2QTHA 1HR0B 2REQA 3TZ6A 1JEDA 3PGMA 3R8XA 4ZFNA 3KQMA 2R44A 1NVAA 2XW6A 2P3SA 3B85A 3NTXA 3VNRA 1Y3AA 1JVBA 2NAFA 4RH0A 2Q1YA 3ONDA 3LMKA 1RW4A 4LF8B 3RSQA 1WP9A 4J4HA 1M8FA 4NATA 3RVNA 4XWKA 3ASZA 5JXWA 3A6JA 1SBYA 5T8KA 1WEHA 1WPXA 3P5BA 3PYMA 3FTCA 5FNVF 1CZHA 1VYUA 2GCEA 3ZD9A 4DLKA 2O59A 5I7VA 5TJHA 2P30A 4WX2B 2HW8A 1QG2A 5C8YF 4DIKA 4U7WA 1GGHA 3VR1A 2ATXA 2R1TA 2PRSA 4HYTA 4C7OB 3ELYA 1E60A 3OP1A 1L5QA 4KC0A 3A6PC 3DZDA 2FNAA 5JEEA 4ENUA 3GMIA 3GLFE 4RH3A 3I23A 3NCHA 3AM3A 5KYUB 3H9EO 2C95A 4MHTA 4EG5A 3GLKA 3VPHA 1OXUA 1QFJA 3C14C 1F8XA 5EKXA 4AQYB 2H1FA 4OHWA 1P1IA 3ZE1B 3ADPA 3O8RA 3CUYA 1JLMA 2YQZA 4L5JA 3UA3A 4Z9XA 5JRJA 1NQ5A 2KM1A 4K6OA 1ES9A 1M1XB 5J4KA 2WAYA 1S89A 2JRCA 2QIOA 1JSXA 1ZH0A 4S3MA 3M1LA 2PK3A 4TWZA 2DJIA 2FDCA 2XCSB 2KLBA 4M7WA 2WKWA 3R0XA 1QSGA 2QVGA 2IYWA 2BELA 1Q6ZA 2E87A 3IHTA 1HLDA 3LUCA 1XC7A 2Q3JA 3QVOA 4MVYA 3EGXB 3VPFA 1K63A 2R96A 5ALSA 4LVCA 1GPUA 1JSLA 1ZSVA 1DIBA 3LBAA 3NCTA 1K89A 1NM5A 2YZ7A 2Z4RA 5AJTA 2CMFA 4MQ6A 3KQPA 4IDQA 3SM3A 1C7FA 1FP6A 2QVYX 4QLAA 2R25B 2HN9A 5KQMA 1Y48E 5TF0A 2DUUA 5EC8A 3DH0A 4B7CA 4EHHA 1PJCA 1DMSA 3SLRA 5K2OA 3EDMA 2ZBUA 1E5DA 4BEWA 4GP9A 3A6ZA 4YALA 4GOJA 4NR0A 3AG6A 2D0OB 1G6OA 1U80A 3KTOA 1KH3A 4KPGA 2BGKA 1FDVA 1Q22A 2FX5A 1Q17A 1UMBA 2SHKA 2BZSA 4KSCA 1X1RA 5EZ5A 3ROTA 4ZYYA 1DAIA 3PWTA 5BW5A 3KIPA 3OLVA 1ZU5A 4CUJA 4L74A 3EAFA 3H5AA 2V45A 2RGUA 2JVKA 1BEUB 1EG7A 4Y30A 3NAQA 4WHMA 3RJMA 3OIWA 1ECJA 1T0BA 3DC7A 3TBHA 1VJ0A 4H7EA 5FOSA 4O8CA 3E8MA 2PMCA 4MWOA 2GCGA 3PR2B 1E2IA 2IE8A 3IVMA 2F8LA 3O21A 4J8PA 1Z0AA 2EOAA 3MM4A 4EBFA 5FTLA 3D3JA 1OC2A 1P4HA 3H3JA 4U9IS 4TQUS 4JC5A 2AQKA 5IT5A 1NAIA 5FADA 2JBWA 3A9SA 4O4LF 3KAQA 1E5LA 3MPOA 4TZ0A 1RWBA 3FFBA 2WMNB 1CZKA 1O2DA 2ZANA 4NZPA 5CT5A 5H70A 1O97C 3ZZMA 1QBKC 1Y98A 3WX0A 3LXRA 4INJA 4P31A 1XAGA 3AHDA 1KPIA 3ZHOA 4ZTZB 1RZRD 2PMKA 1UBHS 5IVKA 3BA1A 3NM5A 3CH7A 1P5FA 2JA2A 1RI3A 1K97A 3F7NA 3VH4A 3C4VA 1LX6A 2VJYA 4JLPA 4QUKA 4CGYA 3ACCA 5CM8B 5MN5A 4I1SA 2XDAA 3QVGB 4GI2A 1GRRA 5ALPA 3WL6A 2BCEA 5EHIA 2JANA 2NYUA 3MTQA 1SK8A 3N7TA 2FRXA 2J9YB 4WDRA 3SKYA 3ML1A 1J7KA 2XRYA 2IXEA 2XUGA 5AMXA 1XLTC 4S0XA 5H9WA 4KP7A 5FBKA 1GFSA 3F47A 1E8NA 3E1KA 4RIIA 3EH1A 3NIBA 1KDYA 4AZ0A 3W5DA 2XWJI 1RPJA 3GROA 3GVPA 3LHSA 1F8UA 5CA0B 3QPWA 2X0FA 4OHOA 3KJHA 2KMLA 4MUYA 3VMFA 1WUTA 3E4DA 3M9LA 1RMQA 1T2EA 2UZ4A 3U5ZB 4AWAA 5C8VA 1JI3A 4RTOA 3HYCA 1SXGA 1R0KA 4YRBA 2F17A 1MMFB 3KT3A 3LW8A 5C5CA 4UJ5A 2V54A 2WOJA 3STWA 1UMBB 2I4IA 3R6TA 4HO1X 4JR0A 4BXOA 2JLBA 3PXUA 5CVUA 3L05A 1MABB 1KZ4A 1SCUA 1K6IA 1XV5A 3IHWA 2A1UA 1FMFA 1A4IA 2NZVG 1BHJA 3I34X 2AN9A 1OY1A 2PKQO 3IJPA 3VU8A 1QC5A 1JDUA 3CKMA 4LJYA 3BXGA 3THOA 3WY9A 1PQPA 2HSDA 4OJTA 2NZJA 4KK4A 5TMDA 4CTJA 3UOWA 4E6PA 3ZHYA 3AUSA 4Y9TA 3VGJA 4FYYA 3UV7A 4XGNA 3V5NA 2H4YA 3HFSA 1U98A 2CF6A 4P33A 5CLGA 1TKBA 4UVIA 3UT6A 4YMUA 5KYWA 4QUAA 4AYTA 1B93A 2C31A 2R4TA 2WAAA 4HDRB 2V96A 1LS1A 2JCSA 3RC3A 3DMDA 2KBEA 1AX9A 3LDUA 2BW0A 3B82A 1WVGA 2ETVA 3E82A 4CNQA 1GY8A 1WTCA 3U3ZA 2MCFA 4B0OA 2J0SA 3IURA 3MELA 3R3ZA 2DE0X 2JFFA 3F6BX 1Z5VA 1PJLA 1VPLA 3K9BA 1F4LA 2H6EA 1QAOA 2IYPA 5DI3B 2YWBA 1LK0A 3JQ8A 2HWYA 1A95A 1ZUWA 2GETA 2GPYA 4ZAFA 5B36A 3X1DA 5AW1A 3NBKA 4R8KA 5KKNB 4ZU1X 1VSBA 3UF0A 2PT6A 3GFFA 5K0GA 3D2AA 5LM3A 1PYGA 3T9EA 3I2KA 2FPXA 1P19A 3H1BA 1TZKA 4WLNA 3VO9A 1XNJA 1ZUD1 1AKNA 4NE7A 1UPUA 3S0JA 4Z4HA 2Q99A 4JIGA 4KXYA 5BSWA 4TKVB 1EGVB 2B1JA 3GMSA 4JEMA 1DO0A 1OLXB 5BOSA 1ZITA 4JI8B 1A2QA 4XPIB 4ZDKA 3WQSB 4HVAA 1R6DA 4FBLA 3DV0B 5JLJA 2QJFA 4YDRA 1VSQA 1ZCAA 2AVDA 3EPJA 4N54A 4K9KA 1YB2A 2FPPA 3RPEA 2NSJA 2XHZA 3U19A 3GFBA 1ZK0A 5CH3A 3A6KA 1CS0B 1JEJA 4EY7A 4RHYA 5T6BA 3G2OA 1EFCA 1GKYA 1R0BA 3I6YA 4QOHA 5THQA 3ZWDA 4YA6A 1NONA 1ZKMA 2CN1A 4TMYA 1FYDA 3IHLA 1CUYA 1WNFA 3OZCA 4DSZA 5ABPA 1CEEA 1KWGA 1KZ1A 2JIPA 4X1IA 2FPGB 3CUKA 2X14A 4L6AA 4E31A 2YJZA 2ZB2A 1G6KA 1PUIA 4AF7A 2AG5A 5AVOA 4ZI3A 4FNOA 4OL0A 1H0RA 4XJXA 3SICE 1OX5A 2G4VA 2I8AA 3W5BA 3GCWA 3O95A 4ITVA 3JQBC 1FPQA 4R83A 4KNYA 4ZCLA 4GPEA 3IBYA 1O6GA 4RE5A 1ISMA 3OZRA 4RZSA 3IIEA 1Z0IA 1V6CA 2VG8A 3D9QX 4JP5A 1RZ3A 3GRFA 2BF4A 1N3YA 2O0MA 4V2UA 3SFTA 1UM8A 3WJ2A 3M81A 5IBPA 4BNDA 4KUHA 2PUWA 1AM4D 4NH4A 4EJFA 2GR9A 4CG0A 3THWA 5A3JA 1L2TA 1CQXA 2A30A 3ZUGA 1DX9A 3BFKA 5A7HA 5LD2C 4AS2A 2ZXUA 1KZ6A 1W87A 3AVUA 1YRWA 3TF5A 4Y6GB 3FMGA 3I0MA 2A57A 3RCBA 3FXAA 5ADUS 1EFKA 2ZIWB 2AMLA 1AHNA 1VLZA 3OIYA 4GOND 1P9NA 1Q6YA 1M54A 4JQCA 5I7HA 4R8MA 2XCRB 1AS3A 2HMWA 3ITEA 2CYAA 1VPEA 4JJKA 3QPVA 4MIKA 2QSJA 5JSYA 2IZ6A 4F92B 2HJ9A 1T9GS 1MDFA 3ZWWA 2JD2A 2QD5A 3DW3X 4K05A 2ZXFA 5ICMA 5JFOA 3W4KA 4EB6B 4GI3A 3T9DA 4CJXA 3ST7A 1DAHA 1KFEB 1P60A 3PFWO 3QKWA 4KI0A 4KDRA 4PPNA 4Q7EA 5FUVA 1BDBA 3TW4A 1BEEA 2OKGA 2FPOA 5M3BA 1XA4A 1FLVA 1ZW6A 3N2GA 2V6FA 3HA3A 1WSAA 3BDIA 3OIFA 1IWBB 3G85A 3G17A 1GU7A 4O2BB 5AJVB 3CX8A 4YHBA 1QS0A 2POQX 4IEFB 2IXFA 3O26A 1P5JA 4JYCA 3X2SA 4AUEA 4Y6OA 2Q6TA 3FHLA 2P8SA 4BVGA 2UYQA 4MCHA 2FPSA 4TV9B 4LBWA 4J2TA 2G88A 3L8GA 1E61A 1G20B 2CZGA 2RMKA 1RLTA 2X40A 1EJBA 3LV8A 4HVTA 1UOQA 2G70A 1DG1G 2OK7A 2PU5A 1A4UA 2Y77A 3BD6A 4PQEA 5JADA 1J39A 4GM4A 1U04A 4RPLA 2XYQA 2XEXA 2FR0A 3LUDA 3HHPA 3TSAA 4RO0A 2CMGA 2C4NA 2W6ID 3DLTA 4IGKA 4IHKA 4RMIA 3T35A 4RQBA 2W0MA 3RSFA 1LA2A 3EJ6A 5G1PA 3SEQA 1YI8A 4HN4B 1PR1A 1HK7A 3OD1A 4BX2A 5KPDA 1EFAA 4UHDA 4MAAA 5HBRA 1QU3A 3KPYA 4AZTA 4TL9A 1Q0SA 2K5UA 1POWA 3B12A 4JUBA 2GBFA 4EZBA 2HI0A 3SE7A 4CM1A 3AP2A 2ZWVA 3GRRA 4P3NA 5CX4A 1J99A 3GFQA 3JZAA 3PJGA 3R5KA 1BTOA 3AILA 4L73A 1NI3A 3EW7A 1V48A 4IJ6A 3SJ7A 2NXNA 2LIPA 3S2SA 1W34A 4HWRA 4HV4A 4GEKA 5GV7A 3P9NA 3ZEIA 1EGMB 3ODGA 4XIYA 2EQ5A 2Z1DA 5LOVB 4L5CA 4LMBA 1Z5WA 2O1XA 3QV2A 4BNDB 4R40A 4KYTA 2YWEA 1PE0A 4PPQA 5ED4A 2PUFA 1YGPA 3IV9A 5DLEA 3T12A 3H2GA 3TEMA 2W2PA 2OZKA 4BNIA 4PZAA 1QOZA 3T5PA 3L6UA 3BICA 3SJUA 4FOTA 1PR6A 4LC0A 4PTLA 4N18A 5A1JA 2PBZA 5HKLA 4AROA 1C4XA 2SNIE 4YJDA 1WV0A 3E1GA 1JFRA 1LLFA 2IQIA 1QTNA 3K6JA 4L8WB 3RU7A 5L7YA 3WWCA 1GXSB 1UUFA 2P2NA 1L4YA 3OEWA 1U3VA 1I1NA 1NYTA 3VSAA 4Q19A 4CMAA 2QTCA 4ZVLA 2FJ0A 4JDUA 2ODWA 1X80A 3EZFA 3FKSD 4B3FX 3HKDA 3P0FA 3NONA 1VG9B 1B1AA 3BIOA 3K5WA 4P2BA 1JILA 4DREA 3FETA 3ESBA 3H9JA 5FH9A 1NBMD 2R97A 2Z43A 4D4GA 2IV3A 2UKDA 4DRYA 3CW2A 2IU6A 4B45A 3SEFA 2YRFA 4CTMA 4MYTA 3DBLB 5DP2A 3NUGA 1D6NA 1GZ6A 3ED5A 1WQ1R 3HU1A 3JVUA 1M6VB 4K2HA 4NBRA 3ZTYA 2NV6A 2ES4A 4RWEA 3V8VA 1QDEA 3EZXA 3SK0A 4QYSA 5L95A 3DVAA 3GJXC 3F6YA 3LWNA 4BB9A 1QUFA 4Q12A 2HK8A 4Q05A 4DPLA 4NJMA 4NAHA 1TAHA 1ECGA 1EG2A 3L82B 4R69A 2PJDA 3ZG6A 1A50B 1JDNA 4PG6A 1TO1E 5KX5B 3WMRA 3R41A 2YXDA 4B47A 3WGOA 3BCRA 1TUIA 3L9XA 2Z5FA 2G04A 4I9UA 3TW8B 5K7SA 1VKJA 4PPFA 3ZZNA 3GGSA 1W2HA 1IXZA 3F7OA 3PUXA 1Y7LA 1S1CA 3LZ6A 1PLLA 4GR9A 2OCLA 4DZTA 4JH0A 4MVCA 2BGNA 2ZT6A 2JFZA 4BO6A 4OXKA 5A4JA 2UUAB 3M4ZA 2UUCB 2L19A 2GO7A 1YASA 2AMYA 2QRPA 1UQTA 4NENB 1DRWA 5JS8A 2IHUA 4EF4A 4FVTA 2VI5A 1E0KA 1GZDA 4MIEA 4RMHA 1J2RA 2XECA 3LCCA 4F7WA 4TS9A 2JJ2D 1IJEA 2F00A 4IGAA 1IZZA 2B4AA 2C59A 2PBFA 2V8OA 4M8IA 1FU7A 4MQ4A 4ND4A 1SCNE 4Q02A 4DS3A 2GWRA 1BMTA 3EVZA 4O2LA 3BJEA 2QRJA 4G5YA 4H6VA 4OP1A 1GPJA 2OXRA 4M88A 5FBQB 4IHAA 4IR7A 2QS9A 4KKVA 4D2IA 1STOA 1JZTA 2H48A 2JIMA 2VHCA 3ESCA 4DRXA 3LKBA 5JBQA 1PJ3A 3WWOA 4R6WA 1LZLA 2QQGA 4EG7A 2COEA 3RAEC 5E6UB 1TCVA 3PHIA 3WVNA 2Q6IA 3AQ4A 3DMTA 1O1YA 3D59A 5HKKD 4XFJA 1DCTA 1YTUA 3BGWA 4QUHA 1HSZA 4NCXA 1NVGA 3TZBA 4BRSA 1XZEA 2XKJE 3C7DB 3J7TA 3ECAA 1KIFA 4Q4LA 5TEWA 1EAMA 3UG6A 1S2GA 3B7PA 2N75A 1RD4A 5D5QA 3HXOA 1ZD1A 1GUBA 5LU9A 3R09A 5JCJD 2E4XA 3C3XA 3E3LA 2H4ZA 4RK7A 4ZT3A 5F5NA 2R8OA 4LA4A 2WWVD 3PI6A 1SVSA 1II0A 5C7LO 3NYIA 2J7PA 3GP5A 3OHMA 5KYTA 3KHUA 3GMDA 1E9RA 3UCEA 5G4KA 5TRTA 4B3TB 3RS8A 1VSTA 4OM8A 4D46A 1SUFA 1VM6A 4QX6A 1T1IA 5ER9A 1A7AA 1JKJA 1EM8B 1H65A 2IOHA 3WK7A 4B2PA 4PFSA 3KV1A 4TT8A 1LC0A 3SVZA 1PNVA 3AUJB 3A2NA 3I4FA 5LZ2A 1RWQA 2XZDA 2AEEA 2F3SA 1Q57A 1E99A 1QFYA 1QMPA 4CKWA 1YK0A 2ZRQA 4X97A 4CEHB 3NHWA 4TRRA 5KOHB 4XJSA 3MCUA 3UJBA 3R0ZA 1V8BA 2OO5C 4YRIA 3R9WA 3S8YA 3B1ZA 1KYWA 1RKVA 2AG8A 4P54A 4CKBB 2VCEA 4LYFA 2OCBA 2KBFA 5T4FA 1DVRA 3K0CC 4XAQA 3A7EA 5I45A 1GV1A 2WFZA 3L43A 2ZXEA 5A71A 1I30A 3UH1A 1PN3A 2QX9A 1PT5A 3EIWA 4XQCA 1AC5A 4LV5B 1TB4A 5CTJA 2F1RA 2HQ1A 3WKCA 3AM5A 1XA3A 2JGDB 3EH2A 3CG4A 3QLVA 3VHXB 1JL3A 2J6HA 1XKTA 2KHZA 3CT6A 3EZLA 2WYIA 2WD9A 3AJDA 3FWKA 4P0TA 2X9VA 1VE3A 3NOXA 2PIDA 4XVRA 4IJMA 2HL6A 4DRXB 2GK4A 2TMGA 4DSAA 2H4JA 4IL5A 3TSYA 1GR0A 4EARA 4M1KA 3GRKA 4MPRA 5E6UA 3GLQA 4I1OA 2RHBA 3R7AA 2CLOB 2PZJA 3O8QB 3GQBA 1SD5A 3PTLA 4RACA 2PFGA 4F7DA 4WN9B 4HLNA 1VPVA 4FGSA 3R7NA 5JAPA 1VRVA 1LBHA 4PV7A 1Q1ZA 3BAFA 2WTXA 2VPPA 1FFGA 2YRXA 3ZGNA 4B3GA 1FNCA 4BP9A 3KC2A 4YN3A 5FFNA 4R7TA 4F72A 2O7NA 4FK8A 2YWXA 4Q7QA 4GO1A 5CFZA 5HKBA 2BGWA 4K8RB 1A98A 1AKEA 1FP7A 4JBIA 5M7EA 2O7SA 5EMKA 3IP1A 3AJ8A 1C0EA 3UXHA 2VHXA 1O5TA 2RHGB 2ZZNA 1P1CA 4NLLA 3AERA 3DHNA 2AUNA 5T5QA 3USZA 1IVSA 2BMFA 2IIBA 3OHSX 5EE1A 4E2YA 3ZY2A 1F4PA 1TKRA 4HQLA 4DCJA 4HDNB 4D0RA 5IASA 4Z2AA 2DQYA 3LK6A 3A9RA 1ND5A 2L17A 3NW9A 2OYRA 4F5YA 2D74A 3G79A 4MZXA 5JCPA 1GNQA 4FDVA 3DOIA 4N8EA 1BDIA 2J4FA 2VWPA 2B6NA 2J7KA 5AXBA 2PLAA 4CYMA 4LFCB 2PGDA 5C32A 5FFFA 5K3AA 1QV7A 3EB9A 4IJUA 3UGTA 4AG5A 1J49A 3I6BA 3U5TA 1G3QA 3KDSE 3KXPA 2VJNA 4Z53A 1S01A 2UDPA 5FOXA 5IWCA 4FYMA 3VJLA 3P2KA 1IDOA 5B4UA 3ICWA 5C7OO 1R2QA 4QSHA 2PCLA 4Y2SA 3T5DA 1M2WA 2YASA 2P2GA 1GGMA 3AESA 3HNOA 3KR9A 2XBUA 5LOVF 3TE6A 5CD1A 4BTLA 4YMVA 5JI2E 1XQ6A 4WUVA 5DDIP 2GKGA 2Y1DA 4KQ9A 4BRZA 5C35A 1YL7A 3P9PA 3P96A 5BWCA 2FPWA 2P1ZA 2WYWA 4JP2A 4P3YA 1Z13A 2A59A 1HTWA 4DIEA 3I3OA 4P93A 4PG7A 3VNUA 1Q7BA 4Q3BA 5B1DA 2F7SA 1SUSA 3CX4A 621PA 1PJRA 1QCDA 2ANBA 3AZOA 4PVCA 1ZN7A 5CGZA 3UPDA 3JQPA 1RAIA 2A9OA 3B7WA 1FRNA 1ZM2A 3A11A 4PHGA 5AJXA 2C7QA 3LT1A 2V97A 1ZMOA 2HLDA 4BO9A 1FYXA 3Q2KA 2NXJA 1R50A 5HEKA 2IDZA 2PS0A 5DW3A 4G4JA 4WESB 5DWDA 7MDHA 2PLFA 2BUAA 1J0BA 1M8GA 3CS3A 4LECA 4LRYA 3EQ6A 2QQ0A 4RNDB 3FTPA 4BU1A 2IXTA 1QVAA 1GU1A 4RD1A 4EKIA 5AH0A 4CIXA 2ONJA 1I01A 1XZBA 3GEIA 3CB4A 2ZETA 1H3EA 4CFSA 4JX8A 4HX2A 3PHHA 3Q3CA 5CLFA 5HSGA 3UJ8A 4DT1A 4MWDA 4UDYX 4J1QA 4L4SA 4IS2A 1GR1A 1C30A 2FV8A 3DWEX 4FDTA 3WA7A 5CPBA 4U02A 4JN6B 2ZUEA 3D6NB 3O9ZA 4V0RA 1NXPA 1US8B 2E4VA 3KFLA 5JWOA 1G38A 1X1DA 1XD8A 3C3KA 2QVZX 2ZE7A 4TZTA 1ZS9A 3D8UA 4DLLA 3TGPA 1RXVA 3RI3A 1EWVA 2YUTA 3ILSA 1BXRA 3H13A 4OKNA 4YPOA 3ZWVA 1N8NA 2NAPA 2ZR0A 3RUEA 5K4AA 2G08A 2DR0A 2EX4A 1MQAA 1G2QA 2P9TA 4J29A 1ZVQA 5AW0A 3WGQA 3E2PA 2GILA 3MJFA 5CAEA 2V65A 5FI3A 4DPKA 5H5JA 3QVTA 1G5IA 3ORRA 1ULAA 1Y89A 1DQRA 5K8JB 4Y0VA 3NTOA 2XF2A 4J9UE 4PAOA 4GWLA 4Y1RA 2R8XA 3DBHB 2J5XA 3T0GA 1A9YA 3ABZA 2BV3A 4J0GA 4LBZA 3T99A 3GG2A 4LZLA 3UJ3X 4F3TA 2QMOA 3H83A 4PWZA 5HFJA 4UNNA 4KACA 1O0BA 1SUEA 1V11A 5ILGA 1EPUA 3D02A 4EFNA 3KU4A 2RC5A 3TNJA 2KWIA 4XD2A 3FSRA 3I6ZA 1XAIA 3DKKA 4XZ3A 5CG2A 3PNLA 5ALMA 3ZY4A 3T7CA 4GGPA 3BSFA 3C6QA 5JJCA 3DOCA 2P5SA 3B48A 3K5PA 4KQCA 5K8UA 1C9DB 3LHDA 4RZ2A 3PFFA 3WK5A 3FNHA 3FLBA 2V7PA 3TRJA 4A5OA 3LM8A 5L7TA 4IIEA 1D09A 2JCGA 3MUEA 5HMLA 1VZ3A 1DJMA 3F90A 4QATA 2YMQA 5I4CA 2JD0A 2LCQA 1MXHA 4RFSB 1QVVA 4E5UA 3BGVA 4M0LA 1AO0A 3LLCA 3OUUA 4E32A 2QG4A 4Z9AA 4X95A 4PX3A 4W4TA 4D4LA 2GZ2A 1FTNA 1O6FA 1TT7A 2CJXA 2VZEA 3BXZA 4DQVA 5KVSA 4KRFA 1FMLA 5FLKA 3VPCA 1YMVA 2FA9A 1NXOA 3D2LA 4ND1A 5F1PA 5JJBA 1UAAA 4D8UA 4B85A 1CF4A 3NBFA 4B82A 5JDCC 2RGYA 2CD9A 4R1MA 1TVKA 2VK1A 3ETDA 3NG1A 4U3JA 1RKQA 4UM9B 2EJWA 2UXDB 2WA2A 4U00A 5LFAA 1PL7A 3N2ZB 2BEWB 2PRJA 4INZA 4M83A 3I28A 3EX7C 1L7XA 1XTBA 3FRHA 3KLOA 1GSAA 3QX9A 3U0BA 2C1XA 2ISCA 2B2NA 2D2EA 2P4QA 1RABA 3LD9A 5JNWA 1GQSA 3NGXA 4PFQA 4XM1A 4YYZA 5KWSA 1Q7TA 3ESQA 1ZX1A 4J7XA 4RD0A 2CCGA 4FNMA 5BSTA 4K9DA 4ZVSA 3QLVC 2MYTA 5IABA 1K4KA 1LV7A 2WDZA 3DPIA 2WZQA 4OO3A 2PZLA 4YQEA 2QZSA 2AJTA 1J1UA 1ZI8A 1L4FA 1H1DA 1QKJA 1YS7A 3KTFA 4M0KA 4HDSA 4KCGA 5UKDA 3P0IA 1MQ9A 1P17A 3AUUA 4WSOA 2J5BA 1I7LA 3LVFO 5NLLA 4GKJB 4Q24A 2BMJA 4Q01A 4NXMB 2YICA 1QHHA 1I4EB 1T26A 3PQ4A 1CR6A 2D7CA 3VC1A 1WB5A 4DDKA 5BSKA 4AY4A 4DLYA 1QPZA 3SGLA 3THXA 4Q6BA 2DKNA 3KKKA 1QHXA 3OZFA 4DSUA 3O3CA 3KQWA 1U2QA 3DOHA 4QARA 4GSLA 1C7JA 2XH8A 3RYIB 1O97D 4CHTA 3G2PA 1JPNA 1Y3CE 2R6R1 4K3VA 4Y1FA 4HFMA 4ILEA 1V1RB 1BO6A 1V4BA 4EJSA 1GT6A 1IM5A 2VYQA 4O2RA 1HE4A 2YKGA 4O5OA 5EN4A 1SBHA 1NC3A 4FT2A 4JOQA 2H8KA 4GMGA 4MUMA 1Z5PA 1CR1A 2IIVA 2VWGA 3DMFA 4RVGA 4TV8F 4D41A 5IZCA 2OE2A 2QTVB 4UZEA 2OHJA 3UMGA 3ZQ4A 4KAFA 3RASA 5HG0A 4K88A 4RKRA 3FZNA 3Q85A 1EVZA 4B17A 2OD9A 3HR7A 1W59A 4WKNA 4ZDJA 2A9JA 4D6PA 4LWQA 5ALVA 3IYLW 1CJBA 1IJKA 1H2EA 3NRJA 4LPSA 3UY4A 3H8WA 4KR0A 3AR9A 1FMTA 4P7FA 5U9CA 4ICIA 4NFHA 3EFHA 3EG9A 4Q3LA 2WEKA 4FS8A 1NSYA 4X45A 2NO6A 4FDMA 1P8AA 4KWEA 1OLUA 2V9CA 4XWOA 3OF5A 4F06A 4TUYA 4G24A 1KI9A 1SU7A 1WIWA 4QEDA 4IIHA 4QJ3A 5FDFA 1MO4A 4XWWA 4JLUA 1OT5A 2FXVA 2B4QA 5I4BA 4Q4AB 1K3FA 4FXOA 5I5EA 4JWKA 5THXA 3VSDA 2HWXA 3DCIA 4J2OA 1LTKA 4XSHA 4FP9A 2X5XA 3F5QA 3LSTA 1TCAA 3VPDA 2P7IA 3MYYA 2Q4DA 1DX4A 5JD4A 2XCLA 1HYQA 1XOIA 2C42A 2OPBA 3PNMA 4CBVA 4KN5A 1H0KA 4D9IA 2I1QA 3N05A 2XGSA 4L9AA 4RGVA 3SIPA 1HT1E 5HE8A 5J23A 3BRWA 3DBOB 5HK8A 2X4DA 3DE3X 3F9RA 1GCGA 3D7SA 3RRJA 4HNUA 3O8CA 3RTCA 1HY3A 5FNZA 1DAOA 1NF3A 1V9CA 1ZH6A 2WHQA 3HWSA 2JIBA 4AU1A 3H99A 1AD2A 2SCUB 4AM8A 4G07A 1VL8A 5DRTA 1QRDA 5L6LB 9ATCA 2H1CA 3E7FA 3DTVD 2B35A 3UHPA 1I1HA 4ARIA 3ZI7A 3OCUA 5TJ9A 5BQXA 1Q3TA 1R9GA 3EGCA 1LDNA 3GGCA 4M7RA 1ZUNB 4IQ8A 1PZHA 1JU4A 2VDWB 3SZMA 5KYUA 5CG1A 4PCUA 4E08A 3LCUA 2JF0A 2C2ZA 3IPAA 2QWXA 5K0ZA 4CEJA 1XIVA 5FEUA 5JLAA 4ER5A 3F73A 1EVJA 2ECPA 2VH5R 1DO2A 3WV5A 4D8XA 1Z38A 2B5WA 1E79A 1A96A 1GNSA 3W4IA 3HQ4O 2WHRA 4HNAA 2DSNA 5C52B 2QZPA 3GC6A 4JUAA 1UWVA 3YASA 1TEVA 1S9HA 3FJ1A 3TRKA 3PPWA 2AS0A 5HTKA 3R9KA 4IOMA 5BN3A 2EERA 2VAMA 5I01A 3DPUA 2FZGA 2ZIGA 2I4LA 3TOVA 4NSNA 3R3WA 4E5PA 2RHTA 2ZBDA 2WF6A 2DSTA 3OFSA 1D07A 2I7CA 4HTAA 3SBDA 1XVTA 1Q2XA 3OAAD 4O59O 3QJYA 1MB4A 2O3TA 2EYQA 2PAAA 5B7QA 5HP4A 3IPRA 4A2CA 1AUVA 2VHUA 4O29A 3OFVA 3AG5A 1OVGA 3V55A 1RRCA 3A1VA 3PUWA 3HFGA 5AR1A 2QNRA 1RWMA 4GG1A 4JOBA 2BJVA 5LJIA 3HJGA 4DB2A 3LLSA 4KI7A 1Z83A 1HF3A 5IUJC 5DX8A 3ABRB 4EMTA 3EMDA 2WHEA 1NR7A 1IH8A 4R3WA 3VNVA 1T2NA 2K7FA 5TMEA 3HC7A 4Y9RA 1E3SA 3Q1KA 1SVWA 1XWFA 3KUDA 3MLBA 3R74A 1QANA 3INRA 4ADSG 1KSHA 1VYVA 1B26A 1LVGA 2YUIA 3DL0A 1R6AA 1MC4A 1UEIA 2ZI4A 4GLLA 3U3DA 3KOXA 3W1WA 2ZRLA 3BUSA 4BLWA 3KFVA 1V5IA 4HQRA 3ZVLA 1HGXA 2Q2OA 4M89A 1N3IA 4D9CA 4DTCA 3PC8C 4HG2A 4ZYLA 3M5WA 4BLVA 2ZJ7A 1Y3BE 1NVEA 2BMDA 1Y6FA 3PITA 1JFSA 2RHWA 1NW9B 1BVHA 1CS0A 5G0VA 5IBQA 2FFHA 1C0IA 4RA9B 5REQA 2P9HA 2CB0A 2ZJ1A 2WA1A 3T1QA 1U94A 1X0XA 2FB9A 2OBBA 2XIJA 2EW2A 2ZSKA 3GW8A 2VDOB 3A1UA 2V3CC 1NQWA 3GJSA 4IVRA 5AI9A 1SHJA 2J46A 4I4CA 2NTVA 4IJQA 4MWSA 2E6UX 5C8YB 4CEJB 3G9ZA 4B87A 3NKVA 4I81A 2P4UA 1KMQA 1KARA 2CDAA 1GQRA 2FETA 2OYSA 4XLTA 5DHQA 2NNLD 3FOZA 1VQ1A 5ALOA 5C46F 5F35A 4YHHB 2ZVPX 5LDHA 3LDHA 4OAOA 2HU2A 4ZQBA 4NCAA 3SXJA 1C3OB 3NVKI 2V7TA 3S81A 4CCAA 1WKVA 5FI1B 3QU2A 4FB5A 4HVLA 3ABQB 2IY7A 1LCIA 2BEUB 4BUZA 2HJGA 4NK5A 3M1YA 5BQ3A 1M1NA 1PW7A 3MT8A 4JIMA 5KNCA 3BQMB 1U4SA 2V0NA 3VYSB 5JCOA 4YJ2B 1EGQA 4DLWA 1NVDA 3GG9A 4ZDWA 4HADA 5EGNA 2GEFA 3B70A 4G0OA 3SKVA 1J23A 2ODEA 3O84A 3EG5A 1U4OA 3GDFA 4AJOA 1USWA 4MI3A 4C7KA 2P35A 2B1IA 2PXXA 3H5OA 5IBRA 2KX7A 3V4VB 3WSTA 1KTIA 3X0DA 2SBTA 3IUBA 4TN5A 1M5UA 1G7CA 1L5RA 1T9BA 1HRDA 1TTQB 1V16A 1XD2B 2EFEB 2WWIA 2H5LA 3AW8A 1YR7A 3PSHA 4NS4A 1J56A 1YQQA 4MLPA 3R0VA 3ZXSA 2I4OA 3K9WA 1WG8A 2OFFA 4HDQB 4BWGA 4D92A 5EZQA 1ACMA 1JU9A 2P40A 2D1SA 3ANYB 1TA4A 3CNOA 3D1VA 4GAEA 4HEQA 4S35A 1UBCA 3WDLA 4BXOB 4INOA 4CRWB 2VUSA 2OPHA 4ZHSA 2B7BA 1MABA 3CQ9A 3FCOA 1XVLA 1O4WA 1SCUB 3IULA 4KR2A 1GIAA 1FDTA 1IONA 1L4NA 5IVDA 2O52A 1N33B 1RRPA 2CXRA 1Q91A 4IX1A 1QC5B 3VBCA 2OKCA 1CZRA 3EUFA 3LF1A 5AHWA 4M9QA 2GQ0A 4CN9A 3M3HA 2FVYA 1KBQA 1JAIA 1IY8A 3KE9A 5HUQA 2FMXA 3GHYA 3ANTA 3HVKA 3PFHA 1IATA 4UD6A 4A6EA 3ZV4A 3ZW8A 5DTEA 2DLNA 1II9A 1Y3FE 2JAQA 2UV8A 4EP1A 5JRDS 3ZHTA 5JY1A 4MMZB 1JQEA 1QGUB 4KR9A 1O9HA 4XDZA 3WFIA 1F1JA 2ZYDA 1WZEA 4IDAA 4M21A 4RDHA 3P71T 4IJWA 2FP4B 4Y2TA 1I14A 1UEXC 3QF4B 4KN6A 3VV2A 1UP7A 1RSZA 3ORSA 5I9SA 2C29D 3I39X 1GQ2A 2GNAA 3FKQA 3KEQA 4UDNA 5AI4A 3FPHA 5BORA 2VK2A 1R9JA 1O6ZA 1KFBB 2R6HA 4LOAA 1USVA 3ZJYA 1KTVA 1E77A 2V4MA 4LRTB 3WG9A 3PGJA 4B79A 4YAIA 2YVAA 5LMNB 4OQNA 1N0VC 2PD4A 3IIMA 4G8CA 3SYTA 3Q41A 4JBGA 3RH0A 3JQ8B 2A78A 4ZYXA 1V0JA 1M1ZA 1EFVA 1RBZA 3VFDA 4BQOA 1N9KA 1YHYA 1BKDR 3HXKA 1YIOA 3LP6A 3LSYA 3N74A 3P4YA 4IDOA 1U2TA 2B4YA 3JRWA 4H08A 4K26A 2C1EA 5SZKB 1ULBA 2ZBRA 3K8QA 3LI2A 5CA1B 4U9UA 2RKWA 3RHTA 2P11A 3ETHA 5LZ4A 3BKWA 3HWX1 3C2QA 3DAFA 4LF5B 2FK8A 2QOEA 4MICA 4JBNA 2LUOA 4WI1A 4OHMA 4DSNA 1S0UA 1OPRA 4MYCA 4OVKA 4IXWA 2OGWA 2YJNA 3DV0A 5JAIA 3HSKA 5EOVA 2JFQA 2ZE5A 1REQA 1DKLA 2YXBA 4EKEA 1JMKC 1ONBA 1XEWX 4INPA 3IQFA 4H3SA 1I1OA 2XNSA 3DD5A 1P9LA 5AHOA 1Z7GA 4G1CA 3EZ9A 1W94A 2NVUA 4JR2A 4KN9S 4Y1EA 1JH9A 1AOXA 2ECKA 2YZGA 3EFBA 1ZAYA 5CCBA 1VTKA 2QDXA 2QLMA 3HKDB 1M2JA 2BWJA 5JQGB 5GM2A 2VJBA 5EINA 4L76A 3K0AA 1GZVA 1Y6QA 2TS1A 4MK4A 3SHTA 3PNBA 3NT4A 2OAGA 2FWIA 2X7JA 4P0PB 3QNUA 2QMEA 2EP7A 2EF0A 2XNDA 1NTRA 1FW8A 5EGSA 2GN2A 3E48A 4QFCA 4G5HA 1TAQA 5JO0A 3DMNA 3GLTA 1QVWA 2H92A 5KZMB 4P4NA 2W8BB 4NPCA 4HXYA 3QFRA 5EE9A 2WWHA 4RTJA 4PZEA 3ZWKA 1U9JA 4IRUB 2W98A 3DFMA 1NL3A 5KAPA 4EVIA 6Q21A 2QZJA 3F5FA 3ENWA 1GAJA 3UJNA 1VCMA 4HP8A 1RHQA 3AR8A 3GYBA 3NC1C 4EYKA 5LVAA 4LDJA 3LOPA 1DLJA 5F2OA 2JLAA 2PY6A 3DOOA 3N0VA 1FJHA 4KQWA 1L4EA 2FSSA 3TW8A 3PYLA 2Z2JA 3HU2A 5DBEX 4NBWA 1O94A 1ZL0A 3WMGA 4G1FA 4FIDA 5MHTA 3EISA 3MCWA 3GLFB 4S2EA 2WICA 4D44A 2VF4X 4O4HB 3ZU6A 4ABYA 1EFVB 1U9IA 1X7GA 2A0YA 4YCLA 3HP7A 5DMXA 3FUCA 3PNPA 4WJKB 2OXTA 1XCPA 1Z68A 1CUAA 1KVSA 2QAIA 2QMQA 1G0OA 1T3GA 1SD1A 3N7AA 3DTVA 2FEOA 1QRAA 3FBTA 4RKWA 3MGAA 3LCMA 4O2AB 3EXFA 4ZVNA 4C89A 1J07A 1T4MA 5I7FA 5E1BA 3RQIA 4LXYA 4TXMA 5T57A 3AL0C 4P5PA 3RJZA 4JB8A 4FNGA 1CS4C 1QG6A 2ZB4A 3QVXA 3ZQKA 4EPVA 1YJ8A 5F1YA 2DETA 3WRYA 1YDMA 2EWWA 5JJLA 4DR7B 1E6UA 4X84A 2D4HA 2CJYA 1PK9A 2PKRA 5BRNA 3AYZB 3KL4A 3USCS 3U81A 4I08A 1E79D 3G5MA 3TZKA 4C4PA 2H18A 2HLPA 2LPMA 4NBTA 3GLGB 2JGMA 1EK1A 3OZTA 1QK3A 1FNSA 1VZ2A 1DIRA 3OF2A 5SICE 2CVQA 4D0NA 2WILA 1GTG1 1M2EA 2B7CA 1IDN1 1YZHA 2JFNA 1KGSA 2PZBA 2V55B 1NLZA 3Q1LA 1MCZA 1T3SA 2GN4A 1VIDA 2VF5X 4NDAA 4TVBA 5EWMB 4BVKA 2J8ZA 4L0MA 2BFNA 2BGGA 3N2EA 3NTQA 4RTQA 1MVLA 4L8LA 2PT9A 1QHGA 1WZ2A 4PX2A 1QDLB 3D43A 4LGMA 3OAAA 1LTQA 2OT3B 4DC1A 4YR9A 3GV0A 3ECCA 3T5BA 3BERA 1T1JA 1X77A 3O8NA 3SQLA 1KO4A 2YOGA 4WK6A 4HAOA 3MMSA 5E6SA 1DC8A 4JXXA 1K68A 2DY1A 2I67A 5C5EA 4QRHA 5AI5A 4O5AA 2XB8A 4EGCB 4HLQB 5IKOA 1R6TA 1MH1A 3UB3A 5CA0F 3RROA 3R8CA 1N2OA 2WKPA 1A4XA 1OYWA 1FF9A 4UMVA 1ZMRA 1ZIOA 3C48A 3HCDA 5H0IA 3TR6A 3URMA 2QI9C 3CKYA 1EA7A 2ZI5A 4IQGA 3QMMA 4FWBA 3R7LA 4N0QA 821PA 4KQ2A 1NWHA 9GPBA 3RYCA 1HDGO 1YQEA 4FYWA 5AKHA 2GEKA 3TGWA 3WADA 1A3CA 3HJUA 4IH4A 2QL6A 1UR5A 4YYEA 4EVQA 1CLEA 1JVNA 4QGHA 1XVIA 2RHLA 1RZVA 3IAHA 2WUWE 2TYSB 2WYOA 3KTDA 1T1SA 3L92A 3M49A 3OEYA 4MGYR 4QYMA 4AS3A 2N3ZA 1YRLA 1X7WB 4MWGA 4MMYB 3P9CA 1U0NA 3NEAA 1DKUA 4QUJA 3FBGA 4MW7A 5KOHA 4O1HA 4E09A 4IYRA 1PR5A 4EWLA 3WOHA 2CY0A 1PQWA 5ES4B 4ZOLF 3DTVB 4YROA 3JQBA 2H31A 3KOWA 3PBKA 2WK1A 1UPBA 3AOEC 1XDZA 4XH9B 3TR5A 4XOIA 1HH4A 3H0KA 3LX6A 3ZLBA 4R9UC 1DKRA 4UE6A 5KNBD 1CZNA 1XMPA 5IJ9A 4N48A 4D9KA 1B6RA 4YEDA 1JEAA 1YQ9A 4L2IA 1B8VA 3GL9A 2J3JA 2QTGA 2A1IA 4GVXA 3IRUA 3RU3A 3CF4A 2O8CA 1A9PA 3T3MB 4BFTA 2IEAA 1X1TA 1YI1A 5E3HA 4PC7A 3CZAA 4E2XA 3AINA 4ATNA 3PEYA 1JWLA 4F21A 2C82A 2GF9A 2PNFA 5P21A 3GQBB 1TQ4A 2RI1A 4RS4A 5DGXA 2FMIA 2VDPB 2CLCX 2YIDA 2ZSHA 4X71A 4FGJA 1TYCA 1AKRA 3K2BA 4CI9A 5DBIA 2X9QA 2MTBA 2W2KB 3KELA 4REOA 1QFXA 1ZESA 5BSHA 5F7ZA 3ZXIA 1M7HA 1O5IA 2JL1A 2OBMA 4ETWA 2GRJA 5ADVA 1IMOA 1GRVA 5AVUA 1NT2A 4LFAB 3VC3A 4QTXA 1IHDA 2WPDD 2XUIA 3LQFA 1W4CA 3QE3A 2ERYA 2R6ZA 4O3FA 1UKZA 3ZIUA 2G1AA 3F7TA 4M60A 3CSSA 2QNBA 5FEMA 5CDHA 3F97A 2Z04A 4YRNA 4LZJA 4HEA1 4DG9A 1W9MA 5FAXA 5TS3A 1Z0ZA 1XL1A 4FFBA 5ERGB 3NZEA 3CVOA 3DGFC 5L3QB 4EW3A 5EKTA 5I9LA 3NBUA 4YCNA 2P8JA 1C4OA 4GX1A 2M98A 4JNKA 4MHOA 4OAPA 4BZQA 1ZNYA 2I3DA 2Y8EA 5KQRA 3ZJTA 1V2GA 3EIFA 2ZRKA 5ETJA 1RQ7A 4KRXA 3IQDB 1QORA 1BG6A 2QP4A 4IMJB 3ZX4A 1I5OA 3IQZA 1R15A 1YONA 3KSAC 1L7DA 1NQOA 3PXAA 3NUZA 5CFLA 2H63A 3ZHBA 2JIZA 3E1SA 3IS3A 3OM9A 2AC7A 5FL3A 5A5FA 2AHRA 2MJLA 5BMVF 3RUPA 2RGNA 2J45A 3MJTA 2R8RA 5DJ5A 4HQ0A 3T7KA 4B44A 4TLEA 3AESB 1ZD2P 1JALA 4UPDA 5EMMA 5I51A 1X87A 2HO4A 2I2WA 2JASA 4ITRC 3C3PA 1V95A 1UM9B 2HJRA 2R6FA 4HWKA 4BQIA 1ORTA 5JAOA 4DYHA 1NATA 1YIDA 4C06A 4LY6A 4AJ2A 5KTMA 2C61A 4NCNA 4TTIA 1XXLA 1THGA 5FNVB 4DR4B 2GFQA 1CETA 3QYPA 2R6JA 4OYYA 4KWIA 3H2SA 1V2HE 3VO8A 2IS6A 4BMXA 2EZ9A 2ZS7A 5E1MA 1CJTC 5AKZA 3VHQA 4Q3DA 2AXNA 1Z0SA 2RBGA 4LVNA 1XDGA 5H4HA 3NO4A 4EHKA 2EFYA 4RDCA 4F5DA 1BKYA 1WXGA 3AEXA 2XAUA 5ELXA 4WESA 2J9RA 3LX8A 1F3LA 2A9QA 4RY2A 3V1LA 4E21A 4ZAGA 1RJWA 1E66A 1Y5IA 1VGRA 2W2KA 2ONYA 2XYPA 5AOCA 4CKEA 4AX8A 4YXWA 3SX4A 4TGLA 4MP3A 4B4DA 1U0GA 3DOFA 1M3SA 2P2SA 4NF2A 1ACJA 2OAQ1 4OHVA 4PFKA 5ELMA 1KQGA 1H94A 2O8EB 5IKEA 4H0FA 2YJ3A 4RSMA 4KAAA 1Q15A 1WWKA 3NBMA 2OMEA 2HCRA 2ZWPA 4G1BA 5A4AA 1U8TA 2Q9UA 3BXPA 3UNXA 5HZHA 1GHTA 5IHPA 1Z6GA 4UEWA 1WF6A 3EASA 4C87A 1PEDA 2WD8A 4OGGA 3NVMB 3I45A 4GVLA 1GTSA 4MI1A 3EAGA 4CKCA 1TMYA 3KJZA 5KTRA 5TMBA 5DVZA 2JVJA 1EZZA 2GZHA 1Z45A 2ZUDA 4XGQA 4Y6SA 2IXGA 1G8HA 2C4VA 2Q0HA 1KHTA 3IOBA 3RVKA 3UYLA 2QYOA 2Z56A 3L6BA 4JJ8A 2AG1A 4LY9A 2X2FA 3SWWA 5D3MA 4C5AA 1KI4A 2YVUA 1B4DA 2IEYA 2WR8A 4AIRA 4U6QA 2E2WA 4DUYB 2HPHA 3D6FA 2YHSA 1CV2A 2C7VA 3AIOA 2HFKA 3OT1A 2CVFA 4ZAXA 4F4CA 2Q3EA 2P6OA 3UKOA 2VR1A 4P82A 1LD3A 1G55A 3EARA 4IZHA 2GN9A 1FTGA 1XRJA 3JQ9A 2NVOA 3FFXA 4EPYA 4RKFA 3GFOA 2AX4A 2Z57A 1YVRA 4MIOA 1ISSA 1Z5NA 4TTRA 4WEQA 2OV6A 1Z37A 4DKXA 4YUYA 2PX0A 3BMCB 2CJWB 1YFLA 4YQYA 5B1YA 4MEAA 1YOVB 2HK9A 4M8NE 4N4AA 4LGCA 4A0SA 1GKUB 1TW2A 1VG0B 1PUJA 2KYRA 4B0PA 4BKQA 5JSUA 2C88A 2HRCA 1E4VA 3FRIA 1JNYA <