4BNDA

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
KMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
total genus 94
structure length 252
sequence length 252
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndA01
3EF1A 1ZD5A 3QU5A 3SD7A 3UM9A 1AQ6A 3L1VA 4O8CA 2JARA 2WFAA 2FEAA 5ALDA 3NAMA 5ALGA 1L8LA 2BDEA 4Y2RA 2O2XA 2IOFA 3IJ5A 2OA0A 2G0AA 4QJBA 1K1EA 5AKHA 4AP9A 2C8KA 2MU1A 3EPRA 5AW1A 4OHFA 3L8GA 4EELA 1S2OA 4AS2A 3N07A 3WK9A 5ALLA 3AR2A 3NRJA 5AKEA 3S6JA 3WK5A 2QLTA 4BEWA 1YDFA 1U7OA 2I33A 1RRCA 1Z4JA 3CNHA 3VAYA 1U7PA 4ZEVA 1XP5A 3SHQA 3NALA 3L8HA 4FFDA 4CF3A 1YV9A 3U19A 4HGRA 3AR6A 2YJ6A 3F9RA 1JUDA 4EX6A 1N9KA 2BY4A 3OPXA 2R8YA 3QX7A 3L1UA 1QYIA 2I7DA 4MWOA 2NO5A 2I55A 3J7TA 5AVSA 2WM8A 3SF0A 2OM6A 4UMEA 3BWVA 5ALQA 3E84A 5AKKA 4KNVA 4J03A 1LTQA 1N8NA 4RESA 2B8JA 5AM0A 2JAWA 4I9FA 3WK7A 3ONNA 5AI4A 4AS3A 3MPOA 1Z4LA 1XPJA 2R8ZA 1F5SA 4BX2A 2HI0A 1O03A 2WF8A 3NANA 1VFPA 1KYTA 4UW9A 1RKUA 2PQ0A 4RETA 5FP0A 1U2SA 2HO4A 2X4DA 3ZW7A 3L0YA 3E8MA 2WF5A 4DW8A 2YJ3A 3QU9A 3E58A 5AW8A 4HGOA 3N1UA 4NAVA 3U7GA 5AW5A 5IT0A 1TJ4A 3AR3A 2GHQA 3QGMA 1WR8A 1RMTA 1WVIA 4DFDA 2Q5EA 5AI5A 3RFUA 5AVQA 3ET4A 4QQFA 2G08A 4NABA 5AVXA 5ALZA 3L7YA 1Z4NA 4EX7A 4Y2UA 2YN4A 1Z5GA 1L6RA 4GXTA 3EF0A 1RQNA 5AW0A 5AI0A 2ZBGA 5ALNA 1L7NA 1NRWA 5AIBA 2EATA 2I34A 2YMMA 2ZG6A 4Y2TA 5AW2A 5IS2A 1Z4KA 4YGYA 1Z88A 1QH9A 1Z4MA 2IOFK 4HGPA 3L8FA 3IB6A 4GIBA 1ZJJA 3SKYA 3UMCA 5AKGA 5ALJA 2MSNA 2RB5A 5T41A 4CNQA 2HF2A 4CF4A 5AK5A 5AKYA 2NYVA 4UM7A 4BX3A 3MC1A 2PKEA 5AM5A 3WKBA 3I28A 1ZD2P 3QU2A 5A3RA 2C8LA 1CR6A 5AW6A 1VJ5A 1Z4IA 4UARA 3ZVLA 5AW7A 1L7MA 4KX5A 2CFTA 1QQ6A 3K1ZA 4BBJA 3OCXA 4UU0A 1SWWA 5ALEA 1T5TA 4ZEWA 5ALUA 5ALHA 5AVYA 5ALOA 1WPGA 2R8XA 2IYEA 5AM2A 4HAIA 3E81A 1RDFA 3DAOA 3N28A 3ZWDA 3R4CA 3ZTWA 2G80A 1RLTA 3OCUA 3W5AA 4C4TA 4B6JA 4EEKA 3A3YA 4BKMA 1ZOLA 2JAOA 5E0OA 1XVIA 4C4SA 2B1RA 3ZX5A 5JJBA 2Q4TA 2ZOSA 5AW3A 3OTQA 2HOQA 3DNPA 3ZVNA 1VJRA 3A1CA 1WZCA 3FZQA 4UU1A 3QU4A 2P9JA 1SWVA 3OCVA 5ALXA 3M1YA 2I6XA 4L6CA 4UATA 5AVUA 5ALKA 5AK6A 2CN1A 3ZX4A 3B8EA 2R8EA 3R09A 3FM9A 1FEZA 5ALMA 1S8OA 3WKDA 5AIAA 5AVTA 5IT4A 3WKCA 4YH1A 1LVHA 4DCCA 3FGOA 2BDUA 4UAVA 1Y8AA 2B0CA 4F72A 1TA0A 4NWIA 2RAVA 4JB3A 2P69A 3ZVMA 3QNMA 1TE2A 2W43A 2B30A 1RMYA 5AVRA 2RARA 4Y2PA 3ET5A 3M9LA 2JGAA 2RBKA 2HCFA 2OBBA 4YCLA 2DQSA 1Z4PX 2G07A 2ODAA 3L0CA 5AM1A 3KOOA 4OFZA 4XPZA 3A1EA 5AKXA 5AW4A 4Y2VA 4UMFA 4BNDA 2PR7A 1QQ7A 2FUCA 3HLTA 3OCZA 2FPXA 4HYTA 1L7PA 4C4RA 4Y2JA 4BYGA 1T5SA 1O08A 4ZEXA 2QYHA 3L8EA 4KN8A 2FPSA 3QLEA 3B9RA 1J97A 2FI1A 5AKLA 1Z5UA 4KYTA 4PNHA 4UASA 3U7EB 2CFSA 2G09A 4IG4A 4YCMA 2ZBFA 2G1AA 2IA5A 3RF6A 2WF6A 1RPZA 1RMQA 3IRUA 2EARA 3W5DA 1QQ5A 3PGVA 3NUQA 4DWOA 4EENA 3D6JA 4HGQA 4XE5A 4YIKA 5AI8A 3ESRA 2VKQA 3KBBA 1ZRNA 5ALVA 1Z4QA 4G9BA 3ZU6A 5AW9A 1TJ3A 5AM4A 3ZWKA 2AMYA 2FPRA 2GO7A 5ALFA 2HF7A 2YMLA 1YS9A 3N8GA 5AKJA 2HSZA 3L0BA 3QUTA 3KC2A 3WK6A 3UMGA 1RKQA 3FPSA 1NF2A 3OCWA 5AK3A 2P11A 3SKXA 3TLMA 2HDOA 5AI9A 3QUCA 3I6BA 3QXGA 3WKEA 4BX0A 1RKVA 5ALIA 5AVZA 3KZXA 2FPUA 2C4NA 5AESA 4FE3A 2B1QA 5A3SA 2GHTA 3QYPA 5AKIA 1YJ5A 2FPWA 1YNSA 5AM3A 4BEVA 5AVVA 3P96A 1Z4OA 1X42A 2ZBEA 2FUEA 2YMQA 4Y3UA 4UAUA 2HHLA 4Y2YA 4XQ0A 5AK4A 3PCTA 1RQLA 4IFTA 2GFHA 3B9BA 1PW5A 3AR7A 3KD3A 3QU7A 5AI6A 2ZXEA 1U2TA 3ZUPA 2AUTA 4F71A 1U02A 2HEGA 4FYPA 2EAUA 2YY6A 2O9JA 4I9GA 2HX1A 3WKAA 2AGVA 3UMBA 3NASA 3U13A 3PDWA 3FVVA 1SU4A 4OCZA 4UMVA 3BA6A 2NO4A 2YJ5A 1ZRMA 3DDHA 4E88A 2CFRA 3FPBA 5AKZA 1T9ZA 3EWIA 4H1WA 3QUQA 3AR9A 1EK2A 5ALPA 3PGLA 1TJ5A 5A3QA 4MUMA 2ZBDA 1EK1A 4XOUA 3U7HB 5AICA 1IWOA 4NFLA 3QUBA 4OD0A 3CZ4A 3GYGA 4KNWA 3A1DA 3WK8A 3NIWA 1NNLA 1L8OA 1J8DA 3MMZA 4J2TA 2Q4RA 4UM5A 3SLRA 2WF9A 1ZD4A 3AR8A 4YCNA 3R9KA 1Q91A 3KDPA 1RLOA 4Y2SA 5AVWA 5ALSA 3AR4A 2W4MA 3W5BA 2YFYA 3HYCA 2FDRA 2B82A 2IOHA 4L57A 2C88A 2YMPA 3SMVA 5ALRA 2C9MA 1RC8A 1CQZA 4JDPA 4CF5A 4KX3A 3U26A 2AH5A 2JAUA 4Y2XA 3I76A 3ZTYA 3I1YA 2D2VA 4EZEA 4CE6A 2YBDA 1MH9A 3W5CA 1YMQA 4UMDA 5AHXA 1RLMA 2GMWA 4NV0A 3U7FB 2WHEA 3AR5A 1Q92A 3ESQA 4HGNA 5ALYA 2B8EA 3WK4A 2G06A 2I54A 4YIHA 4BNDB 2W11A 3L5KA 3MN1A 3WGVA 2YJ4A 5ALTA 5ALWA 3ED5A 4G63A 4L6AA 3N5KA 3ZI4A 1L7OA 3OCYA 2OYCA 4Y2QA 1ZD3A 1ZS9A 2P27A 3DV9A 3WGUA 2WF7A
chains in the Genus database with same CATH superfamily
3KKMA 4DR7B 3KB1A 4GPEA 3VR2D 4IZ6A 2FYTA 2NAPA 5TY0A 1KBZA 4EEZA 1S96A 1W581 1Z82A 1L8LA 5THQA 4BTLA 3LGSA 1JR3A 1KIFA 3IBCA 1O95D 4ZVPA 3HKDB 3AM3A 1KEEA 4NMHA 3L92A 1P4GA 1C7RA 3CNOA 4L5BA 3NOQA 3R8CA 5T4HA 2MU1A 5E6UA 1B23P 4ZO9A 2OWEA 1EGMB 1D5WA 4RQUA 2FQQA 1GN9A 3MILA 5ERGB 3F8WA 1E8NA 3FLAA 3BC1A 1P0FA 4TMKA 1O8CA 2BLNA 4NZMA 5REQA 1GU0A 2ZR7A 1VPDA 3V34A 1D9XA 3ZWWA 2YJTD 2YN2A 5BN3B 1N5LA 1FUKA 1QO0D 3NHPA 1Q1QA 2FEKA 4KGZA 1KZ9A 3VJLA 1CF9A 2DBQA 3JQFA 2A67A 3MTGA 4JAVC 4KO1S 3WDKA 1G5PA 3EZ2A 4LEIA 4AWXA 4BO0A 3D3QA 3OM9A 2GPNA 4J2OA 1IMOA 2RBEA 3GVXA 2F4NA 4B3GA 1I1NA 5JQGA 4MARA 4GGOA 4XQ9A 4ENSA 2WILA 4KFUA 1X0XA 1RSZA 1DHRA 1TQ6A 4QASA 1OFIA 5E6RB 4OP1A 3FNFA 5C18A 2QI9F 4IWYA 2HMSA 2YZGA 4JL5A 1DEAA 1KXJA 1Y5IA 2Q5IA 1QHNA 1RIFA 3L6RA 2JATA 3GRRA 4OAOA 3AGPA 1VE7A 1Z47A 4ROTA 3EVTA 1W96A 3JQ9C 4AS3A 1W48A 1A9RA 1P6UA 1XDGA 1NP6A 1KMQA 2C5GA 2FSHA 2R8ZA 4WY5A 5JYBA 4MKGA 1TO6A 2CNDA 5GP1A 2XGJA 1IUNA 4U02A 4HK4A 1D03A 4MW1A 5CH3A 4CDNA 3T3IA 4IWXA 3FPKA 3P4UA 2OGSA 3OIDA 5HRAA 1G3UA 1EUDB 3DCYA 4PXYA 1F60A 5KI6A 4IGIA 3G88A 4B7AA 1X1EA 4X3CA 3R7WA 1C4OA 5JMOA 2CK3D 3WHPA 1Z6QA 2YYZA 1N2BA 2H9AA 1GZVA 2IHJA 1AB6A 2VK8A 1ZJWA 2X4DA 4MGZR 3C3AA 3K96A 5AUNB 4FEAA 1DDOA 1G7TA 2Z6UA 3SOZA 5FPQA 2VDMB 2ZREA 1BAPA 1Z7BA 2QVGA 4R8KA 3LZDA 1Q0RA 5GINE 3AI7A 3U7GA 3KPYA 4IIJA 2YIVX 3ILVA 5EG5A 1N7IA 5HF9A 5CT9A 3ROKA 3HI4A 3FNRA 2RGNA 3L7NA 2HUPA 2Y67A 4PIVA 4OQ4A 2JHGA 3IDZA 4X92A 3WICA 3EX7C 4MRRA 1CE8A 3V4LA 4LECA 3K94A 4MLDA 1U3GA 2X4IA 1JWBB 2YC4C 2O7QA 2H06A 1J22A 3U62A 1EUCA 1NXWA 4N3NA 4MJ7A 4IQGA 4UTZA 4GPIB 5KCMA 3V1TC 5A4FS 3MNFA 1KYWA 3C39A 3H3FA 1L4EA 3WIVA 2HHHB 3FOWA 4NBWA 3GWGA 4QLBA 4IX1A 4KDFA 2FR8A 1BO6A 3B48A 3HU1A 4L8VA 1NIPA 1YRLA 2FN9A 2Q9AA 3EGDA 5ALNA 4BLOA 1WD5A 1W4RA 2JLVA 4NFYA 2JAHA 4QGAA 2FWRA 2XQIA 4UKDA 3M4NA 4BE9A 2NTVA 4CUJA 4HAWA 4FOLA 1JEQB 4B46A 3LVQE 3QTLA 1OXTA 2D62A 5C51B 3DFFA 3GLRA 1PGQA 4N39A 3WQRA 4FUQA 2XQJA 1U2ZA 1LDNA 2QT9A 1AY0A 2ACVA 1PGPA 4TXHA 4DJTA 3CEAA 1NKSA 1R0BA 3Q9LA 4MUNA 4QXOA 3WOVA 1E5DA 1NDUA 3R7SA 2ODTX 2AOWA 1E2MA 1OJLA 5EJ7A 5J3JA 1N1GA 3EQZA 1GNPA 3TOVA 1SOAA 2C20A 1ADYA 1PEYA 1ZGCA 2HY7A 2YINC 3MT7A 3MC1A 2CZCA 3VYUB 1S9HA 3M6XA 3OTIA 3CUUA 3EFBA 3OQHA 1HE5A 3DEHA 4I50B 1ZD2P 1ISIA 3C7TA 1LD3A 3ZGVA 1I7SB 2VQ3A 1YCHA 4QYXA 1XWWA 4N18A 2OXEA 1X94A 4JR0A 2YVUA 1WX1A 3E2PA 4LPSA 4P53A 4QARA 4CUZA 5AW6A 4UARA 1RWBA 5IJ9B 1K6MA 4FYIA 3GGJA 4JP2A 3H4MA 4QTZA 4QWMA 4Z9XA 1BEEA 1RU3A 2ZKIA 3ZHQA 3WSWA 1WSWA 4X8MA 3LWZA 4KAFA 3OCXA 4JN6B 5B2EA 1XMVA 1HX7A 3W3AA 1R1DA 5L3RA 4DJAA 4QUKA 4GS5A 2AG8A 3V4RA 4EY6A 3RV4A 2XNDD 3GWZA 1LQUA 3C6XA 2QM8A 3L02A 4X7MA 4MCAA 1U0OC 5J23A 1JTEA 4EJFA 1TOAA 3TECE 2W2LD 3DAOA 1WKVA 2WJPA 1KP9A 2C31A 3KQSA 1BXRA 3MMXA 1ZI8A 4H7FA 4UDNA 1NWHA 2YZ7A 4BMCA 4PZUA 2WVJA 1JYEA 1EWRA 2A0XA 3G02A 4WA7A 1EFCA 4EDFA 2FP4B 4BGVA 4J1QA 4UHCA 1RHUA 2J59A 3A3PA 3KKKA 4V0LA 2B7LA 3S4YA 4OHWA 3IJEB 2C96A 4U3JA 4YQYA 3ZCRA 2GPWA 4UBNA 4DZRA 5T67A 3S2UA 1JKIA 4HTAA 3EPKA 1GL3A 2O8VA 3LAWA 1KDZA 3K09C 1XL1A 3NR2A 3O8LA 4LRUA 4N8DA 3OQMA 2XRZA 2FKNA 1XLTA 3DBIA 4JVSB 4JI2B 3B12A 2LCIA 2FFRA 3DSRA 1QK5A 2ODWA 4GP7A 3V1LA 1LFAA 1JHOA 2ZIGA 4DNFA 3ZYCA 2CNNA 3RHTA 1DFGA 1BXZA 2FPPB 3KJFA 2WTMA 1NN5A 3IEIA 4QO8A 3M6VA 3PHGA 1GA1A 5AHOA 2VQ6A 1SXJD 1TCCA 1XAGA 2W0MA 3O8BA 1WMAA 1F1BA 3IKLA 2JFFA 2J5BA 1M8PA 4IXDA 4YXWA 3GLKA 3T5BA 1NAHA 4IMPA 4A0RA 1SO8A 2VR1A 3GK3A 2Q4OA 2J30A 2ZYUX 1Y4DE 3LLUA 4Z8XA 3WL8A 1BG6A 5EIBD 2WZQA 2VBGA 3BB4A 4YRFA 1XZJA 3ECAA 3FGOA 4FHCA 2J4DA 4O63O 1UCFA 4O4LF 4K9PA 3DLCA 1QIFA 1P18A 3R75A 2WV9A 4GR9A 1AURA 1H5UA 2AOUB 1CRLA 3GGOA 4TLBA 4MIEA 4D8UA 2VF2A 4QU8A 3ZVMA 2KM1A 1KO7A 4AKIA 2JFPA 5IC4A 5B57C 1U94A 3MJTA 5LPNA 1XK6A 3TQFA 3CVOA 1LBSA 1QS0B 3P0EA 1R8YA 3X44A 4BNMA 5JJ5A 3BB3A 1G8PA 3GRAA 4F9FA 5JXIA 1MTOA 1BZYA 3I3SR 1TUBA 1YS4A 4RHCA 3U17A 1XMSA 4BUJA 4HN4B 4OFWA 3JZAA 4UMFA 2GJSA 2J0VA 2PKXA 3PDUA 2D7DA 1YFKA 2YS6A 4EL5A 2HXSA 4DJEC 2X0FA 1P2BA 2JIPA 1LLFA 3B82A 1G3MA 3IAAA 2IH5A 3HGQA 4M87A 3CN7A 1ZONA 4RJIA 4D5EA 2DZDA 4IQFA 4EHDA 4B3TB 4OI0A 1YBFA 1NYTA 1Z0AA 5I7FA 1T2DA 4P86A 2AFVA 2ZU0C 4BRZA 4E2ZA 4EL0A 2AR7A 4MKZA 4GOND 1F1JA 4DEYA 4CLRB 1XA4A 2XWQA 2AOTB 4KSBA 4QG7A 3RRNA 3K70C 2ZITA 1I2BA 3F6PA 4P4UA 4U7TB 2RHCA 1KI2A 3HZHA 4UASA 3KHSA 4JOCA 5M5BA 4AIIA 1IXYA 1OZAA 1BX1A 2X1LA 1VLHA 2OBYA 3EODA 3MRTA 5EC8A 4G5GA 4MB2A 1X70A 5K8CA 4ZK2A 2EQBA 2SNIE 3VJMA 2ZI3A 4BVFA 2PUGA 2GJ8A 1QSGA 3A9WA 5LZ9A 5JROA 3EVNA 1GUZA 3IE2A 1YAHA 1YFJA 3G5AA 4MUHA 4EYEA 4HNAB 2QUAA 4KXYA 3INTA 5LYJF 3EUAA 1MT3A 2IWHA 2PKYX 3F5QA 1I4LD 1QHHA 3DHNA 4I4NA 1V3VA 3IAEA 2C4MA 4QGFA 5AW9A 4J6EA 1Y3IA 2AC7A 2AMYA 2NUPB 2PANA 3FPHA 3LT1A 1QCDA 5IAJA 3WDLA 3QVUA 3X43A 1GOTA 3A31A 1O7JA 1YS2X 1ZCZA 1MVOA 4ZVQA 1Z7GA 5F2EA 3NTVA 4G5FA 2H7VA 1RKQA 3AUYA 5CT4A 4XWKA 2QVXX 2YY5A 3PI7A 3SZOA 2XTZA 3I0NA 3SQWA 3I58A 4Q9KA 4X1YB 1ZHFA 2PKCA 1DTWA 4PLTA 5DCYA 1UBHS 1D4OA 2FVYA 2O3UA 1XXHB 1P80A 2N1BA 2QD2A 4R16A 7YASA 3KELA 4QOGA 3PUIA 2AJLI 3I12A 4EM6A 1ONSA 3PUWA 3Q41A 4FLEA 3EQ2A 2AI2A 3NVAA 4FINA 1I2MA 4H60A 5AVJA 5F3WB 3GJTA 4DPLA 3PSAA 2OCDA 4J0QA 2BYTA 3Q7EA 3G1UA 4JSYA 1VB5A 1U99A 1YQXA 4LHEA 4YBZA 3VVBA 1C50A 4HAXA 2Y1WA 4Q4DA 1S3FA 4YJ2F 3ZGYA 3LKZA 4PRYA 4KU4A 2FQYA 4N6GA 3RFCA 3TLXA 3D2CA 3KB2A 1TTPB 4DDWA 1AV7A 1X7GA 2YRFA 2WV7A 3H6HA 2CMGA 5EWMB 4BVHA 2ERXA 1VA5A 2JIRA 4MO2A 1RBQA 3GYBA 4Y6OA 5EHZA 2XCLA 1IULA 2QV7A 2QVYX 4N01A 2XMCA 5CNJA 3BRSA 2BN4A 4PCUA 3VUEA 2P1RA 5CH8A 4D0SA 1TEZA 4TV8A 4ZCTA 4P3KA 1ZGJA 3TBHA 3VTKA 2GD2A 1D3AA 5LJIA 4TQUS 1H2XA 1I3NA 4EHNA 4ESEA 5LLTA 1PQUA 3HJRA 2G82A 3WKAA 1CT9A 1UK8A 4JLPA 3THOA 4ASUD 4IJWA 5EZYF 2Q99A 4QODA 3SEZA 3PDWA 3PL1A 4ZTZB 5J2TB 2QYOA 3VDXA 3RSSA 3CSSA 2P75A 2C07A 3AFOA 1Z6TA 2CD7A 4RTQA 4YP9A 2YJ5A 3I6IA 5C52B 1UOPA 3VSDA 4B2LA 2QN3A 1NVDA 2D00A 3T99A 4Q7JB 5L6MB 1GKYA 4Q4AA 1CY0A 2UYGA 4DLXA 1YQUA 3N75A 2DUUA 4UNQA 1QG4A 3ZN2A 1BXGA 3AR9A 3T4EA 2P3OA 4CJXA 1L7QA 1RWVA 2A0WA 2NW6A 1EVQA 1WCWA 4XLLA 1R0RE 4ZT7A 4CV0A 2F7SA 3ZG6A 4ZPJA 2JZCA 3PHBE 5A6SB 3VR4H 2IYWA 2RBGA 4G4IA 3GYGA 4YI3A 1Z63A 4QLOA 3TMAA 3DULA 5F3DA 4DILA 2F1IA 1DWUA 1CNFA 3AG6A 3GI1A 1MLDA 2X6RA 4J2TA 1JQDA 1OXSC 1KI8A 4NS1A 4I2NA 4W9NC 5HA5A 5JEEA 4YASA 4ZQIA 2GPJA 3LIPA 3FOAA 3MJ4A 4RJJA 1J24A 3DVLA 3A4LA 3HUFA 3JQAA 5KNCD 4D9HA 4LRQA 4KWIA 4C01A 2VF4X 4OKSA 4NPCA 4NU8X 1CEYA 4LCEA 3T3MB 5ENDA 3PE6A 3T7SA 3VR3A 3DQQA 2Q6KA 1PR0A 4BP9A 4F9GA 2N47A 2MINA 1RXIA 4FSHA 2AB0A 2ZWIA 4G1CA 3RHSA 4AQYB 4LGYA 2F55A 4HNQA 4G4JA 3COWA 3I64A 3I9NA 3NBQA 5DX8A 5KPJA 2PV7A 1S2DA 1YUMA 1M6VB 1T91A 1XTBA 3LXRA 1YD7A 1RJ9A 3ROEA 4PLFA 4WFKA 2YXDA 4F84A 3S1SA 1PLJA 2RGEA 5F21A 3SYRA 1E2GA 1WF6A 2FEMA 3HYTA 3QX3A 1SVKA 1H3EA 4HUQA 3I1IA 5EHQA 5IJZA 4Q01A 1H9BA 4E7OA 1CY4A 5FWXA 2PDAA 4O4IA 1M34A 3QKWA 1KMNA 4JB8A 4IBOA 3TSOA 4RSMA 4I55A 1XL0A 3NHMA 4KBFA 2PX8A 1WM1A 3S7ZA 1FDTA 3EA5A 3ZNOA 3QEMA 9MHTA 2WHEA 4AZ0A 3H86A 1JJAA 3RUFA 3NEJA 1I14A 4NE7A 1C7QA 3GP8A 2XBMA 4GVPA 4CKZA 2E4WA 3MGBA 1R9JA 1G5IA 4O2AB 4ZP1A 4MUXA 1HDZA 2E85A 4HS4A 3RI3A 5AP9A 2HSWA 4QOJA 4EAQA 3CISA 1U0BB 3D6AA 3OIUA 4G2TA 4YAWA 5LA6A 3PNOA 4MNTA 1XQWA 4QG3A 4N48A 1EWQA 4XUGB 3K2IA 1AXGA 2A5FA 3SK0A 4CG3A 1QYRA 1EUQA 1NC3A 1MOPA 3O8OA 4HAVA 1QTQA 2E49A 1J90A 1V11A 2IXAA 1ZD5A 3BMNA 3EZGA 4M86A 1CQPA 1GCGA 1DB3A 3CX6A 3GGSA 3QVKA 1HG0A 4WTOA 3K1AA 4AN4A 2FEAA 5C81A 2G0NA 1H6AA 3PF9A 3VI3B 2B1IA 2X15A 3S2SA 2GOYA 4CQMB 1OBCA 1E18A 1ENZA 2ORWA 3V2UA 1UJCA 1JQAA 1OREA 2PLWA 4YMWA 3ZHXA 4OIFA 2NUAB 3FSEA 2VWHA 2O59A 3C3PA 3FVTA 1P62B 5LVAA 3TCNA 1XTRA 2IF0A 1UC8A 4I5FA 5TPZA 5HUHA 2XA2A 3N07A 4UVEA 4K9RA 4EW2A 3MT8A 2FPKA 2P2GA 3EULA 1Q21A 4M49A 5BP7A 2YXBA 3KX2A 3LZ6A 3WK5A 5JYCA 2GPSA 3C5CA 2Q9BA 1A4UA 1IY2A 1STOA 3EYAA 4RD0A 4UJ3A 4ALJA 4B3XA 4BVGA 5G4KB 5KNDH 1VBNA 3VKHA 4M98A 2QK4A 1UP7A 2I33A 4ADSG 1U2EA 3CFYA 3NKFA 5BN5B 1IONA 3OO0A 2DKOA 1Y82A 3NHUA 1U7PA 3H2HA 3BGSA 3UGTA 3KETA 1M1UA 1C30B 1N1EA 1DCKA 2AQIA 3FAKA 5C35A 4K6FA 4Q9JA 4C22A 4H08A 1B8PA 3DLTA 2VDRB 3QYAA 3W1WA 3G3EA 3R7DA 2IXFA 2ZYVX 3EH2A 2VKTA 4HDMA 4YP0A 5DHAA 4DN6A 2G63A 1EWYA 1UFQA 3HJNA 5HIMA 3ZKWB 1U9JA 4I19A 2I0FA 1Q0TA 1Y1SA 2Y9PB 4JH0A 4TN5A 2FV8A 2ZRIA 3E3LA 1ECCA 3K8QA 8AT1A 1N7JA 3MUFA 3AT1A 4J03A 4ZEMA 4ESVA 2YFQA 3D2AA 3KXKA 4LZAA 5TF4A 2AW5A 2JAWA 3DFKA 4I5EA 4MV9A 5B36A 3BJMA 3BWDD 1TZKA 2O2IA 1FSZA 1S3GA 5E9WA 4E5MA 4PZLA 1Y89A 3GIDA 3UY4A 4E08A 2BMFA 5ITZA 1MCZA 3M34A 1MZVA 3GBSA 1FMFA 3G0OA 4TRNA 3ZCSA 2X1MA 4L8WB 3RGGA 4LBWA 2PQ0A 1NX6A 4KR9A 2OCLA 4R1MA 2C84A 2WDZA 2Q3BA 1E2QA 5FP0A 2MYNA 1K5HA 3RJZA 5F51A 2I65A 3SQNA 4YACA 2JFHA 5CX1B 3TTYA 5BMOA 2H1RA 3HDGA 3CLSD 1P7YA 4G0NA 4OBXA 1MUUA 3H1PA 5AVOA 5BWBA 4DW8A 2YJ3A 1RTKA 1MF7A 2PA0A 4D9GA 5EUBA 3MUNA 1KL7A 4TV9B 1L3IA 2NP6A 1TJ4A 1EDBA 4UEOA 3PZRA 5LBIA 2BTQB 2X6TA 2Q3JA 2QRJA 4IMJB 3UUEA 1HH4A 1TF5A 1I0ZA 5FA5A 1AQJA 1E89A 1N5KA 1IMJA 1QX4A 3IIJA 4KLCA 2X2FA 3ZDXB 4QJ4A 5LMCA 4KN5A 1U7TA 4V2UA 3KZKA 2JS7A 4NABA 4BLSA 2P4HX 3NBAA 3LO8A 1V6CA 4AY4A 1E8MA 4DVGA 5FI1B 1IL0A 2VBIA 4R9UC 3BRWA 3JVVA 4MUIA 4LOKA 1QKIA 1GKUB 1HEUA 4J3NA 1ILEA 4LY3A 5EXXA 3LA6A 3R2JA 2J33A 4BB6A 5KCZA 1FYFA 1YK0A 3TDKA 1VIMA 4CM7A 4J43A 1M54A 1SBCA 4LJSA 5K6AC 2LKDA 4FYYA 2N75A 1K63A 1HNWB 5GVRA 3WV4A 4J0DA 2W6ZA 1H4SA 1P9LA 2ZI4A 3E0XA 3Q8WA 1K92A 4DC0A 3EZ7A 5F1KA 5FUQA 1W0CA 3R0ZA 1ISSA 1T8RA 1B8UA 3KUUA 3C97A 4IS3A 4CT0A 1E2DA 1A5ZA 4V1CA 2R87A 2QLBA 1JDVA 2CMFA 2QI9C 2YCBA 1DGQA 5AKGA 3T7JA 3W78A 2YXLA 1JKMA 2FSUA 3IXMA 3WR5A 1IDOA 5AK5A 1GAQA 2Z2KA 4TYPA 3IGFA 3UUGA 2C9DA 3E7DA 3VU1A 3ZV6A 1QE3A 4Z5XA 1T0JB 1P17A 4O4HF 2PKEA 2ZIXA 3TBFA 4YRSA 2ZCJA 1THZA 3RK0A 1A4IA 2ID7A 4KXNA 3DG9A 2OP0A 3URMA 1U0GA 5D3QA 2XV1A 4D1YA 3OH8A 4W8OA 2CHEA 3ICOA 1Q1GA 2Y05A 1XTPA 2P9YA 3EGCA 3O31A 3Q6MA 2ZSUA 3TRDA 3RHFA 5JS7A 1VL1A 3GVHA 5DVZA 2WPDD 3LU1A 2P5SA 5DASA 1XMQB 4ZZIA 1N2ZA 4QXMA 4F4UA 2C61A 5AOAA 2UVPA 2P9BA 4HWOA 5DLDA 2KBEA 2PYZA 3D3EA 4YAJA 2DWPA 2PL3A 3ZHZA 1FXUA 2QRMA 4COOA 2R8XA 4CHGA 1DJPA 2OZPA 4DLKA 3ZWQA 3THRA 1UBLS 2P79A 4QBFA 4JWTA 5LQJA 1Y48E 4C0BA 1M7GA 4Q12A 1II8B 4ZIRB 1HURA 2BR4A 2C2WA 5JADA 1W2HA 2SKEA 3Q7IA 3MMSA 4HYYA 4LV8B 4U2BA 2LPMA 4MUYA 1XG5A 3LT5A 5CIQA 4M9SA 3MWDB 2ZIVB 2PUEA 1RM5A 3IEXA 1W88A 2CXUA 5JW6A 1Z9BA 2AN1A 1XRJA 2OQIA 2HWWA 3HEAA 4HDSA 4QOEA 3VNRA 4KYUA 2GM4A 4C4SA 1OWOA 2X5KO 1ZVMA 2YVLA 3QLJA 3ZXSA 1D2EA 2R48A 4LNAA 3E7PA 4DQKA 1X1TA 2PUTA 1JLSA 2RDMA 2W5UA 3TRKA 2WNIA 2HT6A 4C76A 1HOTA 3VR5A 4U2KA 1UK9A 3RVQA 2AKAB 1LSJA 3TFOA 4WDRA 3T9CA 1U0HC 4OXIA 4B3DA 2LCQA 1X1QA 4R05A 4Z9AA 1T13A 4MK4A 2R62A 1DWQA 3VVMA 4WBSA 2FG6C 4FYKA 4JEHA 1B1CA 5FD8A 4E7PA 1JR3D 4HWGA 3PPYA 1AD2A 3N53A 1C14A 3G2IA 2VP6A 4TQGA 4O4LB 3ZWOA 1H69A 1ZD1A 1EE9A 1Z16A 3L6BA 4IOMA 4QSMA 5CP8A 2CMKA 3I23A 4BFCA 1T0PA 3EPJA 5AIAA 4XVUA 1JP7A 1AK9A 2IW1A 4AKTA 2IIBA 4GH5A 3PNMA 1FLDA 3OPNA 5B4TA 4LXGA 1BROA 3HNRA 1KZ6A 1AVTA 3BFXA 4NWIA 3I6MA 4X54A 3ZD6A 2E55A 1JFVA 1RRKA 1VJGA 2BFAA 3FSRA 2OD2A 5KQLA 4LMRA 1E0AA 3NM5A 3FBTA 2OT3B 3D3KA 3ND9A 4CF7A 5ELXA 1DKMA 2Z3WA 4JLBA 2W2VA 2WFLA 1MB3A 3JQ7A 4J0EA 4L5YA 3U37A 1K68A 2XVYA 4C2TA 5J4KA 3ML1A 1MAAA 2XZLA 1UDXA 2J6BA 4TWAA 3OLXA 3FOEC 4XQEA 2NZ8A 2EJTA 2G07A 1SCJA 2XVMA 4KV9A 1AOXA 1X9HA 4LWQA 2W6MA 3INGA 2DPYA 4FD2A 4FNAA 3LA8A 1UUFA 2BGRA 1HETA 1HQCA 4KO8A 5AKXA 2AF4C 2ZRKA 3T0FA 3INYA 4EZIA 3HCAA 1AX9A 1TNDA 2QTCA 1A7JA 2CFCA 2H1SA 3PBKA 1DBSA 1QQ7A 3H11B 3U7QA 2UYHA 4ZZ2A 5DBHX 2OOSA 2PUFA 1G2OA 3F7NA 4PYQA 3ROTA 4RV5A 3ESAA 1XIVA 4EI9A 1KFCB 2Z09A 3C6YA 2JZOA 4OMFG 2DQ4A 2WYVA 1G19A 1HDGO 3HDVA 3KXIA 4E5KA 5JASA 3BYZA 5EMLA 1QTRA 2DTEA 2PS0A 3NFYA 2GXAA 10MHA 1UDWA 3TD9A 3TMKA 5L95A 5J2UB 1P0IA 1QFMA 5HGJA 1QB8A 4TZ0A 1EVJA 1V71A 2FI1A 621PA 2XNHA 1BE8A 7GPBA 4FGJA 4S0ZA 1SA0A 2A5DA 4YNBA 4HVAA 3U7EB 3KYJB 4B8ZA 2XKAA 4YJHB 1E99A 4C03A 2PXCA 3EPPA 2HCJB 5DTMA 3EBOA 4ZD6A 3V8RA 4CM8B 4GEKA 3HKDA 1JA9A 4MVJF 5HFJA 3S68A 4LJ7A 5CDFE 5KIAA 3DM9B 2NO0A 5G0UA 2EARA 2ZB8A 3PGVA 3X1YA 3QP9A 1NATA 1J5XA 3MWGA 4K88A 2QVZX 1D2NA 1EBFA 1NKVA 3KBBA 4G0OA 4QSHA 2VJAA 4RXMA 1BVHA 3WOHA 4YPOA 2HTFA 4NMMA 3ZW9A 1NQOA 4BEJA 1WW8A 2Z5LA 3H2IA 4G9BA 2DFDA 3NRBA 5BN3A 2PMDA 4JJ7A 4DRYA 3GEPA 5JRDS 5CFQA 3CMMA 1GG9A 2C3OA 4M88A 2ZVQX 3FNQA 4GD3Q 4CYMA 2HFKA 3AZOA 3UC5A 4TX1A 1UOQA 4N7RA 5LCXA 3FDJA 1F48A 1RI2A 1S2MA 4R54A 4U2GA 2Q5FA 4C78A 5JOQA 2HJGA 3FDXA 4PC3A 2P11A 3H1TA 3I5XA 3EA0A 1A1SA 1PDWA 2VHQA 5C5DA 1Z2PX 3W4JA 5EHNA 2P5TB 3FWZA 3F6YA 3IAM1 5E6RA 2FZGA 2PIAA 4TXLA 4FR5A 1AU9A 2B2NA 2QUIA 2YL2A 3A7DA 4OYYA 2ZUWA 4OJKA 1P81A 1IN1A 3L6CA 3AHEA 1KSJA 1WA5A 4IY1A 3K0HA 4ND6A 5CIYA 1CZHA 1NRXA 2B78A 3AP2A 4QFMA 4WDQA 3CS3A 5A3SA 3JQRA 5DNYB 1U63A 1AS0A 3CX3A 1O54A 1CJMA 4YHHB 5TS3A 3OOSA 3VBEA 3DE0X 3RS9A 4YEDA 4ETWA 1FLVA 4ISBA 5J1SB 3L79A 3NXKA 4BU1A 4A26A 5KVSA 3TLAA 1M74A 4TS1A 1DRVA 4YP1A 4YXFA 1MO5A 1XCLA 3REOA 4TTIA 1KSHA 1AJEA 4CQNA 2X14A 3OMLA 1E1RA 3QU7A 4FK8A 1X7XB 4LE2A 4HVCA 2UUBB 4QJ5A 2NYUA 3NBXX 1G3QA 4AW9A 4DSOA 1CYEA 1O4VA 4N8EA 4ZDIA 3LNCA 3VOSA 2H5JA 1F6WA 4MV5A 1YXMA 5EJMA 3CLVA 5L8VA 1EZZA 2ZVDA 4E70A 1KOLA 1MVLA 1JDSA 5IK2A 2G9NA 1XTJA 4RVHA 4JI7B 3KR0A 3NOVA 4RZIA 3NIGB 5E9JA 2QRLA 2HX1A 3QXCA 5G40A 5AXDA 3W3AD 4DV4B 3TR5A 3VSCA 5JVDF 1ZM3A 2EF1A 2GNAA 4RKQA 3SYMA 3UEOA 1QPZA 4OB8A 4A0FA 3MGKA 2Y71A 4N0PA 1OX4B 4BLTA 1YZTA 4KK3A 4FWTA 4TLCA 1A5BB 5EJ5A 3RABA 3SVLA 2R6DA 3KSMA 2VRNA 4GOLD 4NU5A 2XB9A 4Y1GA 3HCNA 4D9KA 1NG1A 2GFIA 3I53A 1SUFA 5CLGA 4D8VA 7ADHA 1OLXA 2VBCA 3IVRA 3JZDA 1NU8A 5HZKA 4B44A 4PU0A 3RC2A 1USGA 1LJ8A 1DG9A 3LZCA 3ICPA 1KKUA 3EWIA 4K87A 2RHOA 4RDXA 4F8YA 2YRXA 1AKYA 1FNCA 3KTAB 1J99A 1E2EA 1TM3E 2PMEA 2O8FA 3O21A 1B2RA 1E1CB 3NHZA 1LFDB 3V7NA 3TO5A 2R4QA 4Y6QA 2OK8A 2R6AA 1GSOA 1MQSA 2YBEA 5EMJA 1RRVA 1ULTA 1R50A 2IY9A 1T8TA 4R7GA 2RE8A 4DSNA 1T2EA 4FZ5A 3P94A 1UQRA 1GPDG 1RLUA 4ARCA 3O6VA 1DIOB 4KB5A 4PG8A 4DF3A 1W35A 5LOVB 3UK6A 2H48A 5EAIA 7MHTA 1TW2A 4HNUA 5LUBA 2FJ0A 2VPQA 4RMIA 1IZ0A 1SOUA 3DB2A 2BMDA 3G2QA 3QJGA 1RLOA 4IJUA 4YRCA 1G98A 2C5EA 3BH7A 4DIEA 4I50A 4Q4HB 3DZKA 1R00A 3LECA 2VZ8A 3UATA 4XIGS 4FFBB 5EJGA 4YXWD 5EJAA 4W7HA 3FWPA 5IBQA 4CNBA 1EDOA 4Q3BA 1MB2A 2RMKA 3GXOA 5DW0A 5IJ9A 3K9QO 3TZEA 4ZYVA 1P75A 2AZMA 4C21A 4RA9B 3AVTA 3V4SA 1YUBA 2G04A 3ZZNA 4AUNA 3UMSA 3K05A 1PNOA 3L46A 2C2BA 2PK3A 4FXPA 1LPNA 4NDAA 1CP2A 2RJ3A 4W5OA 2CLKB 1CZOA 1SUAA 3IS3A 2JBWA 1IJFA 1TM4E 4WN9A 1ACLA 1YAJA 1AN0A 3R0QA 1UPTA 1T0BA 3BBLA 4URUR 1J0EA 4QDKA 4MUAA 4R1TA 1U2DA 1H4TA 1L5WA 3RD5A 3O7MA 3I09A 3ESDA 4OGLA 3VO9A 4AROA 3RU2A 4RKWA 5AJVB 1A9ZA 3MWJA 5GZ1A 1DC5A 3OM0A 1NVVQ 3L05A 1CUHA 1DL5A 5AYVA 1BD3A 3WFZA 1YTLA 4ND4A 4B48A 3I9JA 2YZNA 5HR5A 4M8KA 4MI3A 3REQA 3OG9A 4DLBA 4YT5A 1Z33A 3T5TA 1OIXA 5K7SA 4C7MA 4E6EA 4QEDA 4ZJUA 1UBOS 4UPDA 1ZN2A 2EKQA 3R6DA 4H59A 1UBSB 4P38A 3I8XA 4JBWA 1CY8A 2FZVA 4O1HA 1IVYA 1REQA 4TXMA 5IDQA 2XB2A 1POWA 2ZRJA 4RS4A 2Z95A 4ARUA 5ICGA 1W87A 4UTOA 2OKCA 1XNJA 1T36B 2OVFA 4OQLA 3KIPA 1ZQ1A 3H3XA 4E22A 5BNFA 2DUMA 1F4VA 2Y68A 3KZOA 3LVFO 1ZP6A 3MGGA 3UM9A 5FPKA 2A86A 2FPPA 5HIAA 1N9GA 3NM4A 4H6XA 4LSWA 4KGDA 4JX9A 2PX5A 5IKOA 4BMXA 4BQEA 4JP1A 3UMVA 2FP3A 1Z2CA 3UO8B 1FVOA 3HB7A 4J29A 2PUAA 1S4QA 5J4HA 2WHPB 1BJKA 1JHQA 3ODPA 4JSRA 4BJ6A 4QVIA 1UZLA 1KYIA 2NTJA 4NVRA 1KEWA 2BGIA 3INRA 3W6OA 4BAGA 1DLJA 1S2OA 3IXLA 3KHTA 3S8YA 1YVPA 2MYPA 2FETA 3NEPX 3RS3A 3WLTA 4ND5A 3TDNA 5ALLA 2HQRA 2HZ7A 2XT6A 2ZS8A 5F2NA 2EKZA 1NLYA 1EQUA 1EVYA 4RLHA 4UD2A 5KJCA 1ZICA 5KOYA 5A4JA 2QV0A 3AQIA 5AD1A 4LVNA 3Q1KA 3PUZA 2HRBA 5EE3A 5GZ6A 3GX1A 4UBLA 5JYDA 2NACA 4PQGA 1A2QA 7ABPA 1TCUA 2A5GA 3C24A 2Q6IA 3KZCA 3UJ3X 1R4AA 3WRYC 4ZCQA 4A7PA 4QAQA 4B84A 3AR6A 4DE5A 2A5YB 3SAJA 3D5EA 1YJBA 4G0MA 4HWPA 1XHLA 2VJOA 3ER6A 3CPHA 3FPGA 3OM1A 3F4LA 3CUYA 1RRGA 1SOWA 1QKJA 3EDYA 3JQDA 3BH6A 4EVRA 4OH1A 3F90A 3ZNQA 4YUAA 1DQYA 1LH0A 4GLFA 1HBJA 2BRUA 1XZEA 2OM6A 3BM5A 3DZGA 1N2OA 1A5AB 3GD5A 2Q0SA 1VGQA 3IEUA 2P9HA 3NAZA 5SY9A 4NBVA 1T1RA 1M8JA 5BR1A 3RG8A 1CUWA 4LFCB 5DBFA 2QE6A 2OBNA 4Q82A 4EPXA 5EINA 3AM1A 5BXYA 3ONNA 3TNLA 3DUWA 1TZCA 4RTNA 1HM5A 1Z4LA 2EX4A 2PZFA 1E9RA 4BX2A 1NI4B 2AE1A 2HI0A 3FRJA 2AOTA 4D02A 3JQGB 4CLRA 3EUWA 1N2CE 2GBLA 3LUAA 5FFMA 2A9PA 2Y1XA 5CK4A 5I3CA 2P6RA 3HM2A 1JNXX 2LRHA 4E32A 5I9MA 4RXUA 5LP6C 1SIWA 1TVEA 1CHNA 3CRZA 4K1XA 4Z4IA 5EP1A 2AK2A 1U2SA 3P19A 4N3CA 4WFIA 3KYCA 2VJYA 4FN5A 1SCDA 1ZKMA 1ZHHA 4RF3A 5GJCA 5H4HA 4ALNA 3NHJA 1C8BA 4NCIA 2IV7A 1YA8A 1C3VA 5JDIC 2O5EA 3B5IA 3ND6A 4HZIA 1AC5A 1OGIA 2BFFB 1Y5LA 4QU9A 4QUHA 4IXWA 4MICA 3QRWA 4NRDA 5ILQA 2XCTB 4IGFA 1IEQA 1OBOA 5HM6A 5I7VA 2IIPA 1ZLXA 5AJUA 4D42A 1ZLYA 4P4TA 4DNXA 2G17A 3ROZA 1X92A 2C4KA 2VK4A 3ASYA 4JI8B 3EFOB 4D8YA 2ZYSA 1U2QA 2NUPA 3O9ZA 4L0CA 5A05A 1P7VA 2I5PO 1JE0A 3E1GA 1NSTA 2QRQA 3N05A 3OFKA 3ITKA 3SZLA 4C29A 1TU4A 1YQ9A 4KUEA 4BPRA 4BWVA 1U9IC 3C3BA 4V0QA 2WJZB 1DPFA 1GTG1 1ZNYA 2YN4A 3B3JA 4GPZA 4M4SA 4P34A 4GXTA 3THSA 3ZWPA 4E2XA 4F85A 2P4EA 5KTMA 3R6GA 1B6SA 1E0DA 1N1DA 2K87A 1UC4B 4JUIA 4O02B 1O8BA 1BE1A 1ADFA 3P9CA 3RUDA 4Z0TA 5JD5A 2F3PA 1XXHA 4B8WA 1MXFA 2Q4EA 1DFIA 4Q93A 5EUCA 4OQYA 1HTTA 1NYLA 2Y1OA 3E9CA 2YC2C 3ZGXA 2IGBA 2JFUA 3DZBA 4MKHA 3ETLA 3OE4A 1ECLA 2CZQA 1MA3A 1ZJJA 2ZIAA 1UZMA 3QHPA 4MXDA 1NSFA 5F76A 5HK9A 2YWBA 3COPA 5KAMA 5JNLA 3U61B 4QA9A 3T7IA 3GFSA 2UKDA 4YP5A 3H1BA 5CPFA 5KWIA 1G1MA 1Z36A 2PRYA 3OAAA 2VXBA 3AM4A 4EGSA 5BSWA 4QVKA 4LW8A 1CZNA 2Z2XA 3O84A 4XWYA 2WOOA 2AF3C 3JQAD 3UK1A 4A8HA 3HP7A 5LZ8A 5TMEA 3L8YA 4OP3A 5EWMA 1JHYA 1L5RA 3DQZA 4NBLA 3R8FA 4X45A 2Y0DA 4JT8A 3VR3D 4D98A 1PTJA 2QD3A 2V96A 5HIKA 4Q0MA 4YDHB 1CUFA 5JAIA 3G82C 2FB9A 1VRVA 1L7MA 2GCNA 4MTLA 3YASA 4WZAE 4ZZ1A 1HNXB 3WZMA 3QLVC 1U0EA 3TSWA 1AKEA 5JV5A 5IAKA 3ABRB 4V0MA 4CFYA 1WDLA 2OSVA 1FSGA 2E4UA 3GLUA 4AO6A 4Y9RA 4UZEA 1X3SA 5LD2B 4GEGA 1WW3A 1YB1A 5MFPA 3ZQJA 4Q4CA 2VL7A 1W85A 4CMIB 3EK2A 1B3RA 1WPGA 1T9KA 4IIEA 4UBOA 1ZAKA 5KHOC 2XD4A 3SIPA 1QLJA 1GNSA 1RYMA 2W6QA 2F2TA 4AY3A 4EI2A 1BFKA 3QHQA 3IPXA 1U1FA 1M5RA 4X24A 2C29D 1ORTA 3GJQA 4DLYA 1PJ8A 2WD9A 2CC2A 3U49A 1JDTA 3OLCX 2EGUA 1EQ2A 5JZSA 4AMBA 1HDCA 2PT9A 4Q4LA 1C1XA 1F0KA 4FP9A 4U6QA 3IP5A 4LZPA 3NMUF 4PS0A 4PCLA 3K0FB 2F3QA 2JAOA 3TN7A 3THWB 1XVIA 2FHPA 4C6HA 2A0KA 2ZSFA 1RWXA 4Z4EA 3F3KA 3F98A 5A6SA 1YZLA 3ZJYA 1E6KA 4QHTA 2GHIA 3RS8A 3IEPA 4DQ0A 3ZVNA 4LI3X 4FPXA 5DYYA 3FFTA 5LQDA 2KB0A 1ZRSA 3S29A 4W1QA 2C92A 4JLJA 2IZ0A 4PGHA 3UAZA 4ON9A 5C31A 2R60A 1QH8B 2P9JA 3GCWA 3PZBA 4RD4A 4TWZA 2HIHA 2ARKA 1YI0A 4MV8A 2P7IA 3C8HA 4PC6A 4QX6A 1AF7A 5TR9A 3T94A 4LF8B 4LHSA 1WSDA 5BV7A 1N5IA 4GBED 1Q95A 1YSCA 2Q3LA 3PTAA 1EMDA 3GMIA 4GKBA 1G291 1RHJA 1XZLA 1XD9A 3A6LA 2O1SA 2COEA 2HQSA 521PA 3FVQA 3H8SA 2ZRLA 4D9CA 1PZHA 4NC9A 1HDIA 3LMKA 4GM0A 4TRRA 2P6MA 3ELDA 2QPOA 2P65A 1U9CA 4Q3LA 3AJAA 3SG0A 5G4LA 3UGKA 1UBTS 3HBFA 4INPA 4OJTA 1G21B 5TPZD 4GOOD 4LJLA 3SXPA 3U81A 5JZMA 2IQIA 2BEUB 1L4MA 2DFLA 1MG0A 4LKOA 4F4HA 4DGSA 3UJ8A 2H1OA 1Y8AA 4F72A 2MIIA 4EITA 4XB1A 3ANLA 4D7AA 4JB3A 2IZ1A 1ADJA 4FFOA 5BT9A 3C3EA 4B3BA 4BMZA 2Q1YA 5FTLA 2ZJYA 1DMRA 3TLYA 2CXRA 2W83A 1G5FA 1QYWA 3V8MA 3FI9A 2E87A 1ORDA 2REQB 1SC3A 3S70A 2IOQA 5U4QA 1U0FA 3G5TA 6GPBA 5I4BA 4QYWA 1SURA 4E12A 1OPRA 1JG6A 2QX6A 2V6IA 1F51E 2RHLA 3PT5A 4UHBA 1RAIA 4MIYA 2H2WA 2VNSA 3I5AA 3WLHA 1TMGE 5CJJA 1DBWA 1LQTA 5EJEA 4O2AA 1A5TA 5SZIA 1H5QA 3LT2A 1V96A 2FW1A 5I51A 4TVKA 3I9V6 1M0EA 4B3RB 3WBKA 4A6DA 1W34A 1SH7A 3BJIC 4L95C 3BEDA 4F56A 1FB5A 3B6ZA 2HLPA 1J20A 2FRDA 2JVKA 4LK2A 2QRVB 3GHYA 4KN8A 4EGFA 3OP1A 3B1KA 4PRZA 3H2YA 1WP4A 4RDCA 4YRPA 2HGZA 1KETA 2I22A 3BTSA 4CKWB 2C97A 5DNVA 3IR7A 2IPOA 2YWHA 1KQGA 1D1TA 5JS8A 2QWXA 2WF6A 2CB0A 2H1VA 4HN9A 3UF0A 3ZCVA 2NUAA 4J2HA 3L9XA 4R5HA 2DWQA 5BV2P 1W0JA 1QQ5A 4Y6RA 5ERYA 4RD3A 3OI7A 3RANA 1TYDE 4BV9A 2DH5A 4RCVA 4Q7KA 5TF0A 1KVRA 5IJ0B 1N36B 1K8XB 4WFQA 4Y18A 4TS4A 1XYVA 5U9CA 2GZRA 2DY0A 5G4KA 5AK0A 5ULLA 3ZD8A 4EGAA 1TYCA 4KLAA 2VSFA 3VOBA 2XOKA 2Z4SA 1A95A 4X60A 4KE7A 4MKRA 5WRFA 4O0MA 3KLMX 2BMJA 5BUSA 5IABA 3K5HA 3VHXB 2AQHA 3MS4A 1QZUA 4PTZA 1C30A 3L0BA 2W6IA 3QUTA 1L5SA 1O96B 4JMPA 3OO1A 5D7BA 3GFTA 3BRWD 3RRJA 2DG2A 4EK9A 4BGIA 3EXFB 5AK3A 4M1TA 5GADl 2MYUA 3P9KA 3SKXA 3FYDA 2WP8J 3LUPA 1AUQA 2ZXUA 1TMKA 1Z6YA 5JCJA 3ZKWA 3IQEA 4FGUA 3LCUA 2XZOA 3EPHA 2B20A 2PWYA 5LB2A 2H52A 3FTFA 3HYSA 3V6MA 3GRFA 3ANMA 4YMTA 5IF3A 5JCOA 1DAEA 4LXUA 4OPMA 2C04A 2O50A 3SLKA 1SD2A 4BQFA 2PSDA 1T3TA 1RVDA 1WMDA 4JC4A 4ZQCB 3W9SA 4X65B 5AVVA 2YUTA 3FFWA 1A2BA 4RF5A 4DABA 8ATCA 3F8SA 4P0QB 1QH1B 1FYVA 2WB4A 1ZGGA 2IP4A 2GHRA 2VPIA 2ZQYA 5JSYA 3CR8A 1CXZA 2XQGA 3E5RA 1TEXA 3GPIA 3CLUD 3AI3A 5EPUA 4UJ5A 3SS9X 3KEOA 1F2DA 1GUDA 5KOHB 5CLIA 2EFJA 4RENA 4Z9YA 1UDRA 4UXIA 4R0MA 4URVR 4DADA 4QIHA 1WSBA 5JVDB 5SV2A 1G20B 5IAEA 2ISCA 3HP1A 4DPMA 5CCBA 1CR1A 2DAPA 1RBZA 4JQCA 1VLQA 1DUVG 1D2GA 1R8SA 5DN6A 1NV8A 4ZMBA 4TV9A 3ZIDA 4Y6SA 4HWRA 2BTQA 1R5BA 2Y4NA 5IDXA 3H05A 4ZPXA 2C99A 3ZWCA 3BN3A 4I2VA 1RXUA 1SXJE 1Z22A 3NIDB 4HFJA 2AMLA 4PS1A 4QDZA 4S1WA 1TQ2A 1I9GA 5CBKA 3EBPA 4XCXA 1L4FA 5IWAB 5IM4F 3B5JA 2BKEA 2NZWA 5B1DA 3FKJA 4TMZA 5EP2A 1QIHA 4LJ9A 5AKZA 1F4LA 4DTCA 1WVGA 1R6TA 2XGOA 1UIRA 3A04A 3PQ6A 3K92A 5K45A 2R6GA 1AHHA 1WHSA 4MGKR 3KSRA 1TJ5A 2WAAA 4J0CA 1A50B 3WYBA 5ILOA 2XH8A 3WYFA 2SCUB 5C37A 1SM4A 4MAMA 4BQSA 4X95A 3V8EA 4I4TF 4XDGA 3P9PA 2Q8QA 3B3AA 4F4DA 1QHSA 4NPAA 2I7CA 5D51S 3VR5D 1WZ2A 4MWZA 2H3HA 2C58A 5ESXA 1NNLA 5BQXA 3MSCA 2F1OA 3SS8A 1J8DA 2VWQA 1JEEA 1OUMA 1Z56C 1CUYA 1NW8A 3G7UA 1B0PA 2NO6A 3MMZA 2I99A 2QUBA 4OGFA 4Q1FA 2Y99A 2J32A 5L4LA 3UNXA 4JA2A 1B0ZA 3LUJA 1Q91A 1VSBA 5DM70 2EXXA 2J5RA 4MHSA 2V45A 3NXSA 4F5DA 2C7PA 2FEXA 1JSXA 3L7AA 2QPTA 5AMXA 4GSLA 2WHXA 1ZGBA 1THTA 2WKQA 2AZTA 3FTNA 3LXMA 2IUSA 2QX4A 4EHIA 2UXCB 2YMPA 2ECOA 3E3AA 5LB4A 1PL8A 4JNCA 3ZV7A 3BIFA 1A69A 2ZSEA 3BULA 4PW0A 5L3SB 3DDCA 4JI4B 1YBVA 2PS1A 1OB5A 1YKFA 1OI3A 1I4DD 1PJ3A 4J76A 1U1EA 2EP7A 2JAUA 2QYTA 3I76A 3B20A 2YXEA 5ECWA 1P1KA 2X3YA 2I3DA 2J9YB 3HXKA 2XWJI 2VF8A 3B78A 3M82A 4JEMA 4W1SA 5AHXA 5DP1A 3WYNA 4X3OA 3H0KA 3X1DA 3GT3A 4BV2A 4Q9DA 4EHJA 5DLYA 2GCEA 4RKRA 3RVJA 4WLNA 1CQIB 4CT4B 3IP3A 4ZIRA 2NQ8A 4TQAA 1PK8A 5LDHA 4A0QA 2QOEA 3H9UA 5KWSA 5B1EA 4HI0E 4AC9A 3D5TA 4YPVA 4CIYA 4Q15A 3UT5B 1VXOA 1BDMA 4KFCA 4HAOA 3A9TA 1A9SA 4QOSA 4ZTBA 1O94D 2R7KA 3M5CA 1E79A 5ESRA 4BNWA 2ZAOA 1C3XA 1T9GR 2OLEA 4U9HS 1I4OA 3ZOZA 2Z58A 4A23A 1SRRA 3P0HA 5E1BA 3E9NA 3PEYA 3OPQA 3JD2A 2VHWA 3WGYA 1ZFNA 1Q11A 4MCHA 4ZVUA 3DS8A 4JHXA 4IO0A 3VDMA 3EF1A 3W5JA 4FB4A 4IEFB 3NJRA 5B12A 2FZKA 2WFAA 1QZTA 3TTSA 4DLRA 1ABBA 3EZNA 1GDDA 3PC2A 4NTZA 2KS6A 5ALGA 1GZ6A 4E6PA 4Z54A 3IJ5A 3RVRA 2I6FA 2VP0A 2IYAA 1JAHA 1NA5A 1QGUB 3CZQA 3LDGA 4TMFA 3JSAA 1OR8A 3WYGA 3NHRA 4MYCA 1DAPA 5AW1A 5KINB 4IDPA 1NGSA 3T3EA 3ZDRA 3MCUA 1TF7A 1XNHA 4NJEB 3RREA 2ZTSA 1C0PA 3FUWA 1EXMA 2APJA 2DYKA 3BFVA 1QMPA 3AVXA 3V80A 1A9QA 2VXYA 1RBMA 2SICE 3HB9A 3WLMA 1EEXB 3QKTA 2DR3A 2NXJA 4KXVA 4C2AA 1NUUA 2NNLD 5TARA 4M9UA 4UHHA 1V3QE 3VAYA 1LLQA 1PI3A 4LY9A 4A2CA 4R8MA 1MW8X 1OAKA 1A8IA 5H3LA 1WUKS 2BONA 2V7PA 3FCXA 4IRMA 3DMRA 5F78A 2MCFA 1IUPA 4LZNA 2BMVA 4IDDA 4V1CI 1YJAA 4S1TA 3GPDG 5IM5A 821PA 1VZ2A 3ABOB 2Q28A 2R8YA 4DIOA 1OLUB 1S7CA 2C5FA 3E9EA 4GXNA 4OA5A 4UM7A 2I7DA 5JO9A 5L53A 3SP1A 1KEKA 1PJ4A 3BGDA 1YULA 4X9XA 4BFTA 5M7EA 3LUGA 1F8GA 3AI2A 3LSTA 2CV1A 4IOKA 2Q5QA 2Z8XA 3QF7A 1EG2A 4LCJA 5C8XA 3JAKB 4C6RA 2INGX 3UK7A 4DA6A 3TQSA 2A5LA 4FGKA 3TD2A 3WMFA 1NJ2A 4I9FA 1B8OA 3MBIA 1L5MA 1PJSA 3TPFA 4E5PA 3L4JA 4H0FA 2IDZA 5IZCA 1I33A 4ZAGA 5J2UA 5DJ5A 1G17A 2I1WA 3VR5H 4EARA 2EHJA 4RF4A 4PVDA 1I2ZA 3DV2A 2OGWA 4NYJR 3CVWA 5K3EA 2JIBA 1QV9A 4HXGA 1ZR2A 2R0QC 1AKWA 1MA0A 4YJHA 2JJMA 1KYTA 1PF7E 1RKUA 1VYTA 1MW9X 1W1IA 3IQGX 3OIYA 4K9QA 4CM8A 1UAAA 5A71A 5T4BA 2HMVA 1XYGA 2V5VA 4GPTA 4IIHA 1E1RD 4YP7A 5C34B 2V0CA 3FKQA 4L51A 4L4UA 3SY8A 2L69A 1JILA 1GNRA 1JB9A 1GCOA 2GK3A 2PJZA 3BXXA 5F1YA 5TGZA 2VHYA 3K6SB 3OLQA 1QRSA 4HGOA 1GAJA 4LOHA 1QANA 4BVKA 3ICQB 5IK2D 2HM7A 3EW7A 1L8QA 1B4DA 3OZCA 4UUNA 1H1LA 3HB4X 3MGAA 2JNWA 4WNAB 2I4LA 5FJJA 3ZWMA 4B4OA 4NQZA 3PQ7A 3ZLJA 1QOQB 3ET4A 3C48A 3UKJA 1SKAA 4MPRA 4G0XA 4QQFA 4MR8B 3ZQUA 2V4UA 1LI5A 3IAFA 3UJPA 2G08A 1JR4A 2RGXA 3IQWA 4A03A 1C4WA 4ENVA 4CL8A 2E4YA 1G8MA 1WB5A 1EHCA 3A36A 3AONB 4LDPA 1RPTA 4FHGA 1C8LA 4L2IB 2COUA 2B4AA 2UZ0A 2I4RA 5CCEA 1L7NA 1F3LA 1Q7CA 1T1EA 4OG2A 1Z5VA 1PWXA 1YZYA 3G2JA 3CO5A 1ZY2A 1P0CA 3V7UA 3HUDA 1LDGA 1HI9A 3SDZA 5D5QA 1KEZA 1RRMA 1R9MA 1WVMA 3RFTA 3U0VA 4AG6A 1I3LA 4RKFA 3EQ8A 4EBBA 4Z6KA 3ER9A 4V02A 2VRBA 3I2GA 3BZWA 2FN8A 5K0BA 3L8FA 1G7SA 2CNKA 2PR2A 2XB8A 2CLOB 3HNPA 3LH5A 1CP3A 2QUZA 5I4CA 3AY6A 2A9OA 1I6MA 1U7HA 2OYCA 2FN4A 1W73A 3WWDA 1NQVA 1RS0A 4M8LA 1JIIA 1VBMA 2JIZA 4ZOEA 2ZZMA 1D2CA 4L8GA 3PC7A 4C1BA 4ETNA 1EJ2A 3FFAA 3DOIA 1Z45A 1I80A 2RG1A 3M9XA 3U3MA 3B2QA 3TB6A 4UFPA 2GZDA 2OCIA 1E7RA 4FVTA 4R71A 4FDTA 4H0CA 2C3PA 3SBOA 1W5SA 5KTSA 4FONA 4G1BA 4WNYA 5SYMA 1H6BA 5DI3B 5DGIA 1RWMA 4WNCA 4A91A 1DJMA 3RU9A 1C7FA 4CMEC 1G5TA 5IYZB 4IRUB 3WGHA 1DC6A 2Q46A 3DYIA 5BR8B 5KWEA 3E9DA 3TGLA 4L16A 2FE1A 3ZGLA 3EZLA 4Z99A 5EXSA 1KE1A 4R5MA 3VRHA 1FTWA 1OX4A 1Y34E 1KH3A 1QGDA 3HG7A 4KQ1A 2O5CA 2PGXA 3U60B 2BC9A 5C9ZA 1PUXA 2W48A 1RDFA 4DA8A 2W2MA 4OUKX 2H3EA 3MXOA 1E9VA 4C5BA 1PYGA 1J9ZA 2HQBA 5JAQA 4IH1A 1HDRA 1S02A 3VUFA 5KSOA 3K15A 2X40A 1VLZA 2R00A 4HHEA 5IUKC 1SXPA 4MQ5A 5AOVA 2J6IA 3KTAA 2QR3A 3GDHA 1PUIA 1EBUA 1E1CA 1XTKA 3R9WA 1DBVO 1FTYA 3HFSA 4N0DA 2CXSA 1FDWA 3B8HA 3QIAA 4FYMA 4KBYA 1W94A 4WASA 2YIMA 3I2JA 4LMAA 2HQOA 1J8QA 3QNUA 1USKA 1ICEA 5AO9A 5CB4B 5LU8A 1Y9ZA 3H0CA 3OLWA 3PKJA 2QTAA 1XWIA 2AK3A 1VRWA 3F6SA 1D7AA 1IK6A 1Q1EA 1PZMA 2SKDA 3QU4A 4WERA 5IXYA 2JH3A 5F33A 4V24A 4EG8A 4WK6A 5LOVA 1C1DA 2BFCB 4RV9A 9ATCA 3M7IA 1BOFA 2QZ9A 4DCGA 4EA6A 5JBIA 3KNZA 2DWUA 4D9FA 3QM1A 4QKQA 4B6QA 5AVUA 5HKBA 4K81B 1GP2A 3ZVKA 3GGCA 4Q4HA 1DEOA 2CHQA 1WXEA 4FFBA 1G6KA 4PLVA 1FJGB 5B3LA 2IYVA 1C7EA 1X6VA 4Y2GA 3R09A 4G5YA 1BIFA 4W6ZA 3M6FA 5IVPA 1FX0B 3SS7X 4DUGA 2ZAGA 1FXWF 5DEOA 2D8MA 3B70A 2HDNB 3L7CA 4FLFA 4RA9A 5ES3A 2D6FA 2EZUA 2C7VA 4OLAA 1FSPA 3I01A 1KO4A 2DC1A 2IEDA 3JALB 1LV7A 3VU0A 1M0TA 4JDUA 2P69A 4YTEA 4AJHA 3B7GA 4GMHA 3FY4A 1DCFA 4Z4CA 2V7EA 3ETHA 4QYMA 4WLVA 4WESB 4DEVA 4IXMA 3SSNA 5AVRA 1XQ9A 1LI4A 3O4RA 4R81A 1C80A 4Y6PA 1XMOB 5FWNA 3EIOA 1P9WA 2Z57A 4FDLA 3U9TA 3KQHA 3QWFA 2ODAA 5T6BA 1QR2A 2BW0A 3IEKA 5AM1A 1U8YA 4JMLA 4I1VA 2XKJE 1RI3A 4LE1A 5CNKA 4BCDA 4EYOA 2VAVA 3MTQA 5AW4A 5EIXA 1KP3A 3FG9A 4NCNA 2XMSA 1QWOA 2TECE 3KHUA 3Q98A 4TWRA 2OZEA 3PQ4A 1OMOA 3FPCA 3H17A 3PFBA 3R3WA 4LZLA 2QN7A 2PM8A 3TM4A 2DT5A 2JLBA 1KY3A 2EL7A 4ZEXA 3RC3A 1EE1A 1I32A 3SZ3A 1JXMA 5IKMA 2H0AA 1T36A 5P21A 4D8WA 3BSWA 5DYWA 2B6HA 2PUDA 3UPTA 4DQVA 1BA3A 5DX1A 2FPSA 3E22B 4PYLA 3FZNA 5IBRA 4Z4HA 1RTTA 2LV8A 2OBFA 3I9MA 3AUAA 1EM8B 3NBMA 4FT2A 3VPDA 3F3YA 3R24A 4D46A 4TSRA 3PXAA 1N77A 4MW0A 7MDHA 4RLQA 1XRMA 2EEPA 3EZ9A 2HF9A 2CWDA 4EPTA 1ZRHA 4RIEA 5KTNA 3VNAA 3PUJA 2F90A 5JDCA 4IV8A 3AVUA 1NXOA 4N6OA 4XIIA 2NPFA 1NFFA 3RSHA 1TECE 3LHIA 1GUBA 1HUQA 5IULC 2CCKA 2ZIEA 1JLMA 3IH5A 1M75A 2VDOB 2GSDA 3UFBA 1Q6YA 2RI0A 5IDYA 1QYVA 1Z4QA 3GH1A 3K0CC 3KWMA 1K6EA 1YIOA 4HNHA 3T5GA 3WL6A 3BXPA 1DG3A 2ZE8A 4TUYB 5JMTA 3CO0S 2V9PA 2V1UA 3GH3A 4MW6A 2F3UA 4Q1BA 1YFZA 4F2WA 2C77A 2PZAA 2XWSA 1YS9A 2CFOA 4CIXA 1CQJB 5K0LA 2NO1A 3TNYA 1GRNA 4QFBA 4TM7A 5DCUA 2QTBA 4NESA 3R7AA 1Z0UA 2CXPA 4U7DA 1W7AA 2YOGA 4MCJA 1NQ5A 2JF0A 4LG1A 4X66B 4QGSA 1ST3A 2HDOA 1ONBA 5K99A 3SC3A 3HNOA 4UE3S 3QXGA 5GTDA 1MQ9A 1R5OA 2B3TA 1QFJA 1QCYA 3R9XA 3QV2A 4PYIA 1AMNA 2LIPA 3TR0A 1Y37A 2N0SA 5LC1A 1XJWA 3H13A 1SZJG 4QUDA 4Y6LA 3T1QA 2AFIE 2AR0A 1NPYA 2XADA 4X41A 3IQDB 2WKPA 5EZ6B 2UXDB 2EZ9A 4GR4A 1H6CA 5DMHA 4YQFA 3W9BA 1P9NA 5FPHA 2ODNA 1NI4A 4CPDA 3JQGA 3QLUA 1F0YA 3EJ6A 3K5PA 3GZJA 3OAAD 4JB2A 1WXHA 5TPWB 2IYOA 3D4IA 1SD5A 2RB4A 2QAGC 2XDAA 2G4CA 3TVTA 1TA4A 1IY8A 2C3UA 4JR1A 4PPGA 4IR7A 4UEWA 1T4CB 4YRMA 3G0GA 4RSRA 3H5OA 3AVWA 1NIJA 3QELA 3BGWA 2BFFA 3AVQA 1R6DA 3UCEA 3FGZA 3OKCA 5BWNA 2ROQA 4L5JA 2VZ9A 1L1EA 2VHZA 4BLWA 5A2QA 2EAUA 4U0JA 1DJLA 4OQFA 4QWWA 4Q16A 1IHPA 1VKNA 4H27A 3IP1A 4AXXA 4ED9A 2MSLA 3C1UA 4ER6A 4NG4A 3C0KA 2V74B 3TH5A 3TM5A 2AOVA 4YCSA 3NASA 2QX7A 1ADBA 1PFQA 5KX5A 3EFOA 3QYFA 4FFSA 1DBPA 2RK6A 2CVHA 1J8FA 1JR3E 3RIHA 2G9VA 3QSYA 4OCZA 1U28A 3IBGA 3SQOA 1XZDA 2BH9A 3HU5A 2FG7C 1XJQA 1MRNA 3Q6NA 2G7ZA 3PX7A 2DJ5A 3B1WA 1PLLA 1VHDA 1QHFA 1CZRA 3QJYA 3ZTTA 1K9SA 3FJOA 4UDXX 2OECA 3I2FA 2YWXA 3DWFA 2FPIA 3QUQA 1TL7C 1I30A 1EK2A 2PSEA 2ZRQA 2Z5FA 3FWHA 4BWYA 1CEXA 4PZEA 4JYCA 1RJDA 1GZDA 3TQTA 1AHIA 2XE7A 1A97A 2HSJA 3LS2A 4MYUA 5J5VA 2D2EA 3TCKA 1WO8A 3SKVA 3AP3A 2TMKA 2ZETA 3E5MA 4B47A 5DT2A 1ATIA 1DX9A 3ANYB 1I1QB 1T2NA 2IK8A 3BJRA 3JYNA 1EXNA 2EC5A 1L8XA 3L93A 3QJ5A 2ZUDA 3GDGA 4N7BA 4TKVA 3OU7A 4TWIA 4W5WA 2I62A 5J5AA 1BFUA 4AF6A 5K8UA 5LL6P 3A1FA 3SLRA 3DJYA 2P3LA 3KPUA 4QD3A 2JZNA 1XALA 1NBMA 4YCNA 1SHLA 2OCGA 1VIYA 3H9GA 2ZP1A 1TZ2A 3MM4A 4TTPA 3KUXA 4O2BF 4BP1A 1FOEB 1Y8CA 4KZKA 3V1YA 2BGWA 2O8BB 13PKA 2QJTA 3CRW1 4CTMA 4ENQA 2JKYA 1UANA 4DM7A 2TYSB 3H6KA 3O2NA 1VKRA 2B82A 2IOHA 3BICA 3EVBA 1FVXA 5LYYA 2C88A 3WGNA 4BVEA 2PFKA 5FAXA 5K4GA 5LWHA 1O95C 1GLNA 3P9IA 4WLOA 1YGYA 3SMVA 2FSPA 1RC8A 3L2OB 2IE8A 2J9RA 1L4HA 1IU9A 1MO6A 2E4VA 3AWDA 3O8DA 2ZCUA 4HL6A 3DPIA 1XDSA 3V7YA 4EBFA 2JA2A 4MAFA 2EZ4A 2X2EA 4Q03A 2H9IA 2ZI7A 4J1NA 1TYAE 5I47A 1DAFA 3WTBA 4BNFA 4D9EA 2TMGA 1PFKA 1XRQA 2B3DA 2JJ8A 2RAFA 3LV8A 2XCUA 3P2JA 2Z9BA 4KSYA 4QUIA 4XWGA 5DHFA 3VH1A 1TLFA 1OAAA 1TUEA 4H9GA 4MUGA 2YXNA 2WW8A 3RWOA 1KA9H 1YVUA 2VDNB 4GPAA 5LMUB 4CEHB 1KDRA 3HY3A 3EAQA 4GGMX 1Y4ZA 4TL6A 1UXIA 1XMPA 3HJAA 1N75A 1P0PA 3KJGA 4Q3EA 3QWBA 1K4MA 1H0KA 3HXPA 3IVGA 3P1JA 5FLXA 1BN6A 3EXHC 5DM1A 4B31A 1ETHA 1DINA 3K0FA 4YAFA 3THWA 1QGZA 9ABPA 2WIJA 3VV3A 1Q3KA 2W11A 1RCTE 1QDLB 2R1VB 4RVFA 2B9EA 1Q7TA 2KQUA 2Q6LA 3CX4A 1L4KA 4L7VA 4MVYA 1FNNA 4MWTA 3DHEA 4L6AA 5EXPA 3IUQA 3WLKX 3KPVA 3ZI4A 4DKJA 3RG2A 4BGUA 2D74A 5IPFA 2Q2OA 4A8JB 1AA6A 2C9CA 1QH8A 2HCBA 3ODGA 3RTCA 4M54A 3A1UA 3OX4A 2NU8B 3RE1A 3T41A 2VQDA 1QYCA 3PS9A 3W7VA 1WF3A 4IFEA 3BF7A 3AIIA 3ENKA 1XMJA 4NL4H 5F73A 4CIAA 5JTTA 2XGMA 1XHEA 4XB6B 2ON6A 1ZK2A 4COKA 4NOMA 1VE6A 1HT0A 1Z5NA 2O2YA 1G8HA 2R6CA 1L5ZA 3HCOA 4A6EA 1GGNA 4BXOA 1Q17A 3V8QA 4NNJA 1W0JD 4LC1A 4LVCA 2W4IA 3GMSA 1F5NA 3HJCA 1IN6A 1NT4A 4YGXB 4QQKA 1NFRA 4HAZA 2BEUA 1V45E 4B80A 3HR4A 1HWYA 2A1TR 4UBJA 2E4XA 4CLEA 3MQ2A 3N2ZB 3WSTA 3DD5A 1PJQA 2OB1A 1JPJA 1M2VA 3BWMA 1FNMA 1PDOA 3OJLA 3PFKA 1SY7A 2XOKD 3PXCX 3WQBA 1CRZA 3Q5EA 1PS0A 1Z4JA 3NM6B 4F04A 1ZH8A 5LQAA 3ANNA 3MG9A 1JEYB 4IDQA 2GEBA 4X1KA 2R4TA 3UHPA 2O0HA 2REQA 4Z51A 4URXR 3BAZA 3BHIA 2W6ID 3RF7A 2JEYA 2OV4A 3GEMA 1MB0A 4C08A 4JXXA 3U19A 1M1YB 3CRNA 3NGXA 3R1IA 4HGRA 4KQJA 1JUDA 1JDBC 1WV0A 1JFSA 4PNPA 1JRLA 1Q0QA 2EKDA 4F5ZA 1DIGA 5JCJD 7AT1A 1NVTA 2YIJA 4YJ3F 1VJ1A 2G1KA 3GU3A 5KYTA 3IHWA 1MVNA 1G4UR 2D59A 1MEEA 5EE0A 5CVUA 1DTSA 3KTFA 2WSLA 5LP1A 4QU5A 2ZB4A 1N8NA 1NBEA 4GT1A 4AKEA 1Z83A 5AM0A 4ZAFA 2D1TA 3CZ5A 3LBNA 4K9LA 5AHKA 3DKVA 4QZVA 5AI4A 2CYBA 2D3TA 3EIUA 4B4UA 5KO2A 4ZICA 1UXGA 3N7UA 1SEVA 1LPMA 2IYXA 1Y1LA 4YAUA 3K9WA 2Q1TA 3DC2A 1JQKA 1KK0A 4MO9A 1J0BA 4PPFA 2D7CA 4RPIA 4CKWA 4ZC1A 3AXSA 3SDSA 1CUUA 1R27A 2FSVC 4HB4A 1G5HA 4EPWA 2DB3A 3T38A 5BVGB 3Q72A 2BSAA 5JSUA 4IF6A 2AV6A 3AEZA 2IY8A 1VIAA 1JU4A 1UBCA 4G97A 1S4MA 3OF2A 3TW8B 4C4PA 1RYHA 1YONA 3I30X 3WTCA 5DN6D 3NORA 3E9QA 1M10A 3ECSA 4PXAA 5DNWA 1DT3A 4ZEOA 3GVPA 2BHRA 2QG9A 2XDYA 3UCXA 5IT0A 3OTOB 3AR3A 3H2KA 3PDCA 3QGMA 1YR7A 3P9XA 1ZNXA 3M5WA 1PFUA 3SZUA 1CR0A 3RIEA 2BI7A 4GE0A 3SF8B 4DWVA 1U1CA 1DMSA 3I8SA 4AG3A 3O95A 1UT8A 4J4HA 4XYEA 2W2NA 2VF7A 4KQXA 1XZNA 4M1WA 3N2YA 1G9SA 4RHYA 3VHXA 1K3FA 4PRKA 1E7SA 4EKGA 1DJOA 3IKVA 3N0RA 3HE3A 1KEEB 1ISPA 4Q37A 1O96A 3KP1A 3D6UA 3MFQA 4XCQA 3BAFA 2G9ZA 2OMEA 3W2EA 1TFRA 1D2AA 3HP4A 4RORA 2QG6A 3RSZA 1Z5GA 3EXFA 4XJTA 5JQGF 2XAAA 2WTNA 2ZBGA 3QVOA 5AI0A 4KN9S 5AFSA 2FX5A 2Q50A 1YHZA 2BGMA 2NU6B 1H5NA 2O48X 2X7JA 4QHYA 3IC5A 1C9DB 4FR2A 2HCRA 1PX0A 5GJBA 2HRRA 4OYRA 5IKXA 1CUBA 4MKIA 1N5JA 3CE6A 2CHGA 1QOZA 1Z4MA 3MTJA 3MT9A 5ADWA 1L7BA 3SDBA 4JODA 2DETA 1UWKA 6NULA 4WA8A 1KJ8A 1SQGA 4A5SA 1O6CA 4YRBA 5EPOA 2QMYA 2VHTA 3D8NA 3G9ZA 1B15A 1MT0A 4JJ4A 1C0LA 1DXOA 4J1TC 5EZQA 1SUSA 3TS1A 1QH1A 1PVVA 1Z2NX 2OLJA 4MR7B 1ENPA 1NHGA 1T1GA 1VBKA 1Q50A 1SKYE 3MIZA 4LXIA 3TLZA 4BX3A 3IUJA 4EATA 4F3YA 3PA6A 1Q2XA 2J9FB 4LWPA 4FC6A 4YDQA 2CZGA 4B6GA 3TEMA 1M2NA 1R4ZA 2IPXA 2IOYA 3WLEA 3KJNA 1AB5A 4RV4A 1AZSC 1HSOA 1SK9A 2QZ4A 4WN3A 4ZT3A 5HF6A 1SXJC 1G20A 1VJ5A 1W9MA 1XF1A 1T9HA 2A1UB 2OV8A 3P9SA 2ZGVA 3W77A 3WHIA 4AKSA 4DBLE 1NUPA 4J91A 2W90A 3LP8A 4BY9E 3N2IA 4ZXFA 2J3HA 3MK31 1TGVA 3L0DA 4IIJF 2ZVPX 4EO7A 1I3CA 4KE8A 2R79A 3BX1A 1AO0A 4UU0A 4EF4A 3LTNC 1SWWA 1SXIA 4LISA 3BE4A 3KALA 2QS9A 2V7VA 3LCMA 1J56A 4M7WA 4S1PA 4ZTUB 3ZDEA 5F9FA 1OXVA 1OILA 3OT1B 3CJRA 4D92A 4F6LA 1IG0A 5BQFA 3ITNA 1JHRA 3VKUA 3AY3A 5EZSA 3ESYA 4DG9A 4EB6B 3WMXA 2LDBA 5CM9C 2I67A 1NOIA 1EQAA 1XAHA 2IKQA 1FDOA 2XUHA 4NH4A 2IXGA 2P2SA 4XDYA 2C0PA 4YYEA 1FTQA 3AHCA 1J2JA 4YJGB 1KERA 1AKRA 1T4DA 3I52A 5FBHA 2VT3A 1XKQA 1Z6GA 2QLJA 4FMDF 4EF6A 2O5RA 2Z98A 4WINA 5CX4A 2VDVE 3SR4A 4MI1A 5K2MA 5CG2A 2XMGA 3D2BA 4MKFA 4BKMA 4Q9LA 3SIWA 1ETUA 3CLTD 1UOOA 1E79D 1V3TA 2IZZA 3VPGA 4A8PA 4WACA 4P83A 2XCSB 5EVJA 4HUJA 2GUWA 3B6KA 1IHYA 1P1JA 1WHTB 2JGDB 4R69A 5B3JC 1RWNA 2PBRA 2Q3MA 3PWSA 5AJHA 3T9AA 3VPAA 1TIPA 5IANA 4TKMA 4EY4A 9LDTA 2JFQA 1ZVVA 1LK0A 2VDQB 3NDJA 1H05A 2H17A 4MEJA 3BCHA 2JIMA 1T1SA 3DAGA 3AEUB 2FZ5A 3A37A 1SUBA 4OMCA 4HQOA 4CG1A 1P4HA 2GM5A 1Z17A 1P1IA 4V39A 3GT0A 5EEHA 5JI3E 5KTTA 3A1SA 1N5OX 1UODA 4YUZA 4JEUA 4GWKA 5F2OA 4YWJA 2HSEA 4R2LA 4A3SA 4Z7JA 3HK2A 2Z08A 1JLLB 1ZA1A 3C8MA 3GFGA 1G60A 4P2GA 5L3SA 2BFOA 2Y1EA 1LVHA 2JVJA 2P9GA 3G9TA 3M6MD 4MHTA 3LY5A 3IAHA 3W2FA 3ZGOA 5BOSB 1RC1A 1DO0A 1G8KA 3OMXA 3B52X 4WUVA 1JHUA 1N8KA 2B99A 3G7SA 1FLNA 3DKKA 5EYPB 4GYWA 4A9AA 2PLAA 5CA1B 1RRPA 5KYGA 2BF4A 4Q3OA 1IBSA 2HJRA 4PAQA 2OTCA 2RARA 4DKXA 3FUUA 3PWKA 4DCPA 3M9LA 2JGAA 1CQIA 2C59A 4MQEB 2BKUA 2IDKA 3L4EA 4EY8A 1Z6ZA 4AAYA 1Z74A 2EBWA 2XXAA 4RABA 3KKZA 1SCNE 5KTKA 4BCBA 1ATZA 3KLBA 3EEIA 3OX1A 5TE9A 3GLFE 5TQVA 3H42B 2EVWX 2HLDA 2GNOA 2P9ZA 2QZSA 3C3DA 3CUVA 3KKEA 4QO7A 3CKLA 2AJBA 3H9CA 3SIRA 4YAKA 2CD9A 4HYTA 4MULA 1GR1A 2QENA 2Y6UA 3PEVA 4BASA 4CM4B 1FZQA 1LLDA 2XUZA 3CCFA 4PZCA 3RVLA 3W5HA 2F62A 2WJGA 1K7XB 4Y9UA 4DIBA 2PAAA 2HNKA 2BBSA 2QMUA 5ICSA 1E0SA 3WNCA 1UEXC 2WWFA 4CV2A 2XR1A 3PPVA 4TMXA 3B9RA 1FZTA 1NRIA 3UJAA 4PN7A 5HUQA 4FZRA 3TEJA 4HB0A 4BRSA 3WLAA 3ICEA 4EHKA 4FEYA 3QEKA 2WLTA 1JIQA 1JMVA 1AF4A 2A5JA 2FCAA 2IQ5A 3I04A 3N58A 3P9RA 3V8PA 3DZ8A 4MVJP 4DIKA 1QGUA 4RANA 4TXNA 3ACDA 3ZXYA 1ESDA 2XKKA 3H18A 2FY8A 3U40A 3CVVA 1M1XB 5CLLA 4NJEA 2C4TA 4NCKA 1EB9A 1P8JA 3L18A 2OPHA 4U63A 4ESHA 1NPDA 1ZH4A 1T8PA 3SM9A 4DWJA 3ISTA 2Z3VA 5EGNA 1XZIA 3E9YA 2P4QA 2FUG1 2PUWA 3AYXB 5M34A 1T34A 4JLNA 1LEHA 1BH2A 2E5LB 2AEJA 4P36A 3VTFA 2BELA 2IFTA 3K30A 1SXGA 3DOCA 5FF9A 2BM1A 2QZPA 1CJBA 2L82A 4G86A 3H9EO 1IWBB 3MAAC 4E2YA 3H5LA 4HGZA 4EABA 1WS6A 1P2GA 1TZBA 3QG5A 1N92A 3OIGA 1KNXA 4IDGA 4M0KA 5K3AA 4LIPD 4UZFA 3VKFA 4M9RA 5IJXA 1VDZA 1F12A 1OLUA 3KSZO 4OXXA 2JASA 4UREA 1JWAB 4XZ3A 3BXFA 1QC5B 1R9NA 1E5XA 3DKPA 1R2QA 2V5AA 4MLPA 4R1LA 4RVSA 5DM2A 5ECDA 5EIOA 1I6LA 3UUWA 4BX0A 4D3FA 2BHTA 2RHHA 4LF5B 2CNWA 1G0OA 3KZ1E 3JAKA 3M3HA 3KZXA 3SHVA 5FUMA 4FYJA 4KQHA 1D8AA 1IH8A 2QJRA 3BTOA 1FJHA 2B1QA 2GCGA 3BBPA 2Q0QA 2IEAA 1JGTA 3A6JA 5AKIA 2JLQA 1RAEA 1JFLA 1U2GC 5F77A 2FUEA 1PR4A 4BE7B 3CIOA 5TC4A 2HHLA 1SG9A 1ZOIA 2JIZD 1ZSNA 1A8QA 3HLKA 3HS3A 1EFPB 1B1AA 3PD1A 2XODA 2IBTA 1ULSA 3U4QB 1NFQA 2QA5A 4DZZA 4FYVA 3LWNA 3SFZA 3OBIA 3TZ6A 3K0SA 3AF4A 1XNGA 3MCWA 2KE5A 2XB6A 3OA2A 2HU5A 4LNUA 2FUKA 2PYIA 4WLFA 5LMNB 3PQCA 2ZQ5A 1C3OB 3CZMA 3K6SA 4REQA 4JWKA 1NNSA 3COJA 1S6YA 3F6BX 2PJRA 2C5LA