4BNDA

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
KMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
total genus 94
structure length 252
sequence length 252
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndA01
5FP0A 3AR9A 3ZVNA 3OCZA 3TLMA 1O08A 3L8EA 3L8HA 5AKEA 3L1UA 1QQ7A 3L7YA 3QXGA 3S6JA 3GYGA 2GO7A 1RLMA 2DQSA 2B8EA 2C9MA 5AW7A 3EPRA 1RQLA 4YCMA 5ALIA 1ZRNA 5ALJA 1Z4NA 1X42A 3R09A 2YMQA 3ZW7A 3ZX4A 4L6CA 2HF2A 2AGVA 4PNHA 4C4TA 2C8LA 2G80A 4XOUA 3N07A 1XPJA 4OFZA 4C4SA 2R8EA 3QU2A 2JARA 3QU9A 3BWVA 5ALNA 1LTQA 1WZCA 2AMYA 2G07A 3WKCA 5E0OA 4ZEXA 2B82A 1RC8A 3WK4A 1ZD4A 1Z4IA 1TE2A 5A3QA 4L57A 1KYTA 3ESRA 4YCNA 1Y8AA 3U19A 4IG4A 3SMVA 4DWOA 3N1UA 5ALKA 1L8LA 3ED5A 2MU1A 4GXTA 1Z4OA 1T5TA 4UMVA 1YV9A 1SU4A 4Y2SA 4BX3A 3L8GA 3NASA 2I34A 4BEWA 4I9GA 4YCLA 5ALFA 2RARA 2YY6A 5AW6A 2OBBA 2X4DA 5AKLA 4OD0A 2HOQA 3N8GA 2OA0A 3EWIA 3ZTWA 4GIBA 3WK9A 5AW3A 5ALRA 4AP9A 2O2XA 2R8YA 2GMWA 3FPBA 4NABA 2ODAA 1ZOLA 3PDWA 1F5SA 3L0YA 5AVWA 1QH9A 2YN4A 3L0BA 1T9ZA 1NNLA 4YIHA 4UAUA 1ZJJA 1RKQA 3QUBA 2FPXA 4UMFA 5AIAA 5AM5A 3UM9A 1QQ5A 1WR8A 3FPSA 1RMTA 1YS9A 3E58A 2HHLA 4NWIA 2RB5A 1Z5GA 3QNMA 2W43A 4FYPA 1EK1A 1FEZA 2HSZA 2WHEA 1QYIA 2G09A 2WM8A 3KBBA 4QQFA 1ZD5A 2HO4A 4XPZA 1Z4LA 4FFDA 3D6JA 4FE3A 1U2TA 2WF6A 5AHXA 4F71A 2YJ3A 4Y2XA 2YMLA 3ZWDA 2BY4A 4Y3UA 2CFTA 4J2TA 5ALTA 3NUQA 5AK3A 3AR7A 3VAYA 4DW8A 1L7PA 4UM7A 4F72A 5A3RA 2I33A 4AS2A 1U7OA 2ZOSA 5AKXA 5IT4A 2P27A 3WKEA 2FI1A 3QUQA 1VFPA 2HF7A 5AM2A 2G1AA 5ALWA 5ALQA 1Z4MA 2JAUA 3ET5A 3ZX5A 3OCXA 1RPZA 2WFAA 3PGVA 3U26A 2FPSA 2HX1A 3AR3A 3DDHA 3A1CA 3ZUPA 3U7FB 5AVVA 4BNDA 4BYGA 2B30A 3ZTYA 1RLOA 1EK2A 3SKXA 1RQNA 3OCVA 5AK4A 1RDFA 5ALDA 3E8MA 5IT0A 1CR6A 3CNHA 5AVYA 4HYTA 3DV9A 5AM1A 3KOOA 3ZU6A 2C4NA 2IOHA 3QUTA 2FPRA 1K1EA 4BX2A 1TA0A 4KN8A 3HYCA 2YJ5A 3W5DA 2Q5EA 3FM9A 5AKJA 2B8JA 4RESA 5AVZA 4Y2YA 5ALEA 1YMQA 2WF9A 2HEGA 5T41A 2GHQA 2EAUA 3QLEA 4NAVA 2B1QA 5AK6A 3UMCA 3N28A 1Z5UA 3ZI4A 3KZXA 1IWOA 3ESQA 3KC2A 3OPXA 5AKZA 3NRJA 2VKQA 3ONNA 5AM4A 1U02A 3L1VA 2YJ6A 4EEKA 3N5KA 2Q4RA 3IB6A 2ZXEA 5AI4A 2W4MA 5AVTA 2R8XA 3A1EA 4C4RA 2CN1A 1TJ4A 3QYPA 4IFTA 1U2SA 2WF5A 3FGOA 3WK8A 4UM5A 4UMEA 5AKKA 2P9JA 2PKEA 3KDPA 4UAVA 3MPOA 2C8KA 1Z88A 4CF3A 2I7DA 1JUDA 5AM0A 3WKDA 2W11A 4JDPA 1NRWA 4UASA 5AI8A 4KX3A 3ZVMA 5AI5A 3F9RA 2WF7A 2FPUA 4KX5A 1YDFA 5AW5A 3U7HB 2BDUA 2P11A 1Z4KA 3B8EA 5ALZA 2IOFA 3AR4A 4B6JA 1WVIA 2RBKA 3QGMA 3AR8A 5AVRA 5ALHA 3UMGA 4YGYA 3SLRA 2Q4TA 5ALVA 4YH1A 3SD7A 1RRCA 4UU0A 5ALUA 3KD3A 3IJ5A 2AH5A 3R4CA 4KNVA 1RMQA 2G08A 2O9JA 3U7EB 3AR2A 1L8OA 2HI0A 5ALSA 3J7TA 4G63A 5AW8A 1VJ5A 4L6AA 4QJBA 2YBDA 4EX6A 5AKGA 1ZS9A 3MC1A 3IRUA 5AVXA 1J8DA 2D2VA 4UU1A 3U13A 3SHQA 2YMPA 3R9KA 4EENA 1Q91A 3QU7A 5ALPA 4MUMA 2OYCA 1Z4PX 5AESA 5ALYA 3QX7A 4BNDB 1ZD2P 2ZG6A 3HLTA 2P69A 3WK5A 4XE5A 3FVVA 4NV0A 4BBJA 4Y2RA 1XVIA 2I6XA 5AW4A 3L0CA 5AKYA 1MH9A 1SWWA 1YNSA 2QYHA 1LVHA 5AICA 3OCYA 5AKIA 3I28A 4CNQA 4XQ0A 4CF4A 1N9KA 1T5SA 3CZ4A 1S8OA 4DCCA 5AIBA 4BKMA 3K1ZA 2NYVA 4HGPA 4Y2PA 4BX0A 5ALXA 4ZEVA 2BDEA 3AR6A 3ZWKA 1CQZA 3B9BA 3EF0A 4BEVA 3NALA 2G0AA 3I76A 2C88A 1RMYA 5AW2A 3WK6A 4NFLA 4MWOA 1QQ6A 2QLTA 1XP5A 3PGLA 1Z4QA 2B0CA 3DNPA 2FPWA 3P96A 4ZEWA 4RETA 1PW5A 1TJ5A 4OCZA 2ZBFA 3W5AA 3OCUA 3BA6A 5IS2A 2HDOA 2EATA 4G9BA 4Y2QA 1L6RA 4EZEA 5AVSA 5JJBA 1RLTA 3M9LA 4HGRA 5AW9A 4HGNA 3SKYA 5ALGA 4CF5A 5ALLA 2GHTA 3NANA 1RKUA 1N8NA 5A3SA 2EARA 2IA5A 5AK5A 2CFRA 2FUCA 3WGVA 5AW0A 2HCFA 4O8CA 3WKBA 4EELA 4I9FA 2MSNA 1VJRA 3U7GA 4E88A 1J97A 3W5CA 3RFUA 5AVUA 1NF2A 3L8FA 4UARA 1YJ5A 3UMBA 4H1WA 2RAVA 4KYTA 3QU5A 4AS3A 3MN1A 1U7PA 3WGUA 3M1YA 3AR5A 4HGOA 3FZQA 5AM3A 4J03A 2WF8A 3W5BA 1RKVA 2B1RA 2FEAA 3A3YA 2YMMA 1SWVA 1L7MA 3DAOA 3E84A 2PR7A 4UMDA 5ALOA 2I55A 3SF0A 2AUTA 4Y2JA 3NAMA 4Y2TA 5AI9A 4DFDA 1L7NA 1Q92A 1ZD3A 2G06A 3L5KA 1O03A 1Z4JA 1L7OA 5AW1A 5AI6A 2JAWA 2JAOA 4Y2UA 5AVQA 1AQ6A 3A1DA 4UATA 4OHFA 1S2OA 2IOFK 2YFYA 5AKHA 2I54A 1WPGA 3MMZA 3OCWA 3RF6A 3I6BA 4JB3A 3QU4A 5AI0A 2OM6A 4HAIA 4CE6A 2ZBEA 3ZVLA 2FUEA 3ET4A 3E81A 2JGAA 5ALMA 2IYEA 3NIWA 4UW9A 4Y2VA 2GFHA 3QUCA 4HGQA 3I1YA 2YJ4A 1ZRMA 4YIKA 2NO5A 3OTQA 3WK7A 2CFSA 2PQ0A 2ZBGA 3EF1A 3WKAA 2NO4A 2FDRA 2R8ZA 3B9RA 4KNWA 1TJ3A 2ZBDA 3PCTA 4EX7A
chains in the Genus database with same CATH superfamily
1HG0A 2GEFA 4IJ6A 3UJ6A 2ZVQX 5B1IA 1K4MA 2PX2A 1ZH4A 3UXYA 3ZLTA 4J1NA 1Y8ZA 2CEAA 1U7ZA 2HADA 3AIKA 3WBBA 3GFRA 2D3WA 1UCFA 4LV8B 1OWNA 4Q93A 4WA8A 1MX5A 3GV0A 4YECA 1JTEA 1TM2A 3TQRA 3KZMA 3FBTA 4E08A 1CYDA 4JIMA 3MWJA 3ROEA 1JEYB 3MJFA 3SX0A 1JYSA 3BRSA 1GXSA 5DI3A 1YR8A 1ZRNA 5EQDA 5CB4B 2J5QA 1T3LA 5CDTA 2ACKA 1L7EA 3R09A 4L6CA 3DZFA 1QTIA 3IEPA 2G9VA 3DKKA 4YDRA 1GQRA 5FA8A 1WKVA 5HS6A 1LPNA 2A5YB 1UXJA 2JIZA 4OFZA 3GUZA 2F9FA 4ZDKA 2WIJA 3S2UA 4I55B 2FPIB 3TW4A 3SJAA 4Q1AA 1ID1A 3DMHA 3V9PA 3DEJA 1MCZA 3LT2A 4R1OA 5CBPA 3W9BA 4DGQA 2P41A 4FCWA 4BNYA 2Q2NA 2XLBA 2AWNA 4V1CB 2TMYA 4J29A 3WBKA 3G13A 3EXG1 4WXMA 1E2LA 1VI2A 4C0BA 2JI6A 5JUWA 4ZEXA 1VPWA 5F9FA 4L7VA 1NXPA 1ZH8A 4JQYA 3AF6A 4OHUA 3K0SA 1Y98A 1Z4IA 4ARAA 1JAZA 3FDXA 4DE5A 5DK4A 3QLJA 4OH7A 1JF8A 3D2LA 4U3JA 2ZXUA 3TRKA 1WHSA 3A37A 3KR1A 1AB6A 4FZRA 2ZIEA 4J3FA 3RUAA 1YQTA 3VI4B 2GR9A 3AHDA 3O90A 3PVCA 3DZCA 5JI3E 3IEVA 1ZC3A 4D0LB 3KS9A 2BJVA 2GJ9A 4R9UC 2H59A 2AOVA 4J94A 2DFLA 1FU8A 2RAUA 3RYFA 3WWCA 3H16A 5MN6A 4UNSA 3RTEA 3L8GA 3ZQJA 3LY8A 2QW8A 3WZ2A 4G4JA 1JGTA 2Q50A 1PYOA 4WERA 3WQHA 3NTOA 1HTTA 4K81B 3C15C 4TQUS 3NVKI 1FRQA 3WO0A 5AHRA 3WY9A 2OBBA 4K6FA 4DSZA 2FSGA 2OBFA 4KR3A 4MSUA 1B3RA 1V3UA 3D6VA 4GM0A 4LNUA 2YVKA 4WXEA 5TXGA 4B4DA 5I7VA 5IZ4A 1BDHA 2HLHA 1YRWA 4I50F 2DT8A 4YP9A 1MZVA 4F4JA 4LJ5A 1E3MA 4NIMA 4XD2A 5LU9A 4D43A 4E5MA 1ODLA 2QTHA 2LW7A 1ZOIA 1JDUA 3E5HA 3LDGA 3ZW8A 3S7ZA 2GZ1A 1R64A 1YL5A 1R5JA 3R20A 3DT8A 5KQSA 4PZAA 2CUZA 3CNNA 4JYPA 4MJ7A 1QE3A 2JCGA 2I4MA 4MUYA 3LRXA 4PRZA 5KCZA 2Q8NA 3BXHA 4F3CA 4X1IA 1ZJJA 1ZOSA 1W0KD 2JHCA 2VDJA 2ZBPA 3CBQA 3QSYA 4KO3S 1A96A 4N3AA 3OHPA 3OICA 3O2SB 1AQYA 1P33A 3C1UA 1FFHA 3G7SA 1WIWA 3R77A 2WMOB 1OIVA 1JE1A 5TQJA 2NUAB 2YFHA 2FG5A 3BC1A 5BSHA 4M8SA 5DT2A 2A7XA 4YYZA 1ADGA 2Y99A 1RIIA 1U2TA 3K9HA 2PV0A 1NLFA 3R3WA 4Y9UA 4W6ZA 4N8EA 2Q4DA 3B6EA 3PTAA 5FB3A 1E2BA 4CKXA 1DTWA 4AKHA 1TF2A 2HA7A 3A36A 1P7VA 2IPLA 5TNXA 4D9FA 5HTKA 1FYVA 4JHLA 4QM7A 2IXBA 2Y93A 3HCCA 3W3AA 3ASYA 3G88A 1C80A 1QFZA 1YO6A 2WU3A 4AO8A 1D1SA 3F6SA 4NH0A 2CK3D 1YZQA 4HWPA 4MVJF 4P35A 5EI5A 1PBNA 2AR7A 4RDIA 2OLJA 4EG8A 1IVYA 2ZJ8A 3FRIA 4D44A 2XXAB 4OHZA 2GXQA 2O05A 4DQUA 4OLAA 4EF6A 4ZJYA 4GI3A 1AZSC 4FLEA 4WA7A 3HR8A 3U4AA 4EJ0A 1QMGA 1A9ZA 3CX6A 4IQ8A 1L4NA 3GRRA 2WFAA 4CDNA 1MIOA 3A0UA 3SJBA 3WGIA 1QRSA 1LY1A 3LH5A 1M6VB 1JDBB 1X7GA 1ZLYA 3U48A 2YHAA 1G8AA 2X6RA 1XZ8A 2HIMA 3CZMA 2HXGA 1C41A 4HN9A 1KBOA 4D9NA 2HJGA 2QS9A 3SKXA 1YDWA 2FHPA 2CMGA 3N53A 1VXOA 2Q2OA 2VDVE 5EJ7A 3KTAB 2AW3A 3EQZA 4F3YA 4V1CI 1RDFA 4RY8A 2EIHA 1G0OA 1QO0A 3E9ZA 5FPYA 3CLRD 3JQCA 4OGFA 4INAA 5I5GA 2QIOA 2HWXA 3HFRA 3USES 2PH5A 2UVDA 4MVCA 1D1PA 2P0EA 4IHJF 3OOJA 2R7AA 4MMZB 4U6SA 5AK0A 3VPXA 4E7PA 2FXIA 1PJTA 3UPDA 3DE1X 4NAHA 2GLXA 1EDZA 3JV7A 3VU1A 3HNRA 4DQXA 4JLBA 1BCRB 4XX0A 5K3SA 2ODBA 5G0VA 2QMOA 4GVPA 3H8WA 5BXYA 1W5EA 1QIHA 1YQQA 2B9EA 2N0SA 2ZU6A 3EXG2 3DLBA 2J30A 3RU2A 4LE0A 2GHQA 5FWAA 3B1ZA 5CNJA 5D7NA 5EHZA 1F0YA 1UBUS 4QFDA 3BD9A 5CNIA 2DERA 3GQVA 1JJIA 4ZP1A 1WY5A 2YV3A 3IILA 3RVSA 4BVEA 5KYGA 1PR5A 3UK6A 3N0TA 3T5MA 3J7AC 4V39A 4RPGA 1E8MA 2H85A 1NBME 2H63A 2A94A 2IHTA 4GNRA 2C3OA 4KQJA 5FOVA 5H8WA 2B3TA 2NZUG 3PQ3A 5HF6A 4D9HA 2X0KA 4WX2B 4E51A 4RCZA 4JI4B 3T3OA 2Q4RA 1FQOA 1TW2A 2A92A 2HC9A 2NV2B 2PBRA 3F46A 3IELA 4LWOA 4PC6A 5A6SB 3WLTA 4C6TA 1NI4B 3C7KA 2ZAYA 1NXWA 1Y8CA 3HB1A 3WOVA 4L16A 2IHNA 3TLEA 2ZBUA 4OXYA 4FFWA 1H94A 4QFBA 1TJ4A 4HB2A 4R2XA 4IJMA 4B3TB 4NMLA 2HTFA 1KS2A 1QHXA 2O8BB 4UE6A 2E4XA 2WZDA 4E5UA 1G7TA 1QG2A 4A1FA 2QVZX 1CY1A 3LPDA 5DKFA 1F2VA 1FPMA 2PA3A 3BGOS 3O84A 1C7JA 2BLLA 1UUFA 2W9XA 4CV1A 3WJAA 1QE5A 1VMIA 2FWPA 3M4NA 4D3ZA 3CX7A 2FPUA 3T7AA 2ADOA 3U3KA 3AUJB 3KZNA 3LHSA 1TC2A 2RGNA 3PQ6A 3LDHA 2Q7DA 2P91A 4YRDA 1CPYA 3EHDA 1W0CA 3AR8A 1Z15A 4CIXA 1XLUA 2VHUA 4BPRA 1GGJA 1ZN2A 1DFIA 2BF4A 2CXRA 2NO0A 3HKEB 4QULA 4ZU6X 1RZRA 3L6BA 2Q4TA 3REQB 1CVIA 4K87A 1PHPA 4IBOA 1A8HA 1L8XA 1NM5A 3BXZA 5FUWA 1NLYA 3UFXA 3UN1A 1KEWA 5KNBA 2L0XA 1QRDA 5HGJA 4TV8F 1QG4A 4XCXA 4G8JA 2JD0A 1KDOA 1K6MA 2N42A 4RVUA 4YRZA 1FFBA 4CMIA 1YK1A 3EW9A 1VFNA 2JH3A 2ZYUX 1OTXA 3GD7A 1NV8A 3FYTA 4Z4IA 2OCPA 4MVJP 3VKUA 1DC3A 1KAEA 3PQ7A 1KJYA 1WNFA 3J7TA 3QNWA 1HE4A 5B6PA 1L3BA 2ZWOA 3BVPA 3QRWA 4CUZA 4KE7A 3F90A 4XSVA 5EQFA 4RK0A 4EX6A 4P54A 3F1LA 3GIWA 4FFSA 5JWHA 2V7UA 3IOBA 4PZPA 1YQUA 1THGA 3IP6A 3WDMA 3BXEA 3KFVA 2OILA 3RVRA 1US8A 4MDHA 3EEQA 2OFXA 1V6CA 1Q1EA 2I67A 3HN6A 4EZIA 3INTA 3B1WA 6REQB 3LCJA 4QT4A 5AWFC 3AB8A 3M6FA 4OBEA 3VNAA 3PGMA 3R9KA 3PDIB 5DTJA 5DCWA 1E6KA 2Y4OA 3B9PA 2P4UA 4TTTS 3LA8A 4RXUA 2Q0HA 3GDGA 1FYEA 2OC9A 3GQBB 2VWHA 3K96A 4MR9B 5E1MA 2ZU0C 3AKCA 3PRYA 4FHFA 4BBJA 3K94A 3ZDEA 3H9GA 4LHYA 5JH7F 4P5DA 2C4KA 1CP3A 1TA4A 3NJRA 2OLKA 2QYHA 3D7KA 4NSNA 1TIPA 4KLRA 3QH4A 2G1KA 1VLVA 1I13A 4TZTA 3RRNA 1E3WB 1E2DA 1TADA 4AYXA 1WOMA 5D84A 5JNLA 3PYLA 4LGVA 1NQWA 1MDBA 2QVLA 1N9KA 3R0JA 2LZ0A 3R6DA 2Q7OE 3OOSA 2WIAA 1SQSA 4A6DA 1AKRA 4G81A 4M1TA 4QDTA 2J9YB 3QKRA 1G8JA 3V5NA 2P2GA 3UOGA 1HFJA 2H7XA 4FD3A 4DR5B 1XYYA 1Q11A 2CVQA 3DOEA 3EXHA 3GZJA 3M8KA 4Y2PA 1EQ2A 2HRRA 5ALXA 4ZD6A 4ZYUA 4R3NA 2VKTA 4Z4FA 5THQA 1O5IA 2FPKA 2FEPA 2PXCA 2ZSJA 1FTGA 1IAVA 3OLWA 1KAGA 2ZIFA 3H42B 2F1IA 4BVHA 5JSFA 2EEZA 4G41A 1NW3A 2AHRA 3GB9A 1BROA 5IAJA 2EBWA 4B40A 4GI7A 5JD4A 2QLJA 2XSZA 1KMHB 1VYHA 1Z7GA 1XMJA 5BQPA 5ED4A 2IT1A 4YDSA 1QQ6A 2VT7A 6YASA 1IN4A 1HYQA 1YTUA 2ECFA 1GQSA 1NIPA 3AKDA 4JKIA 1W1WA 5HRUA 1XRNA 2QTCA 2Z56A 4JEHA 1PJ4A 1J90A 4NBWA 5JBIA 2Q6LA 4PQRA 1R8YA 5HK8A 4DKXA 1H05A 3KSDO 1EFVA 7AT1A 2FQ1A 5IC6A 1A7UA 5IXJA 3P9SA 3I5AA 2YBEA 3DZGA 1DKUA 1M0SA 1MB2A 2VPIA 3PNLA 3OMXA 3QM1A 1QGAA 3JVUA 4UBJA 4BGDA 4I99A 5JJBA 3ZCXA 4BMCA 4D9GA 4OXQA 1M73E 3CUEF 2D74A 4RPHA 3EVNA 1CJCA 2AQKA 2I2BA 4QDJA 4ZIRA 3EQ7A 3M2PA 3AETA 2E89A 2HPAA 4CQMA 1KDPA 4OHRA 4CF5A 5ALLA 3HBFA 5A3SA 2JFXA 2P1RA 4Y6OA 5AK5A 3WMGA 4BTVA 5JSHA 4EUEA 4NJMA 3IPLA 3SHFA 3CRRA 3BHIA 2E21A 1M7BA 4C0AC 3UW3A 4C6RA 5JS6A 3BRCA 5DM2A 1M2OB 1J97A 2QAGC 4XIFA 3ZKWB 1RHJA 2GXUA 2FJPA 1SK8A 4PAMA 1K92A 2QORA 4X45A 2AN4A 2KMLA 3FVTA 4E03A 1MEJA 2WAOA 3HVHA 4ARBA 1SXPA 2X8AA 5HGXA 1L7AA 1UFQA 2ZDHA 1HI9A 5HKAA 3UGJA 1G3UA 3C3KA 4R9NA 3M9WA 2WTAA 1CUZA 4EGCB 2JLWA 1J2TA 2A9RA 5EP3A 1NUHA 2YYZA 3AC0A 5FCDA 2XCSB 2VAVA 1G60A 5KWIA 1HNWB 4BNFA 3AL0C 1OCEA 2AUTA 2I9PA 1PLKA 3NAMA 4TPKA 4R2MA 4GWLA 4Y2JA 5L4NA 3RFFA 1TO1E 1Q92A 2YQ4A 2G06A 3QQPA 3ZY6A 3MELA 1W96A 5AH0A 3SFZA 2WHYA 3AHJA 2V3CC 4QEKA 5CFMA 2VHCA 1Y8RA 1OLSA 1VIYA 3E53A 3HACA 4R8VA 1W44A 1IHXA 2QRVB 5AI6A 1C0IA 4HDSA 3RLIA 1EM8A 2ORED 3MT0A 5LJIA 1YFKA 2XADA 4EAAA 3FVQA 2VWPA 2BVNA 3HFJA 3LQQA 5TDHA 5KEIA 3ASVA 3D1VA 3FCAA 4GH5A 4NLLA 1BXGA 4M46A 2QM7A 4CWAA 4FZ3A 5CXSA 3C8MA 4ND6A 2PUCA 1P5ZB 3HCPA 4OB8A 3CKKA 3S1SA 4BVGA 1KMMA 1VLQA 3JQPA 3I6BA 3D3KA 2EXXA 1K98A 3LOQA 1Q2UA 4YCSA 4FOLA 1W36B 5LOVF 1DRUA 1SQGA 3D3EA 4UUQA 4PXSA 4ND4A 5FYDA 3VKFA 2PT6A 3LYHA 2X5NA 7MDHA 1E3TA 1O9GA 1YJQA 1DCTA 1R9NA 4US2R 4QELA 1RJ9B 3AK4A 3GI1A 2JGAA 3W9SA 3TOXA 1GPMA 1IBLB 4AZTA 1CY6A 3QUCA 1NVBA 1QYXA 3HHPA 3I32A 1C7IA 3KOWA 4LRXA 4PX5A 3ANYB 3RHZA 3T4XA 5FUQA 1IJFA 1GRCA 1QVAA 1ZRMA 2VAWA 3IUNA 4PYRA 3BMCB 3MMSA 4HAZA 2BFCB 4XFKA 5B64A 1QP7A 2UXCB 2C20A 2GRJA 3SBOA 1JFVA 2EWWA 2LDBA 2YNMA 4D9BA 2UYHA 4LVOA 1COWD 1H2RS 3B9RA 2H4HA 3JPWA 3LVFO 4U63A 5CFNA 5KB3A 4O4JB 4IZOA 3KT0A 3F8SA 3WLRA 4K9SA 1H85A 2B7CA 4X5OA 1X39A 2ZI6A 3QIVA 1E5DA 4NU8X 4PY2A 7REQB 4NENA 1UDCA 2UKDA 2XODA 1H4QA 3AR9A 4IF4A 3UAVA 5LNK6 3OCZA 4YV2A 4RZ2A 3RU3A 1OR8A 3NT2A 1NN3A 2YC4C 2QRHA 1KE2A 2VSOA 3KDSE 2FVXA 3OUZA 2VZ8A 4E14A 3LF1A 3NIBA 1AQLA 1YI0A 4DMCA 1VP9A 3GGSA 4JWKA 1RQLA 4FJ1A 1J24A 4IWYA 5HCUA 4JSYA 1CTQA 3RTBA 4HQ0A 1JKJA 3GLVA 3OQNA 5DO9A 1JJFA 2BP7A 2FPPB 1DAGA 4OATA 3F1KA 1CEYA 2YMQA 1NKTA 3D0KA 1BHQ1 4X90A 3DMNA 1DIGA 4U39A 5AVKA 1M1YB 4PNHA 5IARA 3L43A 3NEYA 1KZ6A 4RMJA 5JVDA 1OILA 2X19A 4I4IA 3MCAA 2I71A 2X9NA 4K1LA 5BSTA 5LQUA 1CJUC 2ZRKA 3VHRA 1BWPA 1M0WA 1Z36A 3LP5A 4HDNA 3OO1A 1J56A 1H4SA 1LQUA 3VGPA 3LKBA 2J3LA 1PR6A 1WZCA 2AMYA 1R0LA 5E0OA 3UMVA 3FSRA 2IYRA 3KJNA 4EEZA 5A2QA 3FOCA 4TV9A 2C7OA 2PXXA 4IFBA 2XNDD 1UP6A 5E9WA 5T3UA 2VATA 3FGZA 1NC3A 1VE3A 2QLBA 4IIFA 3CIFA 4KPUB 4RCYA 3V8BA 4YAUA 4FS3A 5JALA 5KJCA 1EDDA 3KKZA 1QPZA 5IVKA 1UM8A 4M7WA 2L18A 2POCA 1EVYA 1OXSC 3LC1O 2BEVA 4M8NE 3ZD8A 1KERA 1PT7A 1VPEA 2V7BA 1MAAA 3TEJA 3GVPA 1U8YA 4CV0A 4XB6B 3KL2A 2VUSA 5ALKA 1YR1A 3NGXA 4IVPA 1GNRA 4WLUA 4RVDA 1K88A 3L05A 4XTCS 1J33A 2QZSA 4RD4A 2V9PA 1Z6ZA 1X19A 3TGWA 1XZHA 3FCXA 4L3WA 1E98A 4PSCA 1G21E 1V8OA 2RBEA 4KQHA 3KKMA 4QOEA 1SXJC 3ZIDA 5BUQA 2VHZA 3KAQA 4RYDA 3WV5A 2XBLA 3IP3A 3U5TA 2I78A 2JBAB 4IDHA 3TLBA 2JDIA 2Z3WA 3SXUB 2WU1A 4Q9IA 2OSVA 1N0VC 2F90A 4BC0A 1EESA 3UB3A 1QTQA 4O2RA 2G28A 1DC5A 5LA6A 4AP5A 5BN4B 3M6UA 5JXGA 2Q07A 2RONA 1AHPA 4J2OA 2GASA 4KR0A 4Y30A 2CFIA 2JCBA 2GTHA 3PFCA 4UZEA 5DNUA 1E4EB 3SC3A 3WFJA 3TFWA 1VZ2A 2ASVA 3GRPA 3A9UA 1U3DA 2ZJ5A 3A25A 3OPMA 4DLAA 4B76A 1G5FA 2X5KO 5J5CA 3S1AA 4X66B 4ARUA 5FXMA 1AO0A 1E3EA 1DBWA 5JNSA 3TAHA 1RI3A 1ECLA 2JHGA 2NO1A 3FI9A 1GU7A 4N5LA 1NVVQ 4YPOA 4YV1A 3UW1A 4YAIA 5HK9A 4D8YA 3QUBA 1YB2A 2I8LA 2WP8J 4BFCA 3I30X 1BE8A 2ZAMA 2AMVA 2GERA 1ZEJA 2C84A 2JFGA 3GHHA 4HDRA 1VLLA 1T9GR 4AZVA 3PFFA 3ZCUA 3QNMA 3T9EA 1G42A 3TYXA 4EQ6A 1FEZA 2HSZA 4JMLA 3X1YA 2BZGA 3DULA 4QQFA 3P2EA 4GPZA 1ZPDA 5EHNA 5LMCA 4MUNA 3FPEA 1P74A 4G9GA 4B17A 2HH9A 3WV4A 5G02A 2XE4A 3F49S 4K9PA 4RPLA 4PYNA 1TTHA 4FDLA 5ADHA 4HLNA 4ZVOA 1YR9A 3UT5B 4YJGB 1QCYA 1JHUA 5K3BA 3OVMA 4A26A 2AUNA 4QHSA 3SZ3A 4BFXA 1ZM2A 4B3IA 3FNRA 2PUAA 1IN6A 1ZW1A 2ZP1A 5FJIA 3NOVA 1UKAA 3AVYA 3IOCA 1MNQA 2J6HA 1X7ZA 5ESXA 3P1JA 4JP3A 2VH5R 4DA0A 5FTNA 3H18A 3V8RA 3Q0EA 1JSZA 3HGQA 2FN4A 3PVSA 1S89A 1JDNA 3IP5A 4IJKA 3MG9A 4ISBA 2E4UA 2FZ5A 2VFAA 2VP4A 3HDHA 1N2CB 4FWBA 4P4UA 5CLQA 4QOJA 1E3QA 2WWXA 3CPSA 5ALQA 5DMHA 5BQ5A 3PFGA 2P9ZA 4CQMB 2X8JB 4JWTA 4TWBA 5JIBA 4WNAA 4CIAA 3MRVA 3GBVA 4BO5A 3ADOA 3PCRB 1ZSNA 3Q15C 2PUGA 4D9JA 1XPUA 2XWJI 1JU4A 5M29A 1ULHA 2WTBA 2LNDA 4ERXA 3ADDA 3EZGA 2WMNB 4MR7A 2PBFA 1MJHA 3D0OA 3PD7A 2B92A 2NP7A 1EK2A 2Q1XA 5BYJA 3DBHB 2DETA 1YIOA 3DDSA 3KWFA 5BRJA 1NA5A 3HP1A 4E94A 5HSGA 3IKTA 2NU6B 3HR7A 4YWHA 1ZCBA 3QW4B 4AMYA 5C4MA 1ZO8A 3CEMA 1DOHA 1VIDA 1Q1BA 2NU9A 4LYHA 2RC6A 3RWMB 4Z7OB 1DNPA 5AM1A 1SVLA 3G9XA 1T36A 4K2AA 5KYYB 2BGTA 4HUQA 3INYA 3OWXA 3E9NA 2MINA 3FOBA 3GOQA 2JZCA 4KWHA 1DKRA 4JT2A 3RDPA 1WDLA 5BW5A 4AUKA 2FSSA 2XPCA 4YRTA 1XT6A 2B8JA 2JBWA 2PS3A 4FJ0A 1Z62A 4WY5A 5ALEA 3OTOB 1G5TA 2JFOA 3CB2A 2VXYA 4EY8A 3PXEA 3U44B 4DAEA 1LLQA 4LZAA 4M55A 1RZUA 3HU2A 2M1XA 3OJ0A 1VPVA 1HTBA 4K7JA 5B7GA 3QVJA 3IOEA 1Q3HA 4PR3A 3H6KA 4TWJA 1E7YA 1I4OA 1V71A 2I6TA 2OY0A 3HKCA 3N28A 4JC5A 3JQFC 4MKFA 2XXJA 1EGVB 1KI9A 1KU0A 2HLNA 2ZUCA 4ZI7F 3HM2A 2GAIA 4J0QA 2QT0A 3O1HB 2G76A 2I3ZA 4WOCA 4W7SA 2WJWA 3OZRA 4UUOA 3M5PA 1FVOA 4K8RB 4Q3NA 5EJGA 4DLRA 5DOVA 4DV0B 2BGUA 5DTQA 4H0FA 1B74A 3C14C 3EGXA 3K15A 2W4MA 3Q7QA 1W59A 4I1UA 4RMIA 721PA 3CR8A 4RZ3A 4YGXB 4IHKA 2VF5X 3WZLA 4HAXA 5HZKA 4EFKA 3HJTA 2CN1A 2LVBA 4QBKA 3A26A 5TX7A 1DT3A 1MTZA 2P9QA 3W4JA 2I4TA 4RPIA 2P9JA 2PKEA 1DKPA 4QD3A 3RC1A 1IQ0A 2EZ8A 3U2QA 1ZNYA 1NPTO 2QTFA 1GG8A 2C8KA 5H3CA 1OBCA 2PVCA 1VG1A 2DBYA 2I7DA 2R8PA 4H2DA 2GNOA 1QQTA 3FVWA 4MRVA 3VQTA 5KYUB 2W4QA 1FUUA 3GIDA 3AF2A 3KT6A 3OQBA 4L5IA 4PANA 4UPDA 5CIWA 3RIXA 8ADHA 4PSUA 2IYQA 4N6OA 2CHUA 2OGUA 1EDEA 1VPTA 3G49A 4NK4A 3OO0A 4W4TA 5CBKA 4O8ZA 1I24A 2A0XA 3JYPA 5JTTA 3U7HB 4FHGA 2FRVA 2VHQA 2WWTA 4PGMA 5B2FA 1ECGA 2P6MA 2HBZA 2YV4A 3NLLA 3D6MA 4ITVA 3UAOA 1KJ9A 4DNPA 5JAQA 2W2KB 4FEGA 2DQ4A 2IOYA 3JWEA 4W6QA 6ADHA 3KB2A 1YGPA 1N1EA 3KVRA 4BMVA 2AMFA 4YJKA 3OQVA 1CDEA 3KEOA 4KVFA 3A1NA 1HKUA 5BRNA 3WHIA 4NPAA 2DX7A 4EG4A 4DT1B 2FP3A 3KRTA 1ZK0A 2ZVDA 5ECWA 4B2LA 4JOBA 2C2MA 3H3XA 5HMLA 4BQPA 1XNRB 5FPSA 4X6XA 1KY3A 3R1IA 3DMYA 3BJRA 1BA2A 2VNSA 3SEZA 3IC5A 3V9AA 4BO0A 4BCDA 2ZT8A 4LBVA 4Q3BA 2IUTA 4X6LA 4ZQGA 5EMNA 2FW7A 1XTSA 3HB4X 2VP5A 1W7AA 4FOTA 2A5JA 1TAUA 3QHPA 2ZSAA 1REQA 1ZM4A 3OM0A 5EZ6B 2D2FA 1M6HA 1NBWB 4XIJA 3V00A 3NHBA 1IY1A 3FHLA 4Z1OA 3T06B 3F2VA 1Y63A 3MAAC 2W83A 1PO7A 2YXBA 1Z12A 2WJ3A 3RYHA 5AUOB 3IV7A 1A5TA 1DOZA 3Q9SA 1L4KA 4MV8A 3UNXA 3ZHCA 3VYSB 2FDXA 1UKZA 5KREA 1QG0A 3KP1A 3OOEA 4MZXA 1GGNA 5ENZA 2H06A 2WWFA 3PC6A 3PGXA 3O4JA 1QYWA 2P4HX 2YMPA 3VR6D 2D6FA 1OT5A 1RRFA 2ZI5A 3CG0A 5FHQA 1XZJA 3JVVA 4OA5A 3RSLA 3UICA 2VPWA 2ZG6A 2VQ3A 3OI7A 4L8YA 4AFNA 2XBMA 4Z0NA 3GX1A 2EGUA 3FOZA 2YTZA 4AS1A 4NFHA 5JPIA 4LN1A 1PI3A 5KJ6A 4HH3C 3D7NA 3HLYA 1X1EA 3P32A 4UXIA 5AKYA 1SWWA 2FF7A 3K4HA 3DAGA 4GX0A 5TJ9A 2Z8XA 3AI1A 3B3FA 2QU7A 1PGOA 1WHTB 3IA2A 4JZKA 4WKPA 4TXLA 1JFTA 4KQ2A 2UUAB 2X15A 1PDVA 2RH8A 4HBZA 4WCDA 2E0IA 1F1BA 1QNLA 1UMDB 2QUKA 2R6AA 3GJXC 4MRPA 5K0JA 4OI0A 4H3SA 3FHOA 2IF0A 2F3QA 1QYVA 2I7CA 3TGPA 4QATA 4RM3A 3MWKA 5CT9A 1K5DA 1AKEA 1YQEA 3LBFA 4GL4A 1DJMA 4ZVRA 5DFAA 1QOPB 1NMQA 2WOJA 5BT9A 4KYUA 4G9EA 4N9WA 4PAGA 4Q39A 1RYFA 4UVHA 5EXDA 4ZZ3A 1DWUA 1U0LA 2WYIA 1W0KA 2IX3A 3VJRA 4WZBA 3GEBA 2A5DA 3ZIAD 1JLMA 2Y1LA 2ZULA 3GLTA 4D5EA 2O2CA 4R0MA 4LVUA 3WAJA 3WJ2A 2DTDA 3RV3A 1HSZA 3ZW9A 2GI4A 2JW5A 4LF4B 5U1PA 1ODTC 2GF0A 3DBRA 1CLEA 3GPIA 4XYMA 3EIWA 1EFPB 1A88A 3OM9A 2RSLA 2R6ZA 2C0QA 3M4JA 4LGMA 4V0MA 3C6YA 2OMEA 3DNFA 4NS1A 4W9NA 2K2WA 3AESB 4ZEWA 1NXOA 1O87A 2WNHA 4RETA 1HDZA 4AMUA 3AILA 1DZ3A 3KPUA 3PL1A 2QQGA 4AY6A 1MXFA 2FMKA 1ML4A 3BMQA 4HXFB 4LCEA 2XDQB 3BA6A 2VZLA 4P32A 4WFQA 4WECA 4ZGWA 3KXIA 1LRJA 4PIPA 1SGWA 2AN1A 3T7EA 3TBHA 2XCQA 3G1TA 4RDHA 2GVZC 1R74A 2FETA 3FNBA 3KOZA 3CW9A 4R8KA 1EE1A 3UTDA 3UBMA 3HB5X 3HJUA 2AN5A 3OX2A 2M98A 4HGRA 1V47A 1MB0A 3AZPA 2NZJA 3UWDA 2Z2KA 2QTVB 4ER5A 3EVDA 2NV0A 1JB1A 2HXYA 3DDNA 1VYVA 2UV8A 1GQFA 5IC4A 5JASA 1GVNB 3PUHA 2PUDA 5JYCA 4R84A 3L7CA 1AKWA 4NX2A 3G6KA 4X54A 2CUTA 3R5HA 2GHIA 2OXRA 4I4CA 4AVYA 2ZIAA 2QX6A 3EF3A 1YR7A 2YZ7A 2DZDA 1GUDA 1IY0A 4PG4A 2IHZA 4F7DA 3RIYA 1J9GA 1PLJA 1DPGA 1P75A 2O2ZA 3AU8A 3F6YA 1DS6A 1RP7A 2Q4OA 1RXEA 4XPIB 1VCIA 4DAOA 4IDQA 5B30A 2RAVA 1J20A 1U0NA 1U7PA 2ZJBA 2ZW9A 2D54A 2Z6AA 3FZQA 3WHKA 3UA3A 3GXOA 3MUFA 4UBIA 5LQNA 5I9LA 3L1IA 1SWVA 1U1IA 3H1PA 1OYWA 1O77A 2PYDA 4KIWA 3GYBA 2BGRA 1YS2X 3BKXA 3H99A 1W6RA 1IXKA 1WD5A 4QBHA 4M89A 2F3TA 3TCNA 1I30A 1DBSA 4RTLA 2JK1A 5IYZA 4A23A 621PA 4B0PA 2I6FA 2LKDA 1I94B 1NVEA 1U3CA 3FWYA 1E3SA 3UC5A 2CC2A 3BCRA 3ZZNA 4XCVA 5EUBA 5CXUA 2IYTA 1WDWB 4P3XA 4IV8A 1T3GA 1Z7WA 2H3EA 3V8PA 3FLAA 3GDWA 2FQXA 1O6BA 4GLFA 4G0QA 4B6OA 1XKLA 3OPYB 5EJ6A 1W47A 1NFQA 3A28A 3E03A 5DXAA 1EZ1A 2YFYA 4NCKA 5FLEX 1FNSA 3DHNA 4KRXA 2IS1A 4BN0A 4HH0A 4HBGA 3HK2A 3PPYA 5HWSA 3MMZA 4Q4DA 2GYVA 3DCJA 3LLSA 4ZMRA 3P27A 4I9UA 1KFCB 5KYXB 1LBHA 1TZCA 2NNWB 4HAIA 2QE6A 2ZJOA 4UCFA 5DHQA 3KT3A 5C5IA 5F7OA 5CCBA 4KBGA 1XALA 2FWMX 1C7RA 1TEHA 3LCUA 2P8JA 1NX6A 1T15A 2G04A 2A0WA 2QOEA 3E81A 3NONA 2WQ7A 1K0FA 1E59A 1L3IA 4Y2VA 4B4VA 2XQFA 2BUAA 4GOJA 4N5MA 1QK5A 2XKJE 2YJ4A 2BMJA 5G0WA 1D2RA 4DADA 5I7OA 5GM2A 1WBBA 3IR6A 1UOOA 5DNAA 3C3PA 1DT5A 3GJ3A 1BDMA 3OOWA 4B4WA 1ZR4A 3N58A 3QA3E 4WUTA 4E4RA 5K3DA 4YB8A 3EIFA 2YDXA 3LHKA 1RI2A 4GYJA 1HEYA 3LWDA 1CJBA 2VF8A 3T7RA 1F14A 2IDZA 1OFIA 1VSUA 2QG6A 4EY3A 4GUAA 5BWMA 4EGJA 1RHRA 1NAHA 1WSWA 2O52A 2V1UA 2KJQA 1ZG3A 2XDYA 1DKLA 5C1OA 3AJEA 3ID6C 2CJWB 3EFOA 3B6KA 3H9EO 2CL0X 2FEWB 2FE4A 2PJUA 4IRUB 4B32A 3W9YA 2I2CA 2DGDA 4RCVA 1EUCB 3B1YA 3V8MA 3LL4A 4TYQA 4B8YA 4AF7A 4CMJA 3B6ZA 4GE3A 4I3GA 4OYLA 3CLHA 2JAQA 3E1SA 4Q01A 4CLDA 1SHLA 4KCGA 5JD6A 1JIKA 3BGSA 1DBIA 1M2JA 2XUQA 1GAWA 2I87A 2Z98A 2VDRB 4NXMB 3B78A 4QOSA 1Z4NA 2ZCVA 2XBUA 2IPXA 3T7CA 1GA6A 1N5DA 4AZWA 3UKJA 1JEOA 1ZWLA 3ZLJA 2B8NA 3KVYA 1OTHA 3DE7X 3A3OA 3UAXA 1HV8A 3PPIA 1I1QB 1QSGA 4JLSA 4I1RA 4OBWA 3JQ9C 4BZPA 4BQSA 2K7FA 3DLHA 3DQQA 1EUZA 1O97C 1N9GB 1TLTA 2F3PA 2QMZA 2XD4A 3DMTA 4PM4A 3MLEA 5FBRB 3UBTA 4IDDA 1D2GA 2FK7A 3FY4A 2G07A 2WM3A 4XM0A 1PUIA 5LLDA 1SZJG 1GARA 4PXYA 4C3UA 1PL6A 4O0MA 5CG2A 4CMKA 1ZYUA 3MAGA 4UHKA 4PR0A 1TNDA 2X6TA 4NKRA 2B8WA 4B79A 3CSDA 2W2OA 4UULA 1G1MA 2FWBA 1V11A 4A0RA 2Q1TA 1U1EA 1YGYA 1IHDA 1F51E 3B89A 1KYTA 4LZPA 1Y3HA 3H5RA 4PCLA 1OB5A 3AJAA 3O8LA 2EL7A 4YCNA 1C3OA 1NTOA 2J3QA 4B6PA 1EM6A 3AEQA 3U19A 2CWDA 3AVVA 1J8MF 3NC1C 1W4BA 4Q19A 1PZNA 1UIMA 2IYUA 1EG2A 2EFGA 3D3WA 2Q0XA 2MYPA 3JQBA 3JQ8B 3OU6A 4YONB 4Z7QB 4DY6A 3PQCA 5TPZA 2HSGA 2IS2A 3OZXA 2EZ4A 3HXQA 1E8DA 1WTCA 5CT8A 4ND8B 3C8DA 5AJZA 5T4EA 5CDYA 1U7DA 4FVTA 1NE7A 5A7GA 4C14A 2D62A 3KE9A 2ZI9A 3OQPA 3N7TA 3RBZA 3TN7A 4MKHA 3B12A 5GIOE 4GMKA 5L3SA 1FDUA 2AJ8A 5B3AA 1D6MA 5GINE 3P9XA 1PK7A 3MT9A 1A7KA 1ZY2A 1WB5A 1T0HB 3OPYI 4NH4A 2JGIA 1QZUA 2N47A 2QUJA 4NABA 2HHHB 1AKYA 5JBNA 5H3LA 3FYUB 3NC0C 4EY7A 1JHVA 2J3IA 3OH8A 4D25A 2CCJA 1ATIA 1SIWA 3HJAA 4GOND 3L0YA 2DPYA 4LMAA 3RM3A 4ZQEA 4GC9A 2IZ7A 1FTWA 1Q7EA 3EIUA 1CERA 2C5SA 4GPBA 5F3RA 1MQAA 5AVWA 5IVIA 4HVAA 4F6CA 4ATNA 4CMGA 4FMDB 2NWQA 1XCJA 1WDTA 4OREX 3MMNA 3LCCA 4P3OA 4ROTA 1OH8A 1HE3A 3ISVA 4MRNA 3OY2A 1JTVA 3RNOA 3Q7EA 3E58A 1XZAA 4B1FA 1UBJS 5CITA 3V4LA 3DV0A 1Z5WA 3OBIA 2OP0A 4WTOA 1N1MA 4FOOA 3JTEA 3JR3A 2FVYA 2BJWA 2JEOA 3I1FA 4CJXA 3K6SB 2Y92A 3NYWA 1GA4A 2W58A 1FTSA 1IBCA 2O48X 2FRXA 5BNTA 4BNXA 3PNKA 4F21A 1JQAA 3K1AA 4ZDWA 1YRHA 3UUEA 4PPFA 4FE3A 4CODB 2CDRA 2BSAA 2WF6A 2XUZA 1WMBA 2YJGA 3BREA 3DTVB 1TO2E 2QM3A 5CX1A 1R66A 1I1OA 2QX8A 1Z6XA 3DXYA 2F48A 5CH3A 3UO8B 3WB1A 5K6RA 5CR9A 3DHEA 4G65A 1IDOA 5ENDA 3NAGA 5EESA 7ADHA 2B0JA 1M2VA 1H2YA 3PK0A 1A50B 1SCAA 1X80A 2XF2A 3LUFA 1GTG1 1LK0A 4G0OA 3VU8A 1N78A 1XQ9A 2I3GA 4TS4A 2I76A 2M6RA 1J5PA 4Y6GB 1CQXA 2BKLA 3BH6A 4MVYA 2JLXA 1D0IA 1KK2A 1U7OA 1EXWA 1U28A 4XH9B 3L02A 3U4CA 2ZI4A 3EYAA 4UVIA 4HN4B 1P6QA 3EAGA 4KXUA 4HSGA 2HF7A 5TARA 3SM3A 1Y7IA 3ELBA 4O1MA 3EVTA 5AM2A 3SHWA 4Z4HA 1N6RA 2I7TA 3RQSA 3S4YA 2BE7A 2BFBA 1DDOA 4XUGB 4AKEA 3PDIA 1AUQA 4D8XA 1MRSA 2C2BA 3TL6A 1NPYA 4NS4A 2H11A 5EWLB 4X8LA 3U7FB 5G1PA 2I9KA 1TUBA 4MW9A 4MGYR 3VSCA 3IBFA 4HB4A 2ZPUA 4RW0A 4KFTA 1Y6GA 2XVXA 5CH8A 3KYJB 4XYGA 1R6DA 1GZVA 2EGGA 3I2FA 4B3HA 5BNWA 5ALDA 5HJ2A 4BKRA 4KFUA 4HHEA 3SIWA 1NFRA 4AJNA 2F9LA 4YBRA 2JANA 2Q5LA 3EZ6A 3DEIA 3ZC3A 5I4CA 3ELUA 4JN6B 3CPEA 4FJ2A 1ENZA 2WMYA 1R9JA 3DV9A 1HZZA 5AJTA 3JASA 3QPCA 2QLLA 1IE3A 3QUTA 1Y89A 2FR0A 3AWIA 2P4SA 3DF9A 3SP1A 2UVPB 1UXHA 3Q40A 4HJXA 2IDKA 3M33A 1XCOA 3MGGA 5COBA 2HRDA 1NW9B 3FUVA 1G5IA 1MKYA 2WY2D 5TMPA 1EJ6A 4D45A 1JG4A 4NI5A 4WUVA 2NVWA 3WYFA 2WM9B 1GSIA 2RKOA 4PSKA 4Z7JA 4LZJA 3DL2A 1K7EB 2CBGA 4TWZA 5AVZA 4HEA6 3GF4A 4J07A 2C4UA 3EGIA 1F0NA 1VP3A 3PENA 1OU0A 1ZK3A 3CG4A 1HM5A 3H17A 1QGUA 4M9RA 4BO7A 4DLKA 1OF1A 4B6GA 2MMCA 3U16A 4BV8A 3PC2A 1L5WA 3S2SA 2OV8A 2CE7A 3OT1B 5JJIA 3EPPA 3CV3A 4RTQA 2YOHA 3PUJA 3I12A 3TWOA 3BT7A 3D5EA 2CHEA 3L1VA 3C5EA 4EIWA 4V0OA 1XMXA 1H2FA 4LXXA 1NZFA 4RPJA 5DB4A 5K7SA 1Z5NA 2OXTA 2CJPA 5IF3A 2JGDA 3L0OA 2LXNA 2FWJA 3HA2A 3KHTA 5JPCA 3T5CA 4RKWA 2K4MA 4OQZA 3HKBA 2YZGA 3AI3A 1Z6PA 1YHYA 5C4GB 3S2FA 4PZUA 4B0OA 2AHOA 1YF3A 2G82A 1COWA 1ECJA 1Z0UA 3JQAD 4JI7B 4BATA 1WA5A 2DTXA 2H1WA 1CQIB 5BV0A 3SBXA 4K9LA 4NYMR 1CUVA 1E6UA 4TYNA 3H5LA 3S2EA 3BWCA 5A0FA 3H6HA 1E9SA 4FSXA 4I4NA 4LI3X 5G53C 5J1TB 5K05A 1UWCA 4OP1A 1JR2A 2R84A 4KX3A 3SJCA 4J6FA 4BBAA 3LXUX 3AEYA 4DMRA 3AEUB 1EE9A 3QVXA 3W7VA 1PS9A 5A4IS 2YVAA 3AIIA 3DNMA 5TQ0A 1H2ZA 4A8PA 4EY6A 1C9JA 3CX8A 1FTQA 1YSCA 1L5MA 2IOFA 2GPBA 3EQ2A 5BWLA 2QE7D 2PAFA 3K9CA 1A76A 1B93A 1E79A 2NO7A 4D3DA 3NBKA 1ISPA 2BCJQ 2GK6A 2W6NA 2WKPA 4GM4A 1K3TA 1GPWB 1S2LA 5FO0A 5LWQA 3LGAA 4CKCA 4EF5A 3X43A 1LV8A 3K0AB 2UZ1A 4AJJA 4CM6A 4ES6A 4EWLA 1B0ZA 2HWUA 4CIVA 5LBUA 2D1TA 2ONZA 5DGCA 3VX3A 2PUJA 4AZSA 4CT5A 2Q46A 2PGNA 1AKQA 2E1RA 4YXWA 1KSHA 4FCTA 4HWTA 4LXYA 4JOSA 2YXNA 3CC8A 3R6LA 4D9EA 1UZMA 4OG2A 2ZYAA 4MWTA 3OA2A 5B37A 1T8YA 2FN8A 3I0NA 4EMUA 1W85A 2BFAA 3NBAA 3QE0A 4R7ZA 2IE8A 5BMOA 4ZCQA 3PJDA 3A4NA 5H9VA 1KTVA 2XNDA 2Q1SA 3ZHYA 5C7YA 5A3VA 1Y3IA 2QRVA 4C3OB 3B85A 1U80A 2X9LA 1KR2A 1PQPA 3PNVA 4JL6A 1KTIA 3C0KA 1NLZA 5F78A 4F7WA 3QLVC 4DSTA 2YJNA 1S3FA 2IUEA 2OXFA 5G1OA 3R7FA 5YASA 4WDQA 5FI5A 1RI1A 5IHXA 3EIEA 8ABPA 4GE0A 5HQ3B 3RYCA 1P1CA 2XZPA 5EHQA 3SHQA 4GGPA 4OQYA 2PDAA 2OBNA 2YASA 4LCBA 5ALPA 1CF4A 1PUJA 1YR2A 3QKSB 4WBXC 4IUDS 4LNHA 5D3KA 5EPUA 1F60A 3IQGX 4ZHQA 4NXNB 3HYTA 1E7MA 3WNCA 1JSRA 4I5DA 2AA3A 4IXNA 4JB0A 4C0JA 1H5NA 5GVSA 1XZBA 3I1IA 3E9CA 4GG1A 4A8JA 1JSCA 1GUFA 3RTCA 2Z95A 2SICE 3JATA 2C31A 4ENPA 1XR3A 1M10A 1TKCA 2Y27A 2Z3VA 1FX0A 3K72B 5DGHA 1HA3A 3FKSD 4IIJB 1ULBA 2VNHA 5AKIA 4DM4A 4KGVA 3M1AA 4XVUA 4CEIB 3D31A 3WL7A 6GPBA 1Q7TA 1S2MA 4RFLA 2VP9A 3I39X 3VZQA 3FNEA 4J43A 1Q16A 3D3JA 5DLDA 1T9HA 1CG6A 4ZOLF 2NNLD 4RLFA 3ECAA 5H81A 3SLKA 4YUZA 4AXXA 2F1OA 4PGGA 1BEZA 4YRLA 3ENZA 3N05A 4MRRA 1IOWA 1X38A 4ZAGA 2D7DA 2FR8C 4U7HA 2BDEA 3PF8A 3PHJA 1QP4A 3BN3A 1EJ2A 4ZVPA 2AEEA 3FHCB 1GTZA 3TB4A 1H3FA 5LUAA 4BEVA 3U0BA 4MI1A 4LY0A 4PFKA 1FJ2A 2BOVA 4ZOCA 1G6Q1 1I80A 2LIPA 4MARA 2GJKA 4PINA 4EG5A 1YFZA 4MPRA 3DZDA 1G17A 1ZLXA 4N5DA 1ZN7A 2NMVA 3HJHA 4BHTA 4KVGA 4LE2A 4U7JA 3BSFA 3VPSA 1JQEA 5JR3A 4BV3A 3BMNB 4YJ3A 2ISSD 2WZQA 3MT8A 5F35A 2RI6A 3NIGB 1M1YA 3Q7IA 4IDEA 1UEXC 4K9QA 4MP6A 5CK4A 1O6GA 3UA4A 5IEJA 2V7QD 2E5WA 5F4ZA 1XEAA 2H2WA 1CIPA 1V9SA 2UVQA 3IJPA 2V4MA 2C5BA 2D1RA 4ZC1A 3WDLA 5M34A 2CXPA 5HG0A 5K51A 1BA3A 1XQYA 1OI3A 1RZVA 3LP8A 1RPNA 2P62A 3UHPA 5IBCA 1ACMA 1FFDA 2C2HA 2ZIXA 3KXDA 2XMZA 4GICA 1CF2O 4A8HA 1XEFA 3DD5A 3EY9A 4P2GA 2YWJA 3D2CA 3DTTA 4HDKB 2CBXA 3GLQA 4LX0A 1NJ6A 4YCJA 3RCBA 3UV3A 2O8FA 4EARA 4MR8B 2XVAA 4F12A 5M7EA 2XE6A 2IS6A 2X13A 3NVMB 2Q5HA 1JA0A 4KPUA 4P36A 1R4MA 2HNBA 1ZESA 1UPAA 2MMGA 3KPVA 4PXAA 5ALGA 3TIIA 4UPEA 1WUIS 5G41A 2EARA 3ZGNA 5CA1B 3E7DA 3MXOA 3NTVA 4INJA 2Z04A 4PAWA 4PZ0A 3WL6A 1C3VA 4IHAA 4PBTA 2JS7A 3W5HA 3LAWA 5DBGA 2GBIA 5CVEA 3AH8A 3I8SA 3TMAA 2OCIA 1AZWA 4BJHB 2C03A 4G26A 3U4MA 5HILA 2ZJ6A 4HYQA 1LF0A 1M1UA 4XLLA 1AY0A 1HDIA 2XQGA 3B48A 3O7WA 4XAQA 5BYKA 2XUOA 4YMLA 4XM1A 3AHEA 3MHTA 5LIPA 4XJTA 1Z2CA 1G6KA 4Y7DA 4DABA 3A05A 2WFMA 3F97A 3UB4A 3K9QO 1U2PA 2NTYC 2YWGA 4DBZA 2HREA 5DE3A 2D5LA 2R00A 1PGNA 2ZTLA 3AERB 1XDDA 3HEAA 3B7WA 4UMDA 2NXWA 1LNZA 4EG7A 4PSAA 4JCOA 4DKJA 3O2QB 2YCLA 1I6KA 3UF0A 6CHYA 5BSWA 2B8TA 3RS5A 3VPBA 4JBHA 1DPFA 4UNRA 5JJLA 4ZI3A 3H05A 4JBYA 2AVDA 3I9JA 2VXBA 5A9TA 3RT1A 2C58A 4LTMA 2FPOA 4FYIA 3K0FA 5REQB 2VDWB 3FDZB 2ZYVX 4KXVA 4ZU1X 4QTYA 4MCJA 4A0SA 2PL3A 1KHHA 2BFDB 1F3OA 3BTVA 4FKBA 5AHKA 5CB6A 2J0UA 1KZ7B 3ESAA 1QF6A 1T4CB 3R0VA 1Q7BA 2WIBA 3TSZA 3B3QA 3BIJA 1SBIA 4L76A 4NPHA 3VPAA 5I45A 5FOTA 1W8IA 4LA4A 3WLMA 3SSAA 3AGQA 4FNMA 5AI0A 1GR0A 5C34B 5KYWA 3RHFA 2CNWD 2QW0X 2QY6A 4GWKA 5FTWA 3SQNA 3HCEA 1VE6A 4KIJA 1MOQA 3HCOA 3NWEA 2PNJA 2PH7A 2V6FA 5FORA 1KI3A 1AIPA 1SN7A 1YZVA 3N8NA 2QPOA 3JD3A 4RQTA 3IHTA 5SY9A 2PJDA 1J07A 2M32A 2EG5A 2UZ3A 4AO6A 3HJRA 4K26A 4Q1VA 1P0FA 4G5GA 5F21A 4DV4B 4HDAA 4ECEA 5IN5A 2F59A 3TM5A 3GRKA 2V7GA 4EYOA 3UJ7A 1UKYA 4URUR 1QH8A 2CXQA 1GLNA 3R0QA 5J4YA 3SVZA 2EEPA 4M9ZA 4XB2A 2XNHA 4V24A 1FLDA 5CRIA 2G72A 5DNEA 1VPLA 5E4YA 3LXMA 4MYRA 4YQZA 1D4OA 1ORDA 1RHMA 3G2JA 5DV9A 4X1KB 5E6SB 4DCSA 3AYZB 1Y6ZA 4JENA 3VDMA 2CL6X 4ZRNA 5KHAA 5KTSA 2OXCA 3W2FA 2YR0A 3GC6A 2EV9A 2V0CA 3RYIB 3L7YA 3QELB 4U9UA 3S6JA 2QB5A 4ETMA 1QV7A 3ZTTA 5BSVA 5JW6A 5KNCD 2W2PA 1Z35A 2Q3JA 3W4KA 3AQ4A 3R3ZA 4WCVA 1NSFA 1RLJA 4KJXA 1P60A 4Q4AB 3DV2A 1U9IC 3IQFA 4QQKA 1JRLA 3FRJA 4JC8A 5C7LO 2A9QA 2N46A 5AXAA 3FI0A 4MV7A 1M2FA 3FPCA 2AFHA 5SYNA 2VSFA 4YP1A 5FTKA 4QBTA 2G80A 4O4IA 4RA9B 5DXFA 1R0CA 5IM4F 1NYQA 3BD7A 1R6TA 2YJTD 1P5FA 1XDWA 2DHCA 3GGJA 1NV9A 4RGQA 5JMOA 4YP5A 5H3HA 4EGSA 3EG9A 4N03A 1VKRA 3WAGA 2DPXA 1XJQA 1N2IA 3AVUA 3CEAA 3I8XA 4KQ9A 2QQFA 4KH1A 3WKCA 4BCCA 2WT4A 5TT0A 4IY1A 2BGGA 1C8BA 4D3SA 2AI2A 1OYVA 2WV7A 3BCHA 1JALA 1X94A 3HYRA 1PS8A 3KYCA 4GLJA 4MVJI 4PLCA 5WRFA 3TKAA 1EP3B 4E13A 3GPCA 3WK4A 3V4OA 4C01A 2ZE8A 1S8FA 3W8DA 1EXMA 4FYMA 1MEEA 2IBMA 1AB5A 1X1AA 3D3NA 3O74A 3INNA 4H6VA 4K9KA 3VR6A 1N6PA 2COEA 2OAGA 1V8DA 2A3NA 3E2IA 3EWNA 3GLSA 4FHEA 2Y9PB 4IQGA 3H6GA 4K46A 1QC5B 2PEYA 4MV4A 1DX6A 1EJ0A 1R0YA 5HQTA 5LNK1 5A0VA 3MJVA 3KKEA 4YRBA 1DC8A 3KJIA 3MVEA 1YV9A 3GDHA 3HSSA 3R24A 4MUGA 4OY3A 5ILGA 1RM5A 2QNRA 5HW0A 3GGDA 1CKEA 1RPJA 1MC5A 2YIDA 3OAAD 4AD8A 2WUVA 2AC4A 4HLUA 3RSQA 1V1RA 2DH6A 4P0PB 1WVMA 2ZQ5A 4FBGA 5KNDD 4QLAA 5DSXA 3DO6A 2L19A 1JR3D 4N65A 1QJ4A 3DOIA 4R68A 5FBQB 3NTXA 4D42A 2H4XA 1LNQA 3TOVA 4ZOAA 4BNUA 4JI0B 4BLRA 1O0SA 3O6VA 1GG5A 3EQ9A 2DTEA 4CLXA 4HN2A 3W2IA 1ZK1A 5K3CA 1NJSA 1RACA 1CT9A 4AK9A 4DILA 2HKIA 2JLCA 1NXXA 4S1WA 4DVGA 3UUFA 3WGKA 4I5IA 3Q87B 5DN9A 2ROQA 1PE0A 2AX3A 1DBVO 1S2NA 4C43A 4D8UA 3V1MA 3JY6A 2N9UA 2X86A 4IIHA 5EEGA 3ZIAA 4CKBA 2E2WA 1L8AA 4W1SA 2FPXA 3L0ZA 1VGRA 2VWGA 4LJLA 1CF9A 1RMTA 2PUWA 3MCVA 4H0NA 5FOUA 4ZMSA 5EKDA 4W5WA 2IYVA 1L5QA 1OI2A 3SZOA 2O8NA 4DMUB 3CPHA 1J09A 4J4HA 2I80A 4RF2A 5DT9A 3BCSA 3GCGA 4KMOA 1TPYA 4IUYA 3HWWA 4FFDA 1EVZA 1A9XB 5C8YF 2DECA 2HRZA 2CJXA 3OUUA 1ZGZA 1MORA 2YJ3A 2NVUB 4CM8A 4TZ0A 5EWJB 1DG1G 2AK3A 4KQFA 1G5RA 3U7IA 4D74A 4Y3UA 5EOVA 2CFTA 2IZOA 1HX7A 1FXSA 1G7CA 2ARKA 5D3QA 3VAYA 3O8QA 1CR2A 1D04A 1QIGA 2FSPA 3CNEA 2EF1A 1P5HA 1BWRA 2GILA 1X7XB 4PYMA 3SX2A 1KI6A 3A4TA 3W2TA 3PNPA 2AG8A 1OAOA 4H7PA 1K3UB 3O03A 5AKXA 1EQUA 4ARSA 1U5CA 1JG7A 1H66A 1PQUA 2OKGA 4JVMA 3RUCA 3WKEA 1PNTA 1JH9A 1OLXA 4R3WA 2CLCX 1U2RA 3FFAA 3KSUA 3CUWA 5GOZA 2JAUA 3OCXA 1VHLA 5E7QA 4OGWA 4L1KA 3R3XA 1BN6A 2FLWA 1DXOA 1OT3A 3GVXA 1CBUA 2FPSA 2X7HA 3AR3A 3C41J 1HK7A 3LFTA 1ZCZA 3NDRA 3QVVA 3ONDA 1DX9A 2OCDA 3O4HA 4PC2A 4ZI2A 5IFLA 4UJ3A 2VZEA 3VTFA 5CDGA 4TKZA 3LSYA 3GT7A 5DHAA 2ODTX 1CUHA 3RGWS 4HRVA 1LLDA 4BQNA 1IG3A 2PO7A 4R01A 1I9CA 1KQOA 3GNSA 4TSFD 4YT5A 2AF4C 2RH9B 2ZIWB 4HH1A 4GXRA 4M8IA 4O6VA 5GV7A 3CF6R 3ZE1B 2Y1CA 4AF8A 5FLKA 4YIHA 5HZHA 2B6NA 4BZZA 1BZYA 1PTJA 2MT9A 4GAEA 4YJFB 2R44A 4KSBA 3ZU6A 1X8XA 4R2JA 2QN1A 4HAWA 2D4AA 4WZBE 3WWZA 4YYEA 1AKMA 4CL2A 2CHFA 2WSIA 3TFQA 3IMEA 3Q2IA 3T1OA 1XROA 3BA1A 3WYEA 3LI2A 4DA8A 2Q7XA 5JQWA 1KIFA 1OA1A 4BFYA 3NOQA 4JU9A 2O8EB 2J0SA 3O3CA 1U1FA 8OHMA 1E9EA 5ESRA 4B80A 1Z6TA 3YASA 3AB3A 5CGQB 1MOPA 3NR2A 1KP9A 2ABWA 2J9FB 2ZJ4A 4V0ME 1P9LA 5K2MA 2GF9A 1PUXA 4M36A 1E1LA 1KEKA 4RY0A 3P52A 5B6IA 5C8VA 4OQFA 1T6YA 4EPRA 4BMSA 4R2IA 3W8FA 4L6IA 2IF2A 3UMCA 4DLZA 4DRXA 2VNAA 3PX2A 2C2GA 4NQZA 2NSJA 4OHCA 2X1HA 5AKZA 3RAGA 1EMDA 2ZR8A 1WD7A 4I1YA 2NO6A 3L04A 2ZXEA 3VR4H 1ZA1A 1TM7E 3AL3A 2Q6KA 4MAFA 4OQMA 4BRSA 5HOEA 1IDN1 2P3LA 4Q5IA 1FJGB 2EL9A 3K8YA 2PMWB 1HQYE 3WGYA 3UMMA 2JK0A 5LOVB 5FNVF 3VVMA 3FTFA 2RK3A 4DDVA 1JIVA 2ANCA 2H5EA 1EVLA 3JQ6A 2PEZA 3QFHA 4O1HA 4PTYA 2WWIA 3T3GA 4AJHA 3DKPA 4D4GA 1A69A 1I6WA 4KPGA 3MPOA 3OF3A 1KK0A 2DHEA 2OYRA 3HDJA 3JARB 1UBCA 1E9FA 4CF3A 3GLHB 3U3JA 1TAHA 3LD9A 5AM0A 2Q2WA 4X8OA 3A6KA 4LMRA 2QTVA 3B1XA 1P4SA 2F43B 2C3UA 4M1OA 4NARA 5D5QA 1BHSA 2Z5LA 3DO8A 5DEOA 4HNUA 3WVNA 4LHZA 1TEVA 5DM4A 5E1DA 1KQNA 4L5BA 4PO9A 3RUEA 2PUFA 3DFKA 3QTLA 2IS4A 1IRIA 4NL4H 2XUJA 3EXIA 2AJBA 3LUBA 3Q5EA 2RGWA 3BGIA 1IBKB 4GUDA 3VKVA 1YBVA 1KC1A 2ZRPA 4LHXA 1T24A 4G25A 5E1OA 4EB8A 5DNVA 3FTEA 3EGVA 4M7PA 5ALZA 1B2LA 1A71A 1RAIA 2C54A 2G88A 3LIPA 3Q2OA 1Y4DE 1TFUA 4RS3A 1C9YA 4D9IA 1GPKA 1MJFA 2DLCX 5KWEA 3JW8A 2XRFA 3E9EA 3OD1A 3ZBTA 2P2NA 4YGYA 2HCTA 4I1IA 2HPVA 2WUEA 4D8WA 4F85A 2WA1A 3UH1A 3CLTD 2HA4A 4M87A 4PG6A 1YZTA 3FTPA 4DV5B 3JQ7B 2PCJA 3BZBA 3OX3A 4UM8B 1NBOA 2MJLA 1A7JA 2HLPA 5IBPA 1A04A 1BXRA 1DUIA 3IB3A 2ZRAA 3GNTA 4X1YB 2P5UA 3WIVA 3ZE8A 2AH5A 5J4LA 2O5EA 3GN1A 1P2DA 2OGSA 1HL3A 3JWJA 2O9JA 2JGEA 2R4QA 5A4JA 4ZVMA 3KOMA 3GZNA 2Z43A 1CNMA 1OZGA 4C4OA 1GKLA 1IZ8A 3JZAA 2B21A 4F60A 3OIFA 3COPA 4CI9A 1AV6A 3NU1A 1HF3A 4GT1A 2PZLA 5MN4A 3KJZA 1U3GA 2R87A 1RWQA 3LYAA 1E1MA 1JIXA 1X7YB 2EKZA 3P9QA 4RKEA 2QRJA 2FFRA 4DB4A 3C2QA 1HLGA 1UAYA 2IE0A 1O4WA 3CVXA 1KIMA 1MMFB 1SNYA 3U13A 3WWDA 3IMCA 4R8LA 3WWOA 4RD0A 4ZK2A 2Y05A 2XRMA 4EG0A 2E48A 3KLNA 3TQFA 1HRKA 3FMGA 1S2DA 1FF9A 2DCMA 2HJSA 4R8SA 4ZT3A 4K6MA 4BQRA 1BVRA 4NY1A 2I6SA 2RCYA 2QNBA 3TD9A 5ITZA 3S81A 1C14A 1MVLA 1G8YA 5A05A 1L5GB 1QCDA 1G16A 3EMVA 3SR4A 4JUIA 2PX5A 1WB9A 2WTEA 4ER0A 3RUDA 5IG2A 2H29A 2QXYA 4X63A 4IXTA 2OCGA 1YK0A 4U8HA 4MICA 1LW7A 1DAHA 1UBOS 2VK8A 4HRYA 3SG0A 1R4NB 3ROPA 2VCYA 4CPDA 2XZTA 1P2GA 2X4GA 1JVNA 4L4XA 3DQZA 3Q3EA 5AIBA 5BMVB 3U4QB 1SIOA 1UEIA 3MJCA 3OQHA 3KOUA 4N0EA 4XW2A 4DCVA 5JDIC 1I7DA 1A2KC 2H1RA 4BX0A 3SZGA 4NV1A 3V1TC 4F2HA 3AEKA 4JCCA 4MGZR 1FTYA 4FILA 2QF7A 4ZDJA 1C29B 1U8FO 1EUCA 1X7HA 1WCYA 4IZ6A 2JFYA 4Z2YA 1VI6A 3BE4A 3JAKA 4KITB 3W8NA 4Z9XA 4JNKA 5B12A 2WWYA 4ZV7A 1JHZA 4GM1A 4JBIA 5HUJA 2JGKA 4AJ9A 4A82A 4AW9A 1AN9A 2EZUA 4NFLA 2IW1A 4CR7A 1GEEA 3ZE9A 5JHGB 2A30A 2ZWVA 1D4ZA 3I72A 5DK6A 5A02A 3C5VA 4XQCA 1JT2A 1YKSA 4HDQB 1UC9A 1WOYA 5GVRA 4L0DA 3RK0A 1PW5A 4KRFA 1TJ5A 1RYDA 3D4LA 2HPHA 3EULA 4PYIA 3N59A 4KSCA 4BNMA 4YI3A 3W5SA 4WOKA 3KJXA 4PX3A 2JF0A 5CX4A 5FWXA 1PT6A 2RI1A 2IU6A 3SJZA 4MLPA 2EHJA 3H13A 4IJWA 4F11A 1YDGA 3WIEA 1HR0B 5PNTA 5I9BA 4V2UA 2AZXA 3ANTA 3MTAA 4RVGA 3ZHQA 1R37A 3F3KA 3WGLA 5C52B 3RAEC 2G8LA 1G6OA 3R7NA 1RCFA 1YB1A 1YRYE 3DB1A 1Q50A 3OUTA 2HJVA 3UWSA 1Q7GA 1JECA 3OZGA 4PS1A 3SR3A 1YDEA 2V98A 1NT2A 2OV3A 2V45A 3GLKA 5CNKA 3TZ6A 3U7QB 1YJCA 1PZEA 3IR5A 4PZLA 1SHKA 3NUGA 4HQKA 4I9FA 2YV1A 1RT9A 1SVKA 4UD6A 3JQ8A 1ZUNB 4HMOA 4J9UE 3TTXA 4RBNA 4IDBA 4RKQA 3IO5A 5LP1A 3H5AA 5AVUA 2I6UA 1TCVA 3N2KB 4RWEA 4EDFA 5F5LA 2QIPA 3FYCA 1T10A 4X97A 1W19A 1E9RA 4X44A 3VUFA 3EUFA 1E62A 1NZJA 3LUDA 1RXIA 3QPUA 4PC3A 4YT2A 3EA4A 3WGUA 2OCXA 3DVAA 2ETXA 3EQ8A 5AM3A 1G0NA 4OLJA 2VJLA 3I3SR 3N6VA 4MO9A 2RH4A 4J03A 4BO6A 3T12A 3KX2A 1RKVA 4X93A 5EIFA 3A3YA 2PXHA 2YMMA 3IEUA 1L7MA 3VH3A 1KDRA 4HNVA 3FGNA 9ABPA 3FF1A 1D6SA 4EHKA 3N8IA 2I55A 1TMKA 4LK3A 4M60A 3CRQA 3U6BA 1VJTA 5L4LA 5HVNA 4DCTA 2FZWA 4DSAA 2AW5A 3GK3A 2UYOA 2Y77A 3H1GA 4JODA 5C35A 2ZKIA 4BKOA 1JI3A 2OOSA 3EZFA 3IAS6 1HFKA 3OZIA 5K3EA 4DLVA 3G0DA 1O94C 3PQDA 1DQPA 1AQ6A 5LQSA 1JJVA 4BP3A 3GFOA 4E5PA 3PU6A 5CVCA 2H31A 2QRKA 1UM9A 3CRMA 2CNNA 3LOPA 4TVKA 2NYAA 2YWFA 2P2CA 3AQIA 1NYLA 2DFNA 2H54A 1USIA 1RTTA 1X15A 4INZA 3R8FA 3OCWA 1QAOA 3UJNA 1UJ5A 3EAQA 4FOSA 3DZ8A 4I14A 3OT4A 3WIOA 3PSHA 1OXVA 5I7AA 3I4LA 3RC2A 3FD8A 2E3JA 1T8TA 2GSDA 1PNQA 1Y1TA 2X9VA 2ZPTX 3KG2A 4XJXA 2WLTA 5AJYA 4OI1A 2WWHA 4ZI7B 3JQAA 4WADA 2C7PA 5T6MA 1ZX1A 2W6QA 4OEHA 3WK7A 3WYAA 2TRSB 1L5FA 4BDTA 4FM9A 1EWRA 1U4OA 4Q1DA 1FRVA 4PYOA 2O3RA 5F7JA 5EZYF 2QP3A 2DBZA 3DJYA 2BDTA 4B74A 1EK5A 1T4MA 2P77A 3ACCA 2ZBDA 3IAM1 4CTOA 1EVKA 1K97A 3V4SA 1GADO 2CSUA 1HEUA 1JMYA 4UCXA 1FVHA 2X2EA 1WXIA 3H9CA 4Y7CA 2EBUA 2V3WA 5FUMA 2GN0A 2FQYA 1NN0A 1XEXB 3ICOA 2NV6A 5FUVA 2QMYA 3ETEA 5CPFA 1FZQA 5U4XA 1DEHA 1PL7A 3VC3A 2QE7A 3LTEA 3UK0A 1LGYA 2B7BA 4ONEA 1X14A 1JX6A 1TTQB 4I5GA 2QD3A 4RVSA 4RXTA 3Q8WA 1N3YA 1ZUIA 2I4LA 5DX1A 3D8BA 1TCCA 4MKXA 1B76A 4BVAA 2HMUA 3BK2A 1MDFA 2CYCA 5JISA 1Z75A 3IPYA 3CGWA 2R1TA 1G2OA 1E2IA 1WDKA 1PK8A 3AJ9A 4N3NA 1XPJA 3ZEIA 1FP1D 2C8JA 1KRHA 2FNAA 3LX6A 2O5VA 2NAFA 1T2VA 2JARA 2VAPA 1JYEA 1L5HB 2VRNA 4MYHA 4U7PB 3ZWCA 4CM4A 3GVIA 3OZ7A 2B5WA 4MEAA 3EXFB 3KKOA 1TKAA 2UVPA 2R7MA 3QP9A 2V6MA 4DLUA 3W90A 2QMUA 2O3QA 4F4UA 1DDGA 3BAFA 3A6DA 3C7CB 3RASA 3KU1A 4DG5A 1NVUQ 5FWYB 4YUAA 1Y42X 1L7VC 4G4IA 1MO6A 3RVMA 1X70A 5J2UF 4XSHA 1PZMA 3FRHA 4EUHA 2R97A 5A3QA 1KYYA 4QHTA 2BFMA 2WE8A 3JQEA 4Q3OA 3RANA 1DAEA 3VSAA 1XD8A 3OZCA 1MOZA 1NMSA 1SB8A 4D4JA 4RIHA 1U11A 3BFVA 1J0AA 3V4ZA 1YZ3A 2H0QA 4IWXA 5LL6P 1HG1A 4CGZA 2AMJA 1N0WA 2H1CA 5JQGA 1HDGO 2I2FA 3A27A 1HRDA 1IUNA 4HZIA 4PG7A 4JP1A 1XNGA 4ZQCB 4A10A 3STUA 3AM3A 5KC8A 2KW5A 4Q0MA 3LRTA 5PGMA 1NJ2A 1FDOA 1RFGE 3MINB 4LTDA 1ZI9A 3ZGVA 2Z2ZA 2GXSA 2QX4A 2R68A 2VDOB 3BE5A 3MJTA 2A1TR 2ZUDA 2WYVA 1WQ4A 1ESEA 3CR3C 3F6RA 3FKSA 4IIBA 5FPHA 3DCIA 3F73A 4PHFA 4DXDA 2VT3A 5ESWA 1AX9A 4BL5A 3BEOA 4TMFA 1XHFA 1SURA 1XDSA 3HCBA 3AFOA 2YDYA 4ZO9A 3ZDRA 3BOSA 4IV0A 3ER8A 3PFNA 4GIBA 4RZHA 1TVMA 1N34B 4LZNA 3M3PA 1YS4A 4KE8A 1OYOA 2JGRA 1IOVA 1O89A 3KOXA 4E30A 5CHYA 3GA5A 3U9LA 1N1GA 1U99A 5CB4F 3VH1A 5BOSA 5IKMA 1VOTA 3ZN2A 2JJ1D 3PA8A 1HY3A 3DE2X 3E22B 4OHPA 3OOHA 2Q6IA 3KZVA 3SLGA 3EVGA 4F5WA 1U81A 5CEEA 3EFEA 5DRTA 1XMQB 4JLNA 3IDZA 5BSFA 2W2TA 3KELA 4FHCA 4GMDA 4I55F 1SG0A 1TC1A 3LPAA 3FIJA 3QF4A 3UCEA 1SHUX 3UPTA 1WP9A 4HGZA 4P22A 3QBDA 4Q1EA 3RFVA 4J0EA 1YS1X 5FRDA 5CA0B 4QTZA 5K8JB 2OGZA 4HI0E 4NMXB 1QS0A 2V7QA 3IUSA 4QODA 2HO4A 2P0YA 3LX8A 3ZWQA 3NETA 5JJKA 2QAGB 3LOUA 2AE2A 1E20A 2X42A 5KDOA 4A15A 5KIAA 2CCGA 2PKQP 2E18A 4MQBA 1ZMTA 5ESDA 3M89A 4FYHA 4I8IA 3IL2A 1FYDA 4ENSA 1B6TA 2O0LA 3HVJA 4K9MA 5BSRA 4GQAA 4JR1A 2H5IA 5F2NA 4RKFA 4PLYA 3CLVA 3NBZC 4PLFA 3X1KA 4YMGA 2VUTA 3HRHA 7ABPA 3WQQA 1BFDA 1O95C 1EAYA 4PQGA 5A7HA 4PQFA 4BNNA 4C5AA 3V4FA 1NP6A 5EJAA 2JI7A 4AS2A 4MPJA 4HNSA 3IIKA 1M6EX 2D5AA 4IS3A 5CYPA 3W5VA 2CMDA 5JE8A 1E60A 1R8XA 2NXEA 4PIVA 1POWA 1OASA 3WNBA 3CZPA 1K3FA 4FKZA 4JJ6A 4RPCA 2C4VA 4BNVA 1E3LA 3DDHA 1MGOA 1LTKA 2ZRGA 3FGPA 3GLIB 2VBIA 3QMWA 2UZ0A 4C0HA 2AF3C 4RA6B 3PFHA 4S1TA 1UT6A 2GCGA 1Y4UA 2B30A 1E2PA 2NSDA 3HYNA 2IEIA 1CE8A 3IBCA 4DLWA 1H8EA 2VEDA 2DSNA 5ADVA 4XYLA 5EPOA 4KLZA 3TBKA 2DMRA 1P7YA 4D98A 4UM9B 3LY9A 3DE4X 3TPFA 4ESEA 4EI7A 4MV3A 1Y1KE 3ZCTA 3HPQA 3E3NA 5FL3A 3C3YA 1JBEA 2XQIA 2YRFA 1R6BX 1ND5A 3BPSA 3BD8A 1WW2A 3GZTB 4HMPA 4KMSA 2YKGA 3NIDB 4U0KA 4KN9S 3HY6A 1SUFA 2YVQA 4RORA 3CF4G 4ZPJA 1UWLA 1SC4A 1NMYA 4RHFA 3E05A 1BMFD 4YTEA 2WVJA 4IH4A 5JAOA 1HEIA 2GN9A 3ER6A 1V16A 3QOWA 5FUBA 1SKYB 2Q3EA 1N5IA 3BXFA 3B2NA 3MSXA 4I50A 4I6GA 4KRGA 4X61A 3UCXA 2PKCA 3EVZA 4FLMA 4RESA 1CDZA 2B99A 1X6VA 3LNCA 1QFYA 4J16A 2I22A 1IY2A 2G9ZA 4KO2S 4LGYA 3I64A 1PEKE 1NE2A 3FWZA 2J59A 3FJOA 2G1PA 4A5SA 2JGNA 3A4LA 3N7UA 4D41A 4EUFA 2V0NA 3A2LA 3L1KA 5SY6A 2P6RA 3FMOB 4Z4QA 2CNWA 3ESYA 2O3UA 3I6YA 3KC2A 3MTIA 1WO8A 2XHEA 3OC6A 4KWCA 1AJEA 1Z0ZA 3I04A 3W77A 3VM6A 4V38A 2AZ4A 3E9MA 3IHKA 3NBFA 4RQBA 3S5JA 1SVOA 5BVGB 3RC3A 2HIHA 1B8NA 3HA3A 2ADMA 3RSOA 3PTZA 5BNFA 4CKEB 1TT7A 2BEUA 5F52A 5IVDA 5U4QA 3SU8A 3D81A 1YAJA 3WNQA 4YV0A 2XUPA 2ZE6A 3NO4A 1FLAA 2HEIA 4I1VA 2CLIB 3NXSA 4MP3A 5HKLA 5JY1A 3P9CA 1CUXA 1KEEB 1XMPA 2IHKA 2CDAA 3N7AA 3WK8A 3WSWA 2WWRA 4N0QA 3K8ZA 3W3ZB 1M34E 1TL7C 2QW1A 3BRWD 2ZRJA 3A6JA 1EUDA 4LI0A 4XXHA 2GBPA 3PHLA 4GHWA 3TE7A 3FOEC 1U1DA 5DNDA 1FIUA 3HKDB 4X1OA 4I4TA 2CZQA 2XX3A 4R9VA 3H2GA 3AUXA 4BQEA 3F5MA 3Q5GA 2H9IA 3R0XA 1P31A 4XQEA 4BNZA 1I5OA 3GRVA 4A36A 1UAGA 3GR6A 1ABEA 3MWFA 4HD8A 3P4YA 1ZM3A 1J0BA 4HS4A 2W8ZA 4ITRC 3BQNB 4OAPA 1VXRA 4MVJA 3GRCA 3LV8A 3TSCA 3CH7A 1Z83A 1K5PA 2JCXA 4UDOA 3TTWA 1ISSA 3DDZX 4MWCA 4WCFB 1CCWA 1N2ZA 4Y6PA 5G4KA 5ER9A 2J31A 4L22A 5JS7A 4F1KA 2FYTA 2Q5FA 1OKKD 5TQVA 3WWYA 4CEJA 2CZCA 4QPZA 4P33A 2RHJA 1YQXA 1G3QA 4LF6B 1P9WA 3MTDA 4J1TA 2WJGA 2HK6A 4EF4A 4QLBA 5BN1A 1C1HA 4K8OA 5BQOA 3WXBA 5LC1A 1GYPA 3VMMA 3ZQKA 3A9TA 1RM0A 1JVBA 2Z83A 1D2CA 1V8FA 1V8PA 3FB4A 1QZ3A 2QP4A 1P1KA 5BOVA 3TNFA 3DBLA 5HNKA 5CT6A 1GUAA 2R1UA 2HWKA 2A5GA 2XITA 2YFQA 3DEHA 4RS4A 3ADCA 2G9UA 2BJHA 2RBGA 1ONPA 1JHYA 2P2ZA 5EVCA 4JVSB 1MJGM 2A4KA 3GEEA 4IHJA 2YBDA 1FX1A 1YRAA 3FDZA 3GRUA 3PFWO 5FV4A 4II2A 2ID7A 3D59A 1BSVA 1KYQA 1Q21A 9LDTA 2XCIA 3DTYA 2MYUA 3TNDA 1I7QB 1MIHA 4DMGA 5T3YA 3DZJA 2B4TO 4IDFA 1I3OA 3KTFA 4LZLA 3N39C 3DEYX 1JEAA 4MRSA 2HQRA 4Z54A 2VQ6A 4N3CA 5IZCC 3DGEC 2GN1A 5DLQC 4MQLA 4CLRA 3WMWA 1XTBA 1Z4PX 1EP2B 4O2AA 4OJNA 5AESA 4OBXA 4FSHA 5CJ2A 3KSAC 1IL0A 3OAAA 4CNBA 4CUKA 5FOQA 16PKA 3LDAA 3ILSA 4AI6A 1ZHOA 2GK3A 4I6EA 2XMCA 1NN5A 5KNDA 2XV1A 3C4VA 3C1AA 1ORHA 5EXEA 4U7DA 4Q66C 2GD1O 3EIOA 1JR3A 1TRKA 1U0FA 1U8UA 2HAEA 2ZTMA 1WU8A 3MWEB 5E95A 2CZGA 1P2FA 3RJTA 3WIBA 2RG7A 2DBRA 3CTPA 4G1MB 3T9AA 3NGLA 4YRCA 3WJ1A 4XEHA 3A1WA 3LZ6A 4TL8A 4DREA 1GNVA 3FF4A 4IKEA 1E6LA 1D2MA 2J4DA 1FTNA 1K6JA 1PZHA 2A1UA 3GPBA 3PUIA 4M2LA 3G8BA 3PXBA 4N0MA 3F3SA 5E4TA 1ST2A 2IL1A 3AFGA 2DWQA 1E5XA 1EZ4A 1LPBB 3IKVA 3SBEA 4BB5A 1R0SA 1R6AA 3G6WA 4GDMA 3WLFA 4DRZA