4BNDA

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
KMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
total genus 94
structure length 252
sequence length 252
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndA01
1N9KA 2W11A 1L8OA 1Q92A 2C4NA 5AVYA 1Z4LA 1Z5GA 4I9FA 4DW8A 2WF5A 4DWOA 3ZU6A 1N8NA 4L6AA 3U7EB 4HGQA 4DCCA 3DV9A 2GHQA 1T5SA 4BX0A 3CNHA 3MPOA 2FUCA 1ZS9A 3NIWA 4KYTA 1L7PA 4UMDA 4XPZA 5AW4A 4EENA 3ONNA 3L0CA 2BY4A 4NFLA 2PR7A 2ZBFA 1EK2A 5AKYA 2EARA 3EF0A 2HHLA 2RAVA 3HLTA 2YJ3A 4EZEA 3A3YA 3P96A 3I6BA 1SU4A 5AICA 1WPGA 4QJBA 1ZD5A 4XQ0A 2FI1A 5AW3A 4ZEXA 4YGYA 2C8LA 2ZXEA 1RDFA 3U26A 4UW9A 4BYGA 3AR7A 5AVWA 4L57A 5AI4A 2G07A 4Y2QA 3ED5A 1Z4MA 1Z4IA 2EATA 3A1EA 5AM5A 2MU1A 4CF5A 3D6JA 3SKYA 1XVIA 3EPRA 4FYPA 1Z88A 4C4TA 4AS3A 5AVRA 3SD7A 2JARA 2X4DA 3AR8A 3OPXA 2R8YA 3QGMA 3QNMA 1L6RA 3U13A 4EX6A 2Q4RA 3I1YA 2PQ0A 1YDFA 3R9KA 1QQ7A 2JAWA 2CFTA 2FPSA 2B8EA 5ALJA 1Z4OA 5AM1A 1TE2A 5ALEA 4EELA 4Y2UA 3UMCA 2HI0A 2JGAA 2AH5A 1O08A 4NABA 2B1RA 3E84A 2PKEA 5AVZA 4HGOA 4OHFA 2I33A 5AKGA 1U2SA 1RPZA 1QH9A 1YNSA 2IYEA 3DDHA 4Y2YA 2HF7A 4XE5A 5AKZA 5ALOA 1SWWA 4L6CA 3WK5A 3NANA 2FEAA 3I76A 3ET5A 1JUDA 3SLRA 5AM3A 5A3RA 2IOHA 3R4CA 4Y2PA 4BBJA 3AR4A 5AVTA 3N1UA 2HEGA 3E58A 3ZVNA 2DQSA 2I55A 4CF4A 2YMMA 4HGNA 2I7DA 4UMVA 2GO7A 3W5DA 2VKQA 3OCXA 3NASA 1Z4PX 4UAVA 2EAUA 1TJ3A 2WF9A 2C9MA 3KOOA 1Y8AA 4Y2VA 1Z4JA 4EX7A 3U7FB 3L8GA 1Z5UA 2ZBEA 5IT0A 2P27A 3ZUPA 4UU0A 3ZVLA 5ALFA 1RMTA 3BWVA 1LVHA 2AMYA 4AP9A 1RLMA 5IT4A 2YMPA 2HOQA 1ZRMA 5AW6A 5AKXA 4Y2XA 3CZ4A 2C88A 3BA6A 3FPBA 5AW8A 3N8GA 1XP5A 2B1QA 4UASA 3W5AA 2G1AA 5AESA 3IB6A 3SKXA 3RFUA 1LTQA 5AW0A 3QUQA 3ZWKA 2YJ4A 1VJRA 3OCVA 1L7NA 5A3QA 5AHXA 1TJ4A 1ZD4A 3AR5A 5AVVA 3OCUA 3R09A 2CN1A 1ZRNA 4G9BA 2YMQA 4KX5A 3ZWDA 3ZW7A 3RF6A 3A1CA 1PW5A 3FZQA 4J03A 2G0AA 3PDWA 3AR3A 4KNWA 1MH9A 4Y2RA 1VFPA 3UMBA 5ALWA 1U02A 2JAUA 5AVXA 3UM9A 4MWOA 2JAOA 3FPSA 3ET4A 2YMLA 4JB3A 2R8EA 2RB5A 2P9JA 5AKKA 1YV9A 4XOUA 3WKAA 5ALYA 4RETA 1CR6A 2I6XA 5AI0A 3L1UA 1U7PA 3EWIA 2BDUA 4UATA 3M9LA 3F9RA 2B82A 5ALUA 3PCTA 4IG4A 2IA5A 2NYVA 4BNDA 3PGVA 4KX3A 4UMFA 5AIBA 2YN4A 3B8EA 4CNQA 4QQFA 1NNLA 1ZJJA 3EF1A 5AIAA 5AK5A 3WK8A 3UMGA 5ALZA 4BEWA 1RQNA 2YY6A 3B9BA 5ALNA 4O8CA 3ZTWA 2G09A 2HX1A 2FUEA 3MMZA 3TLMA 4UAUA 2I54A 3L5KA 1J97A 1NF2A 2HCFA 5AM2A 5E0OA 1T9ZA 3OCZA 2ZOSA 4Y2JA 1SWVA 4F71A 4FE3A 2W4MA 4GXTA 2AGVA 3N28A 3KD3A 1WZCA 4NWIA 5ALTA 1F5SA 3NALA 4JDPA 4OFZA 4NAVA 3FM9A 3WK7A 2YJ5A 2ODAA 2G06A 1O03A 1WR8A 2AUTA 1YMQA 2IOFA 4FFDA 3QLEA 4BX2A 1J8DA 3OCWA 5AI8A 1RKVA 3PGLA 1RRCA 4CF3A 5AW9A 3L0BA 2WM8A 5AW2A 2HF2A 1RMYA 4UMEA 5AW7A 2IOFK 3KZXA 2OYCA 1Z4QA 3S6JA 2Q4TA 4KN8A 5ALKA 3KC2A 2OBBA 2GFHA 2YJ6A 5AI6A 4C4RA 5ALHA 1RKQA 2G08A 5AK4A 5A3SA 1S2OA 5AK3A 3IJ5A 3N5KA 3AR6A 5AVSA 1YJ5A 5ALPA 4CE6A 2W43A 3K1ZA 2WFAA 2WHEA 5ALMA 2YBDA 3U7GA 3WKEA 3QXGA 2WF6A 3FGOA 4HGPA 3J7TA 3QUBA 5AKJA 3QU9A 1RLTA 5ALGA 3MN1A 4OCZA 3OTQA 4G63A 3U7HB 2FPWA 4Y2TA 4BEVA 3KDPA 3ZX5A 2YFYA 3HYCA 2NO4A 2D2VA 3QUTA 3QU2A 2Q5EA 5ALRA 4PNHA 3ZVMA 4I9GA 5ALIA 2WF7A 3L7YA 2RARA 3ZTYA 4HAIA 3QU4A 1RQLA 1FEZA 1RC8A 2BDEA 3IRUA 3DNPA 1X42A 2CFSA 2WF8A 5AI5A 5AW1A 1S8OA 1WVIA 2FPRA 3VAYA 3NUQA 3FVVA 2ZG6A 5AKEA 4GIBA 4RESA 4HGRA 3SMVA 1XPJA 3L8HA 4ZEWA 2I34A 3L8FA 1ZOLA 4Y3UA 3QUCA 4F72A 2B0CA 1NRWA 1Q91A 3QX7A 4Y2SA 2RBKA 3OCYA 5T41A 3ZX4A 2HDOA 3W5BA 1L7MA 3AR2A 1ZD2P 4C4SA 5AVQA 2ZBGA 1QYIA 2FPUA 3W5CA 2P69A 1CQZA 3GYGA 4UARA 1RLOA 5ALDA 2C8KA 5FP0A 2FDRA 4UU1A 3ESRA 3L0YA 4YCMA 3U19A 2HO4A 3ESQA 2P11A 2QYHA 4EEKA 5AI9A 3AR9A 1TJ5A 1TA0A 5ALLA 3QU5A 2G80A 1T5TA 1YS9A 3NRJA 1Z4NA 5AM4A 4BX3A 1RKUA 3ZI4A 2R8XA 4KNVA 3I28A 3WKBA 2NO5A 2R8ZA 3WK6A 3E8MA 4HYTA 4H1WA 1ZD3A 5ALVA 3N07A 1RMQA 4B6JA 1U2TA 5IS2A 3L8EA 3M1YA 3B9RA 3NAMA 5ALSA 2O2XA 4UM5A 3DAOA 5AKHA 2FPXA 3QU7A 3E81A 3KBBA 4DFDA 1VJ5A 5AM0A 1K1EA 4BNDB 3MC1A 3WK4A 2B8JA 4YCLA 1IWOA 4NV0A 4YIKA 3QYPA 2HSZA 3A1DA 2QLTA 4BKMA 2OA0A 2O9JA 5JJBA 5AW5A 4YCNA 4J2TA 1L7OA 5AVUA 4AS2A 4YIHA 2GHTA 3WGUA 1KYTA 5AK6A 2CFRA 2B30A 1Z4KA 5AKIA 2OM6A 3WGVA 1QQ5A 3WK9A 5ALXA 4MUMA 3L1VA 1QQ6A 3SF0A 2ZBDA 2MSNA 5AKLA 4UM7A 4IFTA 4ZEVA 2GMWA 4E88A 3WKCA 4YH1A 5ALQA 1EK1A 1AQ6A 3SHQA 4OD0A 1L8LA 1U7OA 3WKDA
chains in the Genus database with same CATH superfamily
1TZKA 2X5NA 4F56A 2MYPA 2JGIA 3VPAA 3O75A 4HYEA 3S29A 3SVLA 2CXRA 2J6HA 4QOGA 3EEQA 3E3MA 1LWNA 1ISGA 1C1XB 2VYFA 3AUXA 1KMQA 2ZT7A 4LCEA 3AJAA 4U02A 1ISSA 3LA8A 1EAMA 3DDCA 3QK7A 1JFSA 1I1OA 1LLQA 2PFGA 1N8NA 4JWKA 2JVJA 3C5HA 4JCOA 5LCXA 4OLFA 4YAEA 4MCAA 1KTIA 2H4WA 1G5IA 4FX5A 4L6AA 1YL6A 1APBA 4QATA 4XSHA 3TXXA 4YMHA 4N1AA 4JP5A 3OIDA 1KEZA 5C8XA 1TLTA 2ZUSA 3I92A 2PGAA 1DAEA 2PLNA 5CW2A 5UKDA 5B55A 3VR4A 3GUYA 3UFXA 3UKOA 1LU9A 3GVHA 3KKQA 3AMVA 3OIVA 4FMDF 4M54A 4PAOA 4Q34A 3Q6NA 1R37A 2O14A 4XGRA 3WHPA 2QUJA 1KMCA 1I3LA 3E6AA 4ILKA 2XWPA 1T3TA 4NFLA 4WFKA 3TB6A 5HZHA 5DNWA 2C1EA 3A37A 1OLSB 1U11A 1RCUA 2FZLA 3ENQA 4TMYA 4LZZA 1BGVA 3TI9A 4D97A 3LI2A 1EE1A 3I6QA 1M74A 2YWJA 3GVXA 5K99A 1J49A 1SU4A 3OKCA 4B73A 2N47A 2VHZA 3EQ7A 5FLYA 4CPDA 4J6FA 4KB5A 1YF3A 4JB0A 2HLDA 4GR5A 4HFRA 1WF6A 1BU5A 1Q7EA 1X1TA 2H3HA 4FCWA 3SYMA 4PYRA 4YRGA 4GXQA 1JEJA 2AZXA 2C82A 3ANNA 2C97A 4H4EA 3SCZA 1D9XA 3UWPA 2W2XA 4Y0VA 2IXEA 1S9DA 2H0RA 5DHTA 5I9NA 5CNMA 2JFGA 4XDZA 4U5XA 2I4RA 1GXSA 1XTUA 4LYDA 4BMOB 2WP0A 3QBDA 2PR2A 2C4HA 3A1EA 3L49A 3VRHA 5F35A 3REQB 4IDEA 1OREA 4ZIRA 2FFRA 2PIDA 2V1UA 2P8SA 4JT4A 2WYVA 1AKQA 2O0LA 3UK2A 3WQRA 1M1YA 3LPCA 3KUKA 2ZRLA 4BPRA 1MOZA 3W8RA 3TRJA 2FPGA 3SHTA 4PAQA 2ORED 2R8YA 1QCYA 1EUZA 3S28A 3OIYA 3Q5EA 2X0KA 3FVTA 4ILEA 3HU5A 3WLPA 2E6KA 4QDXA 4LIPD 1KEEB 3BS4A 3L7LA 3AUTA 1W1WA 3KYDA 4L9RA 3VU1A 1E4VA 2GKOA 3LUJA 4FS8A 2O20A 1Z4OA 1P7PA 3GF4A 4QFCA 3SYKA 2NP7A 2HA2A 4Y2UA 1HTBA 2HI0A 2ZKIA 1FPQA 1NP7A 1Q6YA 2AVDA 4R9VA 3Q15C 4DJ5X 4WXPA 1VCOA 5FLEX 3U2QA 1Z5OA 1ZMBA 1NW9B 1R8JA 3LPDA 2YOHA 4EYSA 2QSYA 1YOVB 3EZ6A 3IXQA 1QDUA 4RD3A 1RWOA 2G88A 2FRDC 3C5CA 1LI7A 4IKPA 4TXJA 3KUXA 4BXOA 3W9YA 4PZUA 1Z8HA 1CHDA 2XGOA 3E03A 2XQKA 4PVDA 4WFIA 1AX9A 2HF7A 1I01A 2COUA 2QM7A 2WHPB 3D31A 1J6UA 3Q5GA 4S0ZA 5G4KB 3V00A 4LYAA 5I4CA 1AHIA 3B6ZA 3NHMA 2YW9A 1T5LA 3DDNA 3I76A 1SBCA 3E9DA 4IKOA 3T95A 1QK5A 2PJZA 2RAPA 3HL4A 4E21A 3CF6R 3PQFA 3O2NA 4R3UC 3T9BA 1LS1A 2IOHA 2XNSA 4TTQA 4YRCA 3N2EA 1O97D 1W59A 1MA3A 2BFNA 2IYYA 3U09A 4YV0A 2VXOA 4HNRA 1BYUA 3DO8A 5ECDA 3RS5A 5JADA 1IY8A 1U28A 1KO5A 4FFPA 1FP6A 3LBYA 2PA0A 2XRMA 2YMMA 3HFJA 4V1CI 3Q0EA 1U0NA 2BGUA 5E2AA 2IDMA 4L4UA 3T5AA 3Q3VA 5AUNB 3MJFA 4RU1A 4J9UE 3RFXA 1Z6PA 3BQMB 2PWZA 2VDWA 1O3YA 2C7BA 2FMIA 1LJLA 1ORRA 2WF9A 4FDLA 4NZZA 3KQOA 4XLLA 3KOOA 4IJ6A 3ZU3A 1ZW1A 2HMTA 3QBJA 4C14A 2PQ2A 4R2IA 4LZJA 1H1DA 3CUVA 3TNJA 3HFGA 2DP4E 4LRYA 4ATNA 2GK4A 2QM3A 4OHRA 3RTDA 3TQQA 2B7LA 4HQNA 3RVJA 2HU5A 1FTGA 5JS8A 3AVPA 4MR7B 2BJVA 1ZRMA 1WXXA 3QIAA 4RHEA 2XKJE 3W4IA 4Z1OA 4QTXA 1J25A 3NWJA 5CJ2A 1FNBA 4ZT5A 3P0JA 3V55A 2Q5HA 4H3KB 3LPNA 5JXJA 1VRWA 2NU7B 1Y8QA 2AWNA 3PNOA 1V9LA 5JNTA 2XGJA 4UBKA 4A26A 5LP6C 3L9WA 1L3BA 1GGFA 1SC9A 3R9IA 4FU0A 2VYNA 4F6LA 2WUFA 3KLNA 4MZDA 4ARZB 1EFAA 3A36A 4Q1AA 1RI1A 2GPBA 3PJFA 1DAHA 1L7NA 4JDUA 1DRVA 2CVHA 4X97A 1JJVA 2ZLBA 4MVCA 2G83A 1EJ0A 4FCVA 2XUGA 4JH0A 4LMPA 3T3GA 5ETJA 4C2BA 2OBXA 2BEVA 3GA0A 4TUYA 3HCAA 2BBTA 2G0AA 1E3IA 2R79A 1RHMA 1CE8A 1KDRA 4WNAA 1ZK3A 1R6DA 2VJMA 1VFPA 4P7JA 1QBKC 1DO8A 1T6YA 1YS2X 2VQDA 3IT0A 3VNBA 4ZYWA 3PC8A 1K7XB 3CN7A 1H2EA 4ZVPA 2R60A 1YE3A 5FOWA 3HM2A 1YKGA 1YZNA 3HACA 1NRJB 4NENA 2SKEA 4PGMA 1JB9A 1B6TA 2OXFA 4AG6A 4QAJA 4JJ6A 2QD4A 2ZIXA 2KWIA 4FEYA 1ZNZA 5SY4A 2ABWA 5JW6A 3JATA 2HRDA 1TMKA 2WT4A 3P94A 2IV7A 4IJMA 4BLTA 1JKMA 1SXJA 4IX1A 1ZSNA 2BHNA 4OKNA 5DOZA 2IYVA 4EWLA 7YASA 2XB9A 5HSGA 1G9XA 2EW2A 3IP9A 3D3KA 3TNFA 1B42A 3D0KA 3LZDA 3NBKA 5JCZA 6LDHA 3EDQA 1M2OA 5CIWA 1N5RA 4YFYA 4HQLA 2J9XB 2FMFA 3BMQB 2WIAA 2X3YA 2NU9A 1HF3A 1QE5A 3MZ0A 1LRJA 4BQNA 4CMCA 3WGMA 4CU2A 1N3BA 4RH3A 5L4SA 1IUKA 3LDFA 1HRKA 3JASB 4HSEA 2IZ1A 1U4SA 3KZKA 4YRLA 1DNPA 2PPVA 3I4CA 1I0LA 1W46A 1W36B 1JEQB 1L5FA 3LRXA 4EOGA 1OFUX 3K0AA 2IWRA 1RXSA 3RC7A 4ENVA 5JDIA 4MAFA 1ACLA 2AK3A 1R4ZA 2QQ5A 1OIVA 5K2OA 1RQNA 1WY5A 2J48A 3B9BA 3I32A 1U2DA 4G97A 3T3OA 3BJMA 1WD7A 4LNUA 5TT1A 4Q9HA 3PXEA 3QMVA 1IBCA 2Q8NA 3ANMA 3HCPA 4C43A 3LWBA 2IPNA 2YV4A 4RKRA 2AQHA 4R1MA 5D5QA 3KXKA 3FSGD 3PVSA 4JV5B 4Y2JA 5JFTA 1P3DA 1R0XA 2LE0A 4HG2A 3L4JA 1U1CA 2DH5A 5LQDA 1NQUA 5JZOA 2GN0A 1OJLA 3Q98A 4NWIA 4XPIA 1FU4A 5JHGB 1ULTA 1ZNYA 5FR2A 3WGYA 4ZQIA 5LDHA 2R2GA 4IFBA 1XBTA 3VJMA 3PJDA 1QRUA 1JZTA 4JLOA 4BO8A 1KP3A 2PLRA 3PD7A 4HDKB 4L0MA 5TQ0A 4HAZA 1ABEA 2NZJA 3TI7A 1M2EA 2VTBA 4G5SA 1N2IA 3F3MA 4X45A 3RSFA 2B25A 1ESCA 4UE6A 5E1BA 5G4LA 3IOMA 5KJ1A 3SDZA 5JC8A 5AI8A 1RKVA 2AZ4A 3ITEA 5K51A 2VOEA 3INRA 2QTZA 1OTHA 2OCYC 5TMPA 1O0BA 1DTWB 4YQEA 1A97A 2BGMA 5AW2A 5CDFA 4ARZA 4YDRA 2F3SA 5TY0A 4GP9A 1Z47A 3GRUA 2GT1A 2ZQZA 2AKEA 2A59A 5CM2Z 3ZK9A 2AFHA 4URWR 2CXUA 3Q3JB 3QA9A 5DRYA 3PEYA 1P75A 1JN0A 4V2IA 2PFKA 3ZQ4A 1LI5A 1V1MA 1H42A 2HKIA 1QIDA 4FFVA 1YU9A 3PL5A 4JR1A 5A3SA 5E4JA 3CVJA 2WTXA 1I1QB 2EJCA 4EG0A 5FI1B 2JFUA 2Y4NA 3L8CA 2CVFA 3V33A 3KEFA 2VF4X 5BYKA 5KHOC 1YC2A 3OUUA 4FGSA 1CHNA 4REQA 1DWUA 2JF0A 4S1NA 3WLTA 1NOIA 2O48X 3DLPX 1JHXA 1XRNA 2AG6A 5F73A 1IAQA 3V2HA 4D98A 3U7GA 4HX5A 1OT5A 3QFFA 4D9JA 2HUNA 4R3NA 1HXHA 2HLHA 3NYIA 4XVRA 3L4KA 2PX5A 1U9YA 1XEWX 3F3KA 1LBSA 2W42A 1EFDN 1F5NA 1VBMA 4UPEA 5KQPA 2EKDA 3SM9A 3GOHA 5IVDA 1JIQA 5EHZA 3K2QA 3BZWA 2F3TA 3WIBA 1RC1A 1W4LA 4Q9LA 5GIOE 4BTLA 2E2WA 3PC3A 1Y1RA 5M04A 2PUEA 3IEVA 1TM2A 4B9EA 2NO7A 3C3JA 3ZLJA 1QVVA 4EQ6B 2YJTD 6ABPA 5EPOA 1SCUA 2F00A 4MICA 3F7MA 3C3EA 3QUTA 1IOZA 3I52A 3V8VA 4FKZA 2OO5C 1NAIA 1JJFA 2Y8EA 4M1TA 4WJKB 1H22A 2MINA 2HA4A 4BE9A 2G9QA 4O4JB 2Z5VA 2IHUA 1X9HA 3G0IA 3Q6IA 4C5AA 1QUFA 1WTCA 2EGUA 2WHPA 2V7PA 3A9VA 4N5NA 1XNGA 5BSUA 3IRUA 2KPOA 3GG2A 2IS2A 3FCEA 3R3XA 4HH1A 4QXOA 5U4XA 1E79A 1YGPA 5A0VA 2DWQA 5KSOA 2C04A 3A9WA 1GTZA 4ENWA 4QXQA 3A4VA 2QVCA 1X14A 2XQGA 1CDZA 1L5OA 4QRIA 5ITVA 2GJ9A 1VSVA 1T4GA 1YL5A 2RH8A 1AZTA 3QMWA 5M34A 3ZK7A 5KYUA 3ZHSA 3EAGA 4M8SA 5I7WA 2Q62A 1B2RA 2A0FA 1UMBA 3DZHA 3DVLA 1EDZA 3O9VA 4DOMA 2J09A 4F72A 1S2MA 1Q91A 2V74B 3DTVD 3GDOA 1GPKA 1VBKA 2EJTA 1GSOA 3KYDB 2IDJA 2R7LA 2J6CA 2ONZA 5TE9A 2FW0A 3SJZA 5JVDF 1NJ2A 1FUEA 5F9MA 4L27A 5JQGF 1XQ9A 1BDBA 1U1GA 2P69A 1W88A 1R6XA 4M86A 4UXIA 4DEVA 1HK7A 2C31A 3HSSA 2HCTA 5AJZA 3ZWOA 1GZ3A 2F90A 2R66A 1B2LA 2X8JB 4KIUA 1KMIY 4PFKA 3VUEA 3YASA 2PS0A 1E1DA 2J31A 2ZJAA 3BUSA 4ND2A 4MRPA 1O9HA 1YS9A 2FGKA 2QG9A 5CT4A 4GPD1 2GUGA 3IQWA 4O1MA 3OWOA 2GPTA 1OWPA 3WRXC 3GP8A 3EZXA 3L1HA 1PFWA 2JLUA 5ESXA 1Z4NA 2VAMA 3T9DA 1UJMA 4EMUA 3AOEC 2SNIE 2GBIA 4TRJA 1IIBA 5EXSA 2ZYSA 3BFVA 1U7WA 3R4VA 1FS6A 3K72B 2R8ZA 4LY0A 2PX3A 3TOZA 3D7MA 5IKPA 3B78A 4IOLA 2QRUA 4KO3S 5ALVA 1VI5A 3NKLA 3I9NA 2J3LA 1QORA 3LFTA 4E5KA 5FTNA 4R7TA 5HJ2A 2Q6OA 3PR1A 4R8LA 1UJNA 4I6GA 4MVJF 4CM8A 5B2FA 2FPXA 1IDN1 1UPAA 1G7CA 4KLAA 3DKKA 4JI8B 2NUTB 4MRAA 2B9EA 4Q4HA 1BKYA 2B8JA 3IPXA 2WD7A 1U65A 4YRZA 1DL5A 1P0IA 2A5LA 2E37A 2QROA 2VPPA 2ZRHA 4TTTS 3DGFC 4L0DA 3SZLA 5ELLA 4PPQA 5K3DA 3RBVA 3NC4A 1K4KA 1LK0A 5TXGA 4NZNA 2AN4A 2H7XA 1MX5A 2WYOA 3NB0A 2G5CA 1Z6AA 5C5IA 2PHZA 3K9CA 4P4LA 2W22A 4J2TA 5JEDA 1GUZA 1KS9A 1NQTA 3CCCA 1EXMA 4MQFA 4QPPA 4R05A 4YIHA 3IAFA 1KYTA 3OKAA 3PXBA 4KC0A 5CFLA 4QVIA 1HZJA 3OFSA 3B6JA 5LD2C 1F4PA 1ZESA 2FTKE 1NV9A 2X5JO 2FN4A 1GU7A 2D1YA 3ONDA 2AHRA 5AHOA 3DOIA 2NVUA 3P9IA 3TW4A 1ADYA 4MPRA 4IILA 4PSDA 1E8MA 4MWZA 4G5YA 3PXUA 3UH1A 3TNDA 5HW0A 3JQEA 2PZFA 4GOXA 1GD1O 4RY0A 2RK6A 4TQ9A 5FR1A 2A5YB 1H94A 4B9AA 4JQYA 1WTAA 5CCBA 4ZQBA 4OAPA 1J1ZA 2MSNA 3TRDA 1T29A 3MTIA 4G1MB 2C9ZA 2XQIA 2O05A 3LOPA 4MLZA 3D54D 5DNEA 5AXAA 1JLKA 2QYOA 3THWA 4ETIA 5E8JA 2BWJA 3O2SB 5I8ZA 1EK1A 1N0IA 3FTNA 3IMFA 5ILOA 4W5RA 5LA6A 3MJHA 1ZCAA 3LSYA 3ASUA 2BHRA 3DQZA 3WR5A 3L0PA 4F46A 1XWIA 4TTIA 3Q3CA 3R6DA 4ZOQI 1SNYA 1E7SA 3WLNA 2W11A 1G1AA 3P0EA 3DOOA 4B8YA 2FSSA 2OFXA 1T43A 2GEJA 5JUWA 1KK1A 3FKSA 1Z4LA 4TS1A 1T2VA 1ZNXA 4HTFB 4CIDA 1ZHHA 3LW8A 2WF5A 3RROA 5BT8A 1RIIA 1UOOA 4JX8A 1YQXA 2F4NA 2WYHA 2HNAA 4WHMA 3AFIA 1V39A 2AQIA 5AOVA 1O6GA 5AQEA 3D0OA 4G23A 4HDMA 3TLXA 3U40A 1I1HA 2ZUTA 3VZRA 4UTOA 4AYXA 4BQPA 1DOAA 1DJNA 4HGQA 3HZOA 4GPTA 3BD8A 1K9SA 4QOJA 4RK0A 5EMJA 2XMGA 3FGZA 5ED4A 3HB5X 2JGJA 3PYLA 3AVTA 2XUIA 3I9V1 3TG8A 1ZS9A 2OZLB 4E15A 2Y66A 4TV9F 4BEBA 1D0IA 1LNQA 2XA1A 4XWGA 1SU7A 2GWRA 1DP4A 2ZSKA 3DOUA 1DBQA 3OJXA 5AKYA 2C07A 3UMFA 4OI0A 3S2UA 3MJSA 1QXSA 2YJ3A 3NRBA 2OV8A 4PCVA 3SJCA 1SBQA 1U81A 4YMVA 4C4XA 5I4KA 4MVWA 3MXTA 3WGQA 1HI9A 4D9GA 1DX9A 4QJBA 3AQ4A 1NVBA 4YB8A 4JI1B 1N2JA 3DF9A 2WWHA 2AFVA 3E3LA 3H9QA 1MAHA 4WZZA 5J4YA 2QI9F 3OQMA 2WZCA 2GXAA 3WHLA 1RRKA 3GHYA 1O89A 1TI7A 3WQQA 4EHNA 3TYXA 4JWTA 2P9YA 2ONCA 3IQFA 2VTEA 1FXUA 4F2GA 1QHSA 3ED5A 4BFSA 1I2BA 2CCJA 3K8ZA 1D07A 2ZREA 4AX4A 1OFUA 3ELDA 5JNSA 3BHNA 4AURA 1MA0A 5KC8A 5A5DA 1R6TA 1CJCA 2DTEA 2O1EA 2QTTA 3I9V6 3L77A 5K6TA 3P4UA 1XTIA 5SZIA 1EM6A 3KXDA 4KXLA 3MS7A 3SEZA 2QJOA 1EP1B 4FDVA 3GVIA 1AURA 1Z25A 2ROQA 4KGVA 1B74A 4YAJA 4HJRA 1UPFA 3AINA 3QWFA 1KQGA 4CKWA 5HXAA 1JA9A 1YBHA 1HL7A 3FOWA 4OGWA 2Q4RA 3SHOA 3MA0A 3LY5A 3CRRA 2NVUB 1DUSA 4F4FA 2AEFA 3F67A 4HEA6 1Z6TA 4HNSA 1ZICA 1G55A 1UAAA 3ZD7A 3ITDA 4LC1A 2L69A 3CR3C 1JG6A 1UEIA 3HN6A 3L92A 3I9LA 4YAKA 5IANA 1J0CA 3G5MA 4MQFB 1VTKA 1J9GA 3IOCA 4DABA 3URKA 1WZNA 1GILA 2JGAA 1S89A 1C29B 5ELMA 3UT5A 3UZUA 3OQOA 3FOCA 1T3HA 4NS1A 4LN1A 2HXGA 4PU0A 2Q4OA 2V7EA 2WOOA 4X84A 3GN2A 1U8EA 4QFMA 1Z22A 3N2KA 2FJUA 3A1NA 3WNDA 4OHFA 1EDOA 2UDPA 3DE4X 2K2QB 5FI5A 3S7ZA 1QYXA 5K5EA 5KYWB 1KQ3A 1RPZA 4Q4HB 3KEQA 3B89A 3RF7A 4NE9A 3DOFA 4Y8VA 4GM0A 4IJKA 2ST1A 1HDZA 3GJ7A 4HEA1 4IIHA 5HQJA 4H15A 1A7KA 2XIJA 2RI1A 4LDAA 3RVMA 4YCBA 2FEAA 5KQSA 1W5BA 2BELA 1ZL2A 2ODNA 1J56A 2ASEA 2VDRB 3LT2A 3VR5A 4RD0A 3WZLA 1R4MA 3HKCB 4OQLA 2EFGA 1HMPA 2V9CA 4BZWA 1XXLA 2VXBA 3SLRA 5K6AA 1Q14A 1IBLB 1NVAA 2BJHA 2DTDA 2JIOA 3VSDA 3E3OA 4F2HA 3CKKA 4BB0A 4URXR 2ATEA 3G82C 3RYFA 3HEBA 3TD2A 1EUYA 4L78A 3G0GA 2VUIB 2I55A 2QQGA 3TZQA 5A6VA 5LXTA 1CUGA 3AL3A 3NXKA 4FEEA 1IAVA 5FWDA 3OSZA 4C9BA 4KWEA 3O2QB 2BKUA 1SCAA 2HA5A 1KY3A 4HBZA 3RT1A 4BP1A 4WVLA 4PIMA 2O7QA 4FPXA 1Y6QA 5FOSA 1F7VA 4RIEA 2RFLA 1R66A 3CUKA 4J0IA 4U7WA 1H5UA 1U0OC 2X8JA 3IRVA 4MKZA 3THSA 4P34A 3IE1A 3RSLA 3MYRA 1W88B 1XZIA 3BL6A 5LQMA 4BB5A 4H08A 1MMFB 1OXSC 2E4XA 4WN9A 5E1DA 2WDZA 3WC4A 4C7OA 3IOYA 3L3BA 1P91A 1KBOA 1KMMA 2HWUA 4KE8A 5F5XA 2ETXA 2CHUA 2RKWA 1LVHA 3U5TA 1FC0A 3E7FA 1YS6A 1G41A 1TZCA 5T4EA 1LZLA 3ZV7A 1ZRSA 1YE8A 3M7IA 2EV9A 2LDXA 3D3JA 8GPBA 4LS3A 4JLMA 1JMKC 1VJ0A 5KDOA 2HMWA 1TUBB 5JS7A 1Z5VA 1UMBB 1J1IA 1TECE 3D3QA 4LDPA 2XJ4A 3NDBB 3SPXA 4LOHA 4RPKA 2DT8A 3A31A 3HP7A 3ZXUB 1EWVA 4H0NA 1A9XA 1MUUA 2SKCA 4NPAA 2W2NA 1H0SA 3ZHXA 4YAWA 3V32A 2A92A 2QI9C 3CY6A 5IEBA 1SKYB 1PNRA 5TVGA 3QG1A 3PGMA 2AI3A 1BX3A 1QIKA 3BSYA 3AL0C 1ECBA 2NTYC 3MRVA 2NN3C 4RH1A 2J5KA 3CZPA 3EC7A 1X2BA 5AXBA 2PEZA 3NUGA 3OCUA 1PJAA 2B4AA 5L3SA 2ZYGA 2D4AA 4TWIA 3T7RA 2YMQA 3ZW7A 3D81A 4CDGA 3C16C 4QM7A 1PW5A 1T4MA 3NT4A 4N9WA 2H16A 5AJTA 4REMA 1T6ZA 4O2AF 3TE6A 4YUVA 4PPGA 3WIUA 1SCUB 1L4BA 4N7BA 4RS3A 4FOTA 4XSGA 5DI3A 2OHJA 2UU9B 1QAMA 4GICA 3LXRA 4DMCA 4CM4B 2R1UA 3B1KA 1P7CA 2NQ2C 3ET4A 5DM70 1XFAA 5KIAA 3IESA 3UAGA 1NI4A 3I8OA 1I7PA 3EZ2A 3E9EA 2ASVA 5K0FA 1VM6A 4TLBA 1DG9A 2HREA 2P6UA 3OMLA 1Y9JA 4MO2A 1OB5A 1RWVA 1T0UA 4O8ZA 1NXVA 2PLWA 1G20A 3WGKA 1L4HA 1U7PA 4UATA 3J81k 2V8BA 5IU6A 1P31A 3H04A 1THMA 4FKBA 4B82A 3F9RA 4BNYA 2B82A 1IU9A 1WW3A 1WL8A 3KPJA 4F4IA 4O02B 1SVIA 2PN1A 4XSVA 5JS1A 2L0XA 4QHSA 4D3ZA 4US1R 4DQ0A 2BM9A 4QLAA 4OGLA 4DIEA 4ZYTA 3HRHA 4A0HA 2JJMA 3UOGA 5FO1A 3B8EA 1K3TA 3L6EA 4QQFA 5HIMA 2BTEA 4NTZA 1HZZA 1KMHB 2BFAA 1BU8A 4IV5A 4K7JA 1JX6A 1V1MB 3V9AA 2VHEA 1ZX1A 3DFKA 3G8BA 3CVUA 4D4HA 2BF4A 3HBFA 4E94A 5BQFA 1EHCA 1CUJA 1UBEA 2HHCA 1J97A 2DTXA 1AG9A 3D64A 1KI9A 2AJTA 3AW9A 4ARSA 3NNDA 4D44A 4B40A 1DTWA 4PC7A 3AFNA 3MILA 4LHSA 4HAOA 2ANBA 1A76A 1UC8A 3CX6A 3GJ6A 2WSYB 3OZUA 4WLEA 2H51A 5IYZB 3F71A 3GBPA 4JC0A 2HNKA 1OLXA 5TQ2B 3HMKA 3RJ5A 4GRIA 2G9UA 1DRKA 1C7QA 4S12A 5HG0A 1CLUA 1XHEA 2YJ5A 4B3CA 4JP1A 3N7UA 3DTTA 5EQTA 1GRCA 2QLNA 2H54A 2D2XA 2NO6A 2Q45A 1NY6A 2Q3HA 1E6KA 3HCEA 4N3AA 4QPZA 1O9BA 3JTEA 3K1AB 4N0QA 1A72A 2QX6A 3UB4A 4ZTZB 2VP3A 2YASA 2ZP1A 4I4TF 3FCOA 3F49S 4MWDA 4RK7A 1QS0B 3EEFA 3L7MA 2WWVD 4U2CA 4WK0B 4L0CA 2EBWA 4Q4JA 4CMEC 4DLYA 1F7UA 3FUXA 2HF2A 3CURA 1TCBA 4HF7A 4M6WA 4QAQA 3TMYA 4RSGA 5AW7A 2QW1A 1YVEI 4D82A 3T0FA 1MX3A 3QLVC 3GGOA 1KZ7B 5G41A 1G3IA 5GJWC 2C20A 2Z08A 3EYAA 4JYPA 7REQA 5IF3A 1NF3A 2DPXA 1B93A 1PBNA 2UUPA 3JWJA 4WXHA 2WY2D 3V46A 1CZLA 2XTMA 3HLYA 5IAEA 2OC9A 4MRRA 4HWPA 3U0BA 5MF6A 3VDMA 3GGJA 1A5BB 3ZU4A 2XHEA 4LFCB 2A6PA 3I05A 4OBWA 3ZBTA 4AY4A 2DHRA 3MB5A 2Z58A 4BDTA 2WPDA 4JT9A 1EWQA 3CNBA 4MUYA 1U9CA 2WB4A 2YBDA 3N2ZB 5A5FA 5LMCA 1W94A 4O25A 1ESMA 5H0IA 1JAYA 4QDJA 5HVNA 1I3KA 3IQIX 1FLVA 5CFPA 3T5BA 4CYMA 1AXEA 4HATA 4ROSA 3BSWA 5AKJA 4FEAA 4CDRA 1C3LA 2QRQA 3LGSA 3GLGE 1JJBA 1GAWA 1SG9A 1ZPDA 4B2LA 5KOJA 2A8YA 1DTSA 1TAHA 1L8XA 4KXNA 4Y2TA 3LP8A 1QJCA 2GZ2A 5DWVA 1QE3A 2QT0A 3V4FA 3ODPA 2EQBA 5BSGA 4ZOBA 4I46A 2Q2OA 3RCBA 2ADMA 5HFNA 6NULA 1FFAA 3HUDA 3EPJA 2C2YA 1N0WA 5KNBA 5LP6A 2DUWA 4G09A 3NRCA 3NO4A 4RFLA 1T4CA 3NOOA 4Y6PA 2WTNA 1TFUA 1RC8A 4I4IA 4A23A 1MVOA 4HZUA 5DFAA 4HPWA 2OSBA 3R6WA 3RLIA 4IIDA 5BOSA 3GZ4A 4G85A 4B0OA 5IJ0A 3FDXA 2VSFA 2IVFA 1BQ3A 3ADOA 3G68A 4BLPA 4DEXA 2GRJA 4LYGA 3ZV3A 4R7GA 1MTZA 4GIBA 5G0UA 3LHIA 2X8LA 4XM2A 3L8HA 2UYCA 3DFFA 5EXPA 3HWSA 2NU7A 4AMZA 1ECPA 5BQ3A 1D2AA 3OPQA 4ACAA 4EVSA 3NS7A 4QO7A 4TZ0A 1CZOA 2RDMA 3OCYA 4OXNA 3ZX4A 1X8LA 3ANLA 2CSUA 3Q10A 2QGNA 3OQPA 4A4DA 5IULC 5L6MB 3EVFA 4OA5A 1ZJZA 4MWBA 2XVXA 3FZNA 4MR9A 3TG2A 3P9RA 4RVOA 2AA3A 5CB0A 3Q8LA 3CB4A 1GPUA 4GGMX 1ECCA 3LJKA 5DO9A 4TTJA 4DV3B 1H66A 2WOJA 3K0HA 1L4EA 1ZMXA 2ZWMA 4M3NA 2Z5LA 2V7QA 2AF3C 3KT8A 1FOEB 4MS3B 3DW3X 4X1IA 2Z9CA 4K40A 2DLCX 3SSAA 4MW2A 1IVSA 2YZNA 2ZWPA 1ZOOA 2VDWB 4BZXA 1E5XA 4TL6A 2VT6A 3TFQA 2GLTA 3QVTA 2WEKA 1A9PA 4FYXA 1MEOA 2C2GA 4MQMA 4YROA 3ZBUA 5EIAA 4D26A 3GNSA 1M7GA 2B1GA 3GJ3A 2CVQA 2DWOA 4Q48A 2TMDA 3NZEA 4K5QA 3BTVA 2FUG6 2RHLA 2PT7A 1WEKA 1XZHA 4WKPA 3WNVA 1C0PA 1M7BA 3PWZA 2PKRA 3ZLTA 4BLVA 4JX9A 3K1TA 4C20A 1CT9A 3DFUA 1FYVA 4OYRA 1Q16A 1NA5A 4K9SA 3ZIAD 5DWQA 1QNLA 2O2XA 1RQ7A 3MELA 1WOYA 3QVJA 2QOEA 3KJGA 2ZJ7A 5IBQA 1NBME 2OPBA 3TECE 5TF4A 3DAFA 3U17A 1UBLS 1GU0A 3V4ZA 3ZLBA 4EUFA 2EX0A 4YN3A 1QFYA 1E6LA 2R6JA 1JYFA 3NPAA 1O4WA 4FGUA 3V3TA 4Y1RB 1YOVA 1T3SA 4YJ3B 1O0SA 3A1DA 4KO4S 3RNLA 4JVSB 4BKMA 1A8QA 1T26A 4O4IF 4MYTA 5E0KB 5K0SA 2BEJA 3ETLA 3FAKA 3O8DA 5KSZA 1M0EA 2R7MA 5JI3E 3SDSA 4OXRA 2QD3A 2V7WA 2XYRA 1TKBA 4V39A 3H84A 1X8XA 1XLUA 2JGFA 2PZBA 4JYCA 4GBJA 2HNBA 1JV2B 2GHIA 3WTBA 5I7EA 3I37X 1XYVA 1G3UA 1WF3A 2BV3A 4FYHA 1KEEA 4HPJB 1NKTA 5CK4A 3SNKA 3MMNA 3NIGB 3V4OA 4JJFA 5E3HA 5MN4A 4FNMA 1KJ9A 1Q22A 1KJQA 5EXEA 2ZBDA 4MUHA 2QE7D 3TLGA 4D9EA 4I55F 2CEAA 2RCNA 5JLJA 3JQ6A 1V47A 2H4XA 5ICFA 1AQ6A 2PANA 2QMZA 3T3DA 1G2OA 1PGOA 1XEXA 1VXOA 1WQ1R 2A35A 4NFHA 4W1RA 1KJYA 3B6EA 1NTOA 4DA0A 1FNNA 1DJQA 2OUIA 1NSFA 3QF4B 4ID9A 1RPNA 1Y3FE 5ES4B 4QYWA 1FP4A 1URPA 2GF2A 1A1VA 4DR1B 3DB1A 4BIMA 1UC5B 4G37A 1D4AA 5ER9A 1KIAA 1DV1A 2IHZA 4JGGA 1PG2A 3HGTA 4L4YA 2M6LA 3R7WA 3GEGA 3TX6A 3RNOA 4YLGA 5IBRA 2EJWA 3OJOA 3HADA 3UAZA 1BN7A 4DWOA 1HGXA 1TLLA 4PQEA 2W8BB 3C6QA 3EIFA 2A3NA 3OZCA 4R40A 2ENWA 1CLEA 2NTEA 4KJZA 1MJGM 4EFNA 1M5RA 2VWQA 2DSNA 3A7DA 3BFXA 3EC2A 2D0OB 4Z1MA 1Z8FA 5BQPA 4MVJI 4GSKA 1VI2A 4OI2A 3ETEA 5FEMA 3IHTA 1Y1KE 2DR0A 3EN0A 1XNQB 1V26A 4OF4A 4J9VA 4JKYA 4YRPA 4GX5A 3TXYA 3WG9A 1U0RA 1XPUA 4MWTA 3IEPA 4NXNB 3CG4A 3UFXB 5JCJD 5JD6A 4TMTA 4RVHA 5K3AA 4OLBA 3EF0A 1FMTA 2QN2A 4J16A 2H57A 2W58A 1MOSA 4OUKX 3JS5A 4H7PA 1KDOA 3H2KA 8ADHA 5TGZA 1DT3A 1H2BA 3H99A 3H8SA 4YCJA 5G0TA 1MD9A 3SOZA 3TTSA 4W1QA 1XZKA 4NYMR 4YJHA 4XQ0A 5ULLA 1USUA 1H85A 2P75A 4RYDA 2X0DA 1WETA 1YQDA 1SURA 3OEHD 3IBGA 4MHOA 1JPUA 3PT9A 1HSOA 5LBIA 4GYKA 4QG3A 1IMOA 3QELA 3UV7A 4RAQA 2B35A 2OCKA 4RD1A 5DN6A 4BYGA 4X91A 3UJ9A 1R0YA 5IFKA 3KQKA 1RYZA 2ZRBA 3ZVRA 1XDDA 1W0CA 1E9SA 3A3OA 1COWD 2VK2A 3HVUA 4P0TA 3TLBA 5GVSA 3IIKA 4J4HA 2C5AA 2J9FB 1EHIA 1GZHB 1U80A 3QE0A 1POWA 1U0TA 4ZVRA 3RC9A 4CCYA 1UFKA 1VLMA 2V65A 1W7AA 3VTFA 3TAXA 4EO9A 3UHAA 4G5HA 5KOHA 3SBDA 1P4JA 2WRZA 1NXOA 1XRQA 4KN5A 5CDUA 4PG5A 2VF7A 1BOFA 1ZI8A 2NXCA 1NVVQ 2V7XA 1AMUA 2Y3IA 2KS6A 4K9RA 5AH0A 4WECA 1RPAA 5G0SA 4A6DA 4E12A 2I78A 3IAS6 4WJLA 1RP7A 2IUEA 1KFEB 1TU3A 3AEUB 3D59A 1PVOA 3S27A 1TM1E 2ZSIA 1P5FA 2I1WA 4XWOA 1RCTE 2B8EA 1X7WB 1T0JB 1S01A 2FPMA 2RH5A 3H97A 4NNPA 4R98A 1VHQA 1TE2A 4WEQA 3RVQA 3VR6A 4CQMA 4YUYA 2PRZA 4QLBA 4Y6GB 3RBXA 1Z7GA 4MMYB 1NJGA 2V7BA 2ATVA 2NLOA 3HCFA 2G1KA 1V71A 3SX4A 3M6MD 1U04A 1M1NA 2VXCA 3RI3A 1NU6A 3RG2A 1YD7A 4F2WA 1TT5B 2CBXA 1E1KA 1CR1A 1SIBE 3L41A 1EVKA 2OZKA 5HTOA 5DVZA 1NMYA 3A6GA 4KLCA 4MV8A 4F7WA 4HZUB 3IDFA 3TQRA 4NSNA 1E9FA 3GUUA 3TUZC 5F1PA 1PX0A 5GP1A 4IGIA 4F5WA 1MJNA 3WGVA 3KQQA 5HRCA 3CWZA 4RJ2A 3WA6A 4PBRA 4HY3A 2GESA 3AR4A 4Y1GA 3D8TA 2JI8A 3G1WA 4MVJA 4UTRA 4ZHSA 1V1RA 3FTFA 1OW3B 4AMUA 5BV7A 3G5AA 3ST7A 4DLAA 5JAIA 2X2EA 1YU6A 4HGNA 4TMVA 3ZHCA 2EL7A 2QTMA 3E2MA 2B3DA 4LDJA 1LUAA 2GO7A 4GECA 1DFIA 4Y2HA 3CXUA 1QLHA 1Q1EA 4RSMA 5KQRA 4P5DA 2AMJA 1SCDA 2C3PA 4JBIA 2VNKA 2B5WA 3DXXA 5TSDA 2C9MA 2OYSA 1AZLA 1R9MA 5CXSA 1XZEA 3PF9A 1DC5A 1GZVA 1U2RA 4LKRA 5DN6D 2JB9A 3KKLA 4F84A 2ZJ0A 4PICA 4NU5A 1XNRB 1FY2A 1KC1A 5JNRA 1OXMA 1Y4SA 4M0LA 1RXEA 2ZPAA 4TM8A 1PAUA 3M9XA 4MV5A 1H4SA 3HBJA 1TMYA 2XQVA 5IT4A 5JZMA 4MQUA 4PHGA 5ICSA 4JAVC 3GV0A 4MS4B 4Q7QA 1J0AA 5HS6A 5JH7F 1KDPA 4DNPA 2VSXA 1O8BA 2OP1A 4U7HA 5GZ3A 2IYOA 1X7ZA 5U1PA 1Z56C 4WNYA 1QG4A 1RD4A 1TQ2A 2A1UB 3ZJYA 5CLFA 2ZUFA 2B8WA 4YQYA 4KQHA 1CY8A 3ETJA 3IB6A 4Q3KA 1NZFA 1IZ8A 2QNRA 5GQSA 1AS0A 4YI5A 2YJ4A 2DBZA 2IBTA 1M72A 2QQEA 1YDHA 4H7EA 3D8UA 3S2GA 3QY0A 3ZY6A 5JDCA 1JDJA 2QORA 4BMSA 5AHXA 1I6WA 1A9TA 3LHSA 3SXUA 5AVVA 3WHKA 2LKDA 3PHHA 4E7OA 3TTYA 3V2IA 3W90A 4LF8B 4HB0A 2ACEA 5E9JA 4BE4A 4OMFG 4AQYB 1V0JA 3NH9A 1H2HA 4J6EA 4URUR 1IMJA 1U9ZA 5D3QA 4ALJA 1VGVA 5AOBA 4XWYA 1BJTA 2JAQA 4ZAGA 5FBHA 1NKVA 2OCAA 4K9OA 3DGEC 2QXTA 1SG0A 4FYVA 3GZNB 5CIQA 3QVXA 2RBEA 1EGMB 4J3JA 3F8TA 1UXIA 2JATA 2R62A 4HN9A 4HWTA 4WZBE 5B36A 4BNIA 4RYLA 2E18A 1OI3A 1BS2A 3D43A 3D2CA 3K09C 3NFRA 4P93A 3TQSA 4DM3A 1GNTA 3LA6A 2WSMA 13PKA 3SMQA 2IYTA 4AY3A 1SKQA 2FXIA 2Q49A 1WZUA 3GHHA 4X8MA 1VYVA 1LXCA 2H4ZA 2WAOA 3STWA 4EW2A 3RUDA 4J4TA 3FDFA 4ETMA 2QSJA 3EJ6A 2H7YA 5BMVB 2X0IA 1J5PA 3KTAB 1N6OA 3PD1A 4KSCA 1CJSA 3TLEA 4FGKA 2O4CA 1H0HA 4GE0A 1Q1AA 4WCDA 4KG7A 1M6VA 3OIWA 3ROEA 4BNDA 1GM5A 4FHGA 5LQJA 5CA0F 4WXMA 2CYAA 4XJTA 4O2AA 4X5OA 1MW8X 2OXIA 2R6AA 4NEGA 4WZAA 3SJ7A 1VJGA 1Y98A 3LOUA 3WLAA 4CMIB 3EF1A 5EIWA 3VPHA 2QGZA 1GYQA 5B1SA 3WK8A 3A11A 2DFNA 4UOZA 2C0QA 1YVRA 1JIJA 4WINA 2DLNA 2RJ3A 3G0CA 1QH1B 4BQSA 5GIPE 2ZSDA 3NTVA 2PUFA 3EXHC 1IIRA 3VDRA 2OORA 3KTDA 2IGBA 2Z5FA 2GH1A 4GUAA 4YJ2A 3ZXIA 1FJGB 4XFJA 3KD3A 5CH8A 4ZI7A 4UDOA 4HNAA 2WYWA 2FQQA 3R6GA 3DFIA 4JDPA 5BQXA 3I2FA 1ZVMA 5A06A 4N3NA 4DSUA 2IS4A 1L9KA 3EIOA 1ULAA 4OH1A 5JT1A 1AK1A 1NWCA 1JT9A 1UBCA 1ECFA 3TLAA 4FFOA 4CIYA 3ZJVA 2TMYA 3C8UA 3VVLA 4WESA 4BX2A 1VZ3A 3GFFA 4PN3A 1JFTA 5L3SB 1OYWA 2PRJA 1QVAA 3LPLA 4HB2A 1Z9BA 2FQWA 5JG7A 3SC2B 3T34A 4B3JA 1Y7TA 1B73A 4ZALA 4CF3A 2VA8A 1B16A 1X1EA 2P5SA 1GGNA 2WM8A 5TPWA 1SUSA 2X42A 1J0EA 4PGAA 1N2SA 2WICA 2JI6A 3ICPA 4NJMB 3S6JA 4C0LA 2B7BA 2EX1A 4DCVA 2POCA 1KH2A 1GA4A 2GX6A 5ER6A 4TWAA 2I1QA 2WAMA 3H18A 3JR7A 1CD5A 1DJMA 2HV8A 2OFWA 3VKVA 1P2DA 1YRWA 3B7WA 4B45A 3T1YB 4L5AA 3P52A 2QY9A 4E7PA 3IUPA 3E27A 4LTNA 3WNQA 1P0FA 2B2NA 2VJCA 3OKFA 3RK1A 3S2FA 1N7GA 5CLIA 1T8UA 1C9YA 3UBTA 4N39A 3DV2A 3LCVB 1XWFA 1XA0A 5LZ7A 3STYA 1KI3A 3MJTA 4BAZA 5T6MA 3KSAC 3OJFA 1QGZA 5ALMA 4EO4A 3GJXC 3GIDA 4GS5A 1OHHA 2VRBA 3P9YA 4Z53A 2G7MC 1FYXA 2JD1A 4XR9A 4ZOCA 5JNVA 3C98A 3D6NB 3FUWA 2PG3A 4PO9A 1Q0PA 4U9UA 1GADO 1NBWB 3UJBA 4DR6B 4WD3A 4FSDA 1P4HA 4PLZA 3MCVA 4ADSG 4ER5A 3QU9A 3IFSA 1Z37A 4GPZA 4AZSA 2O8EA 4PM4A 3KLPX 1SOMA 1U1FA 3I09A 1HO3A 1RE1A 3K0SA 2Q5IA 2OLJA 2BM0A 1EE9A 3LXXA 1CVIA 1JQLB 4MS1B 3G23A 2WJIA 1NUAA 1VCIA 4XUCA 1ISMA 4BO9A 3WAGA 3S2EA 3HYCA 1Y6FA 1DELA 4L5JA 5CVJA 4CI0B 2W5UA 3ESZA 4YRFA 5C52B 2AMLA 2FEPA 2PUTA 3BF7A 3I9KA 2RARA 4FZ5A 1XJQA 2OG1A 1H23A 4I50A 4L3OA 3QU4A 3UNXA 3DL7A 2X0NA 4M53A 3B3FA 1FEZA 4QPDA 5EWLA 2YZMA 2WQZA 3M83A 4ZI3A 1C8BA 1G2IA 1R74A 5HF8A 4OBXA 2E5FA 1M2KA 1TO6A 3C85A 3AC0A 4GOLD 4EG7A 1V1JA 1NJ6A 3V80A 4B8ZA 1U1IA 2BBSA 1O57A 2Q2WA 3L7OA 1CFZA 4QUIA 5AKEA 3ZCRA 3UIEA 4NP6A 5K6AC 3HR4A 4GKJB 1X7ZB 3FWYA 3C1AA 5KJ6A 1KOFA 1TK9A 4R9RA 3FPAA 3VQTA 1ZOLA 5A02A 3LCJA 3HXKA 4XW2A 1F8UA 3AWIA 1P2TA 3KV1A 5EZ6B 4URFA 3RLFA 5HHTA 5JDIC 4JBHA 1EVIA 1Q7CA 3DG9A 4HN2A 5K0BA 5L45A 4Z51A 2CSXA 4Y6OA 3PQ6A 2O6HA 5MGBA 4ZJZA 1A95A 1L5VA 4AWXA 4U7DA 1N2HA 1FUIA 1PWXA 2AHOA 2J5RA 1H8HA 2PGDA 2YQ5A 2ZUVA 3KWMA 3L7BA 4B09A 2G25A 1EBUA 1RLOA 1DDIA 3O73A 5LIRA 3EULA 3Q3IA 5LU9A 3AEQA 3IBTA 2B20A 1UK8A 3PC7A 4P54A 3ZCQA 5FBVB 3ORFA 3CMMA 1JHVA 1JZQA 2Q1TA 4H18A 5D6OA 2GPNA 3F2IA 5CVUA 5AO9A 4ZJYA 1EB9A 1XK7A 2LWIA 1ZUNA 3THOA 5LQAA 1U1EA 2IS1A 1DEXA 2Q4DA 3D0RA 4W6ZA 2PD6A 3P4XA 3PFBA 1QHHA 5JMTA 1PT7A 4H0FA 1JHDA 2VQFB 3AILA 1R00A 1T10A 3H11B 4PYNA 4B3DA 1FX0B 3MTJA 1V1RB 3EAQA 2FQ1A 4BMYA 5AQ1A 2GM5A 4BFVA 4YMTA 4HYTA 3LUGA 2X7XA 3O93A 4XDHA 4DNXA 3PCXA 2J6BA 3DBOB 1RM4A 4F4UA 1U5AA 1C81A 3RK4A 4F9GA 3GPIA 3E4CA 3TIXB 1ZM7A 3MB8A 3SR0A 4BOYA 1VJ5A 3HYNA 1WQ3A 4HVTA 2I76A 5TLSA 3M6AA 2H1FA 3IXLA 5K8CA 1JR3A 3QVMA 5K03A 4XJVA 3I30X 5J9FA 4MIKA 3RTCA 3TRIA 3FPLA 2A86A 3DC2A 5H4GA 1GG2A 5CH5A 3ZY3A 1SK9A 4L4XA 4UNQA 3RSHA 4YR7A 1QP0A 3PTZA 1S4MA 2IPOA 1YA4A 1G7SA 3CUWA 4NMXB 3CZMA 4FJ1A 4AIIA 5LP1A 1VKHA 2VDKB 4UNSA 4Q3DA 4HZGA 4CKCB 4RADA 3C14C 3UYLA 3ZU5A 4G9EA 4JKIA 1Q1QA 3KR0A 3R40A 1F51E 2OM6A 1V8PA 4NV1A 2GI4A 1V37A 4JBYA 2D2IA 3CNLA 3NTLA 4KPUB 1DBRA 5FQOA 3AHGA 4LQCA 1E3SA 2D8AA 4JJEA 3AM3A 3ND8A 3GY0A 3TCKA 1A69A 3CUSA 4BMNA 4V1CB 1EGAA 2EYQA 4MMZB 1ZN7A 1R6AA 3AETB 4QA9A 4ZEVA 2Q7DA 3RPEA 5KDDA 5JJLA 3OJ0A 2ENUA 4JIGA 1TQ4A 2G72A 4RELA 2PQ6A 3BRWD 2QMQA 2PCJA 4IHKA 4KTTE 2XYGA 2HGSA 1OBCA 3FNRA 4HVAA 3ZOZA 1VJTA 3OI7A 3P9ZA 3G5UA 5DNVA 4TLMB 5COAA 5THKA 4NAHA 2X9GA 4DJEC 2IYRA 2O7SA 4K2AA 1I3MA 2Z2KA 1II9A 4RMHA 4ML3A 4ZAWA 4UQOA 5FDFA 1QMPA 4TQUS 4DSOA 2Q2NA 1DX4A 2HU2A 5EFZA 2VJDA 3EDMA 5EEHA 5B6JA 5HJ7A 4X62B 2JFXA 5DBGA 3Q7SA 1KWKA 2XXJA 4IMJB 3EQ9A 4EHHA 4YCSA 4KXWA 3W5JA 5JI2E 5HFJA 5JD3A 1VPVA 4IDOA 3WAKA 1RXWA 2FFJA 2H0AA 1HNNA 1KYVA 1IUPA 4Q7EA 3TD6A 3F6YA 2XUAA 3T3EA 3T15A 2JLZA 4C0HA 1V5FA 4BO5A 4IIFA 3SJAA 3W1VA 1H2AS 4AMGA 2O57A 3I8SA 4TWJA 1MTOA 1OILA 1WWKA 2HWYA 2R1ZA 2XUFA 1YI8A 3NIWA 1SO8A 2R751 2EKLA 1J24A 3L40A 3LG2A 4O63O 4OH7A 3TCNA 2QP3A 3BD7A 2VCYA 3EZ7A 1YCHA 1BN6A 1PG0A 4P80A 3ZJUA 1D04A 3T9FA 3I9JA 5C37A 1ORWA 2FW7A 5KNDH 3GAMA 4O4HF 4JYMA 3ZI7A 2AIRA 1DLJA 2HU8A 3IKJA 4QOFA 2JIZA 2IK8A 3I4LA 1Z26A 3I6BA 2GN4A 5H9WA 4MWSA 1T2FA 1Z63A 2X9LA 2W8BA 2GK7A 1E98A 3D1VA 1LJUA 3F46A 5FI0B 4G0VA 3ZKWB 1QIGA 1RDFA 1V9CA 9ATCA 3K53A 4L4SA 3GFSA 1JKXA 2Z3WA 2ZSAA 3PXDA 3CZCA 4J4BA 3ERCA 1QF7A 1MO4A 3A10A 3KBOA 4QUKA 2A9JA 2NZUG 1FP4B 3BMXA 4B74A 1QHGA 2PX0A 3QF4A 4DLKA 5GTDA 1KERA 2XCRB 2XT9A 4F11A 3AUJB 2AZTA 2CZQA 1ML3A 4QQKA 4TKVA 2QUIA 5DHAA 3UICA 3RUEA 4KYUA 5E8RA 4M7PA 3RYCB 2PE5A 3U7QA 3GJZA 4M8NE 3CZ9A 2VZ8A 4RE5A 1XU4A 5ECGC 4LZPA 4AJJA 1UAYA 1MC1A 3MD0A 2BD0A 3K09A 3WGOA 1NI5A 5CVEA 2M1XA 1CQIB 4IP0A 4JB8A 4XCXA 1DI0A 2HJGA 3H2YA 3JYOA 1SXJC 3OY2A 4PX5A 3CFYA 4V0RA 2SECE 1E0KA 3JD0A 3ZDEA 1N2ZA 2FMXA 2ZJFA 2PQ0A 3ROKA 3J81A 1IJBA 4LXGA 4NBLA 3O8RA 3A6PC 4JLUA 2WKSA 4IDFA 2QN1A 1EX9A 1GL3A 1O94D 3MT7A 2PX8A 1JHUA 3FPHA 4AZ3A 3CRW1 3RFVA 1KEVA 3DYVA 4CKEA 5B3AA 1V25A 2I65A 3A05A 2A5DA 3GLHE 3IT1A 4Z4HA 5HGXA 5LDDC 3JZAA 1W52X 1V7ZA 1NLUA 1VL6A 2ZAOA 1VLLA 1DQYA 2X15A 4KAFA 5DLPA 5C0OE 1OD6A 1UBOS 2FSFA 1LQUA 3MGGA 4Q4DA 1Y4DE 4GEGA 3ENZA 1NI3A 1I4WA 2V3VA 4O2BB 2EC5A 3GEMA 4K87A 2ILTA 3GFTA 1KO8A 2OBLA 5AYVA 3WGZA 2IYEA 2EGGA 1Y9AA 1U31A 4RWZA 1HEUA 1UDAA 3PFIA 4IUYA 5G1NA 5AKZA 3I73A 4AN0A 2Y2VA 1N5LA 3WK5A 4M89A 3E7XA 1NDUA 1SRRA 1YK0A 2QHXA 2VAPA 2GM3A 4FQ7A 4CHGA 2DZDA 2H00A 3H6GA 4DCMA 3HWRA 3OQJA 1M66A 1TEZA 3PDHA 2JEYA 2GD0A 3II6X 2YQ4A 4C06A 4EBBA 2WFZA 2XODA 3QWBA 4G4GA 1MN6A 4GLLA 4RMNA 4EB8A 2XYVA 1ICIA 3S7TA 4GWLA 4HX2A 3TZ6A 1FIUA 2P1ZA 1W44A 4EHKA 2H63A 3S40A 4E11A 3ORQA 4HS4A 1I7QB 4W9MC 1VL8A 2ZBUA 4MKFA 4RVNA 2AXEA 2ODBA 2XB6A 4UDXX 1DGQA 5DI9A 1MR3F 1TIPA 5FLXA 2I7DA 1NKSA 5JEEA 4KACA 2DPHA 4NBNA 4IDPA 2QYSA 1OSNA 3HVIA 2RHJA 4J1TC 6GPBA 4WI1A 4ZD6A 3ZZ0A 3QJGA 3DL4A 3GU3A 3LPMA 5B5SA 4E14A 2WMOB 2WU0A 4LTDA 4MS3A 4HDNB 2HRRA 4R2LA 4X1IB 1Z4JA 2IZZA 4Y2VA 1L5KA 3KO8A 3LDGA 3KVOA 1LLCA 1TUGA 3RS9A 3DUWA 1KQOA 3LC2O 4MV9A 4RXUA 1OLUA 1RJ9B 4OGFA 4OLHA 5C4GB 3AVVA 1YVDA 3OO1A 1RXYA 4FIZA 3P9NA 1BVRA 3UWMA 3LFHA 2OCBA 1MAUA 1VIYA 3AHDA 4ZQCB 1OZ0A 3KWJA 3RUCA 1G4HA 5A6SA 2ETVA 4PHFA 4AZTA 2C7VA 5IAKA 3MCTA 3AFHA 2W6OA 2OBFA 5HBRA 2JEOA 4Q1DA 4HPXB 3VHXA 1XELA 4AJOA 2AFHB 4JOBA 3SKXA 3RFUA 5EHIA 3UWKA 2WT9A 4N03A 3HJGA 3M5PA 3X1WA 4FCCA 3G02A 4R5HA 3DT6A 1KI6A 2WTAA 1DHTA 3KV3O 5DULA 1V8DA 4AJIA 5MN6A 1K66A 1ZD4A 3AR5A 2BP7A 4OSEA 3WLHA 5HPYB 3H8WA 4IH4A 2GK6A 3ZJ5A 1WB9A 3I62A 3U3JA 4LWOA 5I7SA 5CVCA 1BMFA 1G6OA 1KA9H 4ZYZA 5KNDD 4IIJA 1A7UA 1AC5A 2UYYA 4CQLB 3K9FC 1C7RA 3FKSD 1QJ4A 1CUAA 4HDKA 1AK2A 2O6LA 4UD2A 4EJSC 1XD8A 1E1QD 4AI6A 3PFHA 1NG9A 1SZCA 3EBLA 3KYIB 3P5SA 3C7TA 3N53A 4G8BA 4IZOA 2WTUA 1SUIA 4YRKA 2ZYWX 1RVV1 3DBVO 2J67A 4LHXA 3G2OA 4XPIB 2JAOA 1W4ZA 2EKQA 3IELA 4MUBA 4TM7A 5JBQA 2PYIA 3O4RA 2FOXA 5E7IA 4HK4A 4EHLA 2H4JA 1E6CA 1T9GR 4H7JA 4O6VA 1WP9A 4EVRA 4NCAA 4KIWA 4ANFA 4J0EA 3Q7PA 5C80A 3GQBA 1ZC3A 3FD8A 4WXEA 2CNBA 1UR5A 5TGDA 2IYAA 2PH5A 3ICCA 4L3WA 5BYBA 1HQDA 3BMCB 1N57A 2V4UA 2Q3BA 3NWBA 2X1MA 4OPMA 1I30A 1WZ2A 4Q9JA 3NBFA 2HHHB 3MOGA 4EG3A 4G0MA 4RF5A 2DKOA 2HHJA 4A73A 4DQVA 3CO0S 5BP7A 1T34A 5U4QA 3OY7A 3VXKA 1P0CA 3CZ5A 3JVVA 5HYVA 2E48A 4GX1A 1BWPA 3GUCA 3B82A 3OIUA 2OOKA 4CUKA 1L4NA 3T61A 4L7QA 3PUWA 5H5JA 2C1XA 2DKFA 3WYAA 2AK2A 5AK5A 2R1TB 2KHZA 3D6MA 4GL4A 2DKNA 3PS9A 5DBOA 3B1XA 3R7AA 2COEA 1OUMA 4DMHA 5ALZA 4LNHA 4JUIA 3QMPA 1PP4A 1PT5A 3BK1A 4IAOA 3O4JA 4R2JA 2BEWA 3AIIA 2CY0A 5AM2A 1I33A 2ISSD 3HVHA 3NT2A 5HBGA 1OH5A 2JFOA 1Z5PA 4KFTA 1KQFA 3SR3A 4AF8A 1TRKA 4K86A 2WE8A 2GN8A 3WYEA 2EFEB 1CNMA 1YFKA 4DDHA 3DFZA 3NOQA 1QS0A 4OLAA 3M5DA 2EWVA 1ZJ4A 2PUWA 3URMA 3V5NA 3WB9A 3ZWWA 2CV0A 4WY8A 1JT2A 2WLSA 1QX3A 3JXEA 2R25B 3QVVA 3DCYA 2VJMB 3N2LA 4I81A 4JP3A 1CE8B 3UQYS 1E2DA 1XAIA 1IL0A 1GFWA 1W2WB 2Y6VA 1QHEA 3DBRB 5CT8A 2GN1A 2BEVB 1B3RA 2VYCA 3EH1A 1PTKA 4KQKA 3ZU2A 3RSZA 4RTNA 3H9JA 1FSZA 2LIPA 3OCWA 2NSYA 3KQPA 4FXOA 4WXYB 5CFZA 1F3OA 5HCNA 1J9EA 2G9ZA 5IYZA 4M9CA 1GLNA 4IUDS 3OPYA 5H59A 1QQAA 2IHYA 5DM2A 2IGTA 1Q7TA 4BU0A 5IC5A 1IM2A 2PSFA 1N2XA 5CK5A 2VWPA 1J2JA 1GUDA 2OB2A 1KHHA 2QXYA 2Y99A 3D2BA 3JZMA 4LBWA 1Z82A 3BJIC 1E96A 1ECJA 2GSDA 2OBBA 4J7AA 4QC2A 4X41A 2EW8A 4G65A 3RWMB 3NGXA 5JCXA 3SHVA 4WY5A 4UTNA 3ULKA 1P1CA 3K5WA 1M2GA 4HV4A 1R4NB 1FQOA 2O5RA 3KAQA 4Q02A 1T2DA 2ZJ5A 4XJSA 5ALPA 2GZHA 3SM3A 1NSYA 2DECA 2IZ7A 2D00A 3BCUA 5CLJA 2QR3A 3W6PA 1HYGA 2RBGA 1WPXA 2XCQA 3NAQA 5HQ3A 1CW2B 1DBVO 3D3NA 3JQDA 3PUYA 4EHFA 1UJ2A 5GM1A 3C8ZA 3TM4A 3DE3X 4A2QA 4LZWA 3J7TA 4C0KA 1NUHA 3BD6A 1B1CA 1ZRHA 4Z7OB 4ACBA 3U4MA 4RV5A 2UXBB 1G20B 1JL3A 4EA7A 3BRSA 1A4RA 5CHEA 3C8MA 4DXDA 1W93A 3PUIA 1Y8RA 4LWQA 3BIWA 1F8XA 2BBWA 1YIDA 4OP3A 3TTWA 1BDMA 1M6YA 3IP6A 3IQHX 1UBRS 1ULZA 2Y1OA 2JCSA 2BEUB 2JFBA 2N1BA 4ABYA 3U4IA 5IG2A 2VTKA 1OH8A 3DWFA 3NJRA 1B0AA 1XVAA 1H1TA 2J3QA 2OAGA 1E5TA 3DSRA 3DLAA 4EEXA 1UQTA 1YR6A 3K0KA 4AP6A 1Z3IX 5KVVA 3S99A 5CXQA 2X6RA 1LDGA 3F5FA 1VKZA 2BKVA 2QF7A 3JWGA 4EY8A 1GQQA 1HT1E 5FPSA 5D6NA 4MNTA 4NZPA 4TT3A 1A8SA 1PZGA 4OREX 1T13A 4RM2A 2Q8PA 2GAFA 1QO7A 4NOMA 4OM8A 3FGPA 2H85A 1CY0A 4RABA 4B33A 3F7TA 4XUDA 3HA2A 2WF8A 2XOKA 2B1IA 2I7XA 3RC2A 4YX9A 3WLRA 2PXXA 1W2GA 1MPTA 1JDUA 2X23A 3HO6A 4R8MA 5FBKA 4CGYA 5ICGA 1DIOB 1XRJA 3UQZA 1YHYA 1PJCA 3A32A 4W5OA 2ACWA 2I6FA 4G01B 2HMYB 4Y9TA 3C6ZA 4KQCA 4FFWA 1S5PA 5JXGA 4MA0A 1EUQA 5JCOC 1SB8A 1BMQA 1T4BA 4Y2SA 4C04A 4NHOA 3BCHA 5JTUA 1JDBB 3ZWMA 3G9QA 1ODIA 3EXG2 5FWAA 3EGOA 3UUWA 1KRXA 3WWEA 2AWOA 5LSAA 3H1BA 1C8VB 1UXHA 3EXHA 1HDIA 1AGYA 2HBZA 2F67A 4X6UA 2VWGA 4PLPA 1MC8A 3BCSA 4UARA 5DPMA 4DA7A 4MVXA 4Y67A 3UA3A 4UU1A 4OSPA 1H9BA 2OHIA 5HIKA 2I5PO 4CIVA 4YP5A 4WGFA 2O54A 2FWNA 1E7MA 4LV5B 3HXQA 2QYHA 1QLWA 1N25A 2IYQA 4KP7A 4X3OA 2FFAA 3LBNA 2W70A 1X9GA 1TA0A 3ROPA 1PV1A 4ZIRB 1WE2A 2AFIB 2IYPA 1FX1A 3BM5A 4L5YA 4RQAA 5HUHA 2ZYHA 2HD4A 1DAIA 1UANA 3AJ8A 3H2BA 4MSUA 3VX4A 1J20A 4H4DA 4B6OA 3WL8A 4DKXA 4F8YA 4HWSA 3W7VA 4UCXA 3WYGA 3CX8A 4RDXA 1PGNA 1F2DA 3GMTA 3TSWA 2R5FA 1SXJD 2J59A 4EPYA 1U3FA 2OGZA 4MI6A 5T6BA 3R44A 3TRHA 4BNNA 4O1HA 4KGXA 2PKXA 3DEAA 4FR2A 3IAS1 3QA3E 1LV8A 5CTJA 5ALSA 5EUBA 5AKHA 1GPWB 4YJDA 4CKYA 2F1IA 3FLBA 2D59A 3VVMA 3FDZA 3KBBA 4P82A 3BE6A 4EPRA 5C3UA 4RENA 2DAPA 1J0DA 1YS1X 4K3VA 1L5SA 2NZWA 1UWLA 4XR4A 3LLSA 4KV9A 2AYYA 4UUMA 1AKTA 4EJSA 2YC2C 4XGQA 1L5WA 2G1UA 3C87A 2DY0A 3EVEA 3PJGA 4QBTA 4KPYA 2K6GA 3JVUA 2GF9A 5FPHA 5EA2A 5BXQC 4YCNA 2VP6A 5B3JC 1OI2A 3EVTA 4X6YA 3HU3A 2V1XA 4V2UA 5D86A 3RRFA 3K9LA 3C1OA 4K6HA 2PO7A 2UZ1B 4ZEOA 3WLKX 3WQBA 4AUNA 5AK0A 3NAGA 1FBTA 5B58T 2CFRA 1KOGA 1MXFA 2B30A 1IXZA 2VG8A 3LF1A 1FLNA 3FPFA 2PZAA 3IEKA 5F7XA 1XD2B 4TVKA 2JJ1D 2DPGA 1US8B 3Q7RA 1XLWA 3T3MB 1XCPA 4ZVTA 5BWOA 1HT0A 3Q11A 2NO9A 1X19A 1N4DA 2R6GA 5F2EA 3HNPA 1NW4A 4JHLA 4BECA 1P2FA 2OCIA 2X4IA 1VRCA 1AIPA 2P3LA 1GTL1 4KSYA 2RK3A 3BHIA 4YRSA 1AQNA 4B46A 4QO8A 1XK6A 4DUGA 1U6IA 3JQAB 2P9TA 3GLGB 1VB3A 1I3OA 1MCZA 4H16A 4NIMA 3JQBA 3DKVA 5AT1A 2I99A 1PWYE 2C5LA 1EJBA 1ZIXA 4EPTA 2BHSA 3NVKI 3NHFA 1ZK4A 3IUBA 1JHYA 2ZCUA 1O5TA 2Q21A 1UH5A 1YI1A 5C8DA 1B3BA 3OO0A 1QC5B 2Z09A 1WMSA 2GPAA 4KR6A 4JU9A 1QOZA 3RYTC 3FPJA 2I1LA 1U2GC 2LNDA 1QMGA 2PJUA 2PKQP 5EP4A 1LSSA 3PKZA 4J1TA 4NG5A 2PMKA 4YBRA 3NWPA 4R31A 4ZVSA 1XU7A 2EJVA 3FYDA 4Z4EA 2OHXA 2QQFA 3B2QA 3IILA 4P31A 3GAFA 4Y18A 5EN4A 3WGIA 1B23P 1V48A 2HQSA 3CU5A 3K9HA 1EG7A 2EYUA 2ZJ3A 5AOAA 3TBHA 4C4PA 5L51A 2WB2A 2OE2A 2VDQB 5FT9A 4FLEA 2ZWAA 3VOSA 1E69A 3IPAA 1IFXA 2QIOA 4IEFB 4LOKA 3SN6A 4C29A 4IJUA 2C9DA 2BPOA 2JDID 1HY3A 3HU2A 3H9GA 3K2BA 4R6XA 1ANKA 4XPZA 3X3HA 4XDYA 2RGRA 3AHCA 4BNHA 3EHDA 4FYYA 1LPNA 4K6KA 4C0JA 4W63A 3CEPB 1EK2A 3IAUA 4TSFD 4HDCA 1Z0IA 2V55B 3FSGA 3B9QA 2ZBPA 1D2RA 1EEHA 2P3QA 3GEIA 3JARA 1P1RA 2J6IA 1GQYA 3VKGA 1DIGA 2WZBA 1SEVA 1UKBA 2YN0A 2ZI9A 5AJUA 5BNWA 1V8OA 4N5HX 1WPGA 4HDMB 4CQMD 2GRAA 1NJ5A 4QASA 4TLLB 1LGYA 3REOA 1C3JA 4OIMA 2RI6A 5DMXA 4ZEXA 2AE1A 2H1SA 3DA8A 1XDBA 3MSCA 4Q1EA 3RBAA 1Y7IA 3LZCA 2EEPA 1IY9A 1GCOA 2GDZA 2HUPA 1WXHA 1D1TA 1YQUA 4UHEA 4X64B 1CUHA 1VHDA 4H7KA 5DXJA 2RD2A 1KY5A 1P9OA 4KMSA 2X4LA 2FZKA 1Z4IA 2E89A 2EATA 3KR1A 1KZ9A 4DN6A 5F64A 4EY5A 1W9HA 3BQ9A 3BE4A 4IEEA 4RAOA 1XR3A 1IM5A 1PX2A 3OE7A 4ZAZA 2A5JA 2B4QA 4Q7MB 4JBGA 1CJVC 3R5XA 4RK4A 4C30A 1LDNA 4FGZA 4XM1A 5K05A 1QRRA 1VPDA 2JEZA 2Q5LA 2PA3A 4FM9A 4ZI5A 4OXXA 2I8LA 1WBDA 5ALKA 4DQXA 1W6RA 2V97A 3OCCA 1N6KA 2PMCA 3G7NA 4OIFA 2JARA 1ZCJA 1XE3A 1FU7A 2QN7A 1IQ0A 3HVKA 4CODB 1U2DC 4MRMA 3FYTA 3QGMA 4MW1A 4F1WA 4XD2A 3BJEA 2XZOA 2G9RA 5I7VA 5BPFA 2XNCA 1Z5NA 3OEED 2YL2A 2EQAA 4INAA 4QJ5A 2OMKA 1N0UA 2Q6VA 2R5NA 3QYAA 4NK4A 4PZZA 3WIDA 4ESVA 2ZR8A 3BXEA 2FE4A 2I4LA 1NPTO 4EL5A 2Q3MA 4EPWA 1J42A 4NARA 2VDUE 3CZQA 4Z6KA 5GOTA 3ES9A 4WA7A 2YCBA 4Q05A 3UJDA 2HDWA 4D02A 2GETA 1YJAA 3FPGA 2DHCA 4LYHA 3FSJX 1G5RA 2B1RA 1F1BA 1M1YE 3ANTA 3F9IA 2DULA 3KEOA 4HGOA 1VZ2A 1VMAA 2PPLA 5LQRA 4LGCA 4JYAB 1VFNA 4MV1A 1NUTA 1C7ZA 1QF9A 1V16B 4BFWA 3FVQA 3D0QA 2DERA 1LB1B 3WWCA 3ZXSA 4EBFA 1G5TA 2ZYUX 3QFRA 4J43A 4WOCA 5J5AA 3I0ZA 3VPFA 4D9KA 5KYXB 3GLFE 2IX9A 2SHKA 4XCQA 1SWWA 1AHPA 2VJAA 4OHMA 4J07A 3KK0A 2WU4A 3BTUA 1PU2A 2BZ0A 2PU7A 4C03A 1H8HD 3COVA 3H8VA 4AO7A 3ET5A 4BRSA 3MOIA 4XUEA 3PXCX 3R8XA 3UGTA 1QYWA 3NJ8A 1JBQA 3FBTA 1EUDB 2YINC 2NP6A 4Z3OA 2RAFA 4JQCA 4TKUB 1EFUA 1QONA 2Y93A 4N3GA 4Q16A 5DOVA 1BCRA 2QRMA 4N0MA 2JGDA 1TYBE 1CJTC 5JAMA 1BXKA 4M1WA 4G5QA 1FJHA 3F7OA 2PKYX 3OQIB 1IG0A 2W6JD 1R5BA 4G36A 4HMQA 3FXAA 3NASA 1DIRA 1OGJA 1XT6A 1WVGA 4EGAA 1Q0LA 1NPDA 3H4MA 1KYWA 3BIXA 3QXHA 5KHAA 3PR2B 4CUZA 4D4LA 3DBLA 3RANA 4LOLA 4MMXB 3N6XA 4CLXA 2B4RO 4H1UA 3AIMA 9LDBA 3IR6A 1E7WA 3BDVA 1Z5UA 3I0NA 3Q0IA 2FAXA 2ZBEA 3UXYA 4EJSB 1D5WA 5IT0A 3ILVA 3ZUPA 5LXTF 4ZT6A 1YZ3A 2VEDA 2IYZA 2D54A 2XZPA 5T3YA 4I4LA 1D2CA 5BO5A 5C51B 3NDRA 3KZCA 3ETDA 5JATA 1VSUA 5FLKA 2TS1A 3EX7C 3EVCA 5IUJC 3MXOA 1B0UA 5B12A 3F6EX 4DXHA 1CRPA 5J1SB 1Y82A 1E5VA 4PG7A 1EX1A 1KOJA 2NVWA 1XYGA 1FTWA 1VSBA 4N7JA 3GDWA 1IATA 2I7VA 4UFPA 5KS2A 4KFCA 1XA4A 1WDLA 4M22A 3LHFA 5D5HA 1HE8B 1O9GA 1RQRA 2QPTA 3RRMA 5JO0A 3GLIB 4E2WA 3MCAA 4TN1A 1TJPB 4DHEA 2VCEA 4BNMA 1P4GA 1PYGA 2CDBA 5A3QA 1GO2A 4QDKA 3VU8A 1SEPA 5L7YA 1UZMA 4GMHA 4P4SA 621PA 4EGCB 1QQBA 1A88A 1I2ZA 4U2FA 4NKRA 2GZAA 1RP1A 2O59A 4UVGA 3OESA 1DUVG 5A2QA 3VC2A 2MINB 1BNCA 2HF9A 3AR3A 4D6PA 1TYEB 1YZKA 5EJ9A 5I48A 3QBTA 4IG9A 4UM9D 2C4VA 3UH0A 3VAAA 2ZQ5A 3AI1A 2EL9A 1VGQA 2JCXA 2PNFA 1KJJA 2W6CX 3CM0A 4FWIB 4MEJA 4MUXA 2PUCA 2CXQA 4EFDA 2ANCA 1SUPA 1ABFA 1GCGA 1VHLA 4JB3A 5E4YA 2ZRDA 5ALYA 1EK0A 2BFEA 2XGSA 1P8JA 5J5VA 3O0TA 2I6XA 3UTCA 5B1EA 2XKBA 5HR5A 1B41A 2WJYA 4GU5A 5CPFA 2Y71A 3GFQA 3PLRA 1P1FA 2BDUA 4TLCA 5I8PA 3K3PA 3P9PA 4IRUB 4P4TA 1TNDA 5LKRA 1W76A 4OHOA 4EW3A 4WRRA 5ALUA 3V8PA 2FCAA 3WQHA 3OLWA 2XWBF 2JK0A 2VZLA 5CB8A 2EP7A 1VMDA 1XXHA 3IJRA 2NSHA 2NG1A 4QVGA 3IOEA 3H6HA 2ADFA 3ANXA 1G8KA 5TMDA 1ZQ9A 5GPBA 5GV7A 1TK2A 4OU4A 2CNDA 4LGMA 2C92A 2CL0X 4FC7A 4PCUA 4MVJD 4KXMA 3NHAA 1T3LA 4R1TA 3BB4A 4NPCA 2B8NA 2R48A 2FF7A 3FWNA 3WDLA 1OFGA 2AS0A 2B2XA 2LP4Y 4WA8A 3U44A 1TUEA 3RWBA 4IUCS 4ZCQA 3EXIA 1VCMA 2WVJA 5DISB 4FDAA 3GRCA 3GNLA 2IBSA 4ARBA 3WRYC 1X94A 1T9ZA 1GEEA 2M1ZA 2GILA 4LRQA 4ZV4A 5FULA 4FE3A 3S2YA 4G0YA 1J33A 4MUIA 2B78A 2H17A 2I91A 1Y8RB 1QAOA 1B1AA 4P5PA 1VMEA 1WD5A 1A4UA 1VXRA 3QRWA 4J29A 4ZQHA 1K5GA 4YBZA 4BMXA 2P8JA 1C4KA 3W5HA 5DWDA 4EMTA 2WSSD 3WK7A 3NHUA 1LBIA 1UT8A 5TQ0B 5LKAA 2H11A 3A4YA 3NTXA 1S8NA 4WKNA 4BV3A 4QJIA 1UM9A 3HB9A 5LYJB 4E13A 4US0R 2J85A 4UM9B 3ZVKA 4KFUA 4MWGA 3OZDA 2ERXA 3ZD8A 2OCDA 3HDYA 2RMKA 4AYWA 5BUCA 5DGDA 5F9FA 1N8TA 2Z2YA 3LIPA 5F4BA 1VE7A 2CFCA 3KE8A 1RYDA 4EHIA 2ZDQA 3LXUX 3NHSA 5A9SA 2CLHB 2OD7A 2HIHA 2IOFK 4JQOA 3V8BA 4RIHA 4H6XA 1SK8A 4MA5A 1C30B 4WVFA 2ZWOA 3MGAA 1UJCA 3DHVA 4ERXA 2ZI6A 2J87A 3MVEA 3H5AA 4II2A 2OFOA 4CLRA 2RHGB 2QAIA 3QV1A 5I7RA 3ZJTA 1P7ZA 3I5YA 1RKQA 1V3VA 4F3KA 3C3WA 4XQCA 2BMVA 2J33A 3PFKA 4EPVA 3LX6A 4LJ4A 2Q29A 1O6BA 3VYTB 4YREA 4OGKA 4RTOA 1U8AA 2ZS8A 4MPPA 1YZUA 3KB2A 1YHZA 1KYIA 1XOIA 3G0BA 4EKDA 4FFRA 4DG8A 2AVNA 5J4KA 3K1ZA 5HKOA 3HWX1 1ZYUA 3RRJA 4G2NA 5F5NA 2NVBA 2NU9B 2ZZNA 3CEMA 2P2SA 3B51X 2F64A 4I14A 4A91A 4FNGA 4C6RA 3JVEA 4B6SA 4ALLA 3VR4H 3N8DA 3G0DA 2YRFA 3DVSX 3VR0A 1WBJB 3F3SA 1OF1A 4LGYA 1CRWG 4Y7DA 1QYRA 3W4KA 1SC4A 1S1CA 4QELA 4CVNA 3HQ4O 3UC5A 4JXXA 2X77A 2NM0A 4QXAA 3T5MA 4AJ4A 2ZIEA 2O8FB 2ZUWA 3STTA 4DGQA 2FEWB 1OV6A 1T2CA 4ENQA 1XTBA 4LDNA 4P86A 1MQAA 2X86A 2VP5A 1S2LA 3B3QA 4EUNA 4WBSA 4LQDA 1H05A 2H59A 2BI4A 2B37A 1Z2AA 4ESOA 2TYSB 1YHNA 2WIFA 5A7GA 3ZCVA 4GT1A 3RASA 5J4HA 1MRSA 4I9GA 5ALIA 1JEAA 4RJJA 3L7YA 5DNDA 2FPIB 2I7TA 3H9UA 4BCDA 4X9XA 1MVNA 2V6BA 1FVHA 2CXPA 1PNOA 3KOWA 4FEGA 2AJ8A 3C0KA 3NVDA 1TTPB 1V4VA 4NMWA 1PT6A 1X42A 4J3NA 1N0VC 3AXSA 1E7YA 2RHHA 2R7NA 3KL4A 1K2WA 5F7ZA 3ZE2B 2YCLA 1BH2A 5J23A 4M76B 1FMJA 2EBFX 3CINA 2Q50A 2FPPA 2BUAA 3BMCA 1JBEA 3RVPA 4CLRB 2ZI7A 3ZWBA 5IH7A 4CT4B 2XGMA 4M36A 5A1TA 4R41A 2PSEA 4EA6A 2DXIA 2FZEA 2NVOA 4AK9A 2FYTA 1EI9A 1Y9DA 3CH5A 3PUJA 4MOWA 4Q9DA 5FHQA 3RYIA 4PLWA 1Z39A 2H1CA 3CGWA 2IH4A 4IWYA 2VQ3A 3F6CA 2VBFA 4HJXA 1DQRA 3CSDA 2PGJA 3C24A 3G3EA 3IPYA 1O5OA 5LQNA 4KK4A 3ZCXA 3EE6A