4BN4A

Structure of human sirt3 in complex with adp-ribose
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
272
structure length
272
Chain Sequence
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Human Sirtuin 3 Complexes with Adp-Ribose and with Carba-Nad+ and Srt1720: Binding Details and Inhibition Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 87
structure length 272
sequence length 272
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bn4A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bn4A01
5BWLA 2H2IA 3ZGVA 4JT8A 1YBHA 1U31A 3F6EX 4GM4A 4JUFA 4ZP1A 2Q29A 5EJ8A 1Q1AA 3EA4A 1UPBA 2B4YA 4RMJA 1N0HA 2JI9A 4JUBA 2H2DA 4L3OA 5D7NA 2Q28A 1PVDA 3CLUD 3CLSD 2H59A 5EJAA 2VK4A 3CLRD 1PNQA 1YTLA 2JI6A 1YC2A 2AG1A 5K6RA 4L2IA 3U31A 4UTNA 1PT9A 2QQFA 2FSVC 1XLTC 4X3OA 2Q5QA 1PI3A 2VBIA 1YHYA 5MFZA 1J8FA 4QQ8A 4I5IA 1U2DC 2Q5LA 2VBGA 4UTZA 4J16C 4MPJA 4KGDA 4K9NA 1MA3A 4Y6OA 2FN3A 2EZ8A 4ZZIA 1SZDA 1M2GA 1HZZC 4UU7A 4UUBA 4Q9DA 2VBFA 1UPAA 3JR3A 2AG0A 2NXWA 3FSJX 2VJYA 4RJIA 5EJ4A 4MPRA 1S7GA 3JWPA 4C7BA 2PGNA 1SZCA 5DGDA 3GLTA 1V5EA 1JSCA 4O8ZA 4RMGA 1Y9DA 2OO5C 3EY9A 4GM0A 2H4HA 2H4JA 2PGOA 4JUCA 1S5PA 1DJLA 1Z8NA 3D4BA 4RJJA 4BVFA 4COKA 4TWJA 2EZUA 1UPCA 4F56A 4V1CB 2BRUC 2EZTA 3D7KA 3HWX1 5MGNA 1EFVA 1Q14A 4JU9A 1ICIA 3RIYA 1E3TA 2A1TR 4RJKA 5BWOA 2FR8C 5K2OA 1M2KA 4UTXA 4Y6QA 1ZPDA 3CLTD 5EJ7A 5EJ9A 4X3PA 5FYQA 1PTJC 3F6BX 4K9PA 3U3DA 1U28C 2VK8A 3HWWA 3ZG6A 4FVTA 4UU8A 2JLCA 3FZNA 2H2GA 3D81A 4MPPA 2JI8A 5EJMA 4C78A 1YHZA 1PYDA 3CF4G 2JLAA 1BFDA 5EJ6A 2NYRA 4V1CI 2PANA 1Q17A 2IHUA 4K9QA 5DGTA 1YC5A 2OD7A 4RMIA 1YI0A 4D5GA 4UTVA 1OVMA 1OZHA 4JUDX 2H2FA 4TWIA 1QPBA 1Q6ZA 4BUZA 3RIGA 4BVHA 4IAOA 1EFPA 3E9YA 4K9KA 1M2NA 1M2HA 4HD8A 4J1TC 4JD5A 4IF6A 5FEMA 3IAFA 3PKJA 4MQ5A 2C31A 4Y6LA 1O97D 4FZ3A 2UZ1B 1T9CA 4G1CA 4HDAA 2WVAA 2H4FA 4JT9A 2OORC 2VK1A 4KXQA 1V5FA 2A1UA 2Q27A 3GLUA 3FLMA 4JUAA 2W93A 2Q5JA 4QELA 1D4OA 5DEIA 2V3WA 1O96B 4QPZA 2UZ1A 2IHVA 4JU8A 5K6TA 4BVEA 3GLRA 4KPUA 4BVGA 3PDHA 4F4UA 1PO7A 3ZGOA 4JSRA 4UUAA 4V1CA 3IAEA 4K9MA 2OD2A 4BVBA 4BV2A 1NM5C 1POWA 3K35A 4K9OA 5IMSA 2Q5OA 2WVGA 4FEEA 4GG1A 2OD9A 2H2HA 1OZFA 2QQGA 2FRDC 1M2JA 4BV3A 4K9LA 2JI7A 4GM1A 1T9DA 4BN4A 1YNOA 4RMHA 2X7JA 4GPEA 4BN5A 5MF6A 2FWNA 3GLSA 2WVHA 1T9AA 1U2GC 3LQ1A 4UTRA 5BWNA 1OZGA 3EYAA 4FEGA 2HJHA 5AHKA 4D5EA 5MFPA 1POXA 2EZ9A 2JIBA 3OE1A 2EZ4A 2DJIA 1T9BA 1PNOA 4MZXA 4IG9A 4R8MA 1MCZA 5EJ5A 1YI1A 4GP9A 1V5GA 2IHTA 3PKIA 5K3SA
chains in the Genus database with same CATH superfamily
2Q1WA 3R7BA 3WZLA 2V0GA 1VG0B 4G0WA 1SOMA 1U94A 2FMTA 2IXDA 1DADA 2FPGA 3P27A 4MS3B 4RESA 2SCUA 1SKUA 2AKYA 2GWRA 3CWQA 3V32A 4ZICA 1IK4A 3H5NA 2W2LD 3ZWWA 5KVVA 1HV8A 3AHIA 1UMBB 3IBTA 4PANA 1W2WB 2RCNA 3KWFA 3JRWA 2IX9A 3ACCA 2XF2A 1BJKA 5G4LA 2WWTA 4ZVPA 4JL8A 1D2NA 2I6FA 3I42A 2PO7A 2FCAA 2QL5A 1GIAA 5C34B 3S2FA 2XJ9A 4TKLA 4AUNA 2OHOA 2VUTA 1H4SA 4UU7A 2X8JB 3COVA 1T3HA 1CWUA 1G5HA 1OAOA 1Y8AA 3OJWA 3OVMA 4AECA 1GADO 1VCHA 2PH3A 3A2MA 4LRXA 3WWYA 4BWGA 2OV2A 3B8HA 1ULUA 2RGDA 5CH5A 4CEHA 3THXB 2WINI 5HF5A 5JNRA 1C0LA 3WV4A 1LNQA 4QZVA 4LECA 2I67A 1SQGA 1Y7TA 2H3HA 1AS0A 3K5HA 3KCNA 4EW1A 1RZRD 3VU3A 1ETUA 4Z9AA 5HS4A 1QG4A 2J4CA 1OR8A 1N7HA 2WSSA 4GX1A 4DCMA 2RAFA 2VPIA 2XRFA 1QVZA 4DR3B 3MBKA 1VG1A 1N1MA 4GI2A 3MJHA 4KHPB 5FTNA 1LFAA 1UXHA 2PKWA 2OHFA 3ZHBA 4AS1A 1Y1PA 4TQAA 1S2MA 4AWXA 5ADUS 1V95A 3C7CB 3C8HA 3MMXA 4G07A 1T35A 4URHA 3U3XA 1RZUA 4KR0A 4WBNF 5JIBA 2X2FA 1GZUA 3L4BA 3I3SR 1OROA 3EASA 3ORSA 1NP7A 3PNVA 3ZQKA 1WXGA 2V3VA 3OG9A 3K53A 3ACBA 3ROZA 3IX7A 4NEQA 5AKEA 5DLYA 1OJLA 4GMGA 5FNVA 5ADWA 1P44A 5DHSA 2DH6A 3QENA 4N18A 4ILEA 4CDMA 4DC1A 3RDPA 3HQ4O 1D04A 1JA0A 3OKPA 4WCDA 4FW9A 4QDOA 5BY2A 1IEVA 4YDSA 1HETA 2B1JA 4OH1A 2GZRA 1LZLA 1JMVA 1W44A 1L5SA 5IDWA 4Q15A 1A8SA 1R6AA 2C1EA 2BFFB 1CUBA 3AF3A 3NJ8A 3RLIA 2AXNA 2YDYA 1FFXA 4RTPA 1DBWA 1R6TA 4KRGA 1E8DA 4C9BA 4G0ZA 1NJSA 1AK2A 2FHSA 4G2NA 3ZWCA 3IT3A 1K4KA 4LRWA 1BKYA 1NBME 3FWHA 4MVJA 5I7SA 3T3PB 2TSYB 3LQKA 3PK0A 4AJ9A 1A8HA 1BDIA 4ZD6A 4UCQA 1IBRA 3TLEA 1W5FA 3AVYA 1H2EA 3RC7A 3FF4A 3PQ5A 4PBSA 4H6XA 4W63A 1JALA 1TW3A 6ABPA 4O5OA 1LJLA 3RYIA 1LTQA 2R47A 1A2QA 1TCVA 1JTEA 3Q3HA 1D2EA 2QROA 3M6XA 4LBYA 3S27A 3VSCA 5DN6D 3UWMA 4BQNA 1HLGA 1VIMA 1GLGA 1XRSB 3ETLA 3ILSA 5AKLA 5SYAA 1TKCA 4L28A 5TF4A 3SXPA 1MMFB 3T54A 3IVCA 3KPWA 4LNUB 2XDQB 2QT9A 2YL2A 1E2LA 3ROGA 3CSDA 3SS9X 1RYYA 4EHLA 1N0HA 3CKMA 3WXMA 4XDYA 1HE8B 3AUYA 4PLWA 4QEDA 2QM0A 4F9GA 2FEAA 1DWQA 2BGTA 1DQZA 2QVCA 2GO7A 3DMTC 3E4CA 3KP1A 4MCHA 3T4UA 3TQSA 2NNWB 4CQMD 2PYZA 4H08A 1Y5LA 5E4TA 1JSRA 4NESA 4EOGA 2BDUA 1Y1KE 2BBTA 2B4KA 2Q99A 3PVSA 1Z4KA 5C31A 1FEZA 1I4OA 3PVZA 4BZPA 3AB3A 4IHJF 2NU9A 4G4SP 4HS4A 3SCZA 4B44A 5CVEA 1I3OA 3QHQA 1VMIA 3LOQA 1Q3KA 2A9JA 4Q9DA 2NUAA 5EGNA 3GPLA 1GPMA 1D2CA 3G2QA 5IANA 3KLOA 2VPQA 3RHZA 1AKQA 1Y4AE 5BR8B 4G0QA 1SUWA 4DA8A 1QQ6A 1FSGA 2Y1DA 1NBEA 3D59A 2IODA 3PKZA 4I2VA 3UPUA 1TUIA 4O2LA 2O2CA 5AW7A 5I4BA 3FY4A 2QRZA 3GLHE 3QKRB 2IPXA 3A9RA 4WKCA 2AQKA 2X3YA 3VISA 1ZGJA 1KDTA 4Y1EA 3WI7A 1DBQA 1U90A 2D2FA 2EKDA 1G3MA 2GEUA 2R8YA 1YB5A 1OX4B 2VT7A 3G9TA 4LI0A 5H9WA 1YMQA 4FT2A 4YUYA 5IVPA 1YCDA 3QSYA 1ISHA 1NDQA 1ZRSA 2IKQA 3CZRA 3FPJA 1DTSA 5FUYA 1SCNE 2W2OA 3IV7A 5ARDA 3IMFA 2JGDA 4X24A 3W9YA 5JSYA 2IYWA 3SLKA 4MIOA 4TWIA 2CBGA 3LYUA 4Q48A 1NW7A 3RC8A 2J85A 3I23A 4PWYA 1MIOA 1NBOA 4BO2A 3LHDA 2C96A 2JFZA 5HM8A 3WWEA 2HR1A 2ZRBA 4UUNA 3I32A 4QOHA 5J2TA 1J1UA 3IAFA 3SQLA 1A9ZA 4BDSA 5EWJA 3UOWA 3BKWA 3GY0A 5FWXA 4B3JA 3RUHA 1G6HA 3H5WA 3QV1A 3TQRA 4I0WB 2QTAA 3MCZA 1T36A 4X5OA 4NMWA 3A7DA 1ML4A 4Q4AB 5K3BA 3U7IA 5I7VA 3IAS1 2VDMB 5KWEA 3LVBA 1LI5A 1UKZA 1T6ZA 2HPHA 2EF1A 4PG6A 2Q5HA 1NPDA 4EDHA 1UMDB 3H65A 3VOAA 1X8XA 1J9ZA 1GVNB 4KO4S 1RYDA 2P35A 1TM3E 2HA5A 1T9KA 4LCEA 2RGXA 1Y8ZA 1UPXA 4BTLA 4QFBA 2AYYA 1IY8A 1FS6A 3AR2A 3QVJA 4A0RA 2GHRA 5JFOA 3F0TA 1QH1A 3DWFA 2ZW9A 2BBOA 3EEFA 3IQEA 3KKNA 4Z9XA 4AROA 5KYWB 2O7SA 2MSWA 2W6MA 3Q5DA 4KG7A 2D3WA 2G9RA 5L7TA 2B4RO 4R8VA 3QMVA 4XE5A 2P3OA 3KFLA 4UFPA 5JSZB 1OMOA 1PGNA 1OV6A 2P0EA 1RXWA 4OLBA 4NBRA 4NJMB 2BFEA 1QTIA 3FGPA 4OQXA 2JGJA 4NZYA 1G18A 3RSSA 5K45A 3OWOA 2RGEA 3OPQA 5IAKA 1VDZA 3SC6A 2P6PA 4MVJE 1SJ9A 4MGYR 1YBHA 4BE7B 4HLUC 4MW9A 4I19A 1J0CA 1AGNA 1YVDA 2WWGA 2AH5A 4FINA 4IWXA 2I55A 5E2BA 3BSFA 4IXWA 2I29A 3D8HA 1N0IA 2EJBA 2FPMA 3B2QA 3ZQ4A 3T1YB 3VZSA 2VNHA 1MIHA 4XD7A 1DWUA 2JFVA 1KK1A 2A14A 4YN3A 5LZ8A 2P0AA 3MYRA 2PBLA 5DB4A 1HLDA 1OIVA 3OQIB 4M0CA 1L8OA 3VJLA 4R6WA 3JYQA 2CFTA 1Z0ZA 3PLAE 2NVBA 1T91A 3HS3A 5IABA 2V7TA 3INNA 5K0JA 1XA4A 2I91A 2FEKA 2ATCA 3FHJA 2P9HA 1U0SY 3GLFA 1JIXA 4KP7A 1G1AA 3KE9A 2GBGA 5DHQA 5GZ6A 1E1LA 4NCXA 4DSOA 1GYPA 3U44B 1Z73A 1TEZA 1FP2A 3S6JA 3BZUA 5AP9A 1R12A 4Z51A 4E70A 1USWA 3QXHA 1M6VA 3V2HA 2ZBPA 4R0MA 2XVXA 1MABB 3ZWXA 3H5RA 1JLMA 1X7ZB 2GBIA 3ZGZA 2FLVA 3TB6A 3IBYA 3HU1A 1XD8A 2GAFA 3ZDEA 4D8UA 1Y6QA 2UYOA 2CFSA 2Q4RA 5KYGA 4JGGA 1CTQA 4A0QA 1L7RA 2IXAA 6PFKA 2JLXA 1SKMA 3OOJA 5KTNA 3EIQA 3PFHA 3G0OA 3QV2A 4A82A 2BMVA 1TUBA 2ZSIA 4GOOD 1WDKA 3N7AA 4KUHA 5CXQA 2CLEB 5L9AA 4HRAA 5EIXA 5IYZA 2QN2A 3B2NA 3O8OB 1W6RA 4GOLD 2CHVA 4KQIA 1GFWA 4LUCA 3T7EA 2JFUA 2W6PA 4RW0A 3WLQA 4P2GA 5IVIA 4JOCA 1R3DA 3HJAA 4MB6A 4NFLA 2AV6A 3OQIA 5G02A 3GLHA 3SFZA 4HGQA 1I9GA 2H06A 2NZUG 1QHXA 3MGAA 3SHWA 3LRPA 1QHIA 1KMMA 4CKEB 2GBLA 2PH7A 1OA1A 3RTDA 5DHPA 1Y6JA 1WM1A 3FB1A 4CFYA 3TZBA 2V5VA 3KM0A 4EA6A 2WICA 3Q3CA 3R77A 3OKFA 1EUDB 4LISA 1MOZA 3OETA 4ND4A 1MC1A 4JK3A 2X8AA 1KYXA 1N3IA 1NUAA 2PM8A 1B23P 4C0HA 1KO4A 2OQ2A 2QGFA 2XUFA 4RZUA 1WMDA 2GQ0A 3M3PA 3HGTA 4TGLA 3EPLA 4HI0E 5EWLA 2I9KA 2IS6A 4EP1A 2FMUA 3SF8B 4GQBA 4E2YA 1FSPA 2Y76A 4PZEA 1U7ZA 2XB9A 5CM8B 4FKBA 4RX1A 4A2PA 1DBSA 4XGQA 4Z9FA 2JZOA 5D84A 3EODA 1S01A 4DCGA 3N0WA 1Y9JA 1XEXB 3RS7A 4CUJA 1KZ1A 1Y6ZA 2D54A 3FHCB 4M0DA 3B89A 1OZGA 4FT4A 4QRDA 3URKA 3VX3A 1KRWA 1CVIA 1C7FA 2M98A 2D3TA 4F84A 1E4VA 3P4UA 3IILA 3D31A 3AF0A 4WN9A 4IDFA 4FNAA 3C5VA 4TKVB 2XBMA 1R8JA 2VPPA 3DWIA 5FADA 1H8HD 2H1WA 5DCUA 3U7QB 1E2NA 1W0CA 3GFSA 1CUXA 1W76A 2XUKA 5KVCA 1RFLA 2CMHA 3E3NA 2BBSA 3I2HA 4UARA 4A6XA 2TECE 2VSXA 3VTAA 2GARA 1T15A 4J1SA 5J58A 3EULA 4IIBA 2O2DA 5I01A 1AE1A 3DYVA 3GUHA 1Z4OA 3Q7SA 1BKDR 4WXHA 4RK6A 4LOLA 3T12A 1JPVA 2O1SA 3VDXA 2CL7X 4G2TA 3SQNA 2Y99A 4TMFA 3QX8A 2Q3FA 3OPNA 1I3LA 4G1FA 6Q21A 2J0EA 1I1OA 1IHPA 4RIFA 4A4DA 1PWHA 1H69A 1QK4A 3SE0A 3TJZA 3UJBA 4IZOA 5JVDF 1ZCBA 1ZGZA 5KTKA 4FTWA 1UJ2A 2V7VA 4WSOA 3ZU3A 4CETA 5EFZA 5IULC 4UNPA 1RWWA 3V33A 1MAAA 2OBNA 4W1PA 1P33A 2Q8NA 2WAOA 4DIEA 4LXYA 1XCLA 1PFKA 4CG0A 1DEXA 5DF1A 2PJZA 2MR6A 1VJTA 1C0IA 4R2LA 3O2JA 2K4MA 4LDRA 3AFIA 3JCZA 4B3BA 3GGGA 1GGJA 2XVAA 3N8KA 2W22A 3O1JC 4YAKA 4LF6B 2VF5X 1X0VA 2BRUC 4AQ7A 2D2IA 4HDMA 5MGNA 1BVUA 3OFSA 3TXAA 3RUCA 3V8RA 2DHCA 3GT0A 3DULA 1OUMA 4OA8A 3IB6A 4XWYA 2R00A 4LZLA 3I0MA 2II6A 4RVFA 2A3RA 4DEYA 4ZRNA 5A4IS 3HSKA 4PC3A 2D59A 1XTRA 1Y8QB 1WHTB 5EMLA 4JASB 5DXJA 4CF7A 2YNMD 3IUQA 4DZRA 3C6QA 2QBYA 3L8EA 4PZDA 1SC4A 2C7OA 2QUKA 2V96A 3U1TA 1YRQA 4UZFA 1U0TA 1O5IA 2YJ3A 4BUZA 5DWVA 4X20A 2OV4A 3PHHA 4M36A 4ESHA 3WIBA 1T6YA 4OYRA 5BP7A 1AKTA 3C6MA 2WIKA 3EPPA 3LNCA 5CEEA 4HQLA 2YJTD 4IIJF 1RM5A 1SQSA 2HA7A 1J06A 2ZVQX 2P9TA 1HY3A 2QRUA 5ELMA 4YXWA 4EG4A 2H31A 3O4GA 5CURA 1NXVA 1QZ3A 4HG2A 3Q8KA 1XZPA 1IXYA 1GGMA 4RDHA 1ZM7A 2ZZKA 4RLSA 2CLKB 3BJEA 2QRVB 3GLRA 1E2GA 1I4LD 2WKRA 1JQBA 4M1OA 4Y1RB 4QU9A 1EI9A 2PFGA 2Q9UA 1KMHB 3C3XA 3I2GA 5TGTA 1XRLA 2G6BA 1J7KA 1MO2A 3FJYA 2ZYSA 4QUJA 3W2FA 3SHVA 4EJMA 2J7PA 4OJYA 1LTKA 1H23A 4WESA 4D9CA 2FPIB 3T41A 1RR6A 1U2GA 1JQKA 3GHYA 2I1QA 3PWSA 3QI7A 5LDGA 4F91B 5JCPA 5B12A 2PUBA 1GT6A 2YWJA 5MF6A 3KR0A 4CL3A 1T3GA 3AR6A 3WICA 4XIFA 5HGXA 3P20A 6REQB 2HF9A 4XGIA 3WLRA 4LYYA 3SE7A 1PNRA 3D64A 4UU0A 4B6EA 3UMCA 1Q21A 2Q2QA 1P1JA 1I6LA 2QVZX 3R3VA 4IV5A 2WVJA 5D3MB 4N7BA 2WY2D 4EFLA 4TZTA 4E0BA 5BRJA 2F7SA 3VMMA 5IXYA 2VDKB 3TL3A 4TZ6A 2PUJA 5DBIA 4ETMA 3O8CA 1L4MA 4DR1B 2C83A 4YJ3F 1P0PA 2WE7A 1HE1C 5FAKA 1J0BA 1V5WA 2FWAA 2PU5A 4FJ0A 5A5FA 1L4KA 1WXFA 2MR5A 3GJ0A 1LX7A 4XSGA 3HXOA 4OU5A 1HDZA 1U5AA 4WNCA 2JKZA 1GNPA 4WBXC 5JQGF 4LE1A 3TXXA 4P4NA 3JYPA 3H6KA 4RVGA 4CPDA 2MTBA 2EX4A 3H19A 5KC8A 1P6QA 2QZSA 1KEWA 2VPYA 4EL5A 1IBKB 2RIPA 1D2RA 4J9UE 5E4FA 2FCRA 3TZ6A 2L2QA 4G8CA 3KYDA 2XLBA 3ZV4A 4IH4A 4LVNA 2JF0A 1TTHA 2IDMA 4J16C 4BCCA 1PQWA 3TYXA 5AM4A 2OZVA 1S1CA 3SFVA 4FBGA 3MJVA 4F6RB 1AHIA 4DCUA 1W2GA 2W6NA 4J7UA 4E33A 1B3BA 1L5ZA 1YFZA 2WABA 4JIMA 2P1DA 2Q9BA 4PE5B 1GUAA 3ZY4A 1N57A 5ADVA 1JPJA 4BJ6A 4ZQBA 2WBLC 3QVVA 4IIUA 1E3EA 3UANA 2H4JA 1UDRA 4HWRA 1IOLA 4M2LA 4COKA 3WBFA 5E6SA 1SBZA 2RFLA 2O2ZA 1KPIA 2ZLBA 2ERCA 5LOVA 3KQHA 5AK0A 4XUGB 3RSLA 4PYRA 3Q8MA 1M0EA 1OWPA 1EQ2A 5LZ4A 2OVFA 1I2CA 3DEYX 2IK8A 1ZXBA 2EHDA 2ROQA 3I83A 3W3AA 1KBQA 2AFHE 4LOKA 1VLZA 1OLXA 3AM3A 4KIFA 1MQAA 1ZUWA 4C7JA 2FPRA 1P62B 2IEBA 3LA8A 3AONB 3OP1A 4ENUA 2V8BA 3TIXB 5KNDH 2Q5FA 5LPNA 5K2MA 1I7SB 3G1TA 4KVAA 4WK6A 3LUHA 1E92A 4JYCA 4KK3A 3SZUA 1P5FA 3H13A 4Y3UA 3KUKA 1M8JA 2V7UA 3DAYA 4MINA 4RQUA 4V0MA 4N8EA 1KEKA 4KN5A 3TQQA 4C3OB 3QXCA 1MEEA 1NOKA 4RD1A 5D1HA 4AJIA 4H0FA 3AP2A 1TMKA 4Y0NA 3CUWA 1TCAA 3ED1A 2H57A 4C43A 5JCZA 1R15A 5AHXA 3K0AA 4R9SA 3EPKA 3NANA 5EPEA 3SJ7A 3A6ZA 3E81A 3KZMA 1AQUA 4M9ZA 4Q05A 3ZHUA 2X5JO 3N0XA 5CAEA 1TLTA 3LOUA 2GLXA 4LS3A 1CPYA 4Q82A 2PLNA 3VNQA 2B4TO 3IAEA 3V1YA 1QJCA 2ZJ8A 1EGHA 3PFCA 1CVRA 1LCIA 3U4IA 2H1IA 1UMCB 1EMDA 1WMEA 4NV0A 2Y2UA 3FOAA 3IMGA 3VR6D 5K0ZA 2C2WA 2QD5A 4AURA 1E2QA 3BICA 3NV9A 4K88A 4AJKA 5AM5A 3DNPA 1HI9A 3WO1A 1YNOA 3UB4A 3ZXIA 2WHXA 3L0IB 4I1VA 1QRSA 4OSEA 1RMYA 4W5QA 2CY0A 1TO2E 2QXUA 3HR4A 1QGZA 4DRZA 5AD1A 1KQGA 3LUPA 3LSTA 5B58T 1FMJA 2BJHA 3M70A 4FOSA 3SOPA 3ZI4A 4ZKEA 1QONA 1DJNA 2Z98A 2NSYA 4K6GA 1T4DA 3T9DA 1V2HE 4N39A 1M2EA 1C9NA 2ZBDA 1ZOPA 2NXEA 2VDJA 1TM4E 3BJRA 1I7LA 3DLCA 4AWBA 1L5OA 3MG9A 1LSSA 2FQYA 3ZBUA 3ZGLA 4M3NA 5A0FA 1B8UA 1XNQB 2PVSA 1S89A 1PEDA 1P9LA 3IDOA 4ERXA 3AW9A 2WTXA 2PN1A 4HNRA 3ON5A 3Q6NA 3QW4B 4IYJA 4I1YA 3ZWOA 3B3GA 4U00A 4Z8XA 1NU6A 3DAOA 3NHAA 2GJAA 3N8NA 5CDGA 4MMYB 3BXGA 2ORWA 3S2IA 5KJFA 4EW3A 4TL6A 1YASA 2MHCA 3OIUA 3PPYA 3FGOA 2Q2OA 4MRMA 1G9SA 3FTQA 1LLCA 2HK7A 4UUBA 3G5MA 2RJOA 3STVA 1A2BA 3G2LA 4HAIA 2GYWA 1DRVA 2E9SA 2HU5A 2HRZA 2FZEA 3AB8A 2BAGA 4L73A 2P9GA 4IMJB 3MAGA 3L6BA 2PA0A 1XLTA 5AK4A 1C9MA 4U7JA 1PCXA 2ZB7A 2VHTA 4C4RA 1UJCA 1DBVO 2BEWB 2BFCB 3RIYA 1H5NA 5JT1A 5LFAA 3FE2A 4HRVA 3U7RA 1T5TA 5KVQA 1P0IA 3RVRA 2RGCA 1JKMA 4U2DA 4UTOA 3DZJA 3K6KA 3MUEA 2PA3A 3PNBA 1D1TA 2VKTA 1DC5A 3AHCA 3TCKA 4C4OA 4RC9A 1KQ3A 1U6JA 4HEJA 1P1FA 4YLYA 5KO2A 1NMXA 1U3UA 3MWYW 2Z4RA 2PBFA 1DBPA 4KE6A 4YMSA 3OOWA 3ADKA 3T3MB 3NHJA 1MO6A 5BORA 3IEUA 2D0DA 2AF3C 1M1XB 3DAHA 4EPTA 1DXYA 1DMSA 1L7BA 2QZ4A 2QTHA 3E9YA 2GEVA 3H6GA 1EPUA 3Q6IA 3WGGA 2FMIA 1FS4A 1U0NA 3TBHA 1Q3TA 4F93B 3RODA 5LXTB 5L3QA 1VCMA 3ZKAA 1AGRA 1WB4A 4EG3A 1GNVA 2WHQA 4JBGA 4HDQB 4TOIA 4I1PA 3R5FA 2AFIA 1U9IA 2UZ1B 4U2GA 4DADA 4JI5B 2IPMA 2OORC 5JI3E 4F9FA 4I1SA 3WYFA 2YWCA 2CT8A 2GEFA 1WSAA 3U1BA 5G0TA 4FYKA 4GH5A 4MKXA 2YV2A 2LDXA 3TD6A 3VNRA 5I51A 1JH9A 4OATA 5K0SA 3D4OA 1FDVA 4YMGA 2I6XA 4RIEA 1OWLA 1AXEA 1R9MA 2FEMA 2W2MA 3HMKA 4KXMA 5CFZA 3L2OB 1WS6A 2VSNA 2C8VA 4RANA 2P6UA 4MJXA 4Z7NB 1BYIA 1R2QA 1TM5E 4ZQGA 1R5OA 3HVHA 1GR0A 3PHJA 5E38A 4OQMA 3W5VA 1NQXA 2ZRIA 5JAIA 3PJRA 4EUKA 1C8KA 4TLDA 5AMXA 4IZ6A 1GPH1 2JCBA 3B1WA 1WZEA 3MELA 3OTIA 3HVRA 4DPLA 4B3GA 2CHEA 4QJBA 1IXKA 2EX0A 3D5QA 3LVQE 3PQFA 5BW4A 2C3OA 5JU6A 1AH2A 3QJGA 4NLLA 4MVJF 1AA9A 5F3DA 1D6MA 3AUKA 3MHTA 1I80A 2ACWA 3ZE6A 2UZ4A 2Z5VA 3HO6A 3UQYS 4ENWA 1B00A 1XX6A 3L1UA 1NVWQ 3TOZA 5KYUB 4GL2A 2EYQA 3VSBA 1KJNA 3QMPA 4MRRA 5JZMA 3K8QA 3GW8A 1BEZA 4UW9A 2Q7OE 2IYFA 4D8YA 5FWNA 2GK6A 5D7BA 4TTAA 2GEDA 2ZSUA 3S55A 4BLTA 5C8YA 2C7RA 4FEYA 3DWGA 5AM1A 4MUHA 1ZGGA 5JD3A 1SWVA 3PV0A 4L95C 5FFFA 5LMZA 1XU7A 3KCQA 3NATA 3ZLTA 3CT4A 1LBEA 1XLWA 1XVTA 4R2HA 3P4XA 1RHMA 3O8DA 4KAJA 5FA5A 5F5XA 3AINA 4FYPA 3DZBA 3IFSA 1E1NA 4I1OA 3JQ7B 3VOBA 1I6WA 3LGSA 2CUKA 2R62A 1V7QA 4TV8A 3FYCA 3W5HA 1KWKA 4RZ2A 2F9MA 4M83A 5ER6A 1E0KA 1JXOA 1K27A 1NYTA 1PUJA 2FW0A 3EK2A 3L0OA 4J16A 3T3DA 1SZCA 2DKFA 1Y9DA 2WWRA 5EXXA 4O8ZA 3V55A 3DVSX 1WHTA 4IS3A 5FTWA 1KI6A 2XCLA 4IV8A 4LJ7A 3V34A 4EHIA 1YGPA 3R40A 2WFZA 3BEDA 4RNCA 5LQMA 4P34A 1YBFA 1ZN7A 4X6YA 2Z43A 3UJCA 2ZROA 4FPXA 4DIOA 3QEBZ 1ZMRA 2F1JA 3DBVO 5D00A 2JH9A 3R23A 1D2GA 4C04A 2HA2A 4QUIA 3R8FA 2FG7C 3SX0A 3LE8A 4TL8A 1FP6A 2P2CA 4DVGA 1RKBA 3RRXA 3FKQA 1AK1A 1XJWA 2HV9A 1TT5A 4HO1X 1YZGA 4ZJPA 4M87A 4PHHA 3D02A 1FSSA 4JU8A 4EH1A 2IJGX 4KPUB 4OIMA 1KBZA 4OJMX 5TS2A 5LKRA 2PKQO 3OZAA 1MX3A 4FGWA 4G56A 3MOIA 4RZIA 5IJ9B 4DMGA 2RARA 4DT1B 1YRBA 5FRDA 5AJTA 1DKUA 1D8AA 3IIMA 4J9VA 3LQQA 1UFOA 1ZL0A 3N7UA 3O4VA 1RJWA 1P4GA 1QUFA 2QAGC 3HI6A 3PRKE 5BN3A 2I80A 2I2FA 3DZFA 3M6AA 2DFTA 2V3WA 3K1ZA 5LYJA 2WJ6A 1DEAA 2BSXA 2ZJ7A 3AEXA 3GD7A 4I9UA 4U63A 3AFOA 3MCUA 3W5CA 3V80A 3E7XA 4TTJA 2YKGA 1U02A 2BI4A 2DEUA 2PZBA 4UM5A 2AHOA 2HK8A 2I8AA 5HFJA 3B20A 2HGSA 3IURA 2P9FA 1KF0A 4J3JA 2X14A 2PX0A 3AJ8A 2GJ8A 4CN9A 2WAAA 2IPOA 5F9FA 4LE2A 5B6JA 1WZNA 1S7CA 2Y92A 2C92A 3EXFB 3TQFA 4BWYA 4U7WA 5AJVB 3BT7A 4IUYA 1IQPA 2UXCB 1FFCA 1NT4A 4BN4A 1T9DA 1E9BA 2CWDA 4X60A 3ET5A 4GECA 1WXIA 1RYMA 1Z6YA 2XWQA 3ASYA 1BU8A 1HUQA 2AYXA 2QR5A 3JWHA 3PCXA 2QTNA 4PVDA 5SY6A 1V37A 5IF3A 3DGFC 4BNWA 3C3WA 3K9BA 1PBNA 1QIFA 1LK5A 3I8OA 3QX7A 4MUFA 1NKSA 2ETXA 3RYHB 3U19A 4MWOA 1BH6A 1GG5A 1V2GA 3A2NA 4HB2A 4QFMA 4WCFB 2B1GA 3WP0A 4F12A 1XZHA 3P52A 1KYWA 5D85A 1L4YA 4NBNA 1MF7A 3MEQA 3FD8A 2AXEA 3GLKA 4TX1A 2RD2A 4TLMB 3D8RA 1VL1A 3KUUA 2Q28A 1X1DA 4F04A 5CA1F 2H59A 3CE6A 2H7YA 2UUOA 3L0PA 3ZJTA 3OUUA 4H59A 4ND6A 2O1EA 1X92A 3GFRA 4IR7A 4M9SA 1BHQ1 2W83A 1Q1GA 1W8DA 4DMCA 1XRJA 2CNLA 5CDUA 5TT1A 4ZVMA 1J0EA 5ITZA 2AX4A 1K98A 1OBCA 3K9FC 1T0JB 4MCIA 2PX3A 3I2KA 2FTKE 1RMQA 2REBA 3CH6A 2YW9A 4OLJA 4P3NA 5BQXA 1JPNA 3BHIA 2K2QB 2I22A 2AG6A 1VG9B 1F2UB 4R3WA 4X1OA 3V8EA 4EHHA 1FVFA 1ZJ6A 4Y2TA 3EWNA 3KSZO 4QPJC 3TWOA 1PKXA 2WUVA 1QDEA 2YTZA 2A0YA 4TVKA 1N34B 2DY0A 5MGBA 1WNTA 5IG2A 4ZCLA 3QWIA 4JI2B 1VOTA 1YVRA 4Q3BA 1OXTA 2F1OA 4J6EA 3TD2A 2FZKA 3UMJA 2C7VA 2ZETA 2GF0A 3WLOA 4RTLA 3ZY6A 1BIFA 2V59A 3O84A 4FGKA 5KI6A 5EHXA 1HX7A 1UDXA 4FYJA 5I8PA 4GYKA 3ZIAD 4C7VA 1VL8A 3WJ1A 5JXIA 4DLLA 1LF5A 2IY7A 3FNIA 2B2XA 3PHLA 1R5BA 3DZCA 3O8NA 3Q1KA 5SZKB 4EB6B 5KSPA 1Q57A 4KXXA 4R7GA 5ALVA 1JDUA 2XX3A 3ZE7A 5BYBA 5KNLA 4JQOA 1EFUA 3UK7A 4UTVA 1M1YE 2BRUA 3AOEC 1MH9A 1T29A 2P9EA 2PRSA 3SC2A 5C80A 1JMKC 1GNSA 3RS4A 2RDMA 1UZLA 2AJ8A 1SAYA 4JJZA 3QEOA 1BS9A 4KPGA 4RQBA 3CJQA 3U13A 3O0DA 3OZIA 3QPVA 4GPBA 2WSIA 3MA0A 2QR2A 5LDHA 1CRQA 1E2HA 2GPSA 1NPTO 3KQLA 1AG9A 1FUIA 4FFWA 2WFAA 3GD5A 1J8MF 4Q7EA 1NZFA 2P30A 3GUUA 4H7DA 3DPUA 4YJ3B 5TJ9A 1FTGA 4JJ7A 5EMKA 1DO0A 1QH8A 2AZMA 1M2VA 1TPZA 3DP7A 1BJTA 4J4HA 2OG1A 3GFFA 4E3WA 3FPCA 1K75A 2GRAA 1QGUA 4H0CA 4JAVC 1DIAA 1K5DA 1LNZA 3EFOA 4EFDA 4I9HA 1LKZA 4FIZA 2R7KA 4K9SA 2A9OA 2E3JA 3FN4A 5KTPA 1K8YB 4PLPA 3ZW7A 1X87A 4M0UA 4ARCA 1R0LA 2G5CA 2HSWA 2FNAA 2R6R1 4GX2A 3M6FA 5JLAA 3NEJA 2ZDGA 3KPYA 3TO5A 1H0KA 3EVZA 3HFJA 1ABBA 5THXA 2WTBA 5TQVA 2QXYA 3HJNA 3K8ZA 4AQDA 4D5EA 5TGZA 1KJWA 1VRCA 5H4HA 4KYVA 1A72A 1ZZEA 4ZDIA 3LCUA 1L5RA 4YREA 1W4AA 1BX0A 1J4AA 2NVOA 2WYUA 3KG2A 3KZKA 1G38A 4D9HA 2W2QA 2V1UA 4J4TA 4BP1A 3D8SA 1FVXA 4KDRA 3GJXC 2BTQB 3F8SA 4MYSA 3BN3A 4JNCA 1AZTA 2C5FA 4KRYA 3SZGA 2QLBA 5DI9A 4YRMA 2WDZA 4FE3A 3B1FA 1SVWA 1H2YA 3RT9A 2G71A 3M1IA 3E7DA 1OC2A 2G0AA 2CJFA 2HQ1A 4ZALA 4AY6A 2WMNB 1PR9A 5C1IA 4YDHB 1E9RA 1EP2B 1N2GA 1N4AA 1CJKC 2N0SA 4QA9A 2AMJA 4ZVVA 4AN1A 3CSSA 2NVUB 4JJGA 3H5VA 1MJGA 3MUFA 1W85A 3FTEA 1ENPA 1KZ7B 2QLNA 1RNLA 4Y2QA 1EWTA 3QUAA 4AKSA 5L8VA 3Q9LA 1FIUA 3CUYA 1PLLA 4E2ZA 2W58A 4N5DA 4CXMA 3AVTA 1BMDA 4Y2GA 3VI3B 5HTOA 4CG3A 1DBRA 1D8TA 4WJZA 2W2KA 3OC6A 1DDGA 3OZRA 3IYLW 4RD2A 4G67A 4IDBA 4Z1OA 4R1QA 5KOJA 4R84A 3SJCA 4CIDA 2OOSA 1BHO1 1J24A 1LDMA 3TI9A 5CDFE 3CUSA 3VVCA 3C7DB 1T4MA 1VKHA 4JSTA 4V3CA 1Y6RA 3WLIA 4D98A 2YC4C 3FTDA 3GFVA 1JECA 4NDNE 1P81A 3GMTA 2XMQA 2Z1DA 3RSHA 3THRA 5FBVB 1K68A 1TCBA 1V1RA 2OZPA 4NBTA 3UWSA 1SU4A 1JSXA 1Q0QA 3CB4A 2VXBA 2POQX 3A6JA 4R1OA 1E79A 1RHJA 1Y1RA 3QYPA 3QFRA 1HG1A 3TQHA 4OSOA 4HAXA 4RTMA 2P0YA 2OXTA 1S9HA 5JWOA 1HA3A 4Q4HB 3A8TA 5BSUA 3A9SA 1HZZA 4U9UA 3WADA 2IYEA 3GBSA 1JFTA 4BNVA 1A96A 1BFDA 1C2TA 3DMFA 4P4TA 2NPIA 3AY0A 3RTEA 3WZ2A 2WJ3A 2DUMA 3L7CA 2FPLA 4E08A 2B82A 2WJPA 3ZWPA 4KIWA 7GPBA 4NXNB 1FFAA 1XTPA 3PQ4A 1R88A 2FZWA 4NEHB 4W9NA 2B5VA 4AZ0A 3A1NA 4NKRA 4H6VA 4TL7A 4YDQA 1L7AA 4ZXPA 4B7XA 4C5AA 4F11A 5L3SB 3L4JA 2BZSA 2JEOA 3K0CC 2FJ0A 5F7OA 3PENA 2X40A 4D56A 5KU1A 4GYJA 3NIBA 4J0JA 4QGAA 2AD5A 1TIPA 4LF7B 1WZUA 1RQLA 1GXSA 1KI1A 1XK6A 2WSSD 3CUEF 4JODA 3GRFA 4J2OA 4UUOA 1U63A 1KYZA 3DL2A 2HSJA 3B2EA 2Q5JA 3TINA 1GL3A 3S5UA 2JCGA 4O8CA 4AULA 3M83A 1WTAA 1BEEA 5E8JA 3WL4A 1H05A 3ONDA 2NV6A 3GP8A 5BXQC 2P41A 3MK31 1V45E 4FDMA 4F45A 3LI2A 4CV1A 1LW6E 5LNK1 2ZI6A 3SJAA 2QQGA 4G4GA 1V3VA 4HGYA 4Q9NA 3TW4A 2EWMA 2IEIA 4C4XA 2PZEA 4XVHA 3G2OA 3ITNA 4LBWA 2Q8PA 4MCAA 1AOXA 4QYTA 2ZB3A 4J07A 4CHGA 1BFUA 4WFKA 3CHYA 5C4GB 3ZNQA 1H2BA 3AXTA 5F51A 2VAWA 1TF2A 3EZ2A 3U48A 2SCUB 4AY2A 2EWWA 2XJ4A 1O5TA 3I1YA 4D9NA 5CA1B 3GFBA 3JD0A 3PZRA 1E3MA 4BO3A 1CJCA 3HKBA 2MSKA 1A69A 3ANTA 1M67A 4IDDA 4R8LA 3WL7A 4O2BF 5C46F 4B0OA 3QRWA 2JH8A 3ESDA 4PSUA 2B83A 1NR5A 3IKLA 4ZOEA 1LLDA 3I01M 4B1FA 1QFXA 2VYQA 5ANRB 3PDIA 3COJA 1ZIYA 3EF3A 3W1EA 5DM2A 2GF2A 2HZBA 3HUTA 4EGJA 1FUYB 2FR8A 2CK3A 1GPKA 1NV8A 3AIMA 1B7GO 2AOUA 1LS6A 3AUTA 3L0YA 1YKSA 4A0FA 4E09A 4NR0A 3NBYC 1TPYA 4HBZA 1I13A 3LT0A 4BYMA 4X54A 1GPNA 4AYXA 4N6NA 3N8DA 4OXXA 1VIYA 4OMFG 1MG0A 3EUAA 1YIOA 3GA5A 4NDAA 1EGVB 3G59A 1L3BA 2EZ8A 4TSKA 4BO6A 2GZ2A 2X23A 3AY6A 5HE8A 4BQFA 5IF9A 1BD3A 2WJYA 4CF3A 3J81k 5DHRA 1EFLA 2A0WA 2ZUFA 1EK1A 1MV5A 1N2IA 4UFOA 1S7GA 2CYCA 3BWEA 3IP9A 3WIOA 5LVAA 1IZ0A 5KYTA 4ZO9A 1EDOA 3P9YA 5DK6A 4M0MA 1V9LA 4Z53A 1IQRA 3EGXA 3ESRA 4BLWA 2FZLA 2B35A 4NHOA 3FRJA 4W82A 1DWPA 2UYQA 2WSYB 1ZX1A 2LTAA 3GEHA 4LSGA 3EY4A 3HCCA 3TTXA 2BP7A 2HBYA 4NPCA 1ZD4A 5GOZA 2JLBA 1OJ7A 2ZWVA 2QQEA 3H5IA 4EKDA 5B1EA 1R0RE 1MPTA 5EXSA 1QTRA 2VOEA 4EI7A 2JLCA 3U60B 2RHOA 5TMPA 1WUJS 1D2MA 2Z3VA 5D86A 4CM8A 1YZHA 2J3MA 4ZT6A 4B3TB 4AIRA 5BR4A 1BGXT 2EF0A 3RIMA 3IE1A 3CNQS 2RH5A 3PGLA 4G5RA 2J3EA 2JEZA 3DFIA 3EMKA 3QLVA 1K3UB 2VA9A 4KWIA 1WU8A 1ZCAA 2Z1MA 1M1NB 3NOVA 1KMCA 2O7QA 3TTTA 5FTLA 1QCYA 1Q6ZA 2BFFA 3WX0A 4BKMA 1JQLB 2ZRGA 3LUJA 3SSMA 1EM6A 1THGA 1EA7A 3WG9A 1C8LA 4YT4A 3R7FA 1M2NA 4EVSA 1ANKA 1TAUA 2AN4A 4TWRA 2PS1A 4L02A 1V71A 2VJQA 3L6EA 3L7AA 1O97D 2PTHA 3QE2A 1PL7A 3K0FB 1T2DA 3L5KA 3M1AA 1V16B 1G20E 1T13A 2I54A 4LIPD 2PMDA 3DLIA 1TZBA 3P0JA 1EB9A 3M6VA 3ZYCA 2XCTB 4AM8A 2FAXA 1THTA 1NFFA 5DEIA 3G5LA 4TYYA 4HB3A 1JU9A 2JLQA 3N2IA 3OD5A 3O1LA 4KJZA 5GADl 1N3BA 4E6EA 1JPUA 3S2GA 4MR7A 1Z2PX 1TYBE 3LDHA 5KYYA 3PIIA 1OZFA 1WE2A 2GOYA 3DMTA 1U0JA 3K1TA 2YHUA 1Q22A 2EG9A 3PJEA 3QMWA 2I8CA 5CP8A 3ZOZA 3KHUA 1CUZA 1U8CB 1D0IA 1PN3A 2GRUA 3NBXX 3ABIA 1BX1A 3N2ZB 4IH9A 4ZDWA 3W79A 2TMKA 4HLQB 1MZPA 3H97A 3ZGYA 4D43A 2W6JA 5I7UA 5JYDA 1GM5A 1II9A 1TK9A 4R51A 4LY3A 1ZD2P 3ORQA 4EEZA 2C84A 4UPVA 1JG3A 3N6XA 4YJ2F 5ALZA 3UO8B 3O74A 5JZSA 4HDRA 2M6SA 3GGDA 4FXPA 5KNCH 1NE7A 2Z4TA 3JU3A 3AHGA 3BDAA 1IHUA 4FQ8A 4RS4A 1W73A 3JQ9A 2CLSA 2IZ6A 1XHFA 1DQYA 1G5FA 2OGZA 2PZLA 2XYQA 5AJWA 4GSKA 4KMOA 3UMYA 5ALPA 1U1GA 1HNNA 4ND5A 5DLDA 3UHAA 3SQWA 3EXG2 2UVQA 4OOEA 5I9IA 1T5OA 4PN7A 4DMFA 1PGOA 4LJ9A 4EKEA 4I81A 3VKWA 4I4NA 1YR8A 3VX4A 4KFRA 5SYMA 5ALXA 4YXFA 1G7TA 5CXUA 2WWWA 3K0BA 3C6ZA 1TNDA 4QREA 3Q85A 2ODPA 5CYPA 1K6EA 1XLVA 4YTEA 1FJ2A 1A9XB 1ZLYA 2LRHA 3PRYA 1SOAA 3KOOA 2RONA 4P31A 3ZR4B 2GUGA 1WVMA 2HSDA 4Q4DA 4A7PA 2IIBA 4EKGA 5J59A 2KLHA 2W43A 3EUWA 1F4LA 2VDWB 3NNDA 4IGIA 4Q5IA 3JARB 4Q6BA 2I4MA 3VBEA 4DKXA 3W6OA 5ELLA 5FIUA 3HXMA 1NPYA 3K6JA 4ZEOA 2V9CA 5ALQA 2Z8YA 1DAMA 1EJBA 4JJ4A 1ZAKA 3WL3A 4F60A 2PMBA 1F2DA 2B9VA 2BGLA 4CKCA 4BVKA 5HTKA 1Y7HA 5E7JA 4U02A 3ZCTA 5F3WB 2ENWA 5A1TA 1OYWA 3SYMA 5L53A 1ULTA 1VMDA 2D4AA 1SGWA 2V0CA 2ZI9A 1CY2A 1NW9B 3LQYA 4HDNB 4QRIA 3SIWA 1QHNA 4HNAA 3FCUB 1QHGA 2OHXA 2UDPA 4BNHA 4ZYUA 4IVNA 5LUAA 1XD2B 5EWMB 5AQ1A 5I7OA 2AN3A 2JLAA 1KDPA 1E77A 1EFPB 5BW8A 1YDMA 1AM4D 5CFLA 1A98A 1HRKA 1M34A 1Q17A 3BSSA 2P2DA 3BTOA 3OX4A 4KFSA 4ZC1A 3UYLA 1VJ5A 1QCDA 3PRJA 4UC0A 3W6PA 4AJHA 1LNSA 1B0PA 5KWSA 2WRZA 2R8PA 4HZUB 1U2PA 1Y9AA 4B9EA 2V98A 1IUKA 3EXHC 4MMZB 3SSNA 3WQQA 4C0LA 4E30A 3FSEA 5JMWA 4BC1A 5JJIA 4J90A 5HJEA 2H2AA 3EFOB 5NLLA 1DGQA 3Q3EA 4HPXB 4TV9F 5EN4A 3GJ6A 4UUMA 1ADGA 2BTOA 4OX9B 4KV9A 5DHAA 1A2OA 1NWHA 2ABWA 2AW3A 5A3QA 5F2OA 4PLHA 3AQIA 2X4GA 4K9RA 4QELA 1B16A 4ROSA 1YR6A 3ND9A 4RCVA 3CPJB 3LTNC 2RGWA 1VI6A 2W2LA 2C3UA 1NRXA 3ZUGA 4YLGA 1ZUIA 1SWWA 2DX7A 2IE8A 2QVLA 3GJRA 4JQYA 2IXTA 2E49A 3FMPB 5CT6A 2AWNA 5T8KC 3Q0EA 1QF7A 4HLNA 4BX0A 1YACA 1J22A 2ZWIA 4OG2A 5LWQA 1RWBA 1NJ6A 1WDWB 3O2SB 4KN8A 3WSVA 4JQCA 5LU9A 1QS0A 2NU9B 4MWGA 2EKBA 5AI0A 1B0ZA 1PU2A 3AO0B 4MKHA 3HA3A 3U1VA 1UBNA 3CEHA 1QV7A 2R7NA 2PUDA 5DDIP 4DRXA 1WUHS 1ONNA 2GCEA 3WGUA 3IKMB 4XGRA 2I87A 3K6SA 4DABA 2FK7A 1BQEA 1V1JA 5E1MA 3C5WP 1PS0A 5DHTA 3IBGA 4WZAA 1C8BA 1O6FA 3ABSB 3C14C 2YMPA 5DU2A 2P2LA 1A5AB 5HIIA 3T7IA 2PUEA 1QMGA 2BCGY 4LXIA 4KR6A 4CF4A 4IO0A 3C3DA 4TVBA 3STWA 3U4CA 4D0LB 2GWHA 3F2IA 3FPGA 3KLMX 4MEBA 1N2XA 3E27A 4JUFA 4AO7A 3OTOB 3ZVKA 1R6XA 3H0CA 3DLPX 1KHHA 1UJBA 3GGJA 1LDYA 1P72A 3HB9A 1R18A 2G36A 4JUBA 1OFTA 3TQIA 3T7JA 2QRGA 1A8IA 3CURA 1LSOA 2C88A 1GTVA 3FAZA 2JKYA 5IPFA 4UJ3A 4JC5A 2XBLA 4NRDA 4PGFA 5A2QA 2X8WA 1CRWG 3DDZX 5HP4A 2DRIA 2FPOA 4B4OA 3WGIA 2J0VA 3NO4A 5C18A 5DM0A 1FFGA 5MN5A 1BS2A 5K01A 4CGYA 1EP9A 3CR3C 1UJ4A 3ITDA 2OLKA 4OHUA 1YS4A 3IKJA 1SK8A 3RV3A 1IK6A 1ESCA 2QMUA 3BXZA 3URMA 1V1RB 1X80A 4AMYA 3E3LA 1P1HA 4PZUA 2A88A 4Q7KA 2VZ8A 1NNI1 1TM7E 3DDWA 5CITA 5KOIA 4UBLA 5DX0A 1ACMA 2HHLA 5F35A 1P3Y1 2YW2A 3A2LA 3MJEA 3OT1A 4F97A 2Z2ZA 2LVBA 3C41J 2W5UA 3MGGA 2O2YA 3ZZ0A 1MRSA 5EZYA 1XSEA 4OHMA 3PNOA 1JJIA 3FYTA 3R41A 3RSQA 3SOZA 1NC3A 3VKFA 5KUTA 4CIXA 3NHPA 4ZZ3A 3GA0A 3U4QA 4DM4A 5HRCA 2JIQA 5DP2A 1TIKA 5J9FA 3IAM1 1EVEA 3WNQA 1HURA 5FWDA 1O94A 3V8BA 5CFQA 1XD9A 3DO8A 2AG5A 1DXHA 1PYGA 3ZWYA 4CI0B 5BUSA 1VPWA 1N5KA 1E7MA 3WLLA 3PR1A 4XRGA 3PJGA 4BNFA 3FCAA 3PDUA 4YC7A 1R8YA 4OB6A 1XRQA 1UC4B 5FEMA 1X70A 1EBBA 1QG0A 2BMWA 1P18A 2MYTA 3FUWA 4FC7A 4BMCA 1K5HA 1Z38A 5DBFA 4E13A 1OXXK 2IS1A 2QU7A 1G3QA 1NBAA 4NQZA 3G0IA 3GWGA 1XQ9A 4O63O 1JFVA 3BCRA 1Q1BA 2FWPA 2B30A 2ZE8A 3MVEA 4RVCA 3SX4A 4GZ5A 3UAGA 3WP1B 4TSFA 4KWCA 2O5CA 2FR1A 5KQPA 2ECKA 2QTGA 1EJ0A 3ANLA 4IOMA 5CCDA 1IMOA 2OV1A 2PUGA 4I14A 2PG3A 3DT8A 2Z8XA 1NLUA 3F5SA 3PDJA 1Z7BA 4XYEA 2R6JA 4YJ2B 5AVSA 2JJ1D 1S3GA 2OAP1 4BXOB 4GOND 3DLAA 4CQLA 2PJDA 2GETA 3IQFA 1C4XA 1V7CA 2EEPA 3OPYB 3SXUB 1RM0A 4E12A 4F5DA 1EXNA 1DDIA 4MVWA 4K28A 2ZRNA 1JQJC 2ZJYA 3DL7A 4WKBA 5EUBA 1RXYA 5FPTA 3TUIC 3UATA 3UKOA 4PSAA 1ACLA 2ZIZA 5IAJA 4IWNA 5TE9A 2GEKA 3UUWA 4FX5A 2OFXA 2CMGA 4WCVA 1E4EA 4V0NA 3SSAA 4IIJB 2PSSA 2WC1A 2OCPA 3R5SA 1NA5A 1UOOA 4EMBA 2ZT6A 3QVTA 4TL9A 4DLPA 4BP3A 2AJDA 3TNYA 2DFNA 3WNVA 2WWXA 3EEYA 4I1IA 1QZXA 1SCQA 2OQVA 3I4LA 3NOXA 5IJWA 3OIFA 1TUBB 2ZI5A 2BELA 3QBDA 4HGRA 1ML3A 4RFVA 4JBLA 2ZIGA 3PPIA 2HKIA 2OHGA 2Z6VA 2JGFA 5IBPA 4YRJA 3NMUF 3WSWA 4BLPA 3ET4A 2R2GA 3SYKA 3EC1A 1MVLA 3R0XA 2VN8A 5M7EA 2Q5LA 2HAEA 4L0CA 4R54A 4CQJA 1QGDA 4DF3A 4ZYZA 1K0UA 4XD7D 2IP4A 4M8KA 4ZYVA 1ODKA 4QXPA 3I0NA 3IMEA 1RHUA 2OSVA 4V0OA 2CK3D 1CD5A 2YJGA 4I5EA 1NVVR 1XCJA 1GTJ1 3AEYA 2XUGA 3RVPA 3F49S 4B76A 4EAQA 3ENVA 3T4EA 1ZHHA 3STXA 1U2RA 4B6QA 1YK1A 4J1TA 4N3GA 3UWPA 4BAGA 5CW1A 5DNDA 2HX1A 2NZ2A 4N01A 1QORA 4C08A 4OFZA 4HWKA 3AC0A 4RQTA 4J0EA 4ER7A 5KSZA 1C8VB 1Z5VA 3JQFC 5AOCA 4YXWD 2XDWA 3T61A 1HXHA 3TVTA 4DJAA 5CLFA 3F1LA 5BMVB 3DHNA 4PRZA 1A9TA 3PBKA 1JFRA 2VJOA 4JMPA 4BNLA 4EY5A 4DOMA 3CEAA 2EQAA 4IKOA 2AN5A 2HRBA 1YFKA 1T4CA 4ITRC 1U2DA 2C7QA 3F73A 1YRAA 3X1MA 3AFMA 2OFWA 2PUWA 2E5FA 2P4UA 4B6SA 1N5JA 2OWEA 3DHWC 3I73A 4JBHA 2QRVA 3NWPA 1FXWF 4Z7JA 3DLTA 2GZ1A 1Q6YA 3OZWA 4ECAA 2CFCA 1WY5A 3L04A 4PG5A 5JCJA 5K3FA 4UPEA 1YMVA 1ZG3A 1LVHA 1U2ZA 3UBMA 1SU7A 4N0DA 4IXMA 4X6LA 3WIDA 3F7MA 4JT9A 4US1R 5GINE 3C3MA 3CKKA 5FNVB 1Z7GA 1C7IA 4HMQA 1IN5A 1N8NA 1F4PA 3ZU6A 3CX3A 1BRMA 1NP6A 2EGGA 3WNDA 2HBRA 1I7PA 1V7PC 1JXAA 3RS3A 4IM7A 6REQA 3RO7A 1OYOA 2CBXA 2IIPA 3A3OA 4K9OA 3UENA 1QLJA 1P75A 2WF6A 5D3MA 3SEQA 4BEWA 2FV8A 2VNSA 1NDUA 3W2TA 1JGTA 1MC4A 3PDWA 4F92B 4UM9B 1VIDA 4MP8A 3ELBA 4K3UA 5JZ9A 1KK2A 4M1TA 1ZJJA 3HBJA 4QSMA 4H6PA 2OESA 4NENB 3VC2A 4EVIA 3AEQB 3FJOA 3NIWA 4FUTA 1F38A 1MB2A 1ENOA 2LBPA 2CMFA 4KLCA 4DN6A 3DYBA 4PICA 1V4NA 4EI9A 5FI1B 5B2FA 5EERA 1A7AA 3ROXA 3FRHA 1NHGA 5BNTA 4YBZA 5HCIA 3BC1A 2JA2A 4Z0HO 1ZVJA 2HA0A 1TEHA 3W2GA 3P97A 3L4BC 5H3CA 3L77A 1AQYA 3TE7A 4B74A 4MDYA 3C15C 4HDMB 4PTZA 1USGA 5C5CA 1LVGA 1BOFA 2VUSA 1GAEO 1F3OA 3FZQA 3JSXA 1ZH4A 3VNBA 2IH2A 3NGXA 5IC4A 3PX3A 2C9BA 3U0VA 4HQOA 4IGKA 1H3EA 2IT1A 5KINB 5EC8A 4L3OA 4C0SA 1HRDA 4JKYA 3IIKA 4I4LA 1YQQA 2H1LA 4X6UA 1KPGA 3QFSA 3FTCA 1ZGAA 1UXGA 2IYZA 3HB4X 5CHEA 3DFKA 4E5UA 5HUJA 3B1YA 4S35A 2O14A 4KGZA 4I5IA 3I28A 2HWYA 4MQLA 3GDGA 3KYCB 4UPDA 1VYTA 3G2KA 4FMCB 3P9KA 4NK5A 4QGBA 4D9IA 1ZRHA 2JZNA 5A4MS 1IN4A 2PXHA 3EQ7A 4PLYA 1KZHA 4WA8A 2CHUA 3BBLA 1PKEA 3PX7A 4UVGA 1ZR4A 4D57A 1KP9A 1TK2A 3H2GA 3ICPA 3F6SA 5BVGB 5JNSA 4G9EA 1WQ3A 3RK4A 1YB4A 3NOQA 4EY6A 1TRKA 1PFWA 2OCYC 2QG6A 8ABPA 3K71B 2VT6A 3KU4A 5JRDS 3F5MA 1CQZA 3E22A 4XM0A 3WYEA 4RIHA 5CRIA 2FSPA 5FA8A 2GAIA 1LBSA 1E2MA 3RYCB 2PMCA 4A2CA 3ZNPA 3WC4A 4MPPA 5JNLA 2IS4A 3INYA 4C78A 3MTAA 5EUQB 4N47A 5KNCD 3MYYA 5LZ2A 3VPXA 1IBLB 1XNJA 4DNFA 2OG2A 2B1IA 1AUPA 2JLRA 3EMDA 1ORDA 3Q8XB 2JJ2A 3GNTA 3QELB 5E1BA 2EQ5A 3Q72A 4S24A 4ZT2A 3VRHA 3WZMA 2FFJA 5HIAA 2PPLA 3PNKA 2PXAA 4WCFC 3FWZA 4XYBA 3VJKA 2IUYA 3O9MA 1RBYA 5IYZF 2O52A 4X7BA 5ESDA 4P08A 1X38A 3WISA 4YA6A 4NCAA 2ZRHA 2HHJA 1I0ZA 1J2UA 1ULBA 5EESA 5IFLA 2C2KA 1DJQA 2PWYA 2IYLD 4O2AB 3ER8A 3QWAA 3FBWA 3FWYA 3G17A 3CRMA 3HWRA 1MJHA 4JB2A 1A7KA 4BNUA 1DTEA 2M1ZA 4FXOA 2PGDA 3DUWA 4QOEA 3GA7A 2JGAA 1CXZA 1FL9A 1I1NA 1O96A 2P9JA 4PQEA 4C6RA 1A76A 4C22A 4TMTA 1MXFA 4CTNA 4ZYLA 4S1OA 1M6HA 1G5IA 1L7VC 4Z1MD 4WKOA 3BE4A 3K4QA 4INJA 4CM8B 3A1FA 1X14A 1R4NB 2I6SA 3K96A 4AUKA 4U2BA 1H8HA 5T6BA 2X1MA 1U2GC 4D4KA 3BD6A 3L43A 5JFGA 3DZGA 4TTSA 3OFND 2C07A 5MFPA 1QLHA 1CUYA 3RKUA 3NPMA 4LRYA 4BLOA 3LJKA 3PUZA 7MHTA 5JW6A 2FSFA 3UJNA 2NZWA 4MZXA 2A4KA 2C8JA 3C98A 2RK4A 4QUEA 3ZWKA 2DG2A 5LR6A 4Q9JA 3NM4A 3QE3A 1MO3A 1PR5A 3LX5A 2I6GA 5BVHB 3I1IA 3GROA 2XNKA 5JDIA 4RACA 5I9LA 2C4TA 3QW2A 2JDIA 2AR9A 4XB2A 4X97A 4MVJG 5JY6A 3LNTA 3C74A 4ABTA 3I92A 5J4HA 2X9QA 3HU2A 4WK2B 3EQ6A 2JIDA 2E0IA 2XAAA 2QY6A 3GQBA 3I52A 1M2VB 1BMFD 3V7WA 3ZDRA 3DNFA 2WYWA 4ZWNA 1IY0A 4WE3A 1QQ5A 1JDPA 1SQ5A 1XFAA 4R1UA 2VJAA 3FRIA 3GL9A 4QGSA 1ZD3A 4ALJA 3FVVA 3FX2A 3BA6A 3R3WA 4LBZA 1OFGA 3GZTB 3L1JA 3MJCA 4JP5A 4PAMA 4DLZA 1OLUA 4UTZA 2IHKA 1A4XA 3T7TA 5LC1A 4Y6OA 1Z08A 1L5QA 2C4UA 1E6KA 2V65A 1ILWA 8OHMA 7REQA 1KNXA 1U3FA 2I7VA 2NO7A 3DD1A 3O1IC 2ACEA 4GPAA 1CB7A 4H3VA 4LXHA 5A1JA 4CLXA 4FFDA 1KR5A 1SUSA 2GNOA 4B0PA 1W25A 3HYLA 4TRRA 4GUDA 2GDZA 4YRZA 4FDVA 3JPYA 3SZRA 2KLBA 3AZOA 4KMMA 3F4KA 4JI4B 1NLFA 4DMMA 5LQAA 5HX7A 1MG5A 5GQSA 2GF9A 5GGXA 4ENPA 4ETNA 1BN6A 1DFIA 3DO5A 4AY5A 5B3LA 1ZIXA 1M6VB 4CMEA 1UWVA 2PR2A 3HDTA 4B34A 4NL4H 2FF7A 4R3NA 2ATXA 4PIMA 2FUG6 3ABOB 2AT1A 1TMGE 3EVFA 4KQ1A 1XZLA 4LDJA 3ZG6A 5JAQA 1XI2A 3SJZA 3RT1A 2ZBQA 3H8WA 4W1RA 1W0JD 2MSDB 4X92A 2FW8A 2N1BA 4YJGB 3T15A 1NR1A 3EISA 1JIUA 3UGKA 4O2BB 4RA9A 4HHEA 3OHMA 2C2GA 4S1PA 5EZYF 3KRTA 3ZHTA 2XHZA 4XJVA 1UH5A 3H2KA 4QBKA 3LECA 4S2EA 3FBTA 2IZ0A 5EJ2A 4CLRB 5EIOA 5IYZB 1F14A 3P71T 2RHGB 4BVHA 1FDIA 1UBKS 3RS0A 3VC7A 4B3CA 3R09A 5BSHA 2NAPA 3TRIA 4JELA 4PNZA 3EZXA 1VRWA 4ZVKA 1L5HB 3EFEA 1JJBA 5CB6A 2NZVG 2EOAA 2WAMA 4L5YA 1WR8A 4XDZA 5KOYA 2AR0A 1IXZA 2VLIA 1JIKA 3CFYA 3VZRA 4ZRDA 5F7ZA 1GA4A 2WUGA 3ETDA 1T0PA 4CQLB 1L4LA 2ODNA 4NEGA 4BNMA 1YFLA 1K5PA 1JAIA 1NOIA 1T2CA 1ZM2A 1ELOA 1K0FA 1K08A 2SHKA 2VSQA 4J0QA 5AXBA 3A6KA 3HCNA 4ZYWA 1O97C 1QXSA 1T0IA 1TYAE 2VPWA 3K70C 3DG9A 1JKXA 1IN1A 3M6IA 4QL3A 1C41A 1GHTA 3H8SA 4TYPA 5LZ9A 3OJCA 4Q93A 2JI7A 4GM1A 4MRMB 4BKPA 4LF5B 1MO4A 1XDUA 3G89A 2CFRA 3I4CA 2J9RA 4PGAA 2UZIR 4X7MA 4Y9SA 3SMVA 4B4VA 2I7XA 4CT0A 1SUBA 2XGMA 4KNVA 4QUDA 3RBXA 1C9KA 3GDOA 4PX9A 4QJ4A 3OICA 2QWXA 4RA9B 1P9NA 3NVKI 2VDRB 2EWVA 3H1GA 1H2ZA 2FUCA 2VRNA 3HABA 3KDPA 1PSDA 4M7RA 4XFJA 2B5OA 2O8FB 1KZGB 5CBPA 1EXWA 3OJOA 1L8LA 2DJIA 2WYIA 1IU9A 3C5CA 1VJDA 3A9WA 3AUSA 4G85A 1U8YA 4C4TA 4D99A 2UZ3A 2PEZA 5HKLA 4A36A 2HRQA 3E0QA 3CLVA 4U7PB 1BMTA 3LWNA 2GFQA 2XVMA 4OPMA 2C4MA 4ZP1A 2ZBRA 3IVRA 3OCWA 2FRVA 2QA5A 3RVLA 2C2ZA 1GU7A 4CL8A 4J1NA 1QZUA 1G7RA 3JQ7A 4TMXA 3V4VB 3QE0A 1JKJA 1JAXA 3GO4A 4BGEA 3VR5A 2J5QA 1FFYA 1H2FA 3NGMA 3O7WA 3UKJA 2GJSA 3O9VA 2G70A 3UAWA 4EWLA 5HKAA 1E18A 4KIJA 2I6UA 1Y3CE 1X1RA 3KKEA 2JLZA 1D4FA 2OC9A 5FKJA 3O47A 4UE6A 4GR4A 3OFJA 1TJ5A 1V47A 1ATZA 1VLVA 1WW8A 1ZNYA 1OILA 4G01B 4OQPA 2XWJI 5AM0A 4WIAA 1T43A 3QK7A 4R5HA 4QOSA 5C32A 4N3CA 3PUWA 1E62A 4XWGA 1OLSB 2VYCA 1J0AA 1ZINA 4ZQCB 1NAIA 2G5PA 3RTBA 3WHLA 4B3MB 1SD5A 2DLCX 3EH2A 2CEAA 2W2TA 3GLVA 2E5WA 3CO5A 1NVXQ 4E94A 2Q0HA 1YKGA 1ZC3A 5H59A 3KJQA 2X8BA 1T34A 2G9NA 4H3HB 4BRWA 1E5QA 1ZI9A 4JS0A 3O8QA 3KSDO 4TXLA 4F3RA 3F6PA 4DEXA 1UANA 4I8IA 3IVGA 4AN4A 2G1KA 4RABA 1V8OA 3ICCA 4UREA 3X2SA 2QN9A 5DO9A 5EG5A 1XTIA 1WZCA 3K5IA 1U80A 3GRCA 4FN5A 3O3CA 1H94A 1N5OX 2O8NA 3NBFA 4YLEA 3RJ9A 4DDVA 1B8OA 1XVVA 3WRVA 4WI1A 3RD5A 1FLNA 1GQOA 4E2FA 2HI0A 2BF7A 1KVTA 4N5IX 5HW0A 3OE7A 5AHOA 2YYYA 4HPWA 5G4KA 2BPOA 2H4WA 3T1OA 5AI8A 1CDZA 2ZBGA 5BQPA 4KLNA 5EEHA 4D5GA 2XCQA 2CW5A 2R6DA 1PUIA 4I46A 2JJ8A 1R16A 2PWAA 4LRUA 1ZC4A 4NJOA 5JTUA 3A1SA 2QBYB 1AU9A 3OO1A 1PSZA 4FCTA 4C7OA 1JIJA 2HCRA 5E0KB 1HLPA 2GI4A 4XFKA 1S8FA 4HB0A 4DDMA 4MLCA 1CYDA 1D9XA 1Y5RA 4FZJA 4DUYB 1OXBB 4HLUA 5K6TA 4KSCA 2FZCA 4BB6A 1JVNA 3VKGA 4BVEA 2QX6A 3BMXA 3IPCA 2CB9A 3P9NA 3PFFA 2GZAA 3R0JA 2P2GA 2Y4OA 3TAHA 1C1DB 2Q2NA 4DPKA 5K8CA 4BO4A 4MJLA 3B6EA 3PF8A 4MWSA 4PS0A 4QUGA 3AU8A 4GXTA 3RI3A 4AP9A 5KOHB 4DSUA 4KI0A 4WOPA 2PPVA 2C2YA 1RKUA 4ZQEA 3C87A 1RP1A 4TMKA 1COWD 3UG7A 4AZTA 4JIGA 1MAVA 3L92A 2EBHX 2VEOA 2VHCA 5IM5A 3FZYA 2J4FA 3A1UA 1NLYA 1P9OA 2B6HA 3DBLA 1RPJA 3HFGA 1KIMA 4GICA 2DXIA 2ZSJA 2EAUA 3CZPA 4RY9A 3M4JA 3UV6A 4P4SA 3HBMA 1NY6A 3T9BA 3CLKA 4W6ZA 5D51S 4D6YA 3THXA 4ER5A 3B3QA 4QJ3A 1PJBA 4IIDA 3LO8A 1DWOA 2ID9A 3T9AA 3PNSA 4GL4A 1X7XB 4L0DA 4CYMA 2JK1A 3MIZA 3OO0A 5BT9A 3GR6A 3ONNA 1HNWB 3PSHA 3VI4B 3ZTYA 1GQQA 2XNCA 1KDRA 4E1AA 5AVXA 3N6VA 2ZRPA 2H4ZA 3JQBC 4QQKA 5KNDA 3MTJA 5BSWA 3U5ZB 1PK9A 1TKRA 3A9VA 3NU1A 2RKOA 3K73O 4KYIB 4QAJA 1IEXA 2Q3EA 4RPJA 1HE2A 5KX5F 4WY5A 2JHPA 3QYAA 4MMXB 2XT9A 4K6CA 2C4VA 2YIDA 3VOSA 1EH5A 3T06B 3JALA 1V8ZA 1RIIA 3VZPA 3P5BA 3EBLA 4QPCA 5JCOA 1AJEA 1MVNA 3OMWA 4H18A 2XGJA 3S2YA 5A5GA 4RK0A 1UK8A 3I9JA 4XJXA 2VXYA 3WLNA 3I30X 1P8AA 4N54A 1YOBA 2GA9A 2HMSA 1JDSA 1F12A 4IGFA 3LT4A 4BNGA 5CFNA 1FX1A 5DCLA 3U49A 1JQEA 1BW9A 5B1HA 4OTZA 1X7GA 2G7ZA 3HV0A 1QOZA 1JXMA 4LTNA 4WY2A 3MMNA 4ZO7A 4F5EA 5A0VA 4YONB 1A9SA 1NONA 4LF9B 4L5JA 2A94A 5IJ0B 3RGWS 3IKTA 3AEKB 3CUUA 1W87A 3IKVA 4UTXA 3SC2B 2BM0A 2ZYIA 4F2GA 2IZ1A 4PQYA 1ORTA 3AJDA 1HORA 3EDYA 3PQ3A 4PTLA 2CGEA 4TTVA 2HK6A 2K6GA 2VK8A 1Q5PA 4UJ5A 3A4LA 1EQAA 1KVQA 2BMAA 3OIYA 2F3PA 6AT1A 3HCPA 3P0IA 4LJLA 1JXQA 5JH7A 1YDEA 3KQWA 2YJ6A 3QLTA 5JATA 1CY1A 2CN1A 1FTSA 5CLGA 4AB1A 4LWZA 2HLDD 3CY6A 3RSOA 3HA7A 4L07A 1P9WA 4GBGA 4D42A 4EG5A 1UFQA 2VHYA 5JRZA 5JANA 3U6BA 3PE6A 1HYGA 4A8PA 2BDTA 4IFBA 1I10A 2GGSA 5TSDA 2D13A 3LXMA 4W5NA 3BRWA 1R0BA 2F43B 4UAUA 1U3VA 3U4GA 2YQZA 1KXJA 1AKRA 2Z09A 3QITA 1RXIA 3V7UA 3K9QO 3VHRA 3KXKA 1GNLA 2DWQA 5IBCA 2D62A 5BUCA 1EFCA 1G21E 3GJ7A 4U3JB 2REQB 4O4JA 5I7RA 2PVPA 3UA4A 3VSDA 1H1LB 3LM8A 1XZFA 2YN4A 3VPBA 4Z4QA 1T6BY 2O3RA 2PIDA 2YYZA 2H9IA 1ZP6A 4I4TA 4JN6B 2Q07A 2QDKA 3PCTA 1VB5A 2OP0A 1KTVA 2Y6VA 1K6MA 2H16A 2HLDA 2J48A 2VJKA 4IJ6A 4LDPA 4JP3A 1K4YA 1DFGA 1D9ZA 4GOKA 1PVVA 4MOWA 1R6UA 3T1VA 1OB2A 4Q3LA 3P2JA 5I3ZA 4QODA 2Q6VA 1RJGA 2ZJ5A 2L17A 1FW8A 4NECA 5EA2A 3I37X 3KTAA 3WRYA 2PZFA 2RHLA 3HCFA 4QVKA 3R8XA 3TPZA 2XSZD 3N5KA 4WOJA 3SN6A 3ZJYA 4C5BA 2O8CA 1YZVA 4EKIA 2Q1UA 5C81A 1NASA 1T9BA 4E2XA 3LWBA 1V8DA 1TD1A 5E0OA 3T3HA 4QFDA 5BYAA 2C61A 3GMSA 1KP2A 3PCRB 1AQLA 4L74A 4M76B 3QKRA 2C8KA 3GJ4A 5DSZA 1GUBA 3DPIA 3OA2A 1PJZA 4WMLA 2ZTMA 2IH4A 3ROKA 3B6MA 4KKVA 3O92A 3GH1A 4TUYA 3GRAA 4C1BA 4RMJA 4ZV7A 4M22A 4I3GA 1K7CA 2DERA 5THKA 2G17A 1KJ9A 3K70D 4Z4GA 1KJIA 2KYRA 3NIFB 2ZZNA 3ND7A 1BOOA 3C2QA 4LYJA 4Q4JA 4P35A 4YAJA 4C4PA 4CV2A 1GL7A 1FF9A 3PXAA 1HM5A 1B3RA 3O8LA 4MR8B 1EP3B 1IBCA 3VA7A 5KHLB 3DD5A 4OBEA 2GHQA 3C3KA 4PSCA 1O77A 2I6QA 4MPJA 4TWAA 5F1YA 5CMLA 3KHKA 1J8YF 3KXIA 2AYZA 1ZM9A 3PQ8A 1X1EA 3GPIA 3M1LA 5JNUA 4W5JA 5LJLA 3V2UA 3MSXA 3CS3A 4PO3X 4J0HA 5DYTA 1D3AA 4O33A 2Z2JA 1QVRA 4IWYA 1YQTA 3L07A 4NNOA 3ZK7A 5CEJA 1XQ6A 2W6CX 2I1WA 1TXGA 2R1VB 3SGLA 5JLJA 1SU8A 4CIYA 1Y8CA 3H2JA 3QPBA 1EX1A 4WLFA 5CYOA 4FBMA 4B31A 2ZSBA 1AUQA 3BZBA 1PV2A 1Z8NA 2OLEA 3FVRA 2PX8A 3GRKA 3DKIA 3M9XA 4TMZA 3ZZ1A 4BNDA 5JSHA 2ZUDA 4HDKA 3JATB 1NN5A 3BD8A 3OM8A 4QQRA 5FWYA 1EXDA 1TE2A 5NULA 1R7RA 2OFOA 3GJ3A 2WOJA 5JOQA 5C9ZA 4YFVA 3RF6A 3FKSA 4PHFA 1HT2E 1CEEA 2QTVB 3B6JA 4M0KA 2O1XA 3PUYA 2LIPA 4WHMA 4MUYA 1XJQA 5ER9A 4RKFA 2JS7A 3R6TA 4WX2B 3B53X 4MPTA 3SR3A 5AJUA 2JFHA 1GXSB 5KTMA 3HJHA 4EJSA 3QF7A 2WU3A 4YV7A 3UJAA 2VRWA 1HKUA 2IZOA 3D1JA 4B17A 4ZI7A 5FOUA 1ZEMA 1LC0A 1NJ8A 2DWUA 4TXJA 4FYXA 2IV3A 2XWSA 3ZHOA 4ZZ0A 2QM8A 1CFJA 2QT1A 1R50A 2GM3A 3MTIA 1Z29A 4E5MA 1NATA 1RBQA 3PC3A 5JS1A 3LDUA 2QTWB 1CE8B 2BTQA 3KHTA 2BUBA 3QKUA 4FKMA 3DT6A 4TS3A 4NBWA 5AQEA 2KE5A 2WA2A 3I3OA 4KXQA 1ITZA 1PX2A 2HNBA 3DE3X 2PCJA 5AVQA 3TSZA 3ORHA 3H99A 4TMVA 2C78A 4FZ5A 2XB2A 1GZDA 3KVNA 4HH0A 4PHTA 5DX8A 3LBHA 3OT1B 4UUQA 1BROA 2I4IA 4IINA 1VI2A 1Q0LA 1PUXA 4PNEA 5GMOA 3OTQA 2QS9A 4IUBS 4HRXA 1XJCA 3AVWA 1P2VA 5AVTA 5KS2A 4EY4A 3ZCRA 4UATA 4BVLA 3SR4A 4D3SA 2PLWA 1U04A 1GZVA 3TKAA 1TJ3A 2UYYA 4PBRA 5G0VA 1E3DA 1SCUB 1YHNA 3FKJA 3GBPA 3RG2A 1A1SA 1Z5ZA 4B85A 4C4ZA 3CVXA 4GZ6A 3U7FB 3YASA 3LS2A 1OWMA 4DM3A 3NPAA 1T25A 1VBNA 4ZHQF 3KB2A 5BO5A 3MSCA 4KWEA 1T8PA 4Q00A 3EIEA 1QRAA 1W5EA 1XMIA 5AYVA 2QAIA 1WUTA 3PD7A 4AZ3B 4HGNA 1ESDA 1Z13A 1GJRA 1ZN9A 2AWOA 3IUPA 2NQ8A 4KSBA 5BYJA 5LB2A 5LP6F 1KQPA 3HL0A 2FE1A 1FNDA 3MS7A 4IJQA 5ALDA 4KQEA 3JAKA 5EJ5A 4HYQA 3AJEA 2O8BB 2FEWB 2Q6LA 5BT8A 1US8A 3D7NA 3GH3A 3A1EA 5IZCA 3A4MA 1N78A 1A4RA 1L7DA 1X39A 2D7JA 3FMIA 3OKCA 3QE4A 1CG6A 3HRKA 1HYEA 4KWTA 5EJAA 1J99A 3K7EA 4NU0A 2H8KA 1A0OA 1E3QA 3WKDA 5AVRA 1OH7A 2O8EB 1RI5A 3R1IA 1EUZA 3WO0A 1ZL2A 1R4MA 1ZS9A 3EOZA 2Z8YM 4HNUA 3LX6A 1OVGA 5KYNA 1LBQA 2GBCA 4M0EA 3RFTA 4Y6GB 3E15A 4A8JC 2AZXA 3O21A 3FNBA 3SJUA 2VBIA 1XTSA 4MP3A 1MHTA 1Z5NA 3WGHA 3GCZA 1O95C 4ZVNA 3KB6A 1ISGA 4HN9A 3KJGA 2CE2X 4DXHA 2PDAA 1MGOA 1EINA 1NSFA 3EG9B 2EQBA 4RH0A 2I3ZA 5EIWA 3DM9B 1EFAA 3A6PC 1D6SA 1Z6PA 2ZWOA 4FGZA 1JMYA 1QCCA 4R1LA 1EVIA 3P9SA 4DBZA 3TX2A 2FOXA 2FLKA 4NCKA 2QX7A 4B81A 1A9OA 4E11A 3GZNB 1B1AA 5LBIA 1OBOA 5DYYA 2F3TA 4BVFA 4NY1A 4RPLA 3WMWA 1XTZA 2CUTA 2IOYA 3OIWA 4N41A 1VBFA 2CEKA 3JAKB 1QC5B 4BFSA 1R64A 1KI6B 2PGLA 4ZN6A 5JAZA 1G2OA 4M49A 2I3BA 1XEWX 2JZCA 2OAEA 3IRVA 3HO1A 1V6AA 4XXHA 1U3TA 1ICEA 1K9SA 3V6LA 4UM8B 4X94A 2NUPB 2QMQA 4YJFA 5IJXA 3OQNA 1TQHA 4F8EA 5BMOA 3NLLA 3W06A 2SBTA 4Q9KA 2PIAA 4DJFC 1AKMA 1VHJA 4G0NA 4K9QA 2X9VA 3BF8A 4JI1B 2H07A 3PDCA 4IDPA 5E9AA 1CQJB 3MWEA 5IVHA 4UMFA 1XTTA 3IAHA 2FQXA 4N12A 4PIPA 1OX5A 4URUR 1M2HA 3LUKA 2ASVA 3PNPA 1LQTA 1NOJA 3FMOB 4GYYA 3VO2A 2BGRA 4DFDA 4N1AA 4YV0A 4A27A 4DE5A 5JUWA 1Y1TA 4NFSA 1T9CA 4JQSA 1PVOA 2AUMA 3E58A 1V9CA 4ZQIA 5AW8A 1BWRA 3D0KA 4YQZA 1SCAA 1HOTA 1Y98A 2KI5A 2W93A 3I9V1 4JJ6A 4R8KA 4GZ3A 2GM9A 2F4NA 4FJ2A 4RDXA 1NXTA 2R4QA 2I7CA 3BE6A 4P38A 3AERA 3IQGX 4RXUA 3X2FA 2OV6A 5ED4A 5AHRA 2SKCA 4LV8B 1P7PA 2BLNA 3IUEA 4BVJA 4C01A 3H5LA 4IKEA 4E1BA 2AKAB 5JZBA 1BCSA 2V4ZA 3KD2A 4UOEA 1JHAA 1KAHA 1LQUA 3DTTA 5TY0A 3I39X 3UQZA 4R31A 3O91A 4N3AA 1KOFA 2XZLA 1QCZA 1KSGA 2C2MA 5IX8A 2R6FA 2J5BA 4H3SA 1XALA 1YZTA 3L9XA 4FEGA 4MV5A 3HGMA 2J6IA 3DO6A 4MRAA 3TSYA 3WTBA 3UT0A 1D4ZA 1KQFA 1NQTA 1JAYA 5FPKA 4IP0A 3CLHA 1R0WA 2HJWA 3C3CA 1U3CA 2VCEA 4OLHA 4JC8A 1N5DA 1UMBA 2F1IA 5FLEX 5JEEA 2F67A 2IU6A 3ZLJA 2CXOA 3OEHD 3DEFA 4RF5A 1UFRA 2Q5IA 3IJ5A 4I8DA 2AQ8A 2Y1CA 4S0XA 4E7PA 4ETWA 2PL9A 2PWZA 5B57C 1IONA 2R7LA 2XT0A 2XGSA 4WCFA 3FOBA 1YU6A 1VG8A 1VTKA 1XEAA 2A58A 3ONEA 3WOVA 4ICIA 5DYWA 5JAPA 4DR5B 2FWIA 3OMLA 1MZVA 1PJTA 1JJVA 4OI2A 5DT2A 3TW8B 3O8RA 3KXDA 1SFRA 2YXBA 5FAXA 5FOQA 3ABZA 3UV7A 3U31A 1X1AA 1ZWLA 1BW9B 1BCRA 1DNPA 1P77A 1VCNA 5A7FA 1XPOA 1YHYA 2QUIA 2HPVA 2XCRB 4MKRA 3I4FA 5LIPA 2J8ZA 4BFTA 4LQDA 5CDHA 3LC2O 4MVJD 1XIVA 2FSHA 3PC6A 1JSLA 4XCXA 3RIEA 1SOWA 4MAAA 4BCDA 1Q83A 2MYNA 2F55A 1FFBA 4ZAFA 4YJHA 3FA2A 4KLZA 2F62A 3IP6A 2JBAA 3WIEA 3JSAA 4O4JB 1ZUD1 4JOSA 4KGXA 2W6ID 4YT2A 2HPAA 4XD2A 3H4IA 4F9EA 1USKA 2ZPUA 3KVVA 4YYEA 2OO3A 3T9EA 2ZREA 3NTLA 3Q3VA 4WXEA 2K5UA 4EMTA 4ENTA 1X7YA 2XE8A 4TRNA 4URVR 2QUAA 1JFLA 3CLTD 4C7MA 5FI5A 3U3KA 2GD6A 3BULA 4TYMA 1RRCA 1M1ZA 1CZKA 4OXRA 4KNWA 4CTJA 3SU8A 5FJIA 2ZRQA 4NI5A 2HQBA 3H4MA 4A92A 2X2EA 1C1HA 2BR3A 1W59A 5L95A 1ZMOA 1GU0A 2GXQA 2OMKA 3ESYA 4EATA 1SUPA 2VCYA 3EGIA 2G28A 3MTBA 4HEQA 4N3NA 3V4SA 1AIPA 4GLOA 1HDYA 1X9GA 1Y37A 2DKOA 4FK8A 1A88A 4AP6A 3SVLA 1JEJA 3H9CA 4TSFD 1QU2A 5F4ZA 3A6GA 1HNXB 4QARA 2TRSB 4YK7A 1PX0A 1JLLB 4GNRA 2MINB 2DPGA 3EDMA 3RUPA 5BN5A 3NXSA 4FYWA 3TVYA 2NO6A 4IMRA 4PCUA 4TROA 3VYTB 1PD0A 1W1WA 1E4YA 4RLQA 4JC4A 2VQEB 2BMJA 5F77A 1X0XA 3A31A 3LQ2A 1X7DA 1EXVA 2HFKA 3L1HA 4C2UA 4EZEA 1NUPA 1UM9B 3G68A 4TXHA 5FPPA 5FOVA 2ZDHA 3TE6A 4PYQA 3CE9A 4Q4AA 4UAVA 3SQMA 2QMEA 2QM3A 5EKTA 2WFLA 4GLJA 3U9SA 4DG5A 4S0ZA 4CLDA 4RE6A 4MQ6A 2CDRA 4QBIA 2ZRJA 2H2HA 2ZDQA 3L8CA 2FKNA 1VL6A 3REOA 2YHIA 5K8VA 3QA9A 5ARBA 1GKIA 3R3ZA 3NORA 2CZQA 2WJJA 3FOWA 4YAIA 3BXFA 1XXHB 4BVAA 3E9RA 1OI3A 2ID7A 5AUQA 3CRRA 1J42A 2FUKA 2C98A 5HOEA 4I4TF 3O03A 1L3CA 3OY2A 3ZK8A 3GB9A 4LXUA 3UHPA 1WO8A 4XASA 1TM1E 1Z56C 5E2IA 1TU4A 3IUYA 4NMXB 5KTRA 5L40A 4E2WA 3NTVA 2VTBB 1CU1A 1ZEJA 2V9ZA 3ASZA 2DM6A 3QIAA 4ZCMA 3KAJA 1HQCA 3E3MA 3I9FA 2BJVA 3AILA 1N2SA 1PBTA 1VHDA 4UU1A 1LX6A 3JZIA 1M10A 2HUPA 2IC5A 3IE0A 3LH5A 2Z57A