4BNDA

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
b'KMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
total genus 94
structure length 252
sequence length 252
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndA01
2HOQA 2GO7A 1IWOA 2YMLA 4AS3A 5ALWA 5AM3A 1XVIA 3I1YA 4KNWA 3NASA 3U7GA 1WPGA 4Y2XA 3WK8A 4FYPA 3RFUA 3AR2A 2Q4TA 4Y3UA 4F72A 2MSNA 3ESRA 2P69A 3BA6A 3QU2A 4OD0A 4RETA 2JARA 2R8ZA 4BEVA 2Q5EA 3KC2A 3ZTYA 1JUDA 3DNPA 1RMYA 4UAUA 4UM5A 5ALMA 1S8OA 5AKKA 3QU7A 3N1UA 3PDWA 3IB6A 5AW3A 5AIAA 3OCWA 3WKDA 2I55A 4H1WA 5AHXA 3L7YA 2W43A 4CF5A 1ZD3A 3J7TA 4CNQA 4EENA 3I6BA 3L0BA 2O2XA 3QGMA 5AW7A 2PKEA 5ALEA 4HGNA 3CZ4A 3WK5A 2WF7A 2WF6A 2CN1A 2G80A 5AK5A 4F71A 2AUTA 4HAIA 4BYGA 4XQ0A 2HX1A 1Z4LA 2P11A 2GFHA 1Z4NA 3SHQA 1Q92A 1TA0A 1VFPA 1RQLA 2QYHA 4JDPA 2FPXA 4PNHA 1ZJJA 4KNVA 5AW9A 4YCLA 1RKUA 3GYGA 4UARA 1L8OA 5FP0A 3SKXA 4E88A 2P9JA 4BKMA 3QYPA 1YS9A 5AM4A 1NNLA 3U7EB 4L6AA 2HHLA 4ZEXA 3L8EA 5AVUA 5AW0A 4UU1A 3QU9A 5AKGA 4HGRA 2B82A 1U2TA 2WFAA 1RPZA 3BWVA 4I9GA 3ZVNA 1Z88A 4I9FA 1SWVA 3FZQA 3E58A 1RQNA 2CFTA 2WHEA 3MPOA 2R8YA 2WF5A 4DW8A 1RLMA 5ALPA 2R8EA 3QLEA 3U13A 3W5DA 1RDFA 4CE6A 2WF8A 3OCVA 3QXGA 4YCNA 2PQ0A 1XPJA 2HO4A 3VAYA 2HF7A 1Z4MA 3N07A 1PW5A 3DAOA 4AS2A 5ALHA 4GXTA 3ZTWA 5T41A 2YJ5A 3FM9A 5ALXA 3CNHA 3FGOA 2MU1A 5AICA 4Y2PA 2FPWA 1CR6A 1J97A 2HCFA 4Y2RA 4C4RA 3WKEA 1LVHA 3E84A 2IOFA 1WZCA 3F9RA 2W11A 3IRUA 3HLTA 3U19A 5ALLA 1KYTA 1ZD2P 3E8MA 1QQ5A 2BDUA 3DDHA 3ZWDA 2YMPA 4DWOA 2B1RA 2FDRA 1AQ6A 1RMQA 2DQSA 2OYCA 4UMVA 2G08A 2I6XA 5ALYA 5AM1A 4YH1A 4NAVA 4UM7A 5AM0A 2HEGA 3EF1A 1QH9A 3A3YA 4NWIA 3ET4A 5AVWA 3L1VA 2RB5A 3ZUPA 1EK2A 2B1QA 4IG4A 1MH9A 2HI0A 3OTQA 4RESA 1L7PA 4J2TA 4CF3A 3WKBA 3B8EA 5AI6A 5AW4A 4OHFA 2AH5A 2HSZA 3NUQA 4Y2TA 4DFDA 2ODAA 3ZVLA 5AI0A 5AW8A 4ZEVA 5AVTA 1XP5A 1O08A 5AW5A 3KOOA 1Z5UA 3UMCA 1TJ5A 2BDEA 5AW2A 4IFTA 3HYCA 3NALA 1L7MA 3OCXA 1TE2A 1YV9A 2ZBGA 3U7FB 2G0AA 3UM9A 2HDOA 3AR3A 3QUBA 3R9KA 1EK1A 3EWIA 5ALUA 5AIBA 3R4CA 4YIKA 3EPRA 3L8FA 3OCZA 3NAMA 4XE5A 4J03A 4MWOA 2ZBEA 2IYEA 1NF2A 1Z4PX 1N9KA 2EARA 3W5CA 1U2SA 1YMQA 4L6CA 4UATA 2GHTA 2WM8A 2D2VA 1T5TA 3QUCA 2X4DA 1FEZA 5AVSA 4UMFA 2B8JA 5ALJA 3SLRA 3WKAA 5AK6A 1YJ5A 4BX0A 4KX3A 5ALTA 3UMBA 2YMMA 3MC1A 2JAOA 3SMVA 3WGVA 1O03A 2YJ4A 4NABA 4B6JA 1ZOLA 3A1CA 2AMYA 4Y2QA 4DCCA 4BNDB 2CFSA 3AR5A 5AI5A 2CFRA 4ZEWA 2ZG6A 1N8NA 2YBDA 3M1YA 4Y2YA 3QU5A 2B8EA 1ZRMA 3TLMA 2NO5A 1WVIA 1L7OA 3WGUA 3L0YA 3RF6A 1L6RA 3WK9A 4UU0A 3ZX4A 1YNSA 3L1UA 2B0CA 2ZBFA 2YFYA 3FVVA 1RRCA 2G09A 1U02A 3KBBA 1LTQA 1ZD4A 1WR8A 2PR7A 3N5KA 5AVQA 3U7HB 4C4SA 4G63A 2HF2A 3WK6A 1ZS9A 2FUCA 1L7NA 4UMDA 2AGVA 1S2OA 2GHQA 2C88A 1VJRA 3OCYA 5ALKA 5AKEA 5ALOA 2FUEA 3EF0A 5AESA 3S6JA 5AM2A 3W5BA 3AR8A 3QX7A 2OA0A 2I34A 1ZRNA 1T5SA 3IJ5A 1Z4JA 5ALDA 3A1DA 4Y2SA 3E81A 3FPSA 4YGYA 1L8LA 2OBBA 4BNDA 2I33A 3ED5A 4EEKA 2C8LA 4BX2A 4EX6A 2G1AA 5ALQA 1RLOA 3QUTA 3SKYA 2C9MA 3N28A 3P96A 4KN8A 5A3QA 3SF0A 4EELA 5ALVA 4FE3A 3I76A 2EAUA 3U26A 2VKQA 5ALZA 3I28A 4EX7A 3L8HA 5AKYA 4QQFA 2FI1A 5E0OA 2Q4RA 1RMTA 5AW6A 1TJ4A 1Z4IA 3WK7A 2O9JA 1YDFA 4KX5A 4FFDA 2FPSA 3L8GA 5ALRA 3KZXA 3ZX5A 4AP9A 3AR9A 5AW1A 1SWWA 4OFZA 3KD3A 3NANA 2NO4A 3UMGA 1F5SA 3WKCA 3M9LA 4NFLA 4YCMA 2EATA 4BX3A 3ONNA 3MN1A 2WF9A 4GIBA 4Y2UA 2YN4A 5IT4A 4EZEA 1Y8AA 3ZVMA 2C4NA 4O8CA 1T9ZA 4XPZA 3SD7A 3FPBA 2FPRA 4Y2JA 2P27A 5IT0A 5AK4A 2RAVA 2ZXEA 2JAWA 1K1EA 3QUQA 1RC8A 1J8DA 2FEAA 1QQ6A 3NIWA 4JB3A 3OPXA 1U7PA 5ALSA 4BEWA 5AI4A 1SU4A 3QU4A 3QNMA 1RLTA 4G9BA 3R09A 4NV0A 5AI9A 3OCUA 2B30A 2I54A 2YJ6A 4HGQA 2GMWA 5AVYA 2IA5A 3NRJA 5AVRA 2ZBDA 2RBKA 2YJ3A 5ALNA 3ZWKA 2JAUA 3L5KA 5A3RA 2BY4A 1Z5GA 3ZW7A 3W5AA 3PGLA 2QLTA 3ZI4A 3B9RA 3WK4A 5IS2A 2W4MA 1Z4QA 2OM6A 4HYTA 2RARA 1X42A 2I7DA 5ALGA 1VJ5A 2IOHA 3AR7A 2YY6A 3PCTA 4OCZA 4KYTA 3B9BA 5AK3A 3AR4A 3PGVA 4Y2VA 1QYIA 5AKLA 5AKZA 4YIHA 4C4TA 2G07A 2C8KA 4CF4A 3DV9A 4BBJA 5JJBA 3ESQA 5AM5A 1RKVA 3K1ZA 2FPUA 4UW9A 4UASA 4L57A 4XOUA 5AKJA 3A1EA 4HGOA 5AVXA 5AVVA 5ALIA 1TJ3A 5AKXA 3ZU6A 1Q91A 5ALFA 3ET5A 2YMQA 2G06A 3N8GA 2ZOSA 3MMZA 2JGAA 1Z4KA 3D6JA 1CQZA 1NRWA 2NYVA 2R8XA 5AVZA 3L0CA 4MUMA 5AI8A 1ZD5A 4UAVA 4UMEA 1RKQA 1U7OA 4HGPA 4QJBA 5AKIA 5A3SA 1Z4OA 3KDPA 1QQ7A 2IOFK 3AR6A 5AKHA
chains in the Genus database with same CATH superfamily
3TB4A 1A9XB 1GGVA 2ZSJA 2QMHA 4KVFA 2I03A 3RJZA 4Z53A 2JJ2D 2AF4C 2HLDD 2FVXA 2GO7A 4M83A 1CUWA 2ECQA 2YOHA 1W87A 2HWXA 4JUIA 4XCXA 3OLVA 4CKZA 4KNWA 3I04A 3OE5A 1V9CA 2AA3A 4B7ZA 2RGDA 5IC6A 4JYPA 4YRAA 3AR2A 2G1PA 1AB6A 5JXIA 4D02A 2VJNA 1EQAA 2XAAA 2ZUCA 1S3IA 5KVVA 2JFGA 2GZMA 4R9VA 4TTIA 2J4CA 3K6RA 1IM8A 4CN8A 4BUZA 5KNCH 3LOUA 3GJ4A 2Q3EA 4HF7A 3UAXA 1M10A 4OD0A 3QE4A 4FVTA 3DEAA 2BHRA 4K5QA 3ZQ4A 1WMDA 1R8YA 3OLWA 4RCZA 1JUDA 4IQ0A 1RMYA 3UAYA 4AJIA 3DLBA 3TTYA 3M4JA 5A0TA 2PUAA 3PXAA 4UM5A 4YDRA 1VRWA 3KR9A 5HE9A 5IYZF 2ZIWB 2L2QA 1V5WA 1TGYA 2R6FA 4JT8A 2EWVA 3LKVA 1QH1A 3IB6A 2VSOA 4F2WA 5FIUA 1CETA 4RL4A 1M83A 3MSCA 2ZP1A 1W35A 4B0OA 2JLWA 4CF5A 2CY0A 3BJEA 2D2EA 4J9VA 1BCSB 2HAEA 1SKAA 2BJVA 4EGFA 1SZJG 3G5LA 4KQFA 2ZUEA 1SG0A 2QTBA 3PC8A 1Z0UA 4CQNA 1OC4A 2HSJA 4L3VA 4M37A 1S3FA 1ESZA 3F5MA 4LXHA 2GUWA 4FFOA 2P1RA 5DBEX 4ZIRB 2ZBPA 1Z13A 3H1FA 4MA5A 4DXHA 2GD2A 1I14A 3TW8A 5AOBA 1R3UA 2C54A 2Y9PB 1LQTA 1FPMA 2GD1O 2P11A 1BROA 2IHYA 1D1TA 2IUSA 2Z43A 4P7KA 2WSMA 3QWIA 2B6NA 4L76A 3K32A 3UOAB 1UXIA 3QPCA 3QQ5A 2ZTVA 2EQAA 3A6DA 4FB4A 1TVCA 2ZDGA 2ZRLA 3QA9A 4WNAB 4D96A 4TMTA 1O0BA 2ZS7A 1J2RA 3LI2A 2BDTA 5CLGA 4PAQA 1G3RA 5JD4A 1GUZA 1R12A 5CVUA 1RCTE 5FULA 2BKXA 2JI9A 3BE4A 5EXSA 4C1NA 3L8EA 2HMWA 1IOLA 2C9CA 3L1IA 4BGDA 3O9VA 2I4MA 4MIEA 5JSQA 4IIEA 4JP8A 2OG1A 1JWBB 3L7JA 4X8HA 1BFDA 3FDZA 1K6IA 3M81A 3WRVA 1GFZA 5I01A 5JD5A 4LJ8A 1H8EA 2R6HA 1XJCA 2ZRHA 1OWPA 4JMLA 2JNWA 2EDCA 3O2SB 4B6FA 1BKYA 1RQNA 5JWRA 4FLMA 1G59A 2G3YA 5CG2A 2X7HA 5K0NA 4DW8A 5E3JA 5GPBA 3SIXA 2HCTA 3W0LB 2DBZA 4N6OA 2UYHA 1A9YA 1X86B 5TF0A 3T3MB 2OHHA 5BR1A 1QH1B 5LWHA 3DBIA 4E12A 4XYEA 2R2AA 4OJNA 3B36A 1AK9A 1P39A 1SCIA 2OECA 4I6EA 3KOMA 4TLEA 1F1JA 3RRXA 4BN4A 3FCXA 1MJ5A 4YR9A 1D7OA 2XQFA 1NF8A 2IC5A 1QZZA 5JECA 2O2JA 3W3ZB 4HJXA 2FHPA 3IUNA 1FNBA 2WDPA 3OVMA 4N49A 3MJRA 2OO3A 4MQLA 1CB0A 1Y9AA 3H3JA 4JJ7A 1PJ2A 3S5JA 1PNRA 1WCYA 4C4RA 3S2GA 3WZMA 3DFZA 5C4GB 1NU6A 3Q5DA 3QVUA 2XWSA 5ICFA 3TW8B 5TNXA 4ZHQA 1TVEA 3HLTA 3PCRB 2XCOA 2R1UA 4R84A 2R86A 1KYTA 3D0OA 3EB9A 3JWJA 3O38A 1LSUA 1VKHA 3LL4A 3EEQA 1G5QA 4XQEA 2I2CA 4P7BA 3VKGA 1EX7A 2XA9A 4QU5A 2X5XA 3AT1A 5AUOB 3V2HA 5GADl 1RWMA 1ZZEA 2DQSA 1Y7TA 2DTEA 4GP7A 3C6KA 3EGCA 4IDEA 4RCVA 4Z1MA 4LNAA 4ER7A 4RTPA 1NM5A 3SQNA 2C98A 2LXNA 1ORHA 3OIUA 4GM0A 1K66A 1PJQA 1LJUA 3QVTA 4RO0A 1PZGA 2WVAA 1NI4B 1PVDA 4FMCF 4NU0A 5FWDA 5KVQA 3WJAA 2C2YA 5FPSA 4M1EA 4GI3A 2GRAA 1SKBA 4Q12A 3LBHA 3ZXIA 4B4OA 3PIDA 2QL9A 4BMCA 1ZXLA 4CFZA 1HKHA 1QONA 3DVAA 4HQLA 4JU9A 4E2YA 3GP3A 5SV2A 3HCBA 4NWIA 3OPNA 1AUXA 3ZY3A 4R9NA 4MHTA 3D31A 2JHGA 2W00A 4UHJA 2EV9A 5IAOA 2HXYA 4I36A 2R6AA 4XVHA 4JJ8A 3MK31 3OTQA 3O26A 2P9ZA 4G8JA 1B8OA 3FDZB 3BG5A 3MZ0A 5DBHX 4EUSA 1YS4A 2GBFA 3OSUA 5A9TA 1ACLA 2BM1A 4OHFA 4Q9LA 2O0HA 4TWRA 4D0NA 3FPGA 1GA6A 1IVYA 5K9ZA 1JQBA 3EEYA 3DULA 1F2UB 3EY9A 2XB4A 3TH5A 2CFCA 5FWXA 5BWMA 3A2KA 4JL6A 3MCTA 4OHUA 3DB2A 1O08A 3EGXA 2NMVA 5FHQA 1SN7A 2P2SA 1NTRA 3HKCA 1XTRA 1W88A 1QGUA 4QEZA 4G56A 1K63A 2OZVA 5DHPA 1Z33A 1TE2A 3ZCSA 1U1EA 1QPBA 4FKBA 4DC0A 1W36C 3D7RA 4CZ2A 1ZUHA 2XXAB 1JAYA 4HBGA 2WI8A 3SZOA 1GRRA 3ZY6A 2NP7A 1VGQA 2C1EA 3ETHA 3JWIA 3R9KA 5I51A 3RAFC 1EK1A 1Q6ZA 4WCFC 5ALUA 3T5TA 1K27A 3OEEA 5E6RA 4RTSA 1HE1C 4QGSA 1AGYA 4B47A 3EPPA 2XNDD 1N78A 1Y4SA 2JHPA 4IFEA 3PHBE 2QN9A 4HFMA 4C3VA 3GW8A 3CLSC 3FSRA 2EARA 2JCXA 4QL3A 2WY2D 2XRZA 3ZS9A 4CL0A 2BV3A 2C9ZA 4RJJA 5L7WA 3BXXA 3ETEA 3LK7A 2D2VA 4UFNA 3MS7A 4AY3A 4NXMB 3A6JA 2H3HA 1QVRA 5ALJA 4LXIA 3T3IA 4EHDA 3W5HA 5BORA 4PPFA 5AJUA 3EEFA 4QBTA 5DP1A 2WWWA 1OXVA 1RAAA 3B5EA 4QARA 5KX5F 4BJ6A 2RHGB 2FXIA 3K5PA 4UNNA 4V38A 4LC9A 1E92A 3RUCA 2QTTA 3DVAB 2FR8A 1TUIA 2ZUVA 2O3TA 1QUEA 4XFJA 4EMSA 3I45A 2D5CA 4MQMA 5HR5A 4NECA 1VIAA 4WN9A 2NGRA 1CERA 1RWXA 6REQB 1TKBA 3WE7A 3PU6A 4TLCA 1O6GA 5FOUA 4PS1A 1O3YA 2IYYA 1Q22A 4YAGA 1L5YA 4JQOA 2O50A 4X95A 1X7HA 4DWVA 1ZD1A 1Z63A 5SZJA 4IXTA 3QBJA 2FN9A 3G85A 4QGGA 3DW3X 2DP4E 3DTTA 1Y3FE 4J0JA 1HXHA 1PL0A 1Y63A 5CYOA 1WP9A 3RF6A 5J5VA 1F8GA 3IT2A 3N0RA 3MS2A 4MV7A 3HKCB 4U9UA 4Y6RA 1EFTA 2AXQA 2ZULA 1W88B 1QGUB 4FMPA 3WGQA 3WIDA 1WP4A 1XZHA 1JH9A 1RPJA 2ZPUA 1LTQA 3VYTB 3E9YA 4ZGGA 4HS4A 2UZIR 3BD9A 1BE1A 5LN1A 2CJPA 5LBTA 3IALA 2P7HA 4J94A 4PEVA 5E6RB 2B92A 3BQ9A 3ZU3A 1T1EA 5CT4A 4G1MB 1D6NA 2IVZA 4ZI7A 1Q11A 4H7JA 4OV6B 3GLIE 2P0EA 4C7OB 2Q9AA 4L5JA 4Z1OA 5LLSA 1I13A 3H5TA 3UVEA 3EEIA 2IEYA 1GNTA 3CX4A 1CP2A 2G7MC 1VCHA 3P52A 4DLBA 4H1TA 4MQEA 5AUQA 5GV7A 4KQJA 2J85A 3TZHA 3VZRA 4NAUA 5B12A 3VR3A 3I34X 3AJEA 1A5ZA 4IVRA 2D2IA 2ZYWX 5KWSA 2RSLA 1FFDA 2A0FA 4S35A 1AXRA 4GSLA 4L8FA 1DHTA 3M5DA 3SVZA 3SR4A 4LMRA 2BCGY 4BJ5A 1EXDA 3FMVA 3EQ9A 1JHPA 1TO6A 2F64A 4L8LA 2VJYA 2PZKA 5KSPA 4AYTA 5CEJA 3V7YA 3FTCA 3CHYA 2GPYA 1E6MA 3Q7QA 3QP9A 3RAJA 1EXMA 4OLAA 1SK9A 3HBLA 4RY9A 5EJ8A 2JHFA 4WBNF 3N59A 2BGRA 3QVOA 4PAMA 4EVSA 5EXPA 1ZR4A 4I55A 1IBKB 4F21A 1K68A 1YE3A 3DMHA 3CJQA 3SJCA 1PBTA 3SKYA 1ST3A 2C9MA 3H4VA 3P96A 5GWXA 4YYZA 1H8HA 1OLSB 3NPAA 4DDTA 5IXJA 3FJ1A 2I4RA 1YBVA 2H85A 4LAFA 4PCLA 2GZDA 4UEOA 3U7JA 5ITZA 3NG1A 2PRSA 1U1GA 5DK4A 3WWEA 2IYZA 4NNPA 5B7GA 1NULA 1T4GA 2WG1A 4CUKA 3FOZA 5AO9A 2O4CA 3U3KA 3ZU2A 1KDVA 1FFYA 5BRNA 2GRJA 3O9ZA 4G37A 4I1SA 3X2SA 4BCDA 4D3DA 5ED4A 4BLVA 4IIJF 5EOVA 3ZE9A 3IPRA 1KZHA 1OBHA 3L1JA 3H2IA 2HQRA 3NTXA 3RK0A 3BK1A 3W6UA 3ABQB 3PQEA 3GFPA 4ZTBA 1AXEA 1FJ2A 4YFVA 2CVOA 1Y42X 5T6MA 5HUJA 3NP7A 3QY0A 1BKDR 3PXUA 1XA3A 4S0ZA 3TAXA 5FTWA 3J80A 1GZVA 1XYVA 4IJWA 4FXOA 4YRTA 2IW3A 4JCCA 4YRLA 2C61A 1M54A 3PPWA 4ZI7B 3FKJA 4R0MA 3CINA 1FTWA 2WYVA 1ADGA 2WHPB 3KYJB 2N47A 4QSHA 2Q5HA 2GBIA 2P6NA 1JL3A 1D2EA 4PZYA 2VOEA 1PGNA 1QPGA 2GBPA 3KSZO 2Y1WA 5P8WA 2X0FA 5DSZA 3ROGA 2DFKB 3ICWA 3BF8A 3WWPA 3WRXA 4J0IA 4KIFA 4PQRA 1UBRS 4QBHA 1Z6ZA 3FDJA 4HV4A 1KO5A 3JVEA 4NNOA 4Y2UA 3HLKA 3GD7A 1DDIA 4JJIA 1TCVA 4OLHA 1GRQA 3O4RA 4F6CA 5LM3A 1SXGA 4EA6A 3ADBA 1F6DA 5A9SA 4RABA 1H5NA 3CH5A 4KE7A 4O8CA 2LDBA 4TVOA 3G2HA 3ZE1B 4EY6A 4YUYA 3FCUB 3JQ9A 1NONA 2W22A 1PWZA 3QEOA 5TQVA 1QO7A 2X7JA 3AFNA 1MAWA 1VPVA 4PZUA 3SHWA 3VKFA 1QJ4A 1A1VA 1U9IC 1UMKA 1R8QA 2LCQA 2BJWA 2Y2UA 3PRKE 3WB2A 1KBOA 1QQ6A 2ZIEA 3H19A 4A5SA 1U0EA 3QU4A 1YA8A 2QWXA 5BT8A 1YI1A 4I55B 1V25A 4QEDA 1VPTA 2HZ7A 2PUVA 1NMXA 2FPMA 1D9XA 2QMQA 3CS3A 1LI4A 4AY5A 4ZT3A 1O54A 2UZ1A 4J43A 4LDAA 3D59A 2RBKA 4IGEA 3ZU4A 4R98A 1KJZA 2BHTA 2C5LA 5E8RA 3STVA 4C6RA 3B12A 1ENPA 3BRQA 3DAGA 1LX7A 4EW6A 4L8YA 3IKLA 3AEXA 3BREA 4JEHA 1T4MA 4YI5A 3GCZA 4URHA 3VHXA 3W5SA 3C3PA 3HNRA 2HK7A 4B1FA 2G70A 2WIJA 3O1LA 3R3HA 1XZPA 2B2XA 1H65A 2FWPA 2JK1A 5DEIA 5KYXA 2J0QA 5EZSA 1WETA 1DEAA 4MCIA 1UPCA 4ITRC 2ADOA 3AG5A 4E08A 4QPJC 5AK3A 2XYRA 2VYNA 5H4HA 4G09A 2WMNB 3ICCA 1DBPA 4DPMA 1U5AA 3NP9A 1F0NA 1OMOA 3C43A 3FNGA 2PMEA 5KOIA 1YS6A 4V3BA 1GPAA 3FKQA 5HJ5A 5CD1A 3VNQA 3HCCA 1QDLB 2VO1A 3FLMA 3AIMA 2CNOA 1E6KA 3LECA 4YTEA 3SS7X 1E5QA 3R7BA 3WISA 2R00A 2Z3VA 3FMIA 3EISA 5FBQB 2X1HA 1H42A 4HX2A 5G4LA 4HRYA 2JC3A 5GP1A 3RVLA 2PRIA 5J59A 3LKDA 1MNQA 4IGAA 1CHNA 4DLNA 1CNFA 4J16C 4IWYA 1ZK2A 2P2GA 3D8BA 1PQYA 2Q27A 2UYQA 3CCFA 4E6EA 4G0VA 1UFOA 5L6MB 4Q19A 4MWTA 2ZWVA 1F51E 1V3VA 4YPOA 2DFPA 2X0KA 2WYWA 1KE1A 4HADA 3FHTA 3AUYA 4L51A 1H6AA 2QV7A 4GGOA 2LCIA 1DKOA 3MCWA 4PFSA 4RPCA 3ZWOA 3I5YA 1LXCA 2QTGA 1U5CA 5JCJA 3ILVA 3S7TA 4BGUA 1JA1A 4XPIA 3SHFA 1UBOS 1O94D 5DYIA 3T1QA 5JRDS 2OG2A 1E7WA 2P6PA 2BFBA 2BZSA 3MXOA 3WHPA 4J3NA 4MEBA 4NK4A 3ZD8A 6ADHA 4GECA 3ZE6A 4DUGA 3U6BA 4LUCA 4ZA2A 1L7BA 3V7FA 3RYCB 3L9XA 4A0HA 1QUFA 2VWPA 2UZ0A 2PCJA 5ER9A 3IBFA 5KSOA 2F6RA 2J09A 2JCYA 2Y1EA 4KFUA 4Q3DA 3UT5A 3NFRA 1SIOA 1WUKS 1Q7BA 3F2VA 4MXDA 3L7KA 2BFDA 1URPA 4RAOA 3F1KA 3IQXA 2FPKA 1KP9A 2VJCA 4UUBA 5HJEA 3Q7EA 2AOWA 2FDXA 3CO5A 3KCNA 3MRTA 1G0NA 3SBOA 1FXUA 3F6PA 4DDWA 4B6GA 1G6OA 5KNCA 3A36A 3W6ZA 4D4GA 1XTUA 3G0BA 3LM8A 2SHKA 4Q1AA 4BTVA 1OFTA 4ZDJA 5KYXB 1N1DA 3SXJA 4GHWA 1OT3A 3SYMA 4ZJUA 1EYZA 2M2IA 3T7SA 2HNAA 1L4LA 4H9GA 5CAEB 1QO0D 3M2TA 1I7SB 1Q1BA 3BT7A 1VYVA 2OC4A 3I62A 2J6HA 4HP8A 3V7WA 5D1HA 2Q5EA 1XLVA 3KP1A 4UAUA 4YWJA 2REOA 3QEJA 1NVUQ 1MJFA 1OAOA 4A9AA 4DLTA 1UK6A 4ZI5A 5AJXA 4OH7A 2AB0A 1EWTA 4AB1A 3FTEA 1J20A 4P4UA 1UBUS 2OD7A 4KBFA 3RB8A 4EBFA 4TTTS 4HAUA 4OPMA 2GXAA 1YMVA 1IN8A 2X5KO 3PE6A 4Z4EA 1PD1A 1JTVA 3RR2A 5C1PA 2QX7A 5JFTA 2VL7A 1KOFA 3GCWA 4I9UA 5BMOA 2W43A 3EXG2 3UMSA 5TEVA 1ZVKA 3ZXSA 2H16A 2C4KA 2GD0A 3DEKA 3I6BA 3L0BA 1W85A 2M9MA 3P9NA 4U2CA 5HM6A 3WI7A 5K8VA 1M1NA 3D1VA 1MEJA 1V6CA 1T2NA 1BA2A 1R0ZA 1VI6A 2ST1A 4ZT5A 1E4YA 2WF6A 3ZDAA 2PJDA 3F71A 2BFBB 2E55A 4FDLA 4L9WA 1DJPA 1KZ6A 4G84A 4PTYA 1ADBA 4RD4A 1H5QA 4ME6A 1V43A 1PNVA 2ZYSA 4AICA 4BN0A 2HX1A 2YVQA 1LWNA 3N8KA 2FU5C 4M86A 1AJEA 3CZPA 2VA9A 2VXBA 3UT5B 4F4IA 1RZRA 3DOIA 1Z7YA 3ES9A 3I9V6 1TA0A 3ZY2A 1Q1ZA 1KBZA 3LCVB 3KJQA 4O29A 4B45A 5DN6D 1ZINA 3HQ4O 1RYYA 1E77A 2ZBUA 1ND5A 4YCLA 5EN4A 4GF5A 1TYCA 1J07A 1AB5A 1Z25A 4GI1A 4OQPA 4LX0A 1DWOA 3VAAA 3KPVA 1XTKA 2GI4A 5JAMA 2ZI5A 1PR0A 3T41A 3OQOA 2HMYB 3IIEA 1U5BB 3D8SA 5E6SA 4MX8A 1I2DA 1NNI1 2HTEA 4HGYA 4ARUA 2O2GA 3X1JA 4GMFA 1UJMA 1XU9A 2KSQA 2R5NA 4QRDA 1ZU5A 4MH0R 1VE7A 4JV5B 3OC0A 3B6ZA 3SDBA 3R5HA 1AOXA 1DSSG 1T6YA 4OKSA 2HHCA 2XLBA 4TMKA 1C7IA 3CEHA 3OZTA 2O6HA 4I9GA 4H2DA 1LPPA 5JQWA 2NAFA 4ER5A 2V8OA 1Y4UA 2HGSA 3T0GA 4EEZA 4WBXC 1ZN9A 2VZ0A 3OOHA 3ABRB 3HLYA 3LLMA 2ONZA 4M1SA 1II8B 5CDFA 4LN1A 4R2MA 5ALPA 2P1DA 2R44A 5FTLA 3SR0A 3ICVA 1RZVA 3WB0A 1M2GA 1IUOA 1BEEA 1DG1G 4F5ZA 2A3NA 2P90A 1OILA 1EFPA 1Y5LA 2YZGA 3V1YA 3I12A 2MSCB 4QNRA 3EW9A 4TROA 5AQEA 3PQ2A 3SX0A 4BX9A 2EXXA 1VE5A 5EJEA 3RAPR 1JSLA 1ULSA 2QAGB 5BUZA 1VE3A 2VF8A 2H1OA 2BUCA 4IKEA 3UQZA 1YQGA 3DDOA 3FGOA 2ODPA 4UFOA 4P38A 2FPWA 4RZUA 4DR4B 1IZ7A 3OI7A 1QMGA 4MKGA 4EH1A 4EYEA 4TUYF 4QSMA 4EG0A 4F0JA 3CB2A 4K9QA 4QNNA 2A94A 1BGWA 3NDJA 4X93A 4QG7A 4B3DA 3UXYA 3D8HA 3HCOA 1TYEB 2QUBA 4QDXA 1B1AA 2CWWA 4WNIA 4C03A 5CVDA 1O8BA 1THGA 1Z3CA 1EVIA 4M21A 4C6HA 5JLAA 4HSGA 3RFVA 5B36A 3UJ6A 3S70A 3ENZA 3CF6R 1TF7A 2YXLA 3IEPA 3LWZA 4NL4H 4ZMBA 3QSGA 4JP2A 3B7GA 4V39A 1QH9A 1IG3A 1LVUA 1LI7A 1ZCAA 5HQTA 4YQZA 4NOLA 1S6YA 3NHZA 3C4VA 1PVVA 3GQBA 5AVWA 2F1RA 3O3OB 4OM7A 4NE7A 5KDLA 2CHQA 2JGNA 4WXPA 1Q84A 4FR5A 1WX1A 1T5DX 1U2ZA 5TPWB 4J6EA 2R84A 1ONBA 5ENZA 3IERA 2VUTA 4M87A 1RYDA 4JYAB 4URVR 3C98A 4KYUA 3FYDA 3A11A 3R76A 4OO3A 4RFLA 3C3AA 5IJZA 1EJ0A 3VR5H 5AI0A 1R5OA 5AVTA 3ROFA 3I04M 3MAJA 3RUHA 1P2VA 5CXQA 2PYIA 2BH9A 4URUR 1VPWA 3HU2A 1MOPA 2BDEA 2QIOA 3BSSA 3ZYCA 1K4YA 4QXQA 1EFPB 2C5BA 1C2TA 1GSAA 1J4AA 2VHWA 4DJJA 4TVSA 3WQBA 2QGNA 2FFHA 4WJKB 5AHOA 1N8TA 2X4LA 3F7TA 3PXXA 1ZM2A 3B3FA 4GZMA 3FBGA 2Y05A 5KWIA 4HEQA 5FB3A 2RG1A 3VXKA 1RACA 3JQ9C 3PFWO 2Z5VA 1A95A 4PLTA 1RXUA 4L0DA 1GG2A 4FOSA 2WWRA 2IEZA 3BAFA 2P68A 1PFKA 4H1VA 2VUSA 3JQPA 3TPFA 4IQGA 3EZ6A 4E0BA 1II9A 1JR3E 1AK2A 1UKCA 2FNAA 3RC9A 2JRCA 2HU5A 4QYMA 3HVHA 1YMQA 5CM9C 3I2JA 2ATIA 3PDIA 1AK1A 1ZKDA 2BUAA 4QFCA 4OI1A 3EAFA 2YNMA 4DZZA 3HB1A 1KQPA 1EDBA 1Y5IA 2HC9A 1P0FA 2GVDC 5DXAA 3B51X 4BX0A 4ZVQA 1GUAA 3LBIA 4BFXA 4X8LA 3VKWA 3AKEA 4LBYA 2D1YA 3WBFA 3EGOA 3N3AC 2JAOA 1UJ6A 2J4DA 2TYSB 3DZ8A 4B6JA 1N33B 2FZKA 3AHDA 2IDKA 4GP9A 4H1UA 5DFAA 5JJIA 4DCCA 4BNDB 1A8QA 2A5JA 3FHJA 3GQBB 3OTWA 1FW8A 4Y6GB 2P0AA 3RC3A 4ZEWA 2GEJA 3V8EA 3GIWA 1IDOA 4P3NA 4I0WB 1EGAA 3D6NB 1TB4A 4DLVA 4KQ9A 3QU5A 1I4EB 4BU0A 2OQ2A 2NV6A 2QN2A 3RK4A 3T12A 4EPYA 1A7JA 2E49A 3H13A 3KXLA 5JS7A 1GGKA 4FYJA 3IA7A 1EDOA 4RXMA 4XUCA 2IYWA 1C3XA 1X38A 4NC9A 2BGLA 1ISHA 4R2HA 3BXEA 3CCBA 1BH6A 2LKDA 3MGKA 5J4HA 4R4JA 3GT0A 2O8DA 4HLNA 3G82C 4B4KA 3G0OA 3QE9Y 4QWMA 4DPKA 1XDDA 5JWOA 1ESCA 4URFA 4RTNA 2FJ0A 3GZTB 1Z36A 4MS4A 1AV7A 3THOA 4PYOA 5D87A 4D4IA 4ENWA 4YONB 1NGSA 3TG8A 3EFBA 3F6YA 5JJ5A 4W9RA 4UUMA 1Z0SA 4EFNA 4EYKA 2JJYA 4EJFA 4HYEA 4NS1A 4I3GA 2C1ZA 3N5KA 1U9JA 2ZJ2A 4FBGA 4KLCA 1YJ8A 1SO8A 3RKSA 2ACWA 4PAWA 4PRKA 3C4JA 3GRPA 3HU5A 4TTJA 1WKCA 2CBGA 2AE1A 2VXYA 3FFAA 1OT5A 1HRDA 3PQ3A 4YBZA 1M2JA 1O7JA 3H8JA 2Q28A 1NP6A 2G1KA 1JDPA 2IZ1A 5ALOA 4TXHA 3PIIA 2IX9A 3DOFA 4BNUA 2WAXA 4NQRA 5L4LA 3EZNA 5LP1A 1ULZA 3PDIB 3TLXA 1DUSA 3ZE0B 1HNWB 5LIPA 4EG8A 4D92A 5A3JA 1T3TA 3GGGA 2GCGA 3C0KA 3H8VA 4ZAWA 3ZS8A 3ORFA 4QJIA 2AW5A 4ZVVA 4UBMA 1W7AA 4CDNA 5L53A 3I30X 1QXSA 3KT3A 3KV3O 3R0XA 1YR7A 2ZWOA 5U9CA 5ADVA 1MIHA 1RSZA 2FOIA 3A6EA 3FPSA 4MW9A 4R8VA 3TPCA 3TR0A 5J4YA 1Z2DA 2E85A 2W83A 2YVUA 3K35A 3LVFO 5D8DA 2E5FA 3BWCA 4INJA 4JKYA 5JXGA 1K4MA 2AFVA 3QVVA 1Y33E 4KI0A 4MI6A 1AZTA 1NFQA 1NJGA 4KAJA 4JEIA 4TSFD 4BWGA 3P9CA 2C8LA 1JAIA 4TLAA 4EQ6A 1UJCA 3HJRA 1VLQA 5CHEA 2O8CB 1F2TA 3BORA 2I1VB 1KI2A 4GC5A 2H57A 3IDOA 3QUTA 4HXFB 4WVLA 5EZYB 3N28A 2JGEA 2GPJA 4KN8A 2QF7A 4EMUA 1IFXA 2ZJ6A 1KQOA 4EELA 4EG4A 3PG5A 5KTYA 1IQ0A 1LSJA 1P62B 2B5OA 1OAOC 1SBQA 2GXQA 2YJZA 3IJEB 4B6QA 4KE6A 2VPIA 2VKQA 1GZDA 2G1UA 3ZHVA 1L7XA 2BP7A 5TT1A 3HO8A 5DIFA 3A1SA 3SZMA 5CUQA 3FUCA 3S2EA 3DOCA 1M9NA 5FV4A 2FQWA 3AEQA 2EF1A 3K6JA 4Q4JA 3TK1A 2JH9A 2K5UA 4ILEA 2BW0A 2Q3BA 4Q1DA 5EHIA 1TQ8A 2XE4A 4FUTA 1VBNA 1Z4IA 3DL4A 1UINA 4KUEA 2ZUFA 3B6JA 3EXEA 1GSHA 3CRNA 2MWMA 4CV1A 1YQEA 3OQ6A 4PGFA 4TTSA 5DTEA 1L5LA 4P3OA 3SSAA 2HQSA 3DMTA 3WL4A 1GLGA 5JBQA 3MLBA 1TJPB 4BBZA 4Q4DA 3A1UA 2Q1YA 4BGEA 5AQ1A 1E9BA 4JI6B 2RGUA 4RYLA 1E2KA 2DQYA 1VYHA 2XWJI 3LIPA 5E3IA 4EJSC 4XR9A 4CV0A 3IESA 4X8OA 3E15A 1T1GA 4HZUA 3H2GA 1YZHA 4CCSA 2IYXA 2XKAA 4MYRA 4RJKA 3MN1A 3CSSA 1RWOA 1UP6A 4PONA 4U7FA 2FWRA 4YHHB 1UMBA 1Q1QA 3Q11A 4DG5A 3L6RA 3QENA 1KNXA 2N42A 4X3PA 1DEHA 1EFDN 2DLDA 3G8DA 4ZZ3A 1MG5A 4XPZA 1GGJA 4MDEA 4CLXA 1YS1X 2YIMA 2REXB 2FZLA 3UY4A 5EIEA 4PR3A 2FRXA 1BN7A 2J41A 2PX2A 4TYPA 5EI5A 4R8SA 3O8OA 2IH4A 5K2OA 2ORED 1CY0A 3V48A 1XC7A 5KVSA 3PHJA 5HX7A 1WW2A 4MTLA 3G5MA 4OQYA 4EPRA 4CM8A 2VP2A 4R1TA 3MWGA 3I4FA 3N2YA 4EA7A 4DB2A 5I8WA 4EQ6B 1D4AA 1F14A 4CG0A 3HWSA 1Z5OA 1F2TB 2A57A 3MB8A 1LCIA 3OJEA 5BYBA 4LBVA 3UK7A 2G82A 2HRQA 4S24A 4JLBA 4HGQA 1MO5A 1XTJA 2Z2JA 4QYWA 3C70A 3NRJA 4FU0A 1T1IA 4BMVA 1WB5A 2BL4A 4LJYA 1PFWA 4POAA 4KK3A 4ZEOA 5ERYA 3D6TB 2FF7A 3AHJA 1X1RA 2BP7B 3UMFA 5DM60 4L4UA 4YPVA 2FFQA 4HL6A 3W5AA 2CMKA 1HT2E 3BEOA 4MB6A 3WTCA 5I7FA 3AEQB 3STWA 1ZD8A 4WK6A 4H0FA 1KVSA 2PLFA 2WYOA 4ZYTA 3PZRA 4PINA 5JJCA 1GTVA 3EXEB 2VNAA 4OCZA 5D3KA 5DHUA 4TM7A 1ARZA 5BYJA 2PU5A 2H1LA 3PEEA 4AJOA 3AR4A 2VT2A 3KAQA 3CZQA 4ZCTA 1TFRA 3FWZA 2RKWA 3OF3A 4MGZR 4XWTA 4K8OA 1MB0A 1T1SA 4BPRA 4HTAA 2O7VA 4MQUA 5IMBA 3TNJA 1RXIA 3SXPA 2JFNA 1IQPA 1FE8A 4S2EA 5EWLA 5KYYA 2WWHA 1NXSA 1XZCA 4NI5A 3C7KA 4JOCA 3UO8B 3E5NA 2FPUA 3ACCA 4RELA 5HTKA 4L57A 4XDYA 5JNWA 4HZUB 1JEYA 1DGQA 2F3SA 4N3BA 4PU0A 2FZEA 1EB9A 3AHHA 3GGSA 1RVDA 3WGMA 4GWLA 3H75A 1XTQA 4HGOA 1SH7A 1V1RB 3IUSA 2YV3A 3FUVA 4IZHA 1UMBB 4BVBA 5AVVA 5JH7B 3KELA 3DC7A 1RWPA 4RDHA 4NMMA 5BMVA 1HDEA 3BOSA 7YASA 1IN5A 2OM2A 3OY7A 4TYNA 2EKLA 4LDQA 3TL2A 1SA0B 3P2KA 4N6NA 4F2DA 3R24A 3Q72A 2JIRA 3O8OB 3PC2A 3A9RA 1GGFA 4DV6B 2DPMA 2HHAA 1EK0A 4R83A 4Q9IA 4MI1A 5F3WB 7ABPA 2WWGA 2BGNA 1DV1A 2WU3A 1SZCA 1IH8A 1TADA 1Y34E 1ZWKA 3G8AA 4UMEA 4CM8B 5HKBA 3H8WA 2GJ8A 2HHHB 1LTHR 1I6WA 3FHLA 3CRZA 1V7QA 1EBFA 1T4DA 3DOEA 3K0BA 3U4GA 1ISMA 1WXFA 2V7GA 3CLRD 1FTQA 3LDAA 3KDPA 4W9NA 3H1GA 4JT9A 1P7WA 1DAPA 1RTTA 2REQA 3RYFA 4MKHA 5NULA 4BFTA 4JBGA 1X6VA 4KMRA 4WI1A 1JBEA 4I1IA 4PXAA 5TLSA 4N7BA 2Y8EA 2A9KA 4PG6A 1QS0B 1QG0A 3REQA 2CL5A 2UVPA 1F8FA 2OB1A 1E2LA 2ZUSA 3HCFA 3PCXA 3OZ7A 1NBHA 1XZGA 1EZZA 3PF9A 3Q40A 1LU9A 1TQDA 4EMTA 3WK8A 3LQQA 4FYPA 1DWQA 1BX3A 3IIJA 2RFLA 1W4AA 2D0IA 1EFUA 3GLUA 4BE4A 1G2IA 4II3A 1SEVA 2EG5A 4IJUA 4RGYA 4ZT4A 4ZXPA 4BO2A 1XL0A 1XJQA 2IE8A 1T5HX 3OETA 5K2MA 1U0SY 1E96A 1G3UA 1ADFA 1G7SA 1W5TA 4M1OA 5EJGA 3L40A 4REQA 3VH2A 2E9SA 3IT3A 4TX1A 1SRQA 1CUBA 2A0KA 1PLLA 3L3BA 4E1BA 3LY7A 3REFA 4PGAA 4X54A 1WMFA 2X58A 1LUAA 1T9AA 1UBFA 3MILA 5EWLB 3OPYI 3BXZA 5KYYB 1GARA 1Z7BA 2VYFA 2WV9A 5B53A 3T1YB 3OQVA 1RXSA 1UQUA 4ESEA 1QCDA 2I6GA 2PIAA 5ARDA 2W6ZA 3KJHA 2YNMC 4JJKA 4OQEA 1U7HA 1X1SA 2QD5A 4ZOLF 1NUUA 4MMXB 5BMVB 3A06A 5K3AA 4HAVA 1MIOA 3KKQA 1P7PA 1T35A 3WYEA 1XAGA 3CUYA 5GZ1A 1OXBB 4X90A 4JOSA 3TZLA 3N05A 2AXEA 2DKFA 2JCGA 3Q9UA 4HQ0A 4X84A 1Y4AE 2B4TO 1CIVA 1T3GA 1I01A 1RHKA 2R3SA 2YL2A 3ER6A 2G67A 4I4CA 2JGRA 3DVSX 4NCHA 1Z4NA 3SHQA 3IMEA 2XTAA 1UEIA 2GO1A 3RVBA 5DNWA 2V6GA 1E4EA 3HDQA 5EE1A 4RD0A 5EZ5A 1SXPA 5FI1B 4JDPA 3FUTA 3RYFB 3KAJA 1P6QA 1C4XA 5J40A 4DSOA 1KAHA 1O87A 1ODFA 1C0IA 3DEIA 3CPSA 4PO9A 4RDCA 2R7KA 5GV8A 3WGGA 4ZT2A 1RM0A 3M4NA 3JQAB 2YC2C 3PX2A 5HGXA 2Y4NA 4A0QA 1Z0IA 2H4YA 3U3DA 4DR3B 1K75A 5AUNB 4M9CA 4NRDA 1ZU4A 4JX8A 3EH1A 3JD4A 3NHYA 4JLVA 4BMDA 4DBVO 2QYOA 1NNLA 1EWRA 4TL8A 3L77A 1MMFB 1B00A 3G0IA 2CHEA 1SBCA 1ETUA 2QB5A 5H70A 3UXHA 4AMVA 2GXSA 4HY3A 3FSGD 1JYFA 3HRHA 4XA8A 2Z1MA 1MHTA 5B3JA 2OHVA 4GDMA 1B6RA 2DEUA 2FWIA 5EIHA 5LA6A 3TLYA 4B6OA 1ZA2A 4WFKA 1I32A 2C5FA 1TRHA 4OFXA 4REQB 1G98A 1ULBA 1F6BA 3GIDA 4ZTZB 4NESA 2OP0A 1CIJA 3IC5A 5FI5A 5AVXA 4LVOA 4GOOD 3LO5A 1JALA 1OFUX 2Z1DA 3P2IA 4RD1A 1U2PA 1KEWA 2R8EA 3I39X 3QLEA 4TQ9A 3U13A 1JNYA 2WKPA 4BVFA 2YWCA 3W77A 5FUVA 1J5PA 2GM5A 2H5IA 2ZTHA 4BP3A 3QX8A 4N7RA 3KQOA 3VZPA 3C5VA 3MJVA 5JHGB 3RSFA 4CQLB 4EF4A 3RD5A 5JZVA 1D4ZA 4D6YA 4G3XA 1MIOB 1FIUA 1WDKA 4KXMA 4C14A 5FQOA 4M8IA 4ZYLA 1BQ4A 2HK6A 2PXAA 4O2BF 1IPFA 2J7PD 3PLNA 3FI0A 1W1IA 1K8XB 2HJWA 3WL5A 1FQJA 3UMMA 1CDEA 3OO0A 2NO6A 3DBOB 2NV2B 5ALLA 1DT5A 1ULAA 4X1IA 4CFYA 2PQMA 4UULA 2GN6A 3VBCA 2C4VA 5CDFE 5CFPA 7MDHA 4QQ8A 1ZEJA 1E4EB 4BE7B 5A06A 3CB4A 3EODA 1ZGCA 3AI2A 1RRVA 4WK2B 4HDNB 2QPAA 3DW1X 3LPNA 5K6AC 1MVLA 3DHYA 3CURA 1BTOA 1OSNA 3A58B 2F48A 4NX2A 5EQFA 2SBTA 4Q3OA 2R4UA 3CVVA 2P3LA 2G17A 2YZMA 1ORTA 3PNVA 4INOA 4J0FA 2ANCA 2PTHA 1GPLA 3L84A 1KMHA 2WJJA 3MF4A 2Q0XA 1M6WA 5F52A 3WO0A 4C7JA 3RRZA 2Y66A 3UBTA 4OHYA 1CJBA 1DFIA 2YH2A 3AM5A 5B1EA 2KI5A 5IXSA 1GUDA 1W5EA 3EVEA 3ENKA 1Y1PA 2P4EA 3EUFA 1IY2A 3FKSA 3OD1A 4IIVA 2XECA 4IG9A 3UK6A 4IFBA 5LA6B 5FPTA 4GLOA 1LNQA 1OIVA 4UE6A 3OKCA 3UWOA 3OBBA 2ZZMA 2V45A 3IHWA 4D4HA 2CXXA 2ZSUA 4OI4A 4E46A 2WWXA 1B3BA 3QPDA 3D64A 4Y2TA 2NYRA 1Z5PA 2WTEA 4XEUA 5C1DA 2O1EA 3B5JA 4TKMA 1KH3A 2E82A 3HM2A 1K8RA 4OKIA 3TDKA 3IJPA 4AYXA 1YR3A 4WUTA 5FUXA 2IF0A 4P3PA 1EDDA 3FAKA 2A0WA 4NH0A 3A7EA 5KEIA 2NVUB 3NQ41 2O7QA 4RAQA 2GKOA 4BMNA 1VPDA 2DWPA 3E9ZA 5KTTA 1JX6A 2WZBA 3P9ZA 1DUVG 4HDQB 1FX1A 3DWGA 4S1OA 3MW8A 2IBTA 1ZSYA 2HDOA 3T61A 4C2TA 3LE8A 4HDMA 4A3SA 1TZBA 3RAGA 4NCAA 5WRFA 1XAHA 3CGGA 3L5OA 3ZDXB 3X3HA 4PPQA 1WO8A 1MFZA 2PGOA 4R2IA 1MF7A 3LCCA 4RKQA 4RVUA 2OV8A 3VPGA 1Y81A 4M49A 4N65A 5LKAA 2VEOA 2YXNA 3UW3A 4DG8A 5L3ZA 2D00A 3TE7A 4CHTA 3LFHA 5BSEA 2OZLB 4BB5A 2BMVA 4MVXA 1T6NA 4Z8YA 3FI9A 2Z2XA 1JZQA 5IARA 3WG9A 3NT2A 1GPNA 4L3OA 4WXHA 1F17A 2Z57A 1JDSA 4F3YA 3ZZNA 4L9AA 5HG0A 4LG1A 1C1DA 5JNVA 3WGVA 1KMHB 2R7MA 1J06A 5IBRA 1TTPB 3H5LA 3IUYA 4DQLA 5J3JA 3VGJA 3OPYB 1IZ9A 4O2LA 1E2UA 3FF1A 4QGFA 4RA6B 5A03A 5BWOA 4MP3A 3EIHA 2EX0A 1MB3A 2CBZA 1I24A 1Q0SA 2MDTA 3ELWA 3OQIA 2PSEA 1HEUA 2AMVA 3SM9A 1GR1A 1Q7CA 3GROA 4J7UA 1TX4B 1UEJA 1SVUA 2H06A 3ISVA 3HYNA 2OV4A 1Y3AA 1HNZB 1IUPA 1O6FA 3KV1A 3NBUA 1M6HA 3QPWA 1NP7A 4FFPA 3CEAA 1B14A 4IVQA 4Q7LA 4X60A 1N0WA 5IJAA 1H66A 3TTTA 3WLSA 2F8SA 1EUCA 4RK4A 4BLOA 4CDMA 4M54A 3T3HA 1M0WA 2HWUA 1IEVA 1L6RA 2IP4A 3D2LA 4K9NA 1KK0A 5CDHA 5KTPA 4U0JA 3K15A 2I4TA 1IM5A 5LSAA 1DKMA 2YHAA 1G7TA 3QZUA 5IBCA 1JJVA 2A9FA 2WPDD 3TZCA 3ABIA 3KB1A 2HA3A 2QTZA 3E3AA 2BGKA 3QVSA 4KR0A 3WL3A 5TS2A 4ALMA 4AO8A 2PR7A 3E48A 3F67A 2ZS9A 5FNVA 4S04A 5FA6A 4HDMB 3UXMA 1G6Q1 4OVKA 4A2CA 4AN4A 1E9SA 3C3CA 5HMLA 5JDIC 1CZRA 2HMUA 3M89A 4QXMA 3HXMA 3ZDCA 3U4AA 1LJ8A 2AT1A 4M0DA 4B17A 3O8RA 2AGVA 2QUHA 1ONPA 1PEAA 1UBHS 1EEHA 4CMAA 3DHVA 1NIPA 5EE0A 1Z83A 3GLSA 3M8KA 3KKEA 1T9GR 5P21A 2BZ1A 3UGTA 1P80A 4KO4S 4ASUD 4X94A 1PGQA 2L0XA 4E2WA 1XXHB 1RJ9A 4W9NC 4A6XA 4AKSA 4O4IA 5BUCA 4H3SA 3IAHA 2NUPA 1FMCA 1DNPA 3QEMA 1E3TA 3JYLA 4JXKA 1Z8FA 2ZETA 4CKWA 3IJ5A 3LRXA 4KK4A 4H4CA 4M1YA 4QEKA 5A4KA 1Z3IX 4XSGA 3ZH2A 1VG9B 1ZK4A 1W36D 1FA9A 1Q57A 2CSUA 2ZRIA 3DBLB 3JYNA 1C1DB 2CB9A 1GPMA 1OHHD 1YVEI 2NXWA 2W4IA 4HAZA 5THXA 4DIFA 2Q9UA 3UN1A 4BFWA 1R9JA 4UKDA 3QLUA 4KODA 3B2EA 3ITDA 2R751 2V7UA 4XXHA 4E4RA 3IOMA 3PKIA 3N86A 1ZCFA 4DLLA 1U0TA 3TKYA 3ED5A 4A27A 2OCLA 5BSMA 4LDZA 3K94A 4C0HA 4BQFA 1LPOA 3AB8A 3T52A 4F84A 1YVRA 2ZQZA 1QGOA 3K8YA 3DEYX 4G5HA 2EGGA 1N32B 4N7JA 3DMPA 2IU4A 4TLBA 4YO8A 3RASA 1WZEA 1EE9A 4EB6A 3QXCA 1W46A 4FE3A 2ADMA 3D7KA 3M1LA 1QHHB 5IZ4A 3HJAA 3I28A 2WJHA 2ZDHA 4AJ2A 4AKEA 5F98A 2V7XA 1GPDG 2OPBA 2ZRAA 2BYTA 3CF4A 4WLEA 1C2YA 4DR7B 4Z0HO 1U8ZA 2VQEB 4JI4B 3B48A 1J42A 2ZJYA 2UV8A 3R75A 4AQ7A 3JQ8A 2H1CA 3LUGA 1IBCA 3GEMA 3H11A 3IYLW 3HUTA 3PLRA 1G8SA 2IEGA 1YMUA 4NZYA 1JSXA 3MT7A 4FN5A 1RXEA 5DYWA 1RQRA 3H6HA 2XD4A 2NSYA 3I05A 4C21A 4RVDA 1ONSA 1SOAA 4X7RA 5AYVA 1Y37A 1XCLA 1OYVA 4MOWA 3F3YA 4O0MA 4PC2A 1H93A 2HLPA 2QRPA 2ZTUA 2HT1A 5IASA 2IITA 4BTLA 2OCAA 2GYVA 1PRYA 2JCSA 3SYLA 1SGWA 5LMUB 3FIUA 4WVFA 3CR7A 4DA6A 3WYAA 4FE7A 2V7QA 1NX6A 3RS3A 1KEKA 1XZQA 16PKA 3EQ6A 5BY2A 1S2GA 2BKLA 2HJHA 1PFUA 1FPQA 1VHWA 3C3JA 3BDIA 3DDZX 3ETNA 4MJ3A 5J2UA 1N5LA 2DKNA 3LYUA 2CVPA 4G26A 4O4IB 4UDOA 4MV4A 1G8HA 3F73A 1KAOA 3LXXA 4CKWB 1E1QA 5EMLA 1K06A 3GMDA 4IIGA 4KQ2A 1OA0A 1LFAA 2BFFB 1AKEA 2WIDA 4YRCA 5ELLA 2ZWPA 1DAFA 2G9RA 4O4HB 2W48A 1YRAA 3M34A 1LD3A 1O4WA 2CNLA 1W4CA 1DO8A 3BC1A 1DZIA 3OQJA 1H0KA 4G9EA 2Q4OA 4QHYA 3PX7A 4DIUA 1QOPB 1ZNQO 1SCUA 4W1PA 3C3WA 5E2IA 4ZARA 1OWLA 3ZXUB 3PFIA 5JAQA 1SU4A 5LR6A 3B78A 3F5SA 2NUBA 1RYMA 3SCZA 4JUFA 4B7UA 2VSFA 2Y0EA 3WS7A 3D3KA 2A78A 2YRWA 2Y1XA 2XYGA 3EMBA 3FVWA 4MIOA 1E9CA 1SD1A 4Z9YA 3TOSA 1NUQA 4JLKA 3PT5A 4EB6B 3IEKA 1YAHA 4F6RB 2XXJA 4RPIA 4PLPA 5E4JA 3HXOA 4JI0B 2C2ZA 2YJ3A 1GZ7A 2ZSHA 3G7NA 1IN4A 1KRWA 4L8VA 1P9NA 1YOVB 1MCZA 3N8NA 3GGPA 2ID8A 3CVOA 3D8TA 5CEEA 1Y48E 4YPFA 2IVFA 3CWCA 3JQ8B 4CGYA 5IAKA 3IL2A 4QG3A 3IQEA 5DLDA 1RHUA 2IOHA 3ADOA 1N5OX 3C7CB 3KU4A 2CB0A 3SJBA 2BUBA 3L8CA 2IY8A 4FBMA 5DTMA 4J6FA 5HVNA 3DAPA 1T8UA 1KFJB 2C2BA 3GDGA 3DZDA 1ZDMA 2OBMA 5HDQA 3BMCA 1PL6A 2ZTSA 2EIXA 2FSHA 2QI9C 3RVRA 5BR7A 4PQGA 4DMKA 1I3MA 1KGDA 2VHQA 3WJ1A 4K9DA 5JYCA 5J2TA 5HZMA 4QYTA 3TB6A 3ENNA 3N3BC 4QVGA 5ILQA 1BHO1 4XUGB 4DCTA 1ZVJA 2QUZA 3EIWA 1M74A 3TGPA 5KINB 2R6R1 2V7BA 2A14A 2BCJQ 1SOUA 3BIOA 5A5VA 4LPSA 3A1EA 4UBJA 2VFAA 2OXRA 2J6CA 1USVA 4WAUA 1B73A 4MRMA 3EXAA 2Z6QA 1ZITA 2VH5R 3JYOA 1Q91A 3K0KA 4LE2A 3ET5A 3CKMA 4PGMA 5EIOA 2OGTA 4MYSA 5T57A 3ICEA 3N39C 3FBWA 3BERA 5EGSA 2MOKA 4ZDKA 4X6UA 4KHZA 4DLXA 3F98A 3M83A 2QTHA 4I6GA 4EW1A 2H4WA 1CQZA 2JDIA 2NYVA 4HH0A 5AVZA 2D7CA 4F9GA 2ALJA 4N5MA 1PNOA 3CLUD 4DDHA 3WSTA 5HZKA 1N2ZA 3KBOA 1YI8A 3DTVB 2XNKA 1C7JA 1QK5A 3DVQX 3KL4A 1W5FA 4GBJA 2GK4A 3HJBA 1H2XA 1VJTA 3I6MA 4GMHA 4AG3A 3BZBA 4WE3A 4D79A 5L4SA 2GZ1A 2HMSA 4X71A 1UT6A 2VK8A 1ZFNA 5B1DA 3ZK8A 4DGSA 1U0RA 2HA6A 3AVOA 4YP5A 1MXFA 2ZS8A 4IBOA 2CXOA 1Z26A 4A03A 1YQUA 2ZJ0A 2ZTMA 4YJGA 3NVKI 5FR2A 1JFSA 4OFWA 1IB6A 2BEKA 2P9BA 4L5CA 4XDZA 2FUKA 4UEJA 2VHTA 4CTJA 2FN8A 1PZNA 2PANA 4FZ3A 3JXEA 4RU1A 3VO9A 2I29A 1AQNA 1O96A 2X13A 1IZZA 1LK5A 3KL2A 4HB2A 2WPNA 4WGFA 4Y2XA 5AOCA 4BLQA 4G6ZA 1XWFA 3A3OA 3ZCRA 4LCJA 1BVRA 2OKGA 2RONA 4G67A 2ZIXB 3JZFA 5FCDA 2PX8A 1V2HE 2WWVD 1N0HA 3AG6A 2ZANA 5IJWA 3S8YA 1AKRA 1I5OA 1AF4A 1NVVR 2CHGA 3AF0A 4FYYA 3BA6A 3QU2A 4OP1A 1GFSA 1N6RA 1TT5A 1UUFA 1X8JA 3BMCB 5IXYA 5JEDA 3MGAA 4MR7A 5E9JA 1UPUA 4K81B 4GE0A 2WM9B 4WTOA 4BJ3A 1H8ED 3QHPA 1XZAA 3I72A 2FG6C 1FSSA 4QOSA 3QLJA 4P3XA 4BQOA 5AKKA 3DAYA 5DLQC 4DM4A 1OIWA 4Y67A 3K7EA 4B0PA 1PR6A 4TV9A 2PLRA 4YYEA 1J8VA 1Q0LA 3NUZA 4BNZA 2V5UA 1VRCA 3JZMA 3PVCA 1OX6A 1SHKA 1NI5A 5TGTA 3T5CA 2SCUA 1XZEA 4ZCLA 1HORA 1DLJA 2DHCA 2X8JA 1OZFA 3OIVA 4P86A 3INYA 3FB1A 3CPEA 3D6FA 3QKWA 4YX9A 1GCGA 2PKEA 2ZIAA 2FP3A 4R1PA 1RM4A 5A4DA 4G5OA 1JDNA 3TIGA 3VOTA 1KHHA 1TKRA 4P54A 4R0NA 5E9AA 3WLHA 5KOHA 1Z08A 2WTNA 2BR5A 4XJTA 2IIBA 1UDBA 1X1DA 4TTVA 2YICA 2JFPA 3AFGA 1NR1A 1QK3A 2C5HA 2Y0CA 3D43A 3MCAA 4UZEA 5HJ2A 1Z7WA 4HFRA 2VNSA 4ENTA 3PFKA 4HAXA 4XWWA 2P8SA 2RGAA 3O21A 1ECFA 1Y1KE 3JYHA 4QBGB 4K26A 4NE2A 2XVZA 4IX9A 4YT2A 1OZGA 2VWQA 3KAPA 5DHAA 1E58A 3L8YA 1BS2A 2LBPA 2PLNA 2O2DA 4IS2A 4MUIA 1C1HA 1SC3A 3C3YA 1ZRHA 3W2GA 4D9FA 3LAWA 3RADC 1W73A 3MCUA 4YJGB 4CCAA 4UCQA 2F90A 2HDWA 2AV6A 2GBLC 3GA5A 1SIBE 3BTUA 4R7ZA 4Y9SA 5FPPA 2PT5A 4RX1A 2J7KA 3C2QA 1DWPA 1O96B 2JGKA 2WIAA 3G02A 2X77A 2B20A 4RIGA 4UXIA 4IMPA 3UHFA 2XGOA 1B42A 3WFJA 1NZJA 4A6PA 2DUUA 3MQFA 2Z04A 1XCMA 4PSDA 4YK7A 1TA9A 2ERCA 4GT1A 4LYHA 2JI8A 1JNXX 1TT5B 5JMWA 2EJUA 3EJ6A 1C3EA 3KZMA 3JD3A 4MR7B 1XRJA 4FGWA 4I9FA 4XIJA 4ARVA 3HN6A 4YRFA 5B4UA 1TPYA 4E4TA 1M34B 1E3WA 2BTQB 2FUG6 2WT9A 4K46A 3MPOA 1FXSA 2BFAA 1SNYA 3IAAA 3HU1A 4KLZA 3I0ZA 5HK8A 4ZCMA 1ODSA 1R8JA 1XG5A 3LC0A 3D3WB 4AF6A 3CR3C 3K05A 3S55A 3TYXA 3DT8A 4B74A 2FETA 2J5XA 2JAQA 4PHCA 4YRNA 3OCVA 4J1SA 2FSSA 2BOVA 2BVNA 1VGRA 3U9LA 3ESXA 4QGHA 3ZQKA 4C1BA 3OOJA 4P35A 3QEKA 1PU2A 1W47A 2SCUB 2ZJ4A 3B7PA 1MOSA 2BKEA 2B7CA 2FEWB 2X8JB 1HF3A 4GRIA 5KB3A 5JMTA 2FMTA 3SEQA 3JS5A 4V0KA 4HRAA 1EUZA 4CR8A 5IDXA 1TQ2A 2Q2VA 3RS2A 4JVSB 5E7JA 1K6EA 1CQIA 1L0BA 1FFEA 2GTIA 1C9YA 5CIWA 3FTNA 3D4OA 5KOHB 3JWEA 1S1MA 1ZC4A 4KXUA 4OAOA 4QOGA 4B3XA 3AFIA 4CM4A 4WESA 3OEED 3Q41A 3H1TA 2IQIA 1Z9BA 4MV6A 4MV8A 8ABPA 2DPYA 1B16A 2Q3HA 3EOBI 3GF4A 4UZSA 1GDTA 1QZ3A 5EL0A 3SFZA 3CNLA 1CY8A 1KSHA 5IUKC 3ZE7A 2JFBA 3LP6A 1E3MA 3E9RA 4YAKA 5IG2A 721PA 2B8TA 2VA8A 4KZKA 4L4YA 2QRGA 3L1HA 2RDMA 1KQFA 3ZHCA 4LF5B 1I3KA 1DJLA 1KMQA 1NW7A 3IQIX 4A0SA 2OXTA 4N41A 5ALYA 1ORRA 4X92A 4EI7A 1TYZA 2Q45A 1BE0A 2JATA 2OOKA 3DTYA 5I4KA 4B40A 1P5FA 3GH1A 1EWQA 2HEGA 1BMQA 4KPYA 4ZHQF 3LWNA 121PA 4EABA 1Z82A 2FY8A 4G36A 1UP7A 3MWEB 2MMGA 2OGZA 1E2DA 1JKFA 1N2CA 4U7GA 3ET4A 3NAQA 3VZSA 5TQJA 5C4MA 2B2NA 1X7WA 3KDSE 4KO3S 5BWCA 4YRGA 1L7PA 2GM3A 3A4YA 2CNBA 4ND3A 5KU1A 4CMIA 4Y18A 3T7TA 4KB5A 1H9AA 2R6DA 4PIVA 3FDIA 2PSDA 3IP5A 2B9EA 1E5TA 2ODAA 3MCVA 4Y6PA 3HBAA 1IY8A 3G2NA 3ZWXA 2W71A 3OHPA 2OCGA 5DH9A 4KW7A 3BTVA 4E3WA 1IN7A 3E3MA 2HBZA 3ZWBA 2O8FA 2XTZA 2GHRA 2QZJA 2UKDA 4KDFA 3H7AA 3ZDDA 1RHMA 4ATNA 4D3YA 3HTXA 1ELOA 3EWIA 3MG9A 4DR1B 4QX6A 2QW0X 4M9XA 3K6SA 1QM5A 4CM4B 4LV5B 3AJ9A 4R05A 4WESB 2W6PA 3FFTA 2FKNA 3BGWA 4MWCA 4BPBA 3IV7A 2APJA 3V6LA 4Z4GA 1T3SA 1HYEA 3ITNA 4MHOA 5A5FA 2OCPA 5DSTA 3PUJA 2WRZA 2I3DA 2GNOA 4V2IA 3EVDA 1DOHA 1SCAA 3AI1A 3Q6IA 2OLKA 4BY9E 4IILA 1T1JA 4Z86A 1N6IA 1KKUA 1PZFA 2B8JA 4WKGA 4WY2A 4CL3A 1IXKA 4CETA 3DZKA 4OHKA 4OXIA 1H1TA 1DOZA 3VR3D 4MEJA 4DHEA 1NY5A 1MBZA 2WQZA 3BIWA 2CKMA 3C85A 3WLOA 4GICA 3WV5A 1YJCA 3EZFA 2A9RA 3KJZA 3NI2A 2EYQA 4I1RA 3U9SA 1WSAA 2VJMA 3BHNA 3DZGA 2VZ9A 1N2CB 5JARA 1TU0A 1KO1A 3AR5A 3KFVA 2J3EA 4LOIA 4KXFB 1UKZA 2W7TA 4M0UA 3ROEA 1B41A 1E1LA 2FVYA 2GWHA 4FCTA 2VDLB 1R6VA 3HA3A 3ML1A 4YT5A 3ZWPA 2H8KA 2RH9B 3ORYA 3OC6A 5AH0A 5FNZA 3THRA 3W8FA 2J6IA 5SY9A 1QHIA 4BRZA 3ANLA 3G13A 5HQ3B 1QIJA 3I2GA 4CMIB 4E1VA 2BGGA 1QF7A 1VLHA 2C7VA 4X7BA 2ZJFA 3I01A 5CYPA 4HT3B 1B3RA 1H8HD 1Q1AA 1U9YA 3GJ6A 1CB7A 4C22A 3HKDA 2IS4A 1TKCA 2XY4A 4GNKA 4M60A 4JLPA 4D0GA 3ZU5A 3CKLA 4JQYA 3L1UA 4AI6A 2VNJA 1DCFA 4N12A 4BAUA 2DYKA 2DPLA 2YFYA 4PQYA 4EI8A 5D5QA 1X1QA 3ZHRA 3KBBA 1JIXA 5C7OO 1ODCA 3DCJA 1THMA 4X1KA 3O4VA 4YFYA 1AUPA 1Y8QA 3ID6C 4LMAA 4A5OA 2O8FB 4OOFA 3KKZA 2ZVQX 1E2PA 3NTVA 1UBNA 4MMZB 5JCZA 1HFJA 4CM5A 3IAXA 5B30A 3V7UA 1JQJC 3K6SB 5MF6A 1P18A 5BQ3A 2FK7A 4ZVRA 1SD2A 3CX6A 1X77A 2AD1A 1YTUA 1DIOB 2PV0A 5JNSA 3KS9A 3JQQA 3KTAA 3G8YA 3AHCA 3K2BA 4EA8A 1WBBA 3HFSA 1F6WA 4KFCA 1APBA 1OROA 1SCQA 3UHOA 3P94A 3TTXA 4KGDA 1KP2A 2DF8A 5EJAA 3DZHA 2NZUG 4ER0A 4N8EA 2BMDA 4LCBA 1JHVA 1GL3A 4LE0A 3A9WA 4JK3A 1OBCA 1T4CA 4MUKA 3U0BA 5J5CA 1NW9B 3UA3A 1POXA 2C57A 1VDMA 1USIA 2NX2A 1NDHA 4C6SA 2Y2VA 2ORYA 2Q2OA 4ZI7F 5TMBA 4OK6A 3U4DA 4PYKA 3OZRA 1ZIDA 1KU0A 1X7YB 3G8BA 5HKOA 2QJTA 3LT4A 3IAS6 4LSGA 1B1CA 2AKAB 2VJMB 1JXMA 1XTVA 4GPAA 4CLOA 1GPJA 2IPNA 2A5LA 1V1MA 1HDOA 1XEFA 2K7ZA 2WJ3A 1MAVA 3SOZA 1QGAA 3QMWA 2OK8A 4FMDB 1NUHA 5JLJA 1U0FA 4O5OA 4ERNA 2O5CA 5D51S 4Y7DA 3V1TC 5FEUA 1MD9A 4F4JA 3ND9A 5K99A 2H1HA 1KY2A 2EAUA 1Q7EA 4DLWA 2OBNA 2VXCA 5C32A 2I8CA 4MRSA 3KOUA 3OFNA 3VUFA 1M76A 4CNBA 3U49A 4F12A 4ML3A 5ECDA 1EBBA 2Y1DA 3DDCA 5G1NA 5E0OA 3WR5A 1BFUA 1M6YA 2OAQ1 4WZAB 3L41A 1P1IA 4G23A 3V34A 3GA7A 1RZ3A 3G3EA 3QFTA 5AW6A 3CPHA 4BIIA 1HETA 5I4BA 2G04A 1E1DA 4I55F 1L4KA 3VPDA 1YC5A 4F93B 4ZTUB 1SUIA 4EJMA 2IGBA 1NMEA 2DBVO 4X1KB 1Y8QB 1O5TA 3RKRA 2GN1A 4Q7KA 1TD1A 1TPZA 3DMFA 5HF5A 4MJXA 3MELA 1YB4A 3NAGA 4YAEA 3SN6A 2VYND 3AKDA 2B1JA 3PQ6A 5FT9A 3T3DA 4TRNA 3DDSA 1ESMA 1C7QA 3UBMA 1FJHA 4LTDA 1KZ1A 3KTAB 4G0NA 1KI3A 1R4ZA 5CFZA 2BJHA 2XZPA 3ZNPA 1NQUA 3RS5A 3R6DA 3BCRA 4YY3B 1UJ5A 4G25A 1FW6A 2IP1A 2QLJA 4YCSA 2EGUA 1T0JB 2JD0A 2EP8A 4P7GA 1XTBA 4BASA 4B7XA 1U8UA 1TO1E 1T3LA 2ZE6A 1T4CB 1KTIA 3UFXB 3T5PA 4DNFA 5JSZA 3RAEC 3W5UA 2C2GA 1KC3A 2VLIA 1CTQA 1WZIA 3D3QA 3E7XA 3OOWA 1N0IA 5EY5B 1UAYA 1WEHA 3I4CA 2X4GA 3ZUGA 2FSVA 5BP7A 3OQMA 1JIVA 4OIMA 4ER6A 3MTJA 4KQIA 5ALSA 1CYDA 1NBMA 1QQTA 4H15A 1NWHA 3K0CC 4HYQA 3PEUA 3NO4A 3BIXA 2IYSA 1DEOA 3VR0A 3HSYA 3E9NA 3E9EA 3GLHE 1Y3HA 4XJXA 2COKA 5BSWA 1Z8DA 1JAXA 2CZGA 4PR0A 4YRSA 1SUSA 2IW1A 1XJWA 1GA1A 2F3PA 2GN8A 3DDNA 1JG1A 3R7AA 1EINA 1V45E 5AVRA 4CEJA 1SVKA 1T0PA 4KP7A 1X7GA 1JMKC 3PJFA 1ZGGA 4AIRA 1T2CA 5JY6A 1A96A 6LDHA 2HQBA 4CI9A 2CT8A 3UV3A 4P58A 3AWIA 2AEEA 4GKBA 1XZLA 4JKIA 5LP6A 4DRXA 5IYZB 2W4MA 1YUNA 4UVEA 5IANA 2NXCA 5IMSA 4B6EA 2WB2A 5KNCD 5CPBA 1XKLA 2XD9A 3RJ9A 4UE3S 3VDNB 3V7NA 4E30A 3EUEA 3EQ8A 4U8GA 2C9YA 4Q82A 4EUHA 1N4AA 3S29A 5K8LA 1UL1X 1ATZA 2WE8A 2GLUA 1E6CA 2XHZA 3GJRA 3IV9A 5EKTA 1GTL1 5DCUA 4EL5A 1YZTA 4BNKA 1UOQA 2EW1A 4B7CA 1LFDB 2UVQA 3K3PA 3NTUA 3X1ZA 4E09A 1RHQA 5AKLA 3RYIA 3QXXA 1U2GA 3PPYA 1O89A 3DFFA 4V0QA 3SMQA 2PL3A 3PXBA 3H2HA 1KVTA 3F6BX 4QASA 5D00A 1SXHA 1MO6A 1U4SA 3RYIB 3FH0A 1KFEB 4DQDA 3FAZA 3GFBA 4KJXA 4MVJA 5C8VA 1Z6GA 1K0FA 5G0WA 3I2IA 2MT9A 3M3DA 4EM6A 4QPDA 3CJRA 1LC0A 2UVDA 4BV3A 2ZUBA 5ALFA 2XMPA 5BRAA 4TL7A 3EAGA 4KAXA 1XTIA 4FYMA 5JSZB 3RT7A 2AXPA 4FOPA 1MQSA 2N46A 4TL6A 3V4FA 3AERA 6GPBA 4U8HA 2JGAA 2WMOB 3V4OA 1J9ZA 2YWFA 1NRWA 2GEVA 3D6JA 3IVCA 4P93A 4W8HA 5LB2A 3O7WA 3V8RA 1Y4DE 1F2DA 3AL2A 2D59A 3OQPA 3O91A 5KJFA 4I5DA 2QOEA 5LCXA 1P45A 2DCUA 1L7VC 2Q1TA 3ECCA 5E7IA 4MR9A 4B8ZA 5EIBC 1XDBA 3EDRA 3AOGA 1R0RE 1RE1A 3RWBA 4JLDA 5A3SA 1U8YA 2CMFA 3EWAA 3BE5A 1VHQA 2FV8A 1SUBA 3NBYC 2IPOA 2BLNA 3DL7A 5B2ZA 2W2XA 1RZRD 4Y8VA 5F2EA 4BFYA 4CV2A 1PL7A 4KGVA 3TLBA 2F67A 4EHHA 1A8IA 3U80A 2GR9A 2P3OA 2W6NA 2YCBA 1H1LB 3HC7A 4G1EB 1W30A 1Y3CE 4HG2A 3WYDA 1SVLA 5M04A 2Q8NA 3P45A 2R65A 5K20A 1I6LA 1PT5A 1VFNA 4CRWB 4D9MA 1BIFA 1YJXA 3LDHA 3PD7A 4NP6A 4DRXB 1WMBA 1EFHA 1LGYA 2JAPA 2OMEA 4MIKA 1XIVA 2YQ5A 2PSSA 3VZBA 4LMBA 4AW9A 3ESRA 4LVCA 1X0VA 2ID4A 4LJ9A 2P69A 2WIGA 3BILA 3AVXA 1IMOA 4KOAA 2QLBA 4O0LA 1ZM7A 4BEVA 1WE2A 1XQVA 2R8ZA 1WB6A 3GXBA 3ME5A 4PY2A 1N36B 3F46A 1V5EA 3N53A 3W4IA 4KPEC 1MAUA 4G89A 2UXBB 4NBLA 4WOBA 4JVNA 2CE2X 1R8SA 3DNPA 2CXNA 1KYXA 2EJWA 2CLOB 2O2SA 3R77A 1L5KA 5J47A 2B5WA 1AS3A 1E79A 1FMLA 3FRIA 3KKLA 3PGJA 5JIBA 2A1TR 2V59A 1RFGE 3KFXA 4BNMA 2X1LA 3FF4A 2BMEA 3G1WA 2CGEA 3O8BA 1ZHFA 2HO5A 2PS9A 3WLEA 2ZKIA 3JATB 4IQ8A 2BI4A 2JF0A 3NNNA 4GBGA 4OK5A 5M3BA 3WKDA 3GP8A 3HR4A 3X2EA 5ILGA 4G0WA 1ZJYA 5DTQA 4TS4A 1VCIA 4F92B 5KQRA 2BBWA 1UAGA 5AW7A 3UUGA 5ALEA 1MT0A 2DPXA 1RABA 2NN3C 3AERB 2XE6A 3QVMA 2GF2A 4DCNA 4XVUA 4YT8A 1KK2A 1L7RA 4K0RA 4P5PA 2FZGA 2TMYA 4FMCB 5A62A 2O14A 4RDIA 4CMEA 3W1WA 1STOA 1E2HA 3NWOA 1UPXA 4MV3A 4KLAA 5I9TA 3NM5A 3BRWA 1JI0A 4MR9B 2QT0A 3VUEA 3U56A 5CXSA 5HIIA 3H87A 5TIIA 3MWJA 1Z5ZA 3IAM1 4B3TB 2WG2A 2YW2A 4MW6A 1MB2A 2PPVA 4ZN6A 2Z4TA 2JFXA 3WWOA 3A2LA 1KJIA 5JPCA 4A0GA 2HA0A 2NW6A 1GP2A 3GEGA 4DA9A 1R6UA 4R9UC 6NULA 3JR3A 2VPYA 3C7AA 3PDHA 4NBSA 4E88A 4B2LA 2XF2A 2ENUA 1BFKA 3H2BA 3NTRA 2OD9A 3QELA 2ZK7A 4K6OA 5CJPA 1MENA 1SKYB 3I1IA 2IY9A 1ZWLA 2AEMA 4A8JA 2DVMA 2GERA 2IZOA 3PNBA 4RNCA 3ZGNA 4EEXA 2RI6A 4F91B 4D4JA 2NV0A 3QMPA 1GZ3A 2WFAA 1CJVC 3GAMA 2O48X 4FHCA 1RAFA 3GJ8A 5E38A 4JI8B 2VQ6A 1NQTA 3AXSA 3NW9A 4ZVSA 2WV7A 1JIKA 1R7RA 3R6TA 4DAOA 2Z09A 4QGAA 5CB4A 1KJWA 2GPBA 3AQ4A 1R10A 2ECOA 1I2CA 3FZNA 4AG5A 1Z0DA 1KAMA 5C35A 2VJKA 3NTQA 3IBCA 3DSRA 5KOYA 2WNHA 2ZREA 2DM6A 2PBFA 3TFWA 1NSFA 4OJTA 3VBEA 1SHTX 1Y5RA 1YACA 1YGYA 3CVYA 1MV5A 5LPNA 2Y99A 4B6RA 3PYMA 2HWKA 3GYBA 5FV7A 4X65B 1PJ8A 1FRQA 4DYVA 1P0PA 2PL9A 1MJNA 4L72A 3HADA 3TE6A 2WUWE 4A0RA 1IY0A 3NC1C 5LU9A 1B43A 2IWRA 4MKRA 5I7UA 1OGYA 3BXPA 4NCJA 5MGBA 3DEFA 2FN3A 3KUDA 4QYSA 2IOFA 3CX3A 1WZCA 3KQKA 1PD0A 1XDZA 4PZ9A 1YR1A 4RF3A 1GPWB 3M49A 1E3EA 3ZV3A 1QU2A 3VRHA 1IXSB 1U1CA 5CLFA 3E9MA 4TS9A 2C42A 2D7JA 2IPAB 3EXG1 4DWOA 4NLLA 2POCA 4FN4A 1OKKA 2ERXA 2Z30A 3SC2A 5CXXA 3ZIAA 4K0KB 3B9PA 1U0HC 2EP5A 2YNMD 1VKNA 2JEZA 2PS1A 3H2ZA 3G2JA 4B46A 3GUCA 5MN4A 1DTEA 3AUAA 1M2FA 4BRSA 1NMZA 3GN2A 1H2BA 3W5JA 1AA9A 1Z29A 2Q5FA 5KMGA 4INAA 1L5HA 1QU3A 1P77A 3GRUA 3A2MA 4QBKA 1Z6YA 1KZ9A 1JRLA 3E1KA 2YTZA 3QELB 4NZOA 4CMGA 4R68A 1PV4A 1OX5A 1K98A 1XD2B 4X5OA 2J3LA 4ZJZA 4A8JB 1IWPB 3HDHA 1G16A 3BK7A 1SCNE 3WL7A 3WNVA 5B57C 5HRAA 2GCIA 3IBTA 4FSDA 1MW9X 1U2QA 1W19A 3LBNA 1ZNXA 4ZAYA 1FUKA 1GQFA 1M0TA 5LDDC 2ZJ7A 3FPEA 4GYKA 4MV0A 1N6LA 2ZAIA 4DCJA 3B8EA 4LW8A 3S8EA 3CUVA 3PGXA 2VR1A 5KJCA 1RAHA 2E2WA 3ADKA 5CB4B 2Q5CA 4GKJB 1U0JA 1VZ2A 1X1CA 5FI0B 5F9MA 3I64A 1K2WA 4G0QA 3UAZA 4BKRA 4H6VA 3FLAA 3K8ZA 4NBUA 2R0QC 3RABA 3ZEAA 1G4AE 1XRMA 4Q7QA 1L5WA 2ZZKA 3KJNA 4C5AA 3TUZC 8AT1A 1JG4A 2B34A 1SY7A 4EYGA 1D7AA 3FYUB 3OCXA 1BEZA 1W2GA 1TAHA 2A30A 2WIKA 4JCOA 4QUBA 2ZIZA 5DLPA 3VO1A 4D6XA 3DUFA 5IVHA 3CLTC 3P2EA 2V9CA 2Y6VA 1AF7A 1WUJS 3O8LA 5G2OA 5K5EA 2FKAA 2PGXA 4AZ0A 4OMDA 5JNLA 5K6RA 3LC7O 4BVHA 2FSVC 4ZK2A 4XE5A 1X19A 2X8LA 3C24A 4QECA 1QB8A 2LW7A 3P9IA 3QITA 5U1PA 1EGQA 1UPFA 3HBJA 4C5CA 5G1OA 1P31A 5T8KA 3R20A 1OUMA 1EUDA 1IOWA 1VECA 2BFMA 4JBWA 3V2UA 2YIDA 1RU3A 3IKJA 1KERA 2ZQ5A 3KUKA 1QR6A 3RV3A 1T13A 1DBIA 3BGDA 4FK8A 3CBGA 3UXEA 4E51A 1SHLA 2V6BA 3NNSA 3THSA 2O3UA 3WKAA 2AC7A 4HNSA 4MPPA 5C1BA 5CFQA 2NXNA 4YQFA 3E1GA 4PC1A 1OGIA 3DD5A 4EKYA 8GPBA 2IYOA 1L5HB 3A1NA 3K9QO 4YLGA 2YMMA 4D2IA 5LP6C 4ENQA 3O4JA 2YJ4A 2FPGA 1J2JA 1EAYA 2PKQP 2HH9A 5DB4A 1JEOA 2IXFA 4RVNA 4FGLA 4IIJB 4O3MA 1IULA 2QTFA 5E6UA 3V6MA 5F2OA 1N8NA 3CVJA 4AG6A 2ZYDA 1QNFA 3NOOA 4YRRA 2AMJA 1ZLYA 3PFFA 1U9CA 4K2AA 4KV9A 2HA2A 1YR9A 3AHFA 2Z6UA 1WV1A 2B8EA 1JYSA 3M7IA 3NM4A 1NDUA 1OBOA 2IHVA 1U2GC 3CU5A 1Q7GA 4GAEA 4PTZA 3JTMA 3KT0A 5LZ4A 4GVXA 2PUCA 4DNXA 1HDCA 2BD0A 3B6MA 5C31A 4DIDA 1QTQA 1V4BA 3KJIA 1L7OA 2L69A 3WGUA 4FFNA 2CC2A 5JCPA 4Y6QA 2X42A 1YNSA 3AVUA 3TZQA 1Y7IA 4HXYA 1DRWA 3VNVA 2GFQA 1GVHA 2DHQA 3QW2A 5CFMA 3L4KA 1E18A 4DOMA 1NMQA 2G09A 3QOYA 4A16A 1U02A 1XT6A 1OD6A 4QU8A 5JASA 1RRCA 3GZJA 4Q39A 5EZYF 3LQRA 1CJMA 3LQ4A 3DUFB 4K40A 4O1MA 3WLQA 2YYYA 1U7UA 1Q2XA 1ZJ6A 3NEJA 3H5RA 4XD7A 4UOEA 1X1BA 1ZOOA 4MVWA 2GN9A 2FQ1A 4AZ0B 3KSUA 1LK7A 3PK0A 1M66A 4L02A 2WKWA 1KIFA 3WK6A 4BZXA 5I7RA 1E3IA 3CWQA 4HWTA 4D98A 1H2EA 4HCJA 4IWXA 5KYVA 3EPKA 4EHAA 1PGPA 2PMKA 4S1VA 4M4SA 3NRBA 1K7FB 3V8PA 1BMFA 4MV1A 1I33A 4EG5A 1OBVA 2R1ZA 3DOUA 5I7HA 4EARA 4BNGA 1L1RA 1ZCBA 4NCNA 5CT9A 3C1AA 3EF0A 1FNCA 3IP6A 3ANYB 3U1VA 3QY9A 1P2GA 2VUIB 2ZWAA 3G2QA 2Q7DA 5AM2A 1J09A 3NC0C 1IJKA 1MEOA 1UC5B 2RGNA 3EGEA 5KPDA 3R0IA 1F3OA 2C7QA 5F7ZA 3ZZMA 1V8DA 4XIIA 2CDCA 2G8LA 2IU3A 2CLKB 1IEWA 2IWHA 3L07A 2CJWA 3K0SA 3QWHA 3RV4A 3GB9A 3ILXA 4KMSA 1OWNA 5MDHA 1XDWA 1VI2A 5EIAA 3IOEA 4E5NA 2QRMA 2FPGB 4JSYA 3VQTA 1IRIA 1XQ1A 2PXCA 3ZWAA 1HYQA 3EMKA 2OBBA 2XAUA 2AG1A 4ZOCA 1RAEA 2A92A 3TD2A 3I52A 4D81A 3SZUA 3JAMA 3C5HA 4A8TA 2A86A 2NSDA 3QPBA 3W9UA 3BXGA 4RMNA 2NZXA 3UJNA 4DZTA 1GRNA 2CCJA 2HBRA 2Z3ZA 2Z98A 2PKYX 5F7XA 1QWSA 4M0CA 4BQPA 4RV9A 1CUDA 1UFKA 2AMFA 4KUGA 4PLCA 5DASA 2XIJA 2H4JA 2OTCA 3GFVA 4LY3A 5HW0A 1ZJ5A 3QFRA 3WGOA 1EX9A 1XCGB 2EG9A 1ISSA 4X1YA 2FWJA 5AKYA 2YV2A 1VG1A 4LEIA