4BNDA

Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
KMKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKYDQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALEKAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLASQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYPVVQMGIETITVRDWKETAAILKAIIAMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structure of an Atypical [Alpha]-Phosphoglucomutase Related to Eukaryotic Phosphomannomutases
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Isomerase
molecule keywords ALPHA-PHOSPHOGLUCOMUTASE
total genus 94
structure length 252
sequence length 252
ec nomenclature ec 5.4.2.2: Phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 4bndA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4bndA01
1IWOA 3SF0A 1SU4A 1ZD4A 1VFPA 5AW1A 2D2VA 3EWIA 4EX7A 4CF4A 5AI4A 1RPZA 2GHQA 3TLMA 2NO5A 1XVIA 1TA0A 3HYCA 3ZWKA 2GHTA 1Z4KA 5ALNA 2YMMA 4KYTA 5AW9A 4Y2UA 3NUQA 1S2OA 2HDOA 3SHQA 4IG4A 4YCLA 5ALMA 1FEZA 3L8HA 4J2TA 4NABA 5AKHA 4DWOA 2ZOSA 4I9GA 1WPGA 4PNHA 1Z4IA 5IT0A 3PCTA 2HF2A 1YNSA 3I6BA 3IRUA 3VAYA 3ZX4A 3KD3A 3NANA 4NWIA 2AMYA 4H1WA 5IT4A 4J03A 1XP5A 2W4MA 1O08A 3QUQA 3L5KA 3KZXA 2YBDA 3IJ5A 1U2TA 4E88A 2Q5EA 1RRCA 2W11A 3KBBA 5A3RA 4AP9A 5AVVA 5ALFA 2I6XA 3N07A 3OCXA 1J8DA 4FFDA 2IOFK 4XPZA 5AI5A 1XPJA 2CFRA 1Z4OA 5AKGA 1T9ZA 3FGOA 2ZBGA 3UMGA 3FZQA 4UM7A 3WKCA 1U7OA 3N5KA 3ZW7A 4Y2YA 1LTQA 3R9KA 1Z4JA 3WGUA 3UMBA 3DV9A 2ZBFA 2AH5A 3WKAA 5ALOA 4GIBA 5AHXA 5AW8A 2WHEA 3L8GA 2EAUA 2OBBA 1KYTA 3SD7A 3ESQA 5A3QA 4CF3A 2C9MA 1RLMA 1ZOLA 4BNDB 2WFAA 3ZUPA 4CF5A 4G9BA 4UAVA 4HYTA 4RETA 3E84A 4GXTA 1RKUA 1RMQA 1ZD5A 2QLTA 2RBKA 4AS3A 5AI9A 2PQ0A 2B1QA 4UU1A 3ZTWA 2G1AA 1NNLA 4HGOA 3WGVA 2GMWA 1X42A 3QGMA 4BX3A 5AM4A 2YMQA 2DQSA 2FUEA 5AIAA 2R8EA 3ED5A 2FEAA 4UATA 5AK5A 3L7YA 1VJ5A 2R8XA 5AI6A 5AKXA 1QYIA 3ZVMA 2BY4A 2YJ3A 5ALQA 5ALXA 2ODAA 2B0CA 2P9JA 4YIHA 2EARA 3QLEA 1NRWA 5AKZA 4EZEA 5ALJA 1Z4LA 4BKMA 2MU1A 3ZVLA 3FM9A 2YY6A 3ZTYA 3W5AA 1ZS9A 2W43A 1RQNA 3A1CA 1L7OA 4OHFA 5ALLA 2GO7A 4MUMA 3WKDA 3ONNA 3QUBA 5ALEA 5AK4A 2JAWA 1U7PA 3I1YA 3ZWDA 4F72A 4AS2A 3DDHA 4KX3A 3WKEA 2JAUA 1TE2A 3ZI4A 3K1ZA 3NAMA 5ALDA 3ET4A 1L6RA 4OFZA 3QYPA 4BX0A 2ZBDA 1O03A 3S6JA 2P69A 3L1VA 3EF0A 3QX7A 1EK1A 1VJRA 5AVZA 5ALYA 1RLOA 1TJ4A 3PGLA 2B8EA 2R8YA 3ZX5A 3ESRA 5AW2A 1J97A 4JB3A 2RB5A 5AW7A 2I55A 2HSZA 1RMYA 2G80A 5ALPA 2MSNA 3BWVA 4NFLA 3FPSA 3L1UA 3M1YA 2YMLA 2JAOA 4OD0A 4C4TA 1PW5A 2C8LA 1Q92A 2C4NA 4BNDA 5ALTA 2ZXEA 3EF1A 1U2SA 3B9RA 4CNQA 4DFDA 3U7HB 2B8JA 4UMFA 5AM0A 4UAUA 2G08A 4KNVA 2VKQA 3A1DA 1L7MA 5FP0A 3QXGA 3BA6A 4NAVA 4UARA 4FE3A 4XOUA 1YV9A 1ZRMA 5T41A 3U7FB 2HHLA 1N8NA 4EX6A 3WK6A 1YJ5A 4BBJA 2FPXA 3QU5A 4KX5A 2P11A 2O9JA 1JUDA 3E58A 5ALIA 5AW3A 4BYGA 2RARA 3QU7A 3OPXA 4UU0A 3DNPA 2PR7A 3PDWA 3AR8A 3I76A 2YMPA 1QQ6A 3NALA 2B1RA 3EPRA 3PGVA 5ALZA 5AVRA 5AKYA 5AVUA 3HLTA 3W5BA 5AVWA 1K1EA 1RDFA 1N9KA 2Q4RA 2YJ5A 3DAOA 1ZJJA 4UM5A 1Z4QA 2NYVA 5AW6A 1ZRNA 1CR6A 5AM2A 1RKVA 2HEGA 3UMCA 4QJBA 3W5CA 4BEWA 4I9FA 3UM9A 2NO4A 4XQ0A 1RKQA 3NASA 4ZEWA 3RF6A 2C8KA 2G06A 3U7GA 4Y2QA 1RC8A 3N1UA 2I33A 2YJ4A 3KC2A 3OCWA 2WF6A 5AKKA 2IYEA 5AKEA 5AICA 4HGPA 4Y2VA 1Z88A 2OM6A 3FVVA 2BDUA 2HI0A 1RQLA 2JARA 4ZEVA 1CQZA 2IA5A 4YIKA 2CFTA 2G0AA 3SLRA 5IS2A 4Y2SA 3I28A 1NF2A 3WK7A 3D6JA 3MC1A 1Z4PX 2I7DA 2QYHA 3WK9A 1QQ7A 2PKEA 2IOHA 4UMEA 2Q4TA 3OCZA 4BEVA 3AR2A 2HF7A 4Y2JA 2G09A 2HX1A 5JJBA 1ZD2P 5AM5A 3WK8A 4EENA 3AR9A 2B82A 2ZG6A 5E0OA 3QU2A 4F71A 3SMVA 3ZVNA 4YCNA 3ZU6A 5AVTA 3OCYA 4YCMA 4YGYA 2AGVA 2FPSA 4EEKA 3GYGA 1Q91A 5A3SA 1LVHA 1WR8A 3F9RA 5AK6A 4KN8A 2BDEA 1T5TA 2WF8A 4JDPA 3WK4A 1QQ5A 4DCCA 1WVIA 4HGNA 3WKBA 3WK5A 2CFSA 1EK2A 4C4RA 2YFYA 4BX2A 2HO4A 3L0BA 2I54A 4YH1A 3P96A 2X4DA 2FPRA 5AKIA 2B30A 3MMZA 5AM1A 2P27A 4NV0A 3L8EA 4O8CA 1SWWA 3NRJA 4OCZA 5AKJA 3AR3A 3MPOA 5AVQA 4L6CA 3SKYA 4CE6A 1Z4NA 3ET5A 1TJ3A 5AVSA 2FPWA 4DW8A 5AI8A 2AUTA 2ZBEA 1RLTA 3L8FA 2C88A 1L7NA 1MH9A 4L6AA 2WF5A 5AM3A 3CNHA 1ZD3A 2YJ6A 2IOFA 4HGRA 4QQFA 3U7EB 3CZ4A 1F5SA 1QH9A 5ALKA 3L0CA 3KDPA 4UMDA 5ALSA 3B9BA 1L8OA 2FI1A 5ALRA 2R8ZA 3OCVA 4L57A 3W5DA 5AIBA 5AVXA 4RESA 4ZEXA 5AW0A 1Z5GA 3AR6A 3QNMA 4IFTA 2FDRA 2JGAA 2FPUA 4Y2XA 5AW5A 3AR7A 2HOQA 1RMTA 3SKXA 1T5SA 1YMQA 1WZCA 4B6JA 2EATA 3A1EA 1SWVA 5AKLA 3KOOA 3AR5A 1AQ6A 3M9LA 3E8MA 4EELA 3A3YA 1Z4MA 4Y2PA 5AESA 4FYPA 1YDFA 3B8EA 2FUCA 4Y2TA 2CN1A 1YS9A 4UMVA 5ALUA 3U13A 2RAVA 4HGQA 4Y2RA 4KNWA 5ALGA 2HCFA 3QUTA 4Y3UA 3U26A 2OA0A 1L7PA 3OTQA 3RFUA 5AVYA 3AR4A 3FPBA 3U19A 1L8LA 2I34A 1Y8AA 3IB6A 2YN4A 3MN1A 5AK3A 3QUCA 3OCUA 3L0YA 2G07A 1U02A 5AW4A 2WM8A 3R4CA 3N28A 4HAIA 2OYCA 1Z5UA 1S8OA 3R09A 4XE5A 4UASA 2WF7A 5AI0A 5ALVA 2WF9A 4UW9A 4G63A 3N8GA 2GFHA 5ALHA 2O2XA 5ALWA 3QU4A 4C4SA 3E81A 4MWOA 1TJ5A 3QU9A 3NIWA 3J7TA
chains in the Genus database with same CATH superfamily
4HLQB 4F93B 3HCAA 1M74A 3KKNA 1GTRA 1EAMA 5DN6D 1PD0A 3L8YA 4KIWA 2UU9B 1KVRA 1BDBA 2HIAA 1Q7EA 1P8AA 3RAEC 1DADA 2IVFA 1AGPA 2JGFA 3D2BA 4H18A 1YFJA 1KYWA 4JROA 5AI4A 4K9OA 1Z07A 4FFRA 4YACA 3BJRA 1WDKA 2BONA 2OK8A 3ML1A 4I1VA 4Z54A 3DVAA 3GN2A 4HWPA 4KN9S 4IGAA 1GZDA 1SVUA 2FA9A 2EKPA 1Z4KA 3TLAA 4EVQA 1SKMA 5CFLA 1BKSB 3AONB 4K6HA 4KMSA 3NUQA 4G9GA 5JZOA 5H7XA 3KJXA 5FD8A 5KTNA 2D7DA 4TYYA 5E0KB 4O0MA 2C3PA 4Q7QA 3WWOA 2Y9MB 1P2SA 1DAFA 3FW1A 3KYIB 5JZ9A 2YHIB 2RH8A 2JHGA 1YZHA 3TGWA 1I2BA 3ZWAA 4NBKA 1JQJC 1P3JA 3C41J 3W8NA 2XZDA 4NX2A 2QRQA 3AUUA 3ZX4A 1WULS 3DHWC 1LJ8A 5FOSA 4B8WA 1C9MA 2VDLB 4IYRA 1V8DA 2W4MA 4DC0A 1TM4E 1T1SA 1JG6A 4DE5A 4AS1A 4L27A 1WO8A 3TJRA 4O4IF 5ILQA 2C31A 2I4RA 3QJGA 4II3A 2HA2A 3IJEB 4X1IB 1OF1A 1KMHB 1T5DX 3HNOA 5G40A 1XCPA 3V1NA 4Q7LA 3OCXA 4D3YA 4QUEA 2WRZA 4U6QA 5LL6P 3C70A 4G0VA 3CCCA 4UEQA 4BTVA 2V7EA 4YRSA 5FL3A 4A9AA 4QBFA 5L3VA 1E64A 3AETB 2EX0A 2JH8A 4U6NA 5EIBD 3ENZA 3PDCA 1ECPA 2UXCB 1U0SY 4YCDA 1L5YA 1DFGA 1LFDB 4Y2YA 2D1SA 1GVHA 2K2QB 4KQ6A 1FXWF 3OZTA 1T6XA 3DV9A 4K0KB 1IRXA 4U7FA 2AH5A 3TB4A 1JXOA 4CJXA 5BMVA 1SXQA 1VP9A 4NBSA 1CJMA 1U3FA 4BNLA 4JJGA 2J87A 2NN3C 3D3WA 4K9LA 2WJGA 4DDUA 4LF9B 4PC1A 1KS2A 1NNI1 1ZVMA 1L3IA 5DWQA 2IHBA 2HRRA 1B26A 4IQ8A 3WB0A 2OBBA 4XPIB 1BHSA 4IIXA 2L18A 3CUUA 1W6UA 3WQQA 1VKOA 2RK3A 2BEWA 3K5PA 3PZBA 3OI7A 5IJZA 2ZJ3A 3GLHA 1IY2A 1VXOA 3UV3A 5K8LA 1PJTA 4MUGA 4XJVA 3EASA 4GGOA 1DKNA 3QWAA 4QNNA 1M6WA 4CIBA 2HM7A 4CF5A 3O4VA 4EAAA 4B81A 2CKDA 2VT7A 3OE4A 2WWYA 5FV7A 1C8KA 4EA9A 1CIJA 1U8UA 3Q7IA 4EZBA 2XCRB 5KKCA 2RBKA 2HLDD 2XKAA 3PPWA 4O2AF 4Y7DA 2CNNA 1QYWA 4BMNA 4CETA 4PRZA 3MAJA 2J0VA 5KX5A 4Q3OA 4NAUA 3O8LA 4C0SA 5GJWC 5LM3A 3AJAA 5G4LA 1JBEA 1MB9A 2VPIA 3CLTC 3ETNA 3C6XA 3EGIA 1T4CB 4U6SA 3WJ7A 1T0IA 1KY2A 3ZDQA 1SVKA 5KQPA 2WG1A 4OQFA 1K63A 2R8XA 4Q4AA 1TFUA 1T13A 1L5LA 2JDIA 5JFOA 5C1IA 4W4TA 1MABA 2YWXA 5EKDA 2H1FA 4MS3A 1THTA 1V26A 5C32A 6ADHA 4CEIB 1WUTA 1Y3CE 5F98A 2HNKA 4YXFA 1FYEA 3OIGA 2Q5HA 3FM9A 2VA9A 2YY6A 3W5AA 4HYYA 2P4SA 1MRZA 1Y8CA 4X8MA 3QMVA 4IDGA 1EWRA 1CE8B 4U00A 3ROXA 1D8AA 4PZAA 3MWLA 1HQDA 4R84A 2PJDA 4OHFA 5IJ9B 1E2QA 5KOHB 4F1JA 3D1VA 1FTGA 1KH1A 2ZQZA 2ZW9A 3ONNA 3Q7QA 4JB2A 2BV3A 4Q19A 3PYMA 2H06A 3DOIA 3PNPA 2YINC 7REQA 3PHIA 4QZVA 4JGIA 4KHPB 3TZHA 1TKAA 1TZJA 1FTYA 3MTJA 1HXHA 3N0RA 1Z56C 1BCRA 5LWQA 3AF6A 3DEJA 4AS2A 1HTWA 4R9NA 4R68A 5KVCA 4UNQA 1WMSA 1MO4A 5BXYA 4NH0A 3PU6A 4UPDA 4TM8A 3BAFA 4UCXA 1ISGA 2Z58A 3FMIA 2JLZA 2HV8A 2X8LA 5EUQB 4A0FA 2XB8A 1O03A 3CH5A 5I4KA 1UJNA 3OZIA 5CX4A 2GNPA 4NK5A 4O4LB 1FDWA 3RTCA 1EK1A 4GUAA 4JYPA 3LOQA 4ZREA 2FQQA 1Y5LA 9ATCA 3NYQA 4R3NA 3IR7A 4N8SA 5K8TA 4E1BA 2QMEA 3Q5EA 1DQPA 1LRJA 2F2TA 5L3RA 2A0UA 3ER9A 3FOWA 2VVTA 1J06A 4K9KA 1L4HA 2H8KA 5FFNA 4I55F 3C2QA 1YI0A 4IQFA 1QQTA 5I47A 5HZHA 2XZLA 5ALPA 3ZWOA 1KR2A 1SRRA 2KJQA 2WWIA 3TDNA 4ID9A 1NQ5A 5EP4A 1Z5OA 2IF0A 3EXEA 5FAXA 4C0WA 1Y3DE 3AEUA 4EHIA 4LGYA 1Q92A 3OEEA 3HMKA 2FFAA 3OLYA 1T2AA 2FSHA 3FCUB 2G4VA 2NPOA 2XDYA 3CUKA 4G8CA 1UMKA 4OP2A 4B2YA 3AUSA 4NBLA 3CXRA 3MG9A 3SVZA 3KOWA 3QKSA 3L7OA 2ERYA 4XYMA 2IS6A 4E2WA 1SBQA 1E4OA 5IJ9A 4D8TA 1UWKA 5KOIA 1OZAA 1QP8A 4UBIA 5TF4A 1US8A 4NAVA 4YLGA 2ZAIA 1X7YA 2GCPA 3SI7A 1GG2A 2F1OA 3KTDA 1N8NA 5EHZA 1ZCZA 1OH6A 1K08A 4BB5A 1SCIA 3E9QA 4K6OA 1GQYA 4EFLA 3D9QX 4QFMA 3HU5A 3AGPA 1EPUA 1PX0A 1W47A 1EZ1A 2I78A 1ML3A 1XMPA 4QO7A 4D1YA 3DNPA 1N75A 2IZ5A 3NHWA 4HX5A 4JS0A 4HS9A 5BSRA 3V1UA 3KYDA 3KQWA 2C3OA 1CHNA 4OO3A 1K6MA 2WJ4A 3LE8A 2QUJA 4QTUB 1LK7A 4EO7A 1RZRA 2XUGA 1NR1A 1VLHA 1C3OA 3FPAA 4M9XA 2QZSA 5KQMA 1CNMA 3VO8A 4IXNA 2Q4RA 3WXMA 8ABPA 1P6QA 1C3XA 1LUAA 3T15A 5FUQA 1ZA2A 1ZOSA 1C4OA 1J1ZA 2WKPA 3PDJA 5EJGA 4YMGA 4Y18A 2VSQA 3NZEA 3LFUA 4XVCA 3E4CA 2AJBA 2BE9A 4I9FA 4TYPA 3UM9A 2X86A 1T9BA 2R7MA 5IFKA 4KR2A 2Q2VA 3D31A 4FK8A 4ZEWA 1OGIA 2Q1UA 3NHUA 4KB5A 4YRIA 1P7VA 3RRZA 4DJFC 3RK4A 2ZSBA 4IDCA 1SCDA 4YV2A 1FU7A 4R69A 2JA1A 4D3XA 4UOEA 1VJ1A 3A3PA 3VKUA 3E3MA 3ORSA 1H42A 3AESB 1MX3A 4RKEA 3THOA 3UAOA 3MOGA 4M1ZA 3ROQA 2FZVA 4AJNA 2OC9A 4AFNA 2OP0A 1DTWB 3ZY3A 3ZDCA 3OPYB 3NTXA 1XZKA 5CYFA 2PUVA 3FPKA 3IV6A 1NXOA 5DBEX 2O0HA 4MYRA 5AKEA 5HRUA 1MG0A 3VDMA 4MXDA 1V1RA 4YXWA 4K6MA 2ZRAA 1F3LA 5IM4F 1PGOA 3SGLA 3V4RA 2FJ0A 1F7UA 3ADKA 3TD6A 5K0GA 2QSUA 3OEHD 2TS1A 4CDGA 1KJIA 2ATEA 3NC0C 2DKFA 4P3KA 4PPYA 1H5QA 3EIFA 3TUIC 4AG3A 4ER5A 2AT1A 2PX3A 3MOIA 4LRUA 1MA3A 3RW9A 1XMQB 4PZPA 3OE1A 1QGUA 1JMVA 3VR6D 1KMMA 5ECYA 3SX4A 1QP0A 3S28A 1I30A 4MP6A 3WK7A 1X7XB 1ECGA 3VR3A 3DVSX 3VZQA 3G6KA 2MSCB 1FDIA 4PYJA 4B8ZA 2HB6A 3ZCQA 5F78A 1UC5B 2WUVA 4MVJP 1HOXA 1Y81A 2R5FA 3F96A 1IOVA 3AEQA 4UHEA 1EDEA 4DMCA 1QJCA 4KFRA 3JV7A 1K06A 4DJJA 2GJKA 1PLJA 4EF6A 3KDAA 3O26A 1N2XA 2ZG6A 3F8SA 2DWPA 2Z6QA 1YRHA 3CZ5A 3HL4A 4CLHA 4EY5A 1E9SA 4IVNA 3QVUA 1C0IA 5IEBA 4YAUA 3QBEA 4MQBA 2GWHA 1LI7A 4JYZA 4ARZA 1Y0BA 3RE1A 5MDHA 5AK6A 1GTG1 1E7YA 4BO7A 1JIUA 1VKZA 2ZJZA 4B3CA 3UH1A 2EZ9A 3QFTA 2MJLA 3JQGA 4YCAA 3DHVA 3MLBA 4M60A 1AUXA 1KU6A 1VL0A 2D5CA 3GCDA 4Q3NA 4UXIA 1WXQA 3NW9A 1BVUA 2CNOA 4YP9A 3MXOA 3UXYA 4BWGA 1MRSA 1UBHS 2ZBPA 3G0CA 4F5WA 3AY3A 5LWHA 3H9UA 3ZNNA 3A6LA 4DXAA 3SSMA 5DXJA 3EC1A 5COBA 4CLXA 4EHHA 4BAGA 1IULA 3ZIAD 1O95D 2WWGA 4EQZA 2Q49A 2RHGB 3PV0A 2G8NA 1DPFA 2W58A 4Q7MB 4G3XA 4QLBA 1RAIA 1PFKA 3HUDA 4R1OA 3JALA 4BZPA 5H59A 4ZYTA 5LQAA 5DTEA 5HS6A 5ABPA 3LPNA 3NG1A 3AKDA 1GVNB 3PC7A 2V0CA 4JMPA 4QUBA 4DRYA 5AHOA 3F7MA 1F2TA 4WK6A 3WGNA 1NJGA 3CNLA 3GLIB 1ZZEA 4P0PB 1HYEA 4H1HA 4DJTA 2D00A 3AR3A 1L0BA 1VE6A 1NBMA 3U3JA 1E9FA 2VKTA 3ISTA 1N57A 1ZN2A 3FIJA 4XCQA 5CLQA 3WGJA 5JI2E 2ZBEA 2QPOA 5CDHA 4JLWA 3ZEIA 4QODA 1S7CA 2JVKA 4BKPA 4YCBA 1VPVA 3QBTA 3B1WA 3WIBA 3E8XA 1E7MA 4LJ6A 4C3ZA 2ZI7A 1G5QA 2JI8A 1C7IA 2Y1CA 4HGRA 4EIWA 4HI0E 1MRNA 3HRKA 1U11A 5IDYA 1N6OA 2WTNA 1ZD8A 4KLNA 3CZ4A 5EKUA 3P0EA 4F86A 1AD2A 2XEDA 3QE0A 1U5AA 1ENZA 2DLDA 4TOIA 4AZSA 3H0KA 2HQRA 3HPRA 3LKBA 4MRAA 3UPTA 3D7LA 2GN6A 4EQ6A 4LJ7A 1Q16A 5NLLA 2VG8A 4W5JA 5EERA 3MIZA 4HK4A 2JATA 4DMGA 3F98A 4GMDA 3IS3A 3BH0A 3PFFA 3A9CA 4L85A 4AW9A 3HHEA 3AR6A 2WOJA 3DDSA 3K9LA 2QZ4A 4NPAA 2I3AA 1F8XA 1EP3B 2HFKA 2PSHA 3UHOA 4A2PA 1TX4B 2Z2YA 1GTJ1 1R9GA 1IZ7A 1UBNA 4X1OA 1D2NA 1QWSA 4O5OA 4CMCA 2EKQA 1PDOA 1G1AA 3OX4A 4JLJA 1Y8RA 3IV7A 4NPHA 3EA4A 1OBHA 1VPEA 1Z6XA 3L82B 2DVMA 4J75A 3RVRA 3Q1LA 5HUJA 2BEUB 2WJHA 3DVLA 1I3KA 3GUVA 4Q01A 4P0TA 1MF7A 2OD7A 1Q6YA 2XRFA 1AQ6A 2YRWA 3HVKA 2I2DA 3M81A 1DI0A 1O7JA 4L4UA 1DXOA 1XALA 2NXJA 1N0VC 1RR6A 4WE3A 1ZISA 2CLDX 3PXAA 4YHBA 3U1BA 3STHA 2YV4A 1VBFA 2V7WA 2YZKA 4YVFA 5ADUS 2B36A 2C29D 4WOCA 1K5GA 1ZM4A 3DCNA 4KVFA 5KEIA 3BB1A 5KNBA 1SKAA 2WYHA 5GTDA 3RG8A 2H52A 3P0HA 5JHGB 2YS6A 3W2EA 2XXAA 3GUCA 1QLWA 1RXUA 1TEXA 4PHFA 1Y1SA 1XYGA 1XZAA 3G5MA 2W5UA 4YJHA 1V43A 5HIJA 3UAVA 2YYYA 2Q1TA 5MN6A 1XDWA 3E15A 4PNZA 1DCMA 2YCLA 5U4XA 1L7XA 3BE8A 3OTQA 4RZSA 1O4WA 5AVYA 4B48A 2B92A 4QAQA 2JEOA 1L4MA 3L6DA 2TMGA 5JG7A 4N5IX 3UB2A 3L5OA 4RIEA 3UJDA 4UCWA 2JFQA 1DAIA 2VDOB 1ODLA 1GU7A 1VE5A 2OWEA 5CYOA 4IIHA 4MLDA 4R0NA 3VKFA 4CMIB 3R6LA 4Q02A 5LSAA 2P0EA 2FP4B 3JQAA 1N6NA 4RPIA 1JIXA 2Z8XA 5BMVB 2OGZA 1GUFA 4D25A 3D2LA 3MJHA 2E5LB 5JXHA 1EWTA 2EEPA 4P93A 5FOVA 5U1PA 4CKCA 1FMCA 1QLHA 2AEJA 2QRNA 4FLEA 2AR0A 2YOFA 4RVDA 4ED9A 2ZUUA 4HLCA 4HGZA 2WF9A 3GO4A 4D4JA 3G2MA 2IZOA 4UW9A 4E31A 1EA7A 3GJXC 3RC1A 4YB8A 1VCIA 3MYRA 3DL4A 2P6NA 3Q8KA 3FGPA 3LDGA 1VA5A 2XB9A 4DAEA 4XFKA 4JU8A 4KZPA 3SEZA 5DM60 3LDFA 4KUEA 1ZOOA 1GNSA 4Z4HA 3CN7A 3UMRA 5IWCA 1S96A 3G8DA 3M5CA 2QX6A 3I6IA 4V0MA 4NMMA 5F3RA 2QN7A 2ERCA 3SF0A 1KPHA 4I4TF 3OC6A 5EYPB 1HFJA 3WLLA 3ZY4A 1KFCB 1XXHE 2HMSA 1M8KA 2BE7A 3WGQA 4CW7A 2CXRA 3VHQA 5ESWA 2PUFA 5JSQA 1QPGA 1XVIA 2XTZA 3KWMA 2ODTX 2DT5A 1XKQA 1Z45A 4NS1A 5C37A 2G88A 1PJLA 2BZSA 1O87A 2D2EA 1MC5A 2PS9A 2YMMA 3ESAA 3FDJA 3IQXA 1RC0A 3P97A 1G8FA 2DX7A 2ROQA 3Q87B 3MS2A 2VUUA 3PR1A 4M1QA 4UC0A 3KVYA 2ODEA 4YX9A 2IZZA 2PMCA 3VNRA 2JRLA 3G9ZA 3EDOA 3L8HA 3PLRA 1IQRA 3KEQA 4QDTA 4AVYA 1OI3A 5HBRA 2JPDA 4Z1OA 1Z6ZA 3UJ3X 1AZTA 1IM8A 4TLMB 1T0HB 3K9BA 3T3DA 4NNPA 4KGXA 1N4AA 3S2EA 1C0KA 2V96A 3IDAA 4BO5A 3CKLA 1CQWA 1BS9A 3TYXA 2JH3A 4RY9A 3TN7A 4ZJUA 4FSHA 1EVLA 2Z6AA 2C2KA 3UUEA 3UJNA 3D3KA 3H3FA 4WY8A 3QXHA 3VQTA 2XYGA 5FYQA 2PMEA 1QF9A 3BCRA 4KO8A 1V0JA 4JVLA 3EYAA 5KQRA 3GLIE 5EPUA 4C05A 3M9WA 2BHTA 1WJGA 3EISA 4CL0A 3W9SA 1RAAA 3CUTA 5E2AA 1PV2A 2FGJA 2WD7A 5CJJA 3FZQA 3K09A 3K73O 3SC2B 3JAMA 3LT1A 1POWA 4H4DA 1M34E 3N5KA 4CBVA 2GASA 4MR9B 3ZW7A 1QV7A 3SFZA 2J9YB 2VUHB 3WGUA 1I1NA 4N3BA 4UPEA 2A1IA 8OHMA 3WSTA 4DEXA 3FNQA 2PRZA 2B7LA 2JZOA 4NIMA 1V5FA 3RPEA 2Q6KA 4BLPA 3FCOA 1DBPA 1RKXA 1FSPA 3LYUA 2GPWA 2XECA 1WUKS 3L8GA 4EHDA 2HMYB 3A1WA 2XYQA 3GLHB 1QFSA 2C96A 3ACBA 4M8IA 4MI3A 4EZIA 1NG9A 2WMNB 1OZ0A 3MUEA 1RWKA 1J8YF 1DNPA 2FAXA 3GFSA 3RUFA 3G2JA 3LHFA 4PPNA 4YGXB 4G1VA 5A3QA 5JFGA 1ENOA 5HKLA 2C7BA 4I1OA 2NQ2C 1XSEA 2BFFA 4DQVA 4IDDA 2XTMA 1F48A 3O95A 1N6KA 4JSRA 5F1PA 4RUKA 4ETWA 1ISFA 2GBLC 5DX1A 3N2LA 3O8DA 4D41A 1KKUA 4OFXA 1AKNA 3GDGA 1FFEA 1Y6RA 3WVNA 1XELA 2XDAA 2G1AA 1AO3A 3LC2O 1Z15A 3KQTA 3DD1A 4PAWA 4Z4QA 2MINA 3AEKB 3DT6A 3TSCA 3UMYA 1UEJA 4BKQA 5EXPA 3D5TA 4W1SA 2XZPA 1JP7A 2XKBA 1CUFA 1G63A 4IDPA 3X1KA 2A3NA 4UBOA 2NYAA 4CMEA 4UQLA 4QOEA 1CCWA 3CPEA 3WX0A 3K9QO 1KIFA 1DRJA 3GRFA 3I09A 1Q20A 1VRVA 5C18A 2BM9A 1KYXA 3O1LA 4W5HA 4MGEA 2WU4A 1MW9X 2AOXA 3IEXA 4UNNA 5E7MA 3KB1A 4TS3A 4ON9A 5EZQA 2XIJA 1G55A 4N3CA 4YIHA 3BKXA 3WLMA 1R0KA 4C5AA 1Q22A 3ZNOA 1OKKD 5BQ3A 1QF7A 5G53C 3HK2A 1VHQA 2IYOA 3O90A 4HNVA 3HJFA 5JCPA 1S2NA 2ILTA 1ZS9A 1NP6A 3NRBA 3B36A 3IA7A 4I81A 2YHIA 4X91A 1IC6A 1R9NA 3VTAA 1RQNA 1IHPA 1EIZA 1MFPA 1MG5A 4FFPA 4GRDA 4B2PA 5ERYA 1SD2A 3TW8A 1AKRA 2VXYA 1ZCFA 2CDNA 3GNLA 4FFSA 2QTNA 2I6UA 1OLSA 2ZSHA 4RTKA 1UJ4A 1PUXA 2X19A 3DL7A 2IY7A 3DVAB 4RHFA 4U2CA 1HZJA 4WZBA 4DV3B 4A36A 4JAVC 1XEXB 3QFRA 4KAFA 4G0QA 4R9RA 3KQSA 4UDYX 2R8BA 4G0XA 3EA0A 2PSJA 4EF5A 3ET4A 3RHFA 1CEQA 2Z57A 1JSRA 4DKJA 1IOWA 2VHCA 2FLVA 4R0VA 1TCCA 2NZVG 3R1IA 2GN2A 4LY9A 4BVJA 4OJMX 4V0RA 3VU9A 2H1OA 1ADYA 3JXEA 3DCYA 4MKGA 2YIJA 1RE0A 4IW3B 4P08A 4BFSA 5B3KA 4MYHA 4HNQA 1II0A 5IN4A 2FW7A 4KWIA 3NV9A 4HS4A 3GJ8A 4UVHA 3JQQA 3U4HA 3CX7A 2JIZD 4O8ZA 1JTEA 2B4YA 2J3HA 4E32A 2WE7A 4E11A 3T1QA 1S4QA 2GYVA 4XGNA 2GD1O 1E1DA 3LY8A 3MQFA 3T3MB 3NHZA 3U1TA 3ZDFA 1XCGB 2RB5A 2DM6A 4Z0TA 5KWSA 4KR7A 1XRPA 3M9XA 2GB4A 3JS5A 1E69A 5A0TA 5IAAA 2YMLA 1O6ZA 3RUEA 4P9NA 3RJ9A 1A04A 1PW5A 5H3HA 2HTEA 2WWHA 3LWZA 4NLLA 4P3PA 2ZJOA 1YJ8A 2Q46A 3GEEA 3M49A 4P5DA 4E5PA 1BX1A 4H6XA 3SXPA 3HJGA 1TAUA 1CZKA 2ZZKA 2JHFA 4CM3A 4DB2A 1OTXA 3X1DA 1DPGA 4L6IA 4UNPA 3ZU2A 5KNCD 2QKYA 3T12A 1JR2A 3OHMA 4KBYA 1W5SA 2O8VA 5DHTA 4ENRA 1KDZA 3AYZB 1TIBA 2L0XA 4WZ6A 5JEEA 2HHLA 3WWCA 1QIJA 3EAGA 1LW7A 5FTWA 5A7HA 4BBJA 4P2BA 2ZIGA 1YZLA 4NBWA 3KSMA 3OG9A 4X3PA 1QHYA 4BWFB 2FZLA 1W30A 1X1BA 4V0OA 3QEBZ 2Q9AA 2C9YA 2WUFA 4URYR 3FLBA 5JAHA 2W2PA 1VMIA 1KJJA 1ADJA 1OFUX 1HLFA 1JB1A 1KBQA 1THGA 3BDIA 4Q4AB 1JEJA 4G5RA 5I51A 2P62A 2NAFA 3LBIA 1M2GA 2ZYRA 1YAJA 5F1KA 1ZC3A 2HSJA 3GAFA 4F2DA 3ZKWB 1N5KA 1ZJZA 2OCGA 1JB9A 3EK2A 1JHPA 1IPHA 2AC7A 1Q1BA 1TF7A 2G28A 4LBVA 5K0LA 3UWDA 4GE0A 3JQCA 1ZJJA 4UM5A 1E0DA 3HN2A 1MAWA 1COZA 2BEVB 3T06B 1FVFA 1IUOA 4YP1A 7AT1A 2BGKA 3DD5A 3OQOA 3E7PA 3I32A 3UXHA 4MINA 5A4DA 5L7TA 5JV5A 1UPFA 4YAKA 3U7JA 1JG7A 4ARCA 3EWNA 1BH2A 3L1JA 1FYFA 5DNVA 3TLBA 4BEWA 5I7OA 2AXNA 2HUPA 3W7AA 2HJGA 4EK9A 2HA7A 2G83A 1XEXA 5TPZA 4RZ2A 3SDSA 3W2IA 4RANA 3B78A 3O94A 4PAOA 3AOEC 1SPBS 2EP7A 4F46A 4CMJA 4GBMA 5JSZB 1C1XB 5HQ3B 2VUTA 4JLNA 3W6ZA 2VNJA 1AVTA 2P2CA 3KYJB 1O8BA 1AIPA 1K6XA 1XEWY 2AR7A 2GZ3A 4N0QA 4X8LA 2YJ4A 5EIOA 2O0MA 3KS9A 3KUKA 1KBOA 7MHTA 1I1OA 4IDBA 1ZX1A 1UKZA 5AUPB 4LRXA 3ZI0A 3D7RA 4HYEA 1CUYA 4IJ6A 1LVGA 2VPPA 3VPFA 3FNIA 2YX1A 4YDRA 5CVJA 5LUBA 3N2KB 4Y2VA 1T3HA 3LC1O 1BDMA 3A2MA 4J90A 4OF4A 1UQRA 4PLYA 3LX8A 1U2QA 1AB6A 2VPZA 5AD1A 2GX6A 2WIJA 4MV8A 1YJQA 4KQHA 4BMDA 1B0ZA 1X15A 4IILA 2C2WA 4N12A 3ZCVA 3DMYA 2XA2A 3N7UA 1U2ZA 4Y9SA 1Q0UA 2BISA 3WTBA 1D4ZA 3AIIA 1C3LA 4GPZA 2J8ZA 2QW1A 1KDVA 1SR8A 5LLSA 2I7CA 4WI1A 3TK1A 1EFVA 4C22A 1S3FA 2GBLA 5CT5A 5KI6A 4BEVA 5BSWA 2FKAA 1Z18A 1EWYA 4LGVA 2DH6A 2PZKA 4PFJA 2D3TA 1A1SA 1A2OA 1BVYF 4IV0A 4D81A 1IDOA 2J3IA 4IEIA 3S8EA 1CKEA 2PQ2A 4CU2A 2PO7A 5HM8A 2HJSA 3GEIA 3NCTA 4K05A 4M1TA 2RGWA 5K0NA 5LP6A 4WK4B 2OV3A 3UK6A 5IVHA 1XTPA 1GV0A 3PFBA 3N2ZB 1VOTA 4XVRA 2X42A 1XR3A 1JKFA 2PFSA 3GJQA 3GYGA 3VKVA 3SXUA 1N34B 2D8AA 2BELA 3UJHA 1TF5A 4F4DA 1UBMS 4NNOA 1I4OA 1KZ4A 4H16A 4YP0A 5EJMA 4KMOA 4RVSA 1T5IA 2FJUA 3HB5X 2OILA 3H11B 1QQBA 1DV2A 2P75A 2VRWA 4IAOA 4Q4JB 3G8YA 3TZQA 3TZEA 3ZG6A 5T57A 1C7JA 3PC4A 4TMYA 1C9YA 2A0YA 16PKA 4RD2A 4OYHA 1PV4A 3QLVC 3KR9A 3OSUA 5BRAA 4BPRA 1IXZA 1SVOA 1PL6A 1POXA 3IRVA 3QTTA 3IMCA 2I3DA 4X1KB 3WKBA 3BPSA 3CTPA 4YUYA 1QPZA 1KSHA 3GJ0A 3LUFA 1XHLA 2OBXA 2Y05A 3QY0A 2XITA 3JD1A 3QF4B 2ZPAA 5DI9A 2VYVD 1YMVA 1W4LA 3UJBA 4R6XA 2PL1A 3U62A 1LSOA 4LZOA 1YVUA 3IPXA 4LBYA 3CKYA 4Q1EA 3GJRA 4XDGA 1UAYA 3ROFA 4RA6B 3WO1A 3Q15C 3H9EO 3GOHA 4U8HA 5ICGA 1P9NA 3OZXA 5LQCA 4DT1B 2QVXX 2NU7B 3FTCA 2J08A 5DM2A 1Z3IX 5A4AA 2R66A 4U2FA 3DBIA 2GGSA 4FYHA 1TJ3A 2BTOA 4CM1A 2P6RA 3FPCA 1B2RA 3R0QA 3ZZTA 4CV3A 1E2UA 1E2DA 4MQEA 3ZYCA 3EGOA 2Q3EA 3E5MA 3EZFA 1H2YA 4BECA 2AR9A 5K0ZA 4Z2AA 3DW1X 1V4VA 4I08A 2R97A 2GM4A 1XVTA 4L6AA 4RMJA 5DE3A 3SP1A 2WD8A 5BY2A 2R8PA 3FZYA 1X7WB 2J3QA 3I9V6 1IL0A 3W5IA 1DO0A 2NZYA 1Q83A 4O2RA 1ZD9A 3EYWA 4EABA 2Q0SA 3CSSA 5DRTA 5FDFA 3C8MA 3ROGA 1SEVA 3C8DA 1GXSB 2AE1A 3PT5A 1VMKA 2LWIA 4L0CA 4QQNA 5JS7A 1SXGA 2EU8A 4HNRA 3O3NB 1CQIB 4Y6RA 4PEVA 3B9QA 4CUJA 3KT3A 2BTQA 3DE7X 1C30A 4HVTA 3SPXA 5FPSA 2PKRA 4HUJA 1U9IC 4I7EA 4YAEA 1UK9A 2FK7A 3UANA 1U7XA 4CXMA 4LF8B 4C0QC 3D6FA 1KH2A 4NEGA 4K28A 5TPWA 4AG5A 1ZNZA 1G18A 3HC7A 5KYKA 4LRWA 2VQEB 1JFRA 1PG2A 2P78A 3D8TA 1WEHA 4NOKA 4W7IA 2LE0A 2VH1A 5COAA 1Z8DA 4I50F 2VDMB 3JQ9A 4G85A 3UKDA 1U9CA 3FY4A 4LRTB 4NCKA 2OYSA 1X1CA 4TUYB 5L95A 3RK1A 3BMOB 4GMKA 4JOBA 3HYTA 4BC0A 5EUCA 5JE8A 2X76A 5IG2A 2D06A 2ZJ8A 2P5SA 1AKTA 3RKRA 4KWTA 3TG8A 1YOVA 3WAJA 2OYRA 1WW3A 2WFMA 4I1RA 2IW1A 1E66A 3ZCTA 1T5HX 1ZINA 2JRCA 4MWDA 3JCZA 1L4YA 1X2BA 2AI1A 1PUJA 3BERA 2I80A 3OQJA 2EC5A 3HFRA 4Q15A 3EUFA 2AXEA 3OPMA 2XRZA 4HX2A 3PEYA 5I9LA 4EJSB 4Y6OA 1ZXLA 1WVMA 1I2ZA 4MX8A 3WS7A 4C4AA 3HCCA 3HS3A 1RQRA 4L5IA 5AJWA 3PHCA 4MVCA 2FPGB 4D8VA 2P5TB 5CFNA 3BIFA 3T5GA 4X61A 1O6BA 2VRBA 2OUKA 4IFIA 1I94B 2GFIA 4Z4IA 3ZHQA 4DLSA 1KXJA 4B83A 2Y8EA 5FOTA 1ULHA 1KY5A 1MEEA 1N7IA 1X1TA 1NN3A 2WZBA 3JVVA 3G0OA 4GOJA 1SVIA 4OBXA 1MT3A 2UV8A 1ZKDA 4BLRA 2PLAA 2GD0A 3EXHC 5FBRB 3UK2A 2QR5A 4NTZA 4DVJA 5JRDS 2BMWA 2C7QA 2A9JA 5EUMA 3GARA 5J4KA 2W6JA 4L8GA 4DR2B 4G0WA 1R12A 4D26A 1FVOA 2X58A 4CR6A 1T4BA 4EDHA 1I4EB 2WF7A 3AUKA 3QKRB 3HBAA 4XKJA 2HWWA 1ECLA 1XLVA 4LC1A 1ZIXA 1GILA 3USZA 5KPDA 2OLJA 2PPLA 1OT3A 4XWGA 1WG8A 4FXPA 1C3VA 2RBEA 3FSEA 3QU4A 4FGUA 3BWMA 4OXYA 4YJFA 5IXSA 1DUSA 1DIOB 3EODA 1M6VA 3E6AA 1NMQA 4KTTE 4MGKR 4Q1FA 4X54A 4BQEA 1THZA 4IHAA 5DWDA 4J8PA 2EEZA 4Q37A 1JHYA 4TKLA 3TLGA 1P9OA 4U0KA 1G2QA 4AKSA 2BMEA 2HMTA 3N3AC 5HIMA 3JZAA 5IM5A 5JBNA 4ZCMA 3Q7TA 1A88A 1NI4B 1W4CA 5E6SA 4PSVA 4Z0NA 1G7TA 2A88A 2Z09A 2BF7A 3QV1A 1I4WA 2H1LA 1KAGA 2ALJA 2ZI5A 2VNIA 3P2MA 1SBNE 3A0RB 3T4XA 5HW0A 2W42A 4WN9A 3ENNA 2MYTA 2GM9A 3RCBA 1YE8A 2ZI9A 3L7DA 1O6GA 4EGSA 2JFFA 1J8FA 2HDOA 3VVMA 2JAXA 3UOAB 1GFSA 3L9XA 4LYHA 1EHCA 1MQ9A 4J2HA 1QG6A 3OOJA 2Z0MA 4BVHA 4HV4A 3OQBA 3EH1A 4INAA 4TSFA 2HF2A 3O03A 2FSPA 2TMYA 4ZI7B 3A31A 3FCCA 5AR1A 2CXPA 3P5SA 3QUSA 4RXMA 3NANA 5E4FA 4QJIA 1UDWA 3EQ9A 2O23A 3N2NA 2XOKA 2XCUA 1PO7A 3HXPA 4LMAA 4FM9A 2RHJA 2AKEA 1JKMA 3WGKA 1PZFA 2EKBA 2PHZA 2ZTUA 1OFHA 1FUUA 3QUQA 3BAZA 3RC9A 3WRYA 6ABPA 1VMAA 2HLPA 3SVTA 3H8JA 3GJTA 4EHKA 1FFGA 2CL6X 2O1XA 4IDOA 2WZCA 4MUNA 4UE6A 4XQEA 4AKEA 4RY2A 3OPQA 4PG7A 2CUKA 2O8EA 4IVPA 2BGUA 5CYGA 3SSOA 3ANNA 2XDQB 5JTTA 9LDTA 2BZ1A 3AKCA 4XAQA 2WD9A 1V96A 5I7HA 1TUBB 2ID4A 4CV1A 3H9BA 1QBKC 4XQ9A 3ZU4A 1GQ2A 2BFCB 1PR1A 4RSHA 5B58T 4F4FA 1LTQA 2CXTA 3BDVA 4EP1A 1G6KA 3K3PA 4LK3A 4OUKX 4H7KA 3LCCA 3DE4X 4D9FA 1L3BA 3DLTA 1LTHR 2HU5A 4ZVQA 3EMVA 2CYAA 5GQSA 1AUVA 2AZMA 2UVQA 3IEIA 1NN0A 1H4TA 4M9UA 5GVSA 4OQZA 4H31A 1U28A 2BKAA 3PEWA 4YLYA 2YVLA 1GTMA 3T0FA 2WBLC 1C9KA 1CD5A 1G5RA 3F3SA 3NIBA 1E4VA 1E9CA 3X2SA 3GLSA 3L7BA 4NU6A 1XLTC 4PYNA 2C99A 3VH4A 5FNVF 3TBFA 4EW1A 4JB0A 3X1XA 1T6NA 2GYWA 4NG5A 1E2NA 1QZXA 1OXMA 3AL2A 1LEHA 4GXTA 1RMQA 4IMPA 3L6BA 1ZD5A 2QLTA 4XJXA 1JJAA 4HRAA 1C14A 3HUFA 9ABPA 4XGKA 4I9UA 1XFDA 5IXJA 3GCGA 3MTGA 1E6UA 1IEQA 3OQIA 3W4JA 3ANMA 2PUGA 2QTHA 1D3AA 4KVGA 4P34A 3R7LA 4B6FA 4PNEA 4X94A 5ITVA 2OSVA 2W48A 4Q5IA 2ECPA 2L2QA 4M76B 4MUKA 5DHAA 3DZKA 5T4EA 4FFMA 4X3CA 3WGVA 1VL8A 5EOVA 1A1VA 3N05A 2IK8A 5HFJA 3OZEA 3ETEA 2WUWE 4PBRA 5IP5A 4IVRA 4AMVA 2GCEA 1T9GS 2Y1FA 1X80A 4PGFA 5HJ5A 3H97A 1A8IA 4KNYA 5BWMA 3VYSB 2E4VA 2J30A 3LO8A 3KZCA 4IOMA 3DBRA 5GONA 1V5IA 5ALXA 3OZGA 1U31A 2AMVA 2PBFA 2GZMA 1XD2B 3GPCA 3LP8A 4W9NA 3M1IA 3NATA 3UENA 5DNWA 4OHCA 3EGXB 1QTNA 2MU1A 1P2BA 6CHYA 3AH8A 3IKJA 1EE1A 1E62A 1GKUB 2O2IA 1EM6A 1HTTA 2IS4A 3KB2A 4KBFA 4XVQA 1KU0A 5KTSA 4BIMA 4QEZA 3HXOA 1DQNA 1HDYA 2CFOA 5EMNA 1SG0A 3KB6A 3LHIA 5BOSA 4FMPA 3LPCA 2G6BA 3TEMA 3MUNA 4FW9A 5KAMA 1MA0A 3L6UA 4G81A 3C3DA 4V2UA 4HLDA 1G0OA 4FONA 1WA5A 3QH4A 1O9HA 3HO8A 2DP4E 4P31A 4B75A 3Q41A 2W00A 4Z6KA 4RHXA 2DFDA 2YV1A 1Z68A 2W0MA 5IZCA 4PM4A 4WW0A 3AKZA 4TZ6A 4E09A 2ATXA 4E1VA 3VNBA 3IQGX 1Y98A 1RI4A 1G8SA 1CF2O 2G3YA 3FYUA 4J0QA 5FNZA 3WBKA 1SC4A 1W581 2RD2A 2IX9A 5GOTA 5LJIA 4LYEA 1PR0A 5K03A 1PVDA 3RSSA 4CMHA 3FCXA 3PQ5A 3OX1A 4D57A 1YZ3A 2ZTVA 1M2OB 3I53A 3HB9A 1MXHA 2FWNA 4TRJA 4QBIA 2PG3A 3PUJA 4WACA 2JLBA 1M1YE 2Z4SA 1QOPB 2V6JA 3GG9A 4XDYA 2ZCVA 3BWVA 4L95C 2JZNA 1KOFA 5KJCA 2XB6A 4M6WB 2GLUA 1Y80A 3UATA 1C9DB 4LE0A 2VAXA 4C4TA 2C2XA 3EDYA 1A9RA 1XDSA 4JJ4A 5ALTA 4DCOA 1RWVA 3Q3VA 4GM0A 4M0CA 5HS4A 3IOEA 2C2YA 1QH8A 1D2MA 3A1SA 4WA7A 4O08A 3PBKA 1A77A 2XNHA 4C78A 5LQNA 4NXMB 1WCWA 2R85A 4BV3A 5B2EA 2F4VB 3L04A 3AI3A 3FHOA 2J0QA 1T35A 2HJWA 4MQMA 3KQMA 3GUUA 2YC2C 1JX6A 1L7MA 1R0WA 3EZ2A 3GC6A 4WESB 1V4BA 4XM0A 3HSSA 3BBLA 2QZPA 2EJBA 3EEFA 4MVJA 1XEFA 5DTMA 3RTDA 3ISJA 1Z7BA 3TINA 5LCXA 4E5SA 2H9YA 3A6GA 3VX4A 4EMBA 4EB3A 1R4AA 1NL3A 3G8CA 4L2IB 5JD6A 5MF6A 5C5IA 3AMVA 2NXCA 1MFZA 4ZI7F 2N46A 4GPTA 3CSDA 1TEHA 2FP3A 4X62B 3B70A 3BXPA 3EN0A 2W6OA 3MJRA 3R5FA 3N70A 4N3NA 4HL6A 1N2ZA 4LY0A 1KEPA 4FHEA 5DSXA 4HDSB 1D03A 2O2HA 3RVLA 1RHKA 2ZSUA 1HR0B 3EGEA 4MUEA 5A7GA 5HCIA 3NBZC 2RHCA 5IVIA 4DIUA 4UUMA 1M2JA 2H4WA 2SBTA 3Q3IA 3R3WA 5F64A 5K99A 3MMPA 4OQDA 3CEMA 1SBZA 3SYKA 4KK4A 5JAQA 1U9JA 2B25A 4DBZA 2R00C 2XOKD 1G20E 3WWEA 1OFIA 1MHTA 1NHWA 3W7BA 6YASA 1F06A 3IAM1 2CBZA 4B6OA 1V5GA 2TRSB 4E14A 2A4KA 4NZMA 2QTVA 1KEEA 1BDHA 2WTXA 3NASA 1FNSA 2KS6A 4IZIA 4BB6A 1WBBA 2H4ZA 4KSCA 2CCJA 4BEBA 3VSCA 4UM9B 3HFJA 1M76A 2DETA 3ZDAA 3W5BA 4ARIA 3IILA 4MWBA 1XEWX 3ESXA 3V3TA 1JA0A 1D8TA 4EYGA 5IJAA 3L2OB 1WBJB 2VAPA 1YQEA 3JRNA 5IU6A 2PR2A 1OC2A 3N1UA 3MELA 5FRDA 4RD3A 5HIIA 6PFKA 1VIYA 3T1YB 4LGMA 4ND8B 4MZXA 4TV9F 2F43B 3I1FA 3EPJA 3A28A 3L18A 1AKYA 3H19A 4J0KA 5JZSA 3NTRA 1PYOA 4LWZA 2BUCA 3K53A 1HTBA 3MF4A 4RFSB 3ZWXA 1I9GA 4OFWA 4MYTA 4CL8A 4ZCRA 5IZCC 4BNMA 3OIUA 3KSAC 2A9FA 2CXHA 3A2KA 3GVXA 3OLWA 1JWLA 3RYHB 1DQYA 2JARA 1R0SA 4Z9BA 2X1MA 2NNLD 4UCQA 4H27A 3TJZA 4MHTA 1O97D 4MV9A 3B3FA 2QXYA 1LH0A 3OE7D 1M5RA 2LP4Y 3ZDBA 2IELA 5DGCA 5FFMA 4BZZA 4RFLA 1P81A 3AO0B 4AXBA 2EG5A 4KQ2A 5TT0A 3NBXX 1IM5A 2Q4TA 2V59A 1KQ3A 2PGDA 1B00A 2H1WA 1TIPA 2HF7A 3HU2A 5D5QA 3W79A 3THXB 2YFKA 3II6X 4WGFA 1FDTA 3CQ9A 4C88A 1XWFA 5JJBA 1UZAA 2DFNA 4EENA 2VP3A 4A8JB 3STTA 3G2KA 4EI7A 2IDJA 3FYDA 1GNTA 4JI3B 3VNVA 4IUDS 1PHPA 5A6SB 1GUBA 4J94A 4MI6A 1E32A 1CUJA 2WNSA 3HUEA 2QEQA 4FNOA 3C7AA 4G1FA 3D8HA 4MV3A 4LJSA 3RF7A 4HRXA 2QDXA 2YHUA 4AQ7A 4G0ZA 5I7UA 1N1GA 1AY0A 3H99A 3OPYA 1YFLA 2Y27A 2ZS7A 3EZGA 1G4AE 3FOCA 4KQIA 1IEWA 3FOAA 4WRRA 3FVRA 3UWPA 1R4MA 1QONA 5CPFA 2P4QA 5E7JA 4MP8A 1W85B 5GY7A 1RPAA 3QPDA 2CDRA 2E49A 1G98A 1QRAA 4DJ5X 4AY5A 5KWJA 2O2YA 2ZPTX 1HE1C 3PHHA 3WBFA 1OI4A 1OVGA 4O4IB 4RJLA 2IYPA 5A6SA 4Z8YA 5LMUB 1JXAA 4DR7B 2C9DA 1VSUA 2V54A 4UXJA 2BZ0A 3HCEA 2ZPUA 3C1OA 2XGGA 3IVXA 4J16A 2Z4TA 4NP6A 3I04M 2FWMX 4AC9A 1AKEA 5TJHA 4WXMA 3IUQA 3K9HA 3KJFA 4X7PA 2G9ZA 1KIMA 4HYQA 2PUBA 1AS0A 1JLHA 2C57A 5IHXA 3PG5A 2LGJA 1BVRA 2I87A 5DT2A 2C03A 4BDTA 1ZLXA 1N4DA 3S7TA 3TRDA 1OX6A 3ET5A 1P5RA 2FDXA 3DLIA 2BGWA 2FW0A 4DXDA 3P9PA 1XN1A 2Y1KA 1R3DA 4YMVA 2QTBA 3VHRA 4Q00A 3VKHA 1U0FA 4LHYA 3WNVA 1NW4A 5BYJA 4FQ8A 1CQPA 2IYFA 2QJRA 2OAGA 1XDZA 3GEMA 5J2TF 5FO0A 3U4GA 3UBMA 1J7KA 2Q1SA 5ICEA 2O8DB 1WCYA 2AF4C 2IOFA 1W8IA 2PJZA 5K3OA 3OBBA 1IK6A 2HLDA 4HWOA 3WIVA 4PZCA 4EARA 4QEDA 2R6CA 3UAGA 4US2R 1J90A 4G4GA 2O3QA 3RS2A 1ZAKA 4NKRA 2QG6A 3GLGA 1JJIA 1IXYA 1IBSA 1NLFA 4URHA 3QVWA 4DB4A 5C81A 5E9JA 4CT4B 2R8ZA 3AEZA 2RIPA 3B5IA 3QVKA 3W5DA 3DLAA 3FSGA 1UP4A 3USCS 3FE2A 1VZ2A 3TMKA 2NVUB 1F60A 3P9XA 1ILWA 1SA0B 1XA3A 2ZJ2A 4R8VA 1LK0A 2FPGA 3H9CA 1FTWA 3HBFA 1TPZA 4PHGA 1LBEA 4DL9A 2ZCJA 3L41A 4Q3KA 1IN6A 4R1PA 5I8PA 1OJ7A 3GEDA 3BIXA 2PDAA 2GA8A 4J3FA 3GEGA 2E1PA 4INZA 4L8FA 4LFCB 4MIYA 4J49A 2REBA 3E5RA 1D6MA 3V4PB 4F11A 2VP2A 5HK9A 2A1TS 3KFVA 4I3FA 3RSHA 2H0RA 1T5SA 3OEHA 2R1VB 1A9TA 5DBHX 4GMGA 1E2MA 1AK1A 1HURA 4AJPA 4H7JA 4B45A 1M2VB 4PCAA 4RWZA 3HKCB 2VLBA 4M38A 1MO2A 1NY5A 4FN4A 2D1TA 3GK3A 3HZZA 2W22A 3DM9B 3CKMA 4E7PA 1NXWA 3UN1A 1OH7A 1WF6A 4OSPA 1KZHA 3TNLA 1ODJA 1UBKS 3EVDA 4R1QA 2WFLB 3T9BA 5EIXA 1D2RA 2HZ7A 2F67A 2OLEA 3DFZA 4FYPA 4TLAA 1FYDA 4UCFA 1K7FB 1N2HA 2VDNB 3R9IA 1ETHA 2FUCA 5LLDA 3ROZA 1N2GA 3QM1A 1HV8A 4X9XA 3VR5A 1TYBE 4KO1S 3U13A 3ZU5A 4KWCA 3WYEA 2VYFA 3AM3A 3NM6B 3EFHA 3WLFA 4D2IA 1Z62A 5EJ2A 3GA7A 4AY2A 4IZOA 2WY2D 5C4MA 1NVGA 4JI0B 1PJ4A 3CNBA 1GOTA 4FGZA 2Z4RA 2GDJA 4YROA 1H8HA 2C1EA 2LR0A 3VHXA 4RIFA 1L8LA 2GF2A 5IMSA 5T7BA 2DWQA 7GPBA 2KLBA 3DXFA 4FTWA 5A05A 3FSGD 1PDWA 2J0UA 2WZQA 3SZRA 3QENA 1XZ8A 3RU2A 4DLZA 3PJGA 1OAAA 2DHCA 1JILA 2YW2A 3UT5B 3R4CA 1I5RA 1ZWLA 2DYKA 2R6JA 3RUDA 4CV0A 4REQB 3RAFC 5B58C 1GPH1 1ZIYA 2HMVA 2IDZA 2LDBA 5THXA 1E7QA 3W8EA 1GPLA 3IIJA 3CW9A 2Z2IA 3O21A 3AVOA 4MQEB 1NJ2A 3X0DA 1SBHA 2D13A 4HH1A 4W7SA 4XB2A 4DQXA 3PDHA 1DWUA 3COJA 4PQEA 1OXVA 1Z35A 4O4JF 3KQNA 2FWIA 3GRVA 1NC1A 4EUEA 2GTPA 3U3XA 1DFIA 1T4CA 1VIAA 1LSJA 2HK6A 4P6VF 1TMOA 2H31A 2ZJBA 3WWYA 3OA2A 1M7BA 3QA9A 3BCSA 1EU1A 2FN4A 3FYUB 1YHNA 2X5OA 2ZYSA 3MTAA 1P31A 3SMQA 3AT1A 2YWJA 4QYIA 4BMOB 3AIKA 1O89A 2A6PA 2Z43A 3BGDA 3L4SO 5CX1A 2TMDA 3EE6A 3PIIA 3S1LA 2G1UA 4FJ0A 3VR1A 2ZSFA 1YNOA 4JVMA 5I3ZA 2WAMA 3RARA 2KHZA 2PT5A 4TXHA 1ESEA 4MGYR 4YJGA 1DBRA 5EE3A 3I12A 1X1EA 1KYZA 5K2OA 2CMGA 2B21A 4OQ4A 3ZZMA 1V8ZA 2B35A 1GEEA 2AC2A 2D0DA 3T9CA 2GHTA 4KPYA 4DIOA 1XAIA 5ALNA 3ZBPA 1A7AA 3TG2A 3CW8X 3SHQA 1PT7A 1SN7A 1VMDA 3G88A 4P84A 5K4AA 4MMXB 3SC3A 3JRXA 4LTDA 2CNWD 3AB8A 3R5HA 1LWOA 3OZBA 4RMIA 4Y6GB 4D9NA 2RHDA 4N5HX 3G68A 1DARA 3LJKA 5FBQB 1Z4IA 2P5YA 2Q2NA 2QD5A 2B34A 2XIQA 3DTVB 3GFQA 4WJKB 5IKOA 3WWPA 4QEKA 1OLUA 4AF8A 1Q1GA 2VC2B 2OV6A 4DKXA 4CI9A 1V16B 1FW8A 3A06A 4N40A 2EWWA 1MGPA 4PSCA 4W6QA 4C14A 3EXFA 3D64A 1IU9A 1IUNA 4TV8A 1O95A 1ZC4A 1O08A 3QG1A 4XRGA 2R00A 3MWDB 2YBDA 3HWWA 1J56A 1DAEA 2W2LA 4CL2A 3G2OA 3ABSB 3R0VA 5E3JA 3R5SA 4MOWA 1MQAA 1SO8A 5CBKA 1RRPA 4I9NA 5EQJB 3LWNA 3BWDD 5FBWB 2F9FA 5IBQA 4ZDKA 4QPCA 5AKGA 1J07A 5B30A 2MINB 3AEKA 2RGAA 3R7FA 1E99A 1F0KA 3QEOA 4INPA 3S2UA 1HF3A 1Z6GA 1YB6A 1XKLA 1P4SA 4LW8A 4RGVA 5KKNB 3H7AA 3LUKA 1YCGA 3CUSA 1QNFA 3DHEA 2PMDA 3F7TA 3MCAA 4TTAA 1GCGA 2HL6A 2Q4BA 5KVQA 1BTOA 2KE5A 2QXUA 3CPHA 2P30A 5F7ZA 4F9EA 4HQOA 1HNNA 4IUCS 1BX3A 1SUSA 3WKAA 4ZK2A 3EX7C 1GDTA 5ALOA 1ENYA 2N9UA 4GIBA 4ZT4A 5AOCA 4DYVA 2DPYA 5HIAA 2H2WA 3HJCA 3OICA 3E5NA 2VTBA 4BP8A 1Z2CA 5DNUA 4S1VA 5IASA 2EAUA 3GDOA 3N8HA 2ZIVB 1W0KD 4LHVA 2FLKA 4Q3BA 1WY7A 2ZRKA 4LI0A 2UVPA 1ESCA 3WDKA 5I7WA 2WWXA 1ZCAA 3BILA 4ARSA 2QUBA 2VP0A 4Z4GA 2B5OA 3ELUA 4A8JC 1MIOB 3WAGA 2CLIB 5HA5A 3SSAA 2VHQA 4OLBA 3DDZX 4HYTA 4O2AB 4HN9A 3BZUA 5LOVF 3WMEA 5FLXA 5AI9A 1GZVA 2HYIC 4HB2A 4GBED 2AFIB 4GOKA 3EFEA 3FCSB 1NZFA 1VI6A 1JBQA 3G5UA 1E3WB 1HYBA 5LKAA 1W2WB 1DKMA 4PC7A 4PLHA 2WAAA 2QMHA 3UYKA 5L8VA 3CH6A 3GFBA 2PYDA 1N92A 1J2UA 3A4MA 1ACJA 4M55A 3QYAA 5AM4A 4ZI2A 1C4XA 1A9XB 4OXXA 1ZMXA 3EGWA 4XEHA 2YY7A 3WYAA 4BO2A 1KERA 2ADMA 2YHSA 4QVIA 2DEUA 4B3XA 3PD7A 5BN4B 1QGUB 3KAJA 4ND1A 4WKGA 2FUKA 3GZ4A 3HB4X 3CLSC 4L8YA 1OV6A 3OKAA 4WXEA 3R74A 2PSDA 2QROA 4IF6A 5F9FA 3PC8C 4RK7A 2ZCUA 2CSUA 1AHIA 3I23A 2REQA 3HSYA 1BU5A 5ALJA 4BKMA 5KSWB 1MIOA 5A2GA 2Q5OA 3AERA 4FDAA 1L5ZA 4JA2A 2ZREA 1G8PA 3S4YA 1LI5A 3O1IC 3G23A 2E21A 1GYRA 1E20A 3NVDA 4I99A 1G5HA 1NVVQ 2NZWA 1EGHA 4WY5A 3CRVA 2PGXA 1I5OA 2V7VA 3C3WA 4UU7A 1YRBA 3PX2A 2O4UX 4CKYA 1N5IA 1NJ5A 5A04A 3HI6A 4BMCA 4C0BA 4YMLA 3KP1A 3S2IA 1OA0A 2PK3A 3JQAD 1PUIA 4GM1A 1E6KA 3RVKA 3WKEA 3WV5A 3T7SA 3N2YA 4NULA 1C4WA 1HYQA 4MKZA 3SM3A 4R2WA 1INLA 1K5DA 3RQIA 3ZW8A 1Y3FE 4LZLA 5AP9A 1MB2A 4AUKA 3PSAA 1LBQA 1LTKA 3RYIB 3S68A 4HTFB 1UANA 1UXGA 2J7PD 1EFRD 1ZPDA 2O5RA 1MOQA 3FYCA 3KXIA 1P33A 4ZJZA 4UHFA 4UREA 3VZRA 1PT9A 4C0XA 4XYGA 3LI2A 2FETA 2AS0A 4JYCA 2OZPA 3IR6A 4OM8A 1YZUA 3CTMA 2M98A 3VR4A 2VBCA 5A1JA 1EX7A 2R8YA 3D02A 2H08A 4FOPA 1J8QA 2GI4A 3JD2A 3RNLA 4EA6A 4X65B 2HY7A 4M9RA 3RVSA 4FW8A 5KYWB 1E3IA 3I42A 2Z04A 4Q7EA 4CM4A 5AW7A 4M7OA 4PG5A 2H1CA 3QSGA 3TIGA 3KK0A 1VE9A 1PK7A 3COZA 3QYJA 3I2IA 5A0VA 1TJPB 4R1SA 4DIBA 4EO9A 1JFFA 2X0KA 4B7UA 3QEJA 3JTEA 4KXYA 1VLZA 4WZBB 2CLFB 4BNDA 1C3JA 1FP7A 3F6YA 3T7EA 3G2IA 1NV9A 3U7HB 3NT2A 2QY6A 3WAKA 1OU0A 4IIJF 1AA6A 2WPDD 3B2QA 4MRSA 1OWOA 3B82A 2V3WA 5LD2B 2RONA 3T3NA 1PTJC 4OJNA 4BQNA 1IG3A 1WW8A 2O7RA 2OORC 4ZO8A 2C7OA 3F78A 4BJHB 4DCPA 2XF2A 4JSTA 4CU5A 1BYIA 4P4TA 1KEWA 2Q4EA 3L7AA 3OURA 3N86A 4ZA2A 4CM5A 1XZNA 2Q4OA 3GXOA 3QMPA 3R3HA 4KMMA 1SCNE 2FPXA 2IYSA 3L93A 3NYRA 3V9AA 2VLIA 3RUHA 4TKVB 1DIAA 3SX0A 1TYDE 5AW3A 1B8NA 4BMSA 1Z17A 4MJXA 1K3FA 3RR2A 5IJ0A 3IFSA 2I9PA 1EZ4A 3WGTA 3HR4A 4WOBA 3RJTA 5JTUA 4S04A 1Z3CA 1Q1EA 2WLTA 3QVTA 1R0YA 3MD0A 3PWTA 1UCFA 1RLUA 4IYJA 3W9BA 1DAPA 4MUIA 3NDRA 3VH3A 3RJMA 3KEOA 5JH7F 1JA1A 2ZYIA 5DSZA 3CZQA 3PE3A 3FOBA 5JT1A 4HTFA 2ISQA 3C5EA 4MW9A 1KKLA 3TM5A 2PZMA 1JSZA 5ER9A 4MQUA 5JLAA 4BCCA 3ORYA 4NNJA 3WADA 2NU6B 3HWSA 3ONDA 3ABRB 1ZWKA 1XG5A 1M6HA 3AZPA 4LOJA 4RD6A 3WGOA 4COKA 2QP9X 2VSFA 4EW2A 1T29A 2YXEA 3K7EA 5LU9A 3AUJB 3QVLA 1JFSA 3A26A 3RF6A 3Q7EA 2DXIA 2DECA 4FYMA 1GQRA 1Z6QA 5CFRA 4QT4A 5B3LA 3KWFA 3U7GA 4CHGA 5DP2A 2AX3A 5FPKA 4HFJA 4HPJB 3IDZA 4FXOA 4MQFB 1XAHA 3T1NA 5JCOC 1V8BA 2ZAYA 4HOYA 1PJRA 1OYYA 5K2MA 4C07A 3VC3A 1NW3A 1L5HB 3TBHA 5JHHB 3UW1A 2C61A 1X1AA 1B93A 1PR2A 2VK2A 3WWZA 3LHKA 2IYEA 4I4TA 2QJTA 4KXVA 3D0QA 3RB8A 4ROSA 3ZHSA 4N1AA 3QVGA 4US0R 1DC5A 4GI7A 2GVDC 1E1KA 1KQPA 4M83A 4IIDA 6NULA 3ORFA 5CA0A 5IN5A 3DT9A 1OTYA 3GZJA 5FAKA 1MABB 1H94A 2C7PA 4QATA 2QI9C 2QX4A 4X6UA 1YR2A 2F3SA 2B94A 3OQ6A 4HMPA 4ER0A 5I9IA 3UUGA 5F21A 4MPRA 4ZT2A 1H0KA 2QUAA 3RRBA 4KO4S 4QX6A 2EBUA 3LK6A 1GAXA 2PRSA 3A25A 2JJYA 2W4QA 4TV9A 1F9EA 4WXRA 3C39A 1FF9A 3ICQB 5KCZA 3OJWA 3BWYA 1EUDA 4X60A 2V98A 4KVAA 1N77A 2D1QA 1PBTA 2GRUA 3H13A 1TW2A 2F8LA 3KVRA 3GRUA 3K8ZA 3ZD6A 3NAZA 3NHAA 5AM5A 2AFIA 4Y30A 5DU2A 3MFQA 2GBGA 4YAOA 2RH9B 1UK8A 2FMUA 3H2HA 2EQAA 5D3ZA 4LY6A 3DL0A 4HUQA 1HBJA 2M32A 3BJIC 3OY2A 1NW9B 2JAPA 1S1MA 5B6JA 1HE2A 3OWHA 1RYNA 3EUEA 5CK4A 3M3HA 2MSLA 1JWBB 3JQDA 3BHMA 3LL4A 1OA1A 4FFLA 1XJWA 2ZE6A 4QREA 4CL3A 1E1QA 4YJ3F 4C89A 3PI6A 3TW8B 2WF8A 4JHXA 4BGUA 5T4BA 5CP8A 4K1LA 2VAMA 3O0DA 2Z95A 3TIIA 1GL3A 2GKSA 2O57A 4GLBA 1N6RA 1G8KA 4XXHA 2E9SA 2Z9DA 4G1BA 4XD7D 1VKNA 1AKQA 3IAXA 1DJQA 5DOZA 3SZGA 2PANA 4FUTA 3WLOA 1MB0A 3K05A 3FYHA 1VC2A 3CRW1 3SDZA 3KKOA 5FPTA 5HRCA 4FPXA 3UNXA 3MW8A 1D2HA 3L0BA 5EJ8A 5BNZA 3A4YA 1UBSB 4NATA 1HO3A 1SC1A 2PXHA 2BTEA 5DCYA 4R71A 2WV9A 4XUDA 2FFHA 2GN9A 2J3EA 1KDYA 5JS8A 3WHLA 3SQLA 4UQOA 4WOKA 2W70A 1Z22A 2EXXA 1OROA 5AVQA 5E9AA 3OCJA 3OLZA 1UFVA 2PKQP 2VJQA 3FNRA 2AUTA 4QD3A 2Z9BA 5KOYA 3P9CA 3ZDZB 4AECA 3ETCA 1Q0LA 2A9QA 2ZSDA 5CPBA 5JNLA 3EIQA 3EIUA 4WVFA 1FJHA 4C5CA 3UGKA 5DXFA 1VIDA 3IA2A 4XM1A 4DQUA 3ZE1B 4BHTA 2GSWA 1IJEA 3BD9A 3QBDA 4ODIA 2R5NA 4YQEA 2UKDA 721PA 3FFAA 5BORA 3FNHA 3GFOA 1EP1B 1LX6A 1QH9A 2RK4A 2SHKA 2WJYA 3EVTA 4TQUS 1MP0A 2SNIE 4J9VA 5AHWA 4GNRA 4BQRA 1NMEA 1JQLB 3KSBC 3S99A 1M75A 1FNDA 1XVVA 3INRA 4ZQFA 5C7OO 4IX1A 3QXJA 1J42A 2H07A 3ZDXB 1D09A 4L9SA 5CXXA 4ZEXA 1TUGA 1ONNA 2PZEA 4MCJA 1KSFX 2C8JA 3MCZA 4L4SA 2X14A 4V2IA 1CIPA 3A2NA 3F9CA 1SXJC 3OA0A 4GU5A 3URKA 4BXOA 4DZTA 1Z73A 3KCNA 4JLDA 4OQYA 2A9VA 3R7WB 4ADSG 3TPFA 3HVRA 1XZDA 5BMOA 3I92A 2HOQA 3U4DA 2IV3A 2RGXA 1EFUA 5L45A 3N76A 1BO6A 4N6NA 2W9XA 4J9UE 1YA8A 2B2XA 2QN1A 4PSUA 1E3SA 1W4AA 2V03A 3CW2A 3TSZA 1Z4MA 1HA3A 1A5BB 4YREA 3WISA 4PLGA 3KYDB 3OIWA 4MP3A 4HTAA 1UKBA 1SCUB 5HZMA 1PGQA 4E5UA 5I7FA 1PR4A 1R00A 4HBZA 1U5BA 1O3YA 2QMQA 1W2HA 2FH5B 1K9VF 3AI7A 4Y2TA 3TGPA 3KZOA 1KI4A 1XU4A 1H6DA 2PA3A 2X15A 4AF7A 1U04A 3EC2A 3KXKA 5ETJA 2UUOA 2CLMB 2PT6A 4GDMA 1IE3A 2IYQA 3WHKA 3JAWA 4MQ5A 1L5KA 4F9GA 3Q4GA 4TL6A 4IR7A 2F43A 3UC9A 3FNEA 1VRWA 2XUJA 3ZE9A 1FS4A 1IAVA 1I9CA 3MHTA 2IYWA 1A0OA 3LBNA 2GAAA 5BWNA 2A84A 3QKTA 4EATA 1K8YB 3F4LA 4MKXA 4YJ2B 4ZRDA 1ORHA 1B43A 3LH5A 4DDTA 4D8UA 3WYDA 1LC3A 2DQZA 1G41A 4WXYB 4IX9A 3RYFA 4AJ4A 3O3CA 5GOZA 1Z5UA 3PGXA 5LP6C 4ESHA 3NC4A 1TI7A 2QAGA 3CX4A 3IGFA 4GZ6A 2F62A 3IEPA 4LK2A 2R7AA 1GL7A 4GICA 1DE0A 3BXEA 4R2MA 1XMJA 4J3NA 3MSCA 2HFJA 2PV0A 2ANBA 1F2DA 4JC5A 1GNRA 4X1YA 3RYCA 5IT9A 4IINA 5ALHA 2FUG1 2QVLA 1CUEA 3LRTA 4NJMA 2W8ZA 2KYRA 2ZXUA 3EQ8A 3E81A 2ZB2A 1ZDMA 2I7XA 2GXSA 3GUHA 1Y8ZA 4DABA 1FYWA 3GH3A 4S2UA 2G5GX 1H8EA 3OMXA 1V35A 1W1UA 3TQFA 4IHKA 2I03A 1ZBDA 4R8RA 1IEVA 4PO9A 3K20A 3Q9LA 2XLCA 3T34A 4JV5B 3HHPA 2Y1GA 3LWBA 1Y6JA 1I10A 1V47A 1PT6A 3CRMA 1T10A 1G6HA 2D3WA 3WLRA 1OWNA 4MGIR 1E6WA 3ZXYA 2JCBA 1GPJA 3KRTA 2JFVA 3EZ6A 3P2IA 1K0UA 4JR2A 3NRCA 4WERA 3M8KA 1K7EB 3R5TA 5IH3A 2MMGA 3AHIA 5FB3A 1UP6A 3R7DA 3RLFA 3TL3A 3VBEA 4PZYA 4RGBA 1IY8A 3BH6A 5I9MA 2X6RA 3U4CA 3LQ2A 4ZT5A 3ZQKA 2FMXA 5LN1A 3KR0A 1S2OA 1JQBA 3R6GA 4ZAWA 4IG4A 4IWYA 4GP7A 4OOEA 2FZWA 1CSEE 4MUXA 1JXQA 2GEBA 2C8VA 4B3RB 4PC6A 5KHAA 1QK4A 4MS1B 2FSIA 2IYLD 3K30A 4YRMA 1OUMA 2B78A 1Z6AA 5FA6A 3ROKA 3ZWVA 2W8BB 4V38A 5B1EA 5KUTA 3I6ZA 3QFFA 1J0XO 2Z6VA 3P9IA 3K96A 4NWIA 3TRIA 4MUHA 3CVYA 1W7AA 3KJEA 1JEOA 1KI2A 1ZGBA 3LVBA 3IAS1 3RIHA 4AROA 3H2GA 4Q05A 1J2EA 4EPVA 1WBDA 4ME6A 4EMSA 4KKVA 5CHEA 5IVDA 3HH8A 1G7CA 3MLEA 5K5EA 5LQUA 5E6UB 5BUCA 3L0OA 1J8DA 2IOFK 3I2JA 3QRWA 5LDDC 2V58A 2YYSA 3NPAA 2YY5A 2GJSA 4HAVA 4NZNA 5AYVA 3SIXA 4PIMA 4WA8A 3B53X 5KJ6A 1Y9EA 4ALJA 3FA2A 3O3OB 1E8MA 4RF4A 4G86A 4M9SA 4O5AA 2Z2JA 3ZS9A 2NP7A 4L73A 1QFXA 5CRIA 5BN3B 2C42A 3D4LA 1O5IA 1GO2A 4RKWA 4RPJA 5CA0F 3HCWA 4V39A 1Z4JA 1BEUB 3ZZ1A 4A26A 5KVSA 3VDNB 1LF5A 4DLWA 4P83A 3ZCXA 4IJUA 1X9IA 3KUXA 4XYLA 3LDHA 3P0FA 4X63A 1VBMA 2V9PA 4PCUA 5CTAA 4D6XA 2F3PA 3E53A 3T41A 3K0SA 2DERA 5PGMA 4AMBA 1ZW1A 3ZHCA 2FRDC 4BNZA 2HPAA 1D0SA 4DY4A 4J1TC 2JGJA 1MTZA 2ZJAA 3ZWCA 5BOSB 5JPCA 3J81k 2BN4A 1P2TA 2JDID 2Z1MA 4IBOA 3A10A 5KINB 3CU5A 3QY9A 2XUHA 2XZOA 5LNK1 2W6JD 2X40A 4DR1B 1GTL1 3GGOA 3ZUPA 2B99A 4ZT7A 1C8VB 1TZBA 2QQGA 4KKXB 3TX6A 2FEMA 3VR0A 1I2CA 1V7QA 2BBOA 3L49A 3LLCA 3NKFA 5L3QA 4HAYA 2ISCA 1PNQA 3N7AA 3QVVA 4B47A 3C3BA 3RJZA 5H3CA 2WIGA 4G37A 3H3XA 1DMSA 1SQGA 4O4HF 3GV0A 1MX1A 4MPDA 3DAFA 2PO5A 2HQ1A 2RGNC 4LV5B 4KREA 2AJ8A 1IRIA 5LP1A 2H7YA 2PLFA 2YHAA 1AZLA 1NUTA 3EIEA 1NDQA 3MCUA 4ARZB 2I66A 1T1RA 2CB9A 4CRWB 4MWCA 4TS1A 2QSYA 4A1FA 1UPTA 1ZVJA 1N7GA 1UWVA 2JJ8A 2WTMA 4OHWA 1G3UA 1FMTA 1XTSA 1PSDA 3CRZA 3ND9A 1AGNA 3PIDA 1X92A 4J0JA 4NFHA 4Q3AA 2IHNA 3HBLA 2JJ1A 1CEYA 1UBRS 1T2VA 1TJYA 3GDWA 3L6CA 4J3JA 1QYIA 5LOVA 3AM5A 2Z56A 1LK5A 2H4XA 5ENVA 2OAP1 3HY6A 4TLBA 5HFAA 3RQSA 1ZU4A 4AZVA 3ICEA 2HJRA 3HBMA 1MEJA 1TO2E 1XPRA 4HADA 1B1AA 4PYKA 2CVZA 1NW8A 4FNMA 3TTTA 3FTEA 3I34X 2RKOA 1FIUA 4OSEA 4CGYA 3ZYZA 2CSXA 2HMUA 4CODB 1EUYA 1SRQA 2P2YA 4LYYA 2PH3A 3N0TA 3U61B 4ND8A 4RHEA 4YUVA 3V2IA 1ECBA 4WBSA 4IP0A 4BJ3A 3N75A 2FPPB 3VI3B 1WZEA 4EG5A 3QPUA 3WFZA 3ADPA 2DLNA 3JRWA 5CXQA 4AQDA 1HLPA 1UM9B 4DPLA 2AG5A 2OORA 4IZHA 3OZAA 3G1UA 5EUBA 1PR3A 4P7GA 1FJ2A 5GONF 5CVTA 2ZR7A 2OHFA 2XSZD 2XTJA 4PHCA 5CJ2A 2FW1A 4BRSA 5K0TA 2YH2A 3EBPA 4FDTA 4W63A 1QBGA 3T7IA 1BWRA 2YVKA 5JOQA 3BSSA 4BQPA 4FKMA 3L7MA 2JD2A 4RCYA 4RM2A 2JGIA 5CYPA 5EYPA 3VR4H 4KFCA 1K7XB 5LOVB 1V8PA 1MVLA 1RPJA 3S6JA 4UFNA 4BNXA 3M6VA 4J0CA 4QL3A 4R8KA 3SZUA 1CS0A 2P3LA 3CLVA 3DWEX 2IYZA 1QGED 3QX7A 2YXBA 2AOTB 4F2GA 2EWMA 4OKSA 3HEMA 5CT8A 4ZOAA 3ESBA 3ZZUA 4GGPA 4FOSA 2JVJA 1RFGE 3RROA 2H2FA 1E3QA 2J46A 3DXXA 3FI0A 2VWHA 3CG4A 3PGJA 3ESRA 1W5EA 4BFXA 5ESRA 3RSCA 1XFAA 3CE6A 3MT8A 1UDXA 1FB5A 1W52X 1Z5ZA 2QQ0A 1AMNA 1Q95A 2G1KA 5J40A 5JLJA 4X0EA 2WYIA 3VMMA 3LNTA 1XAJA 5H9WA 4PIVA 3L1UA 2BM8A 2GZRA 4OAPA 3QHQA 1NJ8A 3FDXA 4WHMA 1QXSA 4NG4A 1N3LA 4KH0A 1VCNA 2KPOA 4CVNA 4EB6B 5AJUA 4JKOA 1OAKA 1XU7A 1J70A 4JX8A 4DTCA 3VR2A 1E7SA 1NIJA 3PLNA 3S40A 1HEYA 2CVPA 4BO0A 4YCCA 4JJEA 3T5AA 2FZKA 5TS3A 3KE8A 2BFDA 4YONB 2NUAB 3LCRA 4Q03A 3TSAA 2WILA 1MQ8B 4O1HA 4M9ZA 4QYMA 3ZHRA 4QTYA 3D6VA 4XOUA 4DIFA 1ZRMA 4DRXB 5CDUA 3TTXA 4HDCA 4QBHA 3WK6A 4EX6A 4ZC8A 3WB9A 2SKCA 3AJRA 3F5FA 4OFBA 3QI7A 2IGBA 4YP6A 4DANA 2F3TA 2EFJA 4N41A 4LEIA 2WE8A 4L9WA 3GNTA 1V8FA 1CRZA 3PNVA 1RYEA 1B76A 2XE4A 5TRTA 3IHTA 1NJ1A 3PL1A 4XVHA 3I2FA 3NJ4A 1JR3A 1FRZA 4IICA 4L74A 5EWJB 1JPUA 3SE7A 1RNLA 1SZPA 2ZTLA 3DOHA 1W4ZA 1TT5A 3AR8A 3OM1A 4X92A 3AZOA 2G4CA 3L0IB 4DLPA 2JI9A 1EWKA 2OCYC 4F21A 2PZFA 2IU3A 3NJRA 5AVRA 3T7AA 4WASA 2FW9A 3MTDA 4PSKA 4IWXA 3RU9A 5KS2A 3DS8A 4NK4A 5T64A 4TRMA 3QVMA 4NMXB 5HF5A 5JYEA 4RTNA 1AS2A 4CMGA 1S8AA 4OVKA 3KKZA 3W78A 5BSUA 1FS6A 5AW6A 3W1EA 3O47A 1PV1A 2C7VA 1Y8RB 3A7EA 4D8XA 2N0SA 1N32B 1RKVA 2R96A 2C2ZA 2GUGA 3ORRA 3D8BA 3HDVA 2RI6A 3W5CA 3TXXA 3CVWA 4ZI5A 3ZY6A 5JYCA 2YZ2A 2GXQA 3L7KA 2IEIA 1U7UA 2RHTA 4G65A 5FI0B 5K01A 3OJFA 2QVYX 2VP9A 4YQZA 2X8JA 3D8UA 4YMSA 3SICE 1EK6A 4A8PA 3PE4A 121PA 2G06A 1N8TA 1UBTS 1JDSA 1KGDA 1US8B 4US1R 1AUOA 1G21A 4X45A 5B37A 2Q5FA 5TMDA 5YASA 2NUTB 3VV3A 4BFUA 4L78A 4ZP1A 3T7JA 1KQFA 1RFLA 3LQ1A 3MINB 4EQ6B 2F4NA 1R74A 4L08A 2VK1A 4NOMA 4IQ4A 3V1KA 3TR0A 1IUPA 4I4IA 1DEXA 4BO3A 1ZOIA 4QXOA 3WGHA 5L7YA 1WTAA 3ZBUA 3EXEB 4RD0A 2QIPA 4C4ZA 5HJ7A 2FF7A 2VTBB 4RWEA 2YIDA 1NOIA 3IPYA 3QWHA 3GL9A 5TXGA 4BQIA 3DBRB 1XTBA 3WLNA 2VZ9A 1JR3D 3KETA 3TZBA 3HO1A 2R48A 4R8LA 1P74A 2AOWA 4HB3A 4MV1A 4K3VA 1GA4A 1ST2A 1U9ZA 5CTJA 1I5EA 1H1DA 3ZH2A 3HFGA 2JGRA 4U7PB 4XWWA 1NW7A 2J5KA 2X5JO 4RAOA 3RFCA 3CB2A 3SFVA 3CO0S 2XNSA 4C4XA 4BS9A 1EFPB 3F7OA 5CM8B 4JJZA 2F7SA 4A5SA 5BW4A 3QKIA 3PQ3A 4FOOA 1SY7A 3F1LA 1YCFA 4OAOA 1HG1A 3OFVA 2FX5A 3NR2A 3SBDA 3VAZA 1ZBQA 2CJPA 4DG9A 1BXRB 4EG3A 5E7QA 2NUPB 2X9VA 3I9OA 4RY8A 3W05A 1W59A 3SS8A 4WNIA 4LDNA 1JDPA 2GCGA 3I58A 4G5XA 4X7RA 1NXQA 3ZWMA 2M2IA 5IWAB 3K0CC 3KQYA 3UXMA 4MEBA 4NU8X 4KH1A 4NBNA 4L7VA 1JECA 4I14A 4CLEA 1BDIA 5ADVA 2DULA 3UVEA 1WR8A 2H85A 3DKVA 4IOKA 4M1SA 2WDPA 3GU3A 1P62B 4JNKA 2IODA 5J63A 3L0DA 1IOLA 2VPQA 4WGGA 4GL4A 3LT0A 2PX2A 5JCZA 2G25A 4I4CA 1E2GA 4J0DA 3WQRA 2Y0PA 4R6WA 3CWZA 3ZWBA 1QGYA 2XYPA 2BGLA 2OXFA 3IVCA 1AK2A 1TO6A 1IPEA 4B4VA 221PA 3QE4A 2CFSA 1JG1A 4YRZA 3GJ3A 4CM6A 4ZYLA 5JSHA 4S12A 3SX2A 1WKBA 2FE4A 2ZRQA 3V00A 1EIWA 3FIUA 1YB1A 5IKEA 3I5XA 3A6PC 1U0LA 3DUFB 3PENA 5JSYA 1ZMOA 1U1CA 4CYMA 1ID8A 3D4OA 5IW8A 1HUQA 2JL1A 3LBFA 5FQNA 2XGOA 3DP7A 3HWRA 2B9EA 2BT4A 1CZUA 2OHHA 3F5SA 3V32A 2OQRA 4ZDJA 1P5JA 1UBJS 3WSVA 4FWIB 5TIIA 4LJAA 4ZOCA 1AF4A 2I2FA 4PZLA 3EY9A 5EIHA 4ZO7A 1EUCA 1NGSA 4MYDA 1AUPA 1XAGA 3NWJA 5ARBA 2M1XA 4G97A 4KU4A 3ZD7A 2CVFA 1GFWA 2Q6LA 5DK4A 3GLUA 1Q1NA 4YAFA 3PFNA 1G2IA 2YJ6A 3FZEA 4RHYA