4BOKA

Crystal structure of bacillus circulans tn-31 aman6
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
340
structure length
340
Chain Sequence
AYTASDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHRNSDHIVDGNWAGQLLSGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of B. Circulans Aman6 Defines the Fold and Mechanism of the Gh-76 Mannoprotein Transglycosylases and Bacterial Mannosidases
rcsb
molecule keywords ALPHA-1,6-MANNANASE
molecule tags Hydrolase
source organism Bacillus circulans
total genus 136
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4bokA00
4GTOB 4ZRPA 1C3DA 3G6JB 1MZCB 4GTTB 3KSLB 3DSUB 4GTQB 3DSTB 3K7XA 1UMPA 4YDEB 4BOJA 3E34B 3KLSA 4MBGB 1O5MB 2G02A 4GTPB 3SFYB 3EU5B 1DCEB 4LNVA 1HZFA 3SFXB 2V8IA 2PMVA 2V3NA 4ZH1A 1D8EB 1TNUB 2WIIB 1H35A 3SQCA 1TNBB 1TN7B 1FPPB 1N4SB 3DPYB 2BBCA 4GTVB 3DSSB 3KQ4A 2GOXA 1O79A 2XWJB 2BEDB 1N9AB 2H6HB 4KKIA 4MU9A 1O6QA 2WINB 2XWBB 1KZOB 2WY8A 4LNGB 3E33B 3Q73B 3RJ3A 3PZ1B 3D5RA 3C72B 3Q75B 1JCSB 3PZ4B 3Q7FB 4V1SA 3Q78B 2A73B 3DSXB 4D4BA 4L9PB 3OEDA 4GTSB 2R2LB 3Q79B 4GTMB 1N4RB 1TNOB 2V8JA 1O1SB 4D94A 4ZRQA 5FOBB 2NOJA 2XQWA 3HXFB 1JCQB 1NL4B 1O6RA 4C1SA 5JPMB 1QBQB 3DRAB 2WY7A 1SQCA 2H6GB 3E30B 3CU7A 1H36A 4D4DA 1H3AA 2ZIRB 1H39A 2BB5A 4YDOB 3EUVB 1N4QB 3Q7AB 1SA4B 1FT1B 1O6HA 1TNZB 1LD8B 4FXKB 2B39A 2BB6A 3HXCB 1W6JA 5FO9B 2PN5A 2H6IB 1N4PB 1N95B 1O1RB 1GHQA 1R76A 1X81B 4GTRB 1TN6B 1N94B 3DSVB 1NI1B 1H37A 2H6FB 1H3CA 1GSZA 4D4AA 1W6KA 2F0YB 1H3BA 1KZPB 5FO7B 4M76A 3DSWB 1O1TB 3KSQB 5JPNB 4ONTA 1GXOA 1QQFA 5FO8B 1S63B 1S64B 2IEJB 4EHMB 4FXGB 3PZ3B 1QSJA 3HXDB 1SA5B 3E37B 2V3PA 3HXEB 3D5SA 3OXUA 2ZISB 1FT2B 4LNBB 2I07B 1LD7B 1LTXB 3PZ2B 1GXNA 2G0DA 3E32B 5AGDA 2V8KA 4V1RA 1TNYB 1TN8B 4BOKA 1D8DB 3HXBB 4KKJA 1JCRB 4D4CA 2SQCA 1GXMA
chains in the Genus database with same CATH superfamily
4WVAA 4WVCA 4ZRPA 4GTTB 1LF6A 3SDVA 5IKHA 3E34B 4MBGB 1LXMA 2G02A 1FMIA 1DCEB 1KREA 5IK0A 3QPFA 3ACTA 3QFZA 3ANKA 5GW7A 3SDTA 4ZH5A 3ANIA 4FJQA 3G4FA 3P5PA 4Z4JA 4GTVB 2B4FA 3QSPA 2D5JA 3KQ4A 1RWGA 2BEDB 2XWBB 1KZOB 3PZ1B 3C72B 3PYAA 2EACA 1OJNA 3M00A 2J5CA 3E73A 3Q75B 1C82A 1V7WA 4J5TA 5DHKA 3RRSA 2A8ZA 4D4BA 1X1IA 4KTRA 3W7UA 1TF4A 2BRVX 4D94A 1HM2A 2CQTA 1XWTA 4AYQA 1QBQB 5IL8A 1FAEA 1SQCA 2H6GB 1H36A 4AYOA 3EZ8A 5M7IA 2EAEA 3EUVB 4YDOB 3AFJA 3QXQA 1KSDA 3Q7AB 2DRSA 1FT1B 1G87A 3SDQA 1FBWA 3M73A 1ULVA 3RX5A 1KFGA 2JG0A 3M7BA 1N95B 1FP3A 3D3IA 2X03A 3W7WA 3N0GA 4GTRB 1IA7A 3DSVB 1G6IA 4L0GA 3LZ9A 1W6KA 2F0YB 1NC5A 3SAEA 4YCRA 1N23A 1GXOA 1N7NA 2CQSA 1UG9A 1DL2A 2QNOA 3GT5A 1OJPA 1S64B 5GY3A 3HXDB 2V3PA 2WCOA 3HXEB 3QRYA 2ZISB 4TF4A 2DRRA 4WU0A 2FUTA 2Z07A 1XWQA 1N1BA 1GXNA 3M02A 3M7EA 1N20A 5AGDA 2V8KA 3K11A 4Q88A 1TN8B 4KKJA 1JCRB 3NNBA 3S4CA 1FCEA 4OZWA 4L6XA 2ZZRA 3DSTB 1UT9A 5ILZA 3KLSA 1V5DA 4OK4A 3SFYB 1N21A 1GAHA 4OZVA 1KWFA 2V3NA 1TNUB 1RWFA 1KRFA 1GAIA 3QT3A 1TNBB 4MMIA 1K72A 1N4SB 4DOEA 3DPYB 2BBCA 5ILDA 2GOXA 2H6HB 4MU9A 1O6QA 2WINB 1IS9A 2WY8A 1J0MA 4LNGB 3Q73B 4XUVA 3RJ3A 1F1SA 5EASA 3H3KA 3M72A 5CD2A 4EL8A 3M75A 3EQAA 4L9PB 3OEDA 4GTSB 4Q2BA 4GTMB 1N4RB 2F6DA 4ZRQA 2NOJA 5GZKA 2XQWA 3HXFB 3S4AA 4RNQA 1H13A 1HM3A 1O6RA 5JPMB 5IM1A 1RWAA 2WY7A 2JF4A 3E30B 4D4DA 1H3AA 1H39A 1AYXA 3GZKA 1LXKA 1SA4B 2BRWA 2AFAA 4MMHA 1TNZB 1LD8B 3W7XA 3HXCB 1V5CA 1CB8A 3E7JA 2D8LA 2PN5A 2H6IB 1O1RB 1GHQA 2VN7A 1R76A 1X81B 3M78A 1H3CA 1GSZA 1KZPB 1N22A 3ON6A 3DSWB 2GZ6A 3M01A 1FO2A 2P0VA 3AFLA 1G9JA 5KKBA 4ONTA 3X17A 5JMDA 1S63B 2AHGA 4FXGB 3PZ3B 4WVBA 1SA5B 3E37B 3D5SA 4CJ1A 3P2CA 3EU8A 3E80A 3RX7A 4V1RA 3S4BA 1D8DB 1HCUA 5EAUA 1C3DA 3P5RA 4GTQB 3KSLB 3W5NA 4ZG8A 3K7XA 1UMPA 4CJ0A 4BOJA 3VSNA 2Q1FA 5ILHA 3EU5B 4LNVA 1F9GA 3SFXB 4CE7A 4ZH1A 1D8EB 2WIIB 3W5MA 1H35A 2BRPA 3SQCA 1W3YA 1TN7B 1FBOA 1FPPB 2WDAA 3TF4A 2XWJB 1GLMA 4KKIA 1QAZA 4JJJA 3M76A 3H7LA 3WKHA 1RWHA 1HV6A 3D5RA 2FV1A 1N7OA 5CZLA 4DODA 1JCSB 2GH4A 3PZ4B 3Q7FB 4V1SA 3Q78B 2A73B 4FUSA 2R2LB 3QXFA 3WKFA 5DHIA 5ILYA 2V8JA 3G4DA 5DGRA 1RQ5A 3M77A 1JCQB 3WUXA 4C1SA 3QDEA 1L1YA 4F10A 1OJMA 3CU7A 3M74A 3VXDA 1KS8A 3WKIA 1RW9A 2BB6A 1AGMA 1W6JA 5FO9B 1I8QA 5DGQA 1N7PA 1N4PB 4OK2A 1X1HA 4KTPA 2ZBLA 4F13A 3WIWA 3WIQA 1N1ZA 1KKTA 3A0OA 1NXCA 1NI1B 4OJZA 5IK9A 4AYPA 1CLCA 1KSCA 1HXAA 3WIRA 3S9VA 2ONHA 4DI5A 5IKAA 1QQFA 5FO8B 2IEJB 3WKGA 1RWCA 1XW2A 3OXUA 3W7TA 1FT2B 5JMFA 3GLYA 1LD7B 3PZ2B 3E32B 3SDRA 4NEIA 3SDUA 4D4CA 2E24A 3PMMA 2SQCA 2JJBA 4GTOB 2RGKA 3G6JB 1HX9A 4TXTA 2RI8A 1MZCB 5E2JA 3DSUB 2ONGA 4YDEB 3QFYA 1HN0A 3NFVA 2FUQA 1O5MB 4GTPB 3S4DA 1HZFA 3M7CA 4LIXA 2V8IA 2PMVA 4E1YA 2VN4A 3T33A 1DOGA 1WU6A 1H14A 3RX8A 5M7YA 1HMWA 3VSMA 3PYBA 5C05A 2RI9A 3DSSB 1WU5A 1O79A 1V7VA 1L2AA 1N9AB 4FNVA 4GAXA 3E33B 1J0NA 1OJOA 1X1JA 1LOHA 5ILJA 5MEHA 3DSXB 1EGUA 1X9DA 3Q79B 1TNOB 1O1SB 4AYRA 5EATA 2E22A 1HMUA 3QT9A 4Z4LA 1LF9A 5FOBB 1NL4B 1F9OA 5IK6A 3M71A 1FO3A 3QWTA 3DRAB 2FUZA 1HXCA 2YIKA 4GL3A 2ZIRB 1JS4A 2BB5A 3N0FA 3H2WA 1N24A 1N7RA 1N4QB 1F9DA 1O6HA 5ILIA 1HXGA 1WU4A 4FXKB 2B39A 2DRQA 2EADA 3ANJA 1VD5A 3CIHA 1IA6A 1N7QA 1TN6B 1N94B 1CEMA 5ILKA 1H37A 2H6FB 3VW5A 3RSYA 4D4AA 1H3BA 3A3VA 5FO7B 2NVPA 4M76A 2AHFA 1H12A 1O1TB 2FV0A 3KSQB 5JPNB 1H54A 4QT9A 3M7LA 1GA2A 4EHMB 1QSJA 2XFGA 1V7XA 3WC3A 4LNBB 2FBAA 3QG0A 1WZZA 2I07B 1LTXB 5IL3A 3ACSA 2G0DA 3RENA 1TNYB 5CA3A 4BOKA 2EABA 3HXBB 2DROA 1G9GA 1GXMA 3W7SA 2OKXA 2WYNA 3E6UA
chains in the Genus database with same CATH topology
4WVAA 4WVCA 4ZRPA 4GTTB 1LF6A 3SDVA 3E34B 4MBGB 2G02A 1FMIA 1DCEB 1KREA 3QPFA 3ACTA 3QFZA 3ANKA 5GW7A 3SDTA 4ZH5A 3ANIA 3P5PA 4Z4JA 4GTVB 2B4FA 3QSPA 2D5JA 3KQ4A 2BEDB 2XWBB 1KZOB 3PZ1B 3C72B 3PYAA 2EACA 3Q75B 3E73A 1V7WA 4J5TA 3RRSA 2A8ZA 4D4BA 4KTRA 3W7UA 1TF4A 4D94A 2CQTA 1XWTA 4AYQA 1QBQB 1FAEA 1SQCA 2H6GB 1H36A 4AYOA 3EZ8A 5M7IA 2EAEA 3EUVB 4YDOB 3AFJA 3QXQA 1KSDA 3Q7AB 2DRSA 1FT1B 1G87A 3SDQA 1FBWA 3M73A 1ULVA 3RX5A 1KFGA 2JG0A 3M7BA 1N95B 1FP3A 3D3IA 3W7WA 4GTRB 1IA7A 3DSVB 1G6IA 4L0GA 1W6KA 2F0YB 1NC5A 3SAEA 4YCRA 1GXOA 2CQSA 1UG9A 1DL2A 2QNOA 3GT5A 1S64B 5GY3A 3HXDB 2V3PA 3HXEB 3QRYA 2ZISB 4TF4A 2DRRA 4WU0A 2Z07A 1XWQA 1GXNA 5AGDA 3M7EA 2V8KA 3K11A 4Q88A 1TN8B 4KKJA 1JCRB 3S4CA 1FCEA 4L6XA 2ZZRA 3DSTB 1UT9A 3KLSA 1V5DA 3SFYB 1GAHA 1KWFA 2V3NA 1TNUB 1KRFA 1GAIA 3QT3A 1TNBB 1K72A 1N4SB 4DOEA 3DPYB 2BBCA 2GOXA 2H6HB 4MU9A 1O6QA 2WINB 1IS9A 2WY8A 4LNGB 3Q73B 4XUVA 3RJ3A 3H3KA 3M72A 5CD2A 4EL8A 3M75A 3EQAA 4L9PB 3OEDA 4GTSB 4Q2BA 4GTMB 1N4RB 2F6DA 4ZRQA 2NOJA 5GZKA 2XQWA 3HXFB 3S4AA 1H13A 1O6RA 5JPMB 2WY7A 2JF4A 3E30B 4D4DA 1H3AA 1H39A 1AYXA 3GZKA 1SA4B 2AFAA 1TNZB 1LD8B 3W7XA 3HXCB 1V5CA 2D8LA 2PN5A 2H6IB 1O1RB 1GHQA 2VN7A 1R76A 1X81B 3M78A 1H3CA 1GSZA 1KZPB 3ON6A 3DSWB 2GZ6A 1FO2A 2P0VA 5KKBA 1G9JA 4ONTA 3X17A 1S63B 2AHGA 4FXGB 3PZ3B 4WVBA 1SA5B 3E37B 3D5SA 4CJ1A 3P2CA 3EU8A 3RX7A 4V1RA 3S4BA 1D8DB 1HCUA 1C3DA 3P5RA 4GTQB 3KSLB 3W5NA 4ZG8A 3K7XA 1UMPA 4CJ0A 4BOJA 3EU5B 4LNVA 3SFXB 4CE7A 4ZH1A 1D8EB 2WIIB 3W5MA 1H35A 3SQCA 1TN7B 1FBOA 1FPPB 3TF4A 2XWJB 1GLMA 4KKIA 4JJJA 3M76A 3H7LA 3WKHA 3D5RA 2FV1A 5CZLA 4DODA 1JCSB 2GH4A 3PZ4B 3Q7FB 4V1SA 3Q78B 2A73B 4FUSA 2R2LB 3QXFA 3WKFA 2V8JA 5DGRA 1RQ5A 3M77A 1JCQB 3WUXA 4C1SA 3QDEA 1L1YA 3CU7A 3M74A 3VXDA 1KS8A 3WKIA 2BB6A 1AGMA 1W6JA 5FO9B 5DGQA 1N4PB 4KTPA 2ZBLA 3WIWA 3WIQA 1KKTA 1NXCA 1NI1B 4AYPA 1CLCA 1KSCA 3WIRA 3S9VA 1QQFA 5FO8B 2IEJB 3WKGA 1XW2A 3OXUA 3W7TA 1FT2B 3GLYA 1LD7B 3PZ2B 3E32B 3SDRA 3SDUA 4D4CA 3PMMA 2SQCA 2JJBA 4GTOB 2RGKA 3G6JB 4TXTA 2RI8A 1MZCB 5E2JA 3DSUB 4YDEB 3QFYA 1O5MB 4GTPB 3S4DA 1HZFA 3M7CA 4LIXA 2V8IA 2PMVA 2VN4A 3T33A 1DOGA 1WU6A 1H14A 3RX8A 5M7YA 3PYBA 2RI9A 3DSSB 1WU5A 1O79A 1V7VA 1L2AA 1N9AB 3E33B 5MEHA 3DSXB 1X9DA 3Q79B 1TNOB 1O1SB 4AYRA 4Z4LA 3QT9A 5FOBB 1LF9A 1NL4B 1F9OA 3M71A 1FO3A 3QWTA 3DRAB 2FUZA 2YIKA 4GL3A 2ZIRB 1JS4A 2BB5A 3H2WA 1N4QB 1F9DA 1O6HA 1WU4A 4FXKB 2B39A 2DRQA 2EADA 3ANJA 1VD5A 3CIHA 1IA6A 1TN6B 1N94B 1CEMA 1H37A 2H6FB 3VW5A 3RSYA 4D4AA 1H3BA 3A3VA 5FO7B 2NVPA 4M76A 2AHFA 1H12A 1O1TB 2FV0A 3KSQB 5JPNB 1H54A 4QT9A 3M7LA 1GA2A 4EHMB 1QSJA 2XFGA 1V7XA 3WC3A 4LNBB 2FBAA 3QG0A 1WZZA 2I07B 1LTXB 3ACSA 2G0DA 3RENA 1TNYB 5CA3A 4BOKA 2EABA 3HXBB 2DROA 1G9GA 1GXMA 3W7SA 2OKXA 2WYNA 3E6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTO B;  4ZRP A;  1C3D A;  3G6J B;  1MZC B;  4GTT B;  3KSL B;  3DSU B;  4GTQ B;  3DST B;  3K7X A;  1UMP A;  4YDE B;  4BOJ A;  3E34 B;  3KLS A;  4MBG B;  1O5M B;  2G02 A;  4GTP B;  3SFY B;  3EU5 B;  1DCE B;  4LNV A;  1HZF A;  3SFX B;  2V8I A;  2PMV A;  2V3N A;  4ZH1 A;  1D8E B;  1TNU B;  2WII B;  1H35 A;  3SQC A;  1TNB B;  1TN7 B;  1FPP B;  1N4S B;  3DPY B;  2BBC A;  4GTV B;  3DSS B;  3KQ4 A;  2GOX A;  1O79 A;  2XWJ B;  2BED B;  1N9A B;  2H6H B;  4KKI A;  4MU9 A;  1O6Q A;  2WIN B;  2XWB B;  1KZO B;  2WY8 A;  4LNG B;  3E33 B;  3Q73 B;  3RJ3 A;  3PZ1 B;  3D5R A;  3C72 B;  3Q75 B;  1JCS B;  3PZ4 B;  3Q7F B;  4V1S A;  3Q78 B;  2A73 B;  3DSX B;  4D4B A;  4L9P B;  3OED A;  4GTS B;  2R2L B;  3Q79 B;  4GTM B;  1N4R B;  1TNO B;  2V8J A;  1O1S B;  4D94 A;  4ZRQ A;  5FOB B;  2NOJ A;  2XQW A;  3HXF B;  1JCQ B;  1NL4 B;  1O6R A;  4C1S A;  5JPM B;  1QBQ B;  3DRA B;  2WY7 A;  1SQC A;  2H6G B;  3E30 B;  3CU7 A;  1H36 A;  4D4D A;  1H3A A;  2ZIR B;  1H39 A;  2BB5 A;  4YDO B;  3EUV B;  1N4Q B;  3Q7A B;  1SA4 B;  1FT1 B;  1O6H A;  1TNZ B;  1LD8 B;  4FXK B;  2B39 A;  2BB6 A;  3HXC B;  1W6J A;  5FO9 B;  2PN5 A;  2H6I B;  1N4P B;  1N95 B;  1O1R B;  1GHQ A;  1R76 A;  1X81 B;  4GTR B;  1TN6 B;  1N94 B;  3DSV B;  1NI1 B;  1H37 A;  2H6F B;  1H3C A;  1GSZ A;  4D4A A;  1W6K A;  2F0Y B;  1H3B A;  1KZP B;  5FO7 B;  4M76 A;  3DSW B;  1O1T B;  3KSQ B;  5JPN B;  4ONT A;  1GXO A;  1QQF A;  5FO8 B;  1S63 B;  1S64 B;  2IEJ B;  4EHM B;  4FXG B;  3PZ3 B;  1QSJ A;  3HXD B;  1SA5 B;  3E37 B;  2V3P A;  3HXE B;  3D5S A;  3OXU A;  2ZIS B;  1FT2 B;  4LNB B;  2I07 B;  1LD7 B;  1LTX B;  3PZ2 B;  1GXN A;  2G0D A;  3E32 B;  5AGD A;  2V8K A;  4V1R A;  1TNY B;  1TN8 B;  4BOK A;  1D8D B;  3HXB B;  4KKJ A;  1JCR B;  4D4C A;  2SQC A;  1GXM A; 
#chains in the Genus database with same CATH topology
 4WVA A;  4WVC A;  4ZRP A;  4GTT B;  1LF6 A;  3SDV A;  5IKH A;  3E34 B;  4MBG B;  1LXM A;  2G02 A;  1FMI A;  1DCE B;  1KRE A;  5IK0 A;  3QPF A;  3ACT A;  3QFZ A;  3ANK A;  5GW7 A;  3SDT A;  4ZH5 A;  3ANI A;  4FJQ A;  3G4F A;  3P5P A;  4Z4J A;  4GTV B;  2B4F A;  3QSP A;  2D5J A;  3KQ4 A;  1RWG A;  2BED B;  2XWB B;  1KZO B;  3PZ1 B;  3C72 B;  3PYA A;  2EAC A;  1OJN A;  3M00 A;  2J5C A;  3E73 A;  3Q75 B;  1C82 A;  1V7W A;  4J5T A;  5DHK A;  3RRS A;  2A8Z A;  4D4B A;  1X1I A;  4KTR A;  3W7U A;  1TF4 A;  2BRV X;  4D94 A;  1HM2 A;  2CQT A;  1XWT A;  4AYQ A;  1QBQ B;  5IL8 A;  1FAE A;  1SQC A;  2H6G B;  1H36 A;  4AYO A;  3EZ8 A;  5M7I A;  2EAE A;  3EUV B;  4YDO B;  3AFJ A;  3QXQ A;  1KSD A;  3Q7A B;  2DRS A;  1FT1 B;  1G87 A;  3SDQ A;  1FBW A;  3M73 A;  1ULV A;  3RX5 A;  1KFG A;  2JG0 A;  3M7B A;  1N95 B;  1FP3 A;  3D3I A;  2X03 A;  3W7W A;  3N0G A;  4GTR B;  1IA7 A;  3DSV B;  1G6I A;  4L0G A;  3LZ9 A;  1W6K A;  2F0Y B;  1NC5 A;  3SAE A;  4YCR A;  1N23 A;  1GXO A;  1N7N A;  2CQS A;  1UG9 A;  1DL2 A;  2QNO A;  3GT5 A;  1OJP A;  1S64 B;  5GY3 A;  3HXD B;  2V3P A;  2WCO A;  3HXE B;  3QRY A;  2ZIS B;  4TF4 A;  2DRR A;  4WU0 A;  2FUT A;  2Z07 A;  1XWQ A;  1N1B A;  1GXN A;  3M02 A;  3M7E A;  1N20 A;  5AGD A;  2V8K A;  3K11 A;  4Q88 A;  1TN8 B;  4KKJ A;  1JCR B;  3NNB A;  3S4C A;  1FCE A;  4OZW A;  4L6X A;  2ZZR A;  3DST B;  1UT9 A;  5ILZ A;  3KLS A;  1V5D A;  4OK4 A;  3SFY B;  1N21 A;  1GAH A;  4OZV A;  1KWF A;  2V3N A;  1TNU B;  1RWF A;  1KRF A;  1GAI A;  3QT3 A;  1TNB B;  4MMI A;  1K72 A;  1N4S B;  4DOE A;  3DPY B;  2BBC A;  5ILD A;  2GOX A;  2H6H B;  4MU9 A;  1O6Q A;  2WIN B;  1IS9 A;  2WY8 A;  1J0M A;  4LNG B;  3Q73 B;  4XUV A;  3RJ3 A;  1F1S A;  5EAS A;  3H3K A;  3M72 A;  5CD2 A;  4EL8 A;  3M75 A;  3EQA A;  4L9P B;  3OED A;  4GTS B;  4Q2B A;  4GTM B;  1N4R B;  2F6D A;  4ZRQ A;  2NOJ A;  5GZK A;  2XQW A;  3HXF B;  3S4A A;  4RNQ A;  1H13 A;  1HM3 A;  1O6R A;  5JPM B;  5IM1 A;  1RWA A;  2WY7 A;  2JF4 A;  3E30 B;  4D4D A;  1H3A A;  1H39 A;  1AYX A;  3GZK A;  1LXK A;  1SA4 B;  2BRW A;  2AFA A;  4MMH A;  1TNZ B;  1LD8 B;  3W7X A;  3HXC B;  1V5C A;  1CB8 A;  3E7J A;  2D8L A;  2PN5 A;  2H6I B;  1O1R B;  1GHQ A;  2VN7 A;  1R76 A;  1X81 B;  3M78 A;  1H3C A;  1GSZ A;  1KZP B;  1N22 A;  3ON6 A;  3DSW B;  2GZ6 A;  3M01 A;  1FO2 A;  2P0V A;  3AFL A;  1G9J A;  5KKB A;  4ONT A;  3X17 A;  5JMD A;  1S63 B;  2AHG A;  4FXG B;  3PZ3 B;  4WVB A;  1SA5 B;  3E37 B;  3D5S A;  4CJ1 A;  3P2C A;  3EU8 A;  3E80 A;  3RX7 A;  4V1R A;  3S4B A;  1D8D B;  1HCU A;  5EAU A;  1C3D A;  3P5R A;  4GTQ B;  3KSL B;  3W5N A;  4ZG8 A;  3K7X A;  1UMP A;  4CJ0 A;  4BOJ A;  3VSN A;  2Q1F A;  5ILH A;  3EU5 B;  4LNV A;  1F9G A;  3SFX B;  4CE7 A;  4ZH1 A;  1D8E B;  2WII B;  3W5M A;  1H35 A;  2BRP A;  3SQC A;  1W3Y A;  1TN7 B;  1FBO A;  1FPP B;  2WDA A;  3TF4 A;  2XWJ B;  1GLM A;  4KKI A;  1QAZ A;  4JJJ A;  3M76 A;  3H7L A;  3WKH A;  1RWH A;  1HV6 A;  3D5R A;  2FV1 A;  1N7O A;  5CZL A;  4DOD A;  1JCS B;  2GH4 A;  3PZ4 B;  3Q7F B;  4V1S A;  3Q78 B;  2A73 B;  4FUS A;  2R2L B;  3QXF A;  3WKF A;  5DHI A;  5ILY A;  2V8J A;  3G4D A;  5DGR A;  1RQ5 A;  3M77 A;  1JCQ B;  3WUX A;  4C1S A;  3QDE A;  1L1Y A;  4F10 A;  1OJM A;  3CU7 A;  3M74 A;  3VXD A;  1KS8 A;  3WKI A;  1RW9 A;  2BB6 A;  1AGM A;  1W6J A;  5FO9 B;  1I8Q A;  5DGQ A;  1N7P A;  1N4P B;  4OK2 A;  1X1H A;  4KTP A;  2ZBL A;  4F13 A;  3WIW A;  3WIQ A;  1N1Z A;  1KKT A;  3A0O A;  1NXC A;  1NI1 B;  4OJZ A;  5IK9 A;  4AYP A;  1CLC A;  1KSC A;  1HXA A;  3WIR A;  3S9V A;  2ONH A;  4DI5 A;  5IKA A;  1QQF A;  5FO8 B;  2IEJ B;  3WKG A;  1RWC A;  1XW2 A;  3OXU A;  3W7T A;  1FT2 B;  5JMF A;  3GLY A;  1LD7 B;  3PZ2 B;  3E32 B;  3SDR A;  4NEI A;  3SDU A;  4D4C A;  2E24 A;  3PMM A;  2SQC A;  2JJB A;  4GTO B;  2RGK A;  3G6J B;  1HX9 A;  4TXT A;  2RI8 A;  1MZC B;  5E2J A;  3DSU B;  2ONG A;  4YDE B;  3QFY A;  1HN0 A;  3NFV A;  2FUQ A;  1O5M B;  4GTP B;  3S4D A;  1HZF A;  3M7C A;  4LIX A;  2V8I A;  2PMV A;  4E1Y A;  2VN4 A;  3T33 A;  1DOG A;  1WU6 A;  1H14 A;  3RX8 A;  5M7Y A;  1HMW A;  3VSM A;  3PYB A;  5C05 A;  2RI9 A;  3DSS B;  1WU5 A;  1O79 A;  1V7V A;  1L2A A;  1N9A B;  4FNV A;  4GAX A;  3E33 B;  1J0N A;  1OJO A;  1X1J A;  1LOH A;  5ILJ A;  5MEH A;  3DSX B;  1EGU A;  1X9D A;  3Q79 B;  1TNO B;  1O1S B;  4AYR A;  5EAT A;  2E22 A;  1HMU A;  3QT9 A;  4Z4L A;  1LF9 A;  5FOB B;  1NL4 B;  1F9O A;  5IK6 A;  3M71 A;  1FO3 A;  3QWT A;  3DRA B;  2FUZ A;  1HXC A;  2YIK A;  4GL3 A;  2ZIR B;  1JS4 A;  2BB5 A;  3N0F A;  3H2W A;  1N24 A;  1N7R A;  1N4Q B;  1F9D A;  1O6H A;  5ILI A;  1HXG A;  1WU4 A;  4FXK B;  2B39 A;  2DRQ A;  2EAD A;  3ANJ A;  1VD5 A;  3CIH A;  1IA6 A;  1N7Q A;  1TN6 B;  1N94 B;  1CEM A;  5ILK A;  1H37 A;  2H6F B;  3VW5 A;  3RSY A;  4D4A A;  1H3B A;  3A3V A;  5FO7 B;  2NVP A;  4M76 A;  2AHF A;  1H12 A;  1O1T B;  2FV0 A;  3KSQ B;  5JPN B;  1H54 A;  4QT9 A;  3M7L A;  1GA2 A;  4EHM B;  1QSJ A;  2XFG A;  1V7X A;  3WC3 A;  4LNB B;  2FBA A;  3QG0 A;  1WZZ A;  2I07 B;  1LTX B;  5IL3 A;  3ACS A;  2G0D A;  3REN A;  1TNY B;  5CA3 A;  4BOK A;  2EAB A;  3HXB B;  2DRO A;  1G9G A;  1GXM A;  3W7S A;  2OKX A;  2WYN A;  3E6U A; 
#chains in the Genus database with same CATH homology
 4WVA A;  4WVC A;  4ZRP A;  4GTT B;  1LF6 A;  3SDV A;  3E34 B;  4MBG B;  2G02 A;  1FMI A;  1DCE B;  1KRE A;  3QPF A;  3ACT A;  3QFZ A;  3ANK A;  5GW7 A;  3SDT A;  4ZH5 A;  3ANI A;  3P5P A;  4Z4J A;  4GTV B;  2B4F A;  3QSP A;  2D5J A;  3KQ4 A;  2BED B;  2XWB B;  1KZO B;  3PZ1 B;  3C72 B;  3PYA A;  2EAC A;  3Q75 B;  3E73 A;  1V7W A;  4J5T A;  3RRS A;  2A8Z A;  4D4B A;  4KTR A;  3W7U A;  1TF4 A;  4D94 A;  2CQT A;  1XWT A;  4AYQ A;  1QBQ B;  1FAE A;  1SQC A;  2H6G B;  1H36 A;  4AYO A;  3EZ8 A;  5M7I A;  2EAE A;  3EUV B;  4YDO B;  3AFJ A;  3QXQ A;  1KSD A;  3Q7A B;  2DRS A;  1FT1 B;  1G87 A;  3SDQ A;  1FBW A;  3M73 A;  1ULV A;  3RX5 A;  1KFG A;  2JG0 A;  3M7B A;  1N95 B;  1FP3 A;  3D3I A;  3W7W A;  4GTR B;  1IA7 A;  3DSV B;  1G6I A;  4L0G A;  1W6K A;  2F0Y B;  1NC5 A;  3SAE A;  4YCR A;  1GXO A;  2CQS A;  1UG9 A;  1DL2 A;  2QNO A;  3GT5 A;  1S64 B;  5GY3 A;  3HXD B;  2V3P A;  3HXE B;  3QRY A;  2ZIS B;  4TF4 A;  2DRR A;  4WU0 A;  2Z07 A;  1XWQ A;  1GXN A;  5AGD A;  3M7E A;  2V8K A;  3K11 A;  4Q88 A;  1TN8 B;  4KKJ A;  1JCR B;  3S4C A;  1FCE A;  4L6X A;  2ZZR A;  3DST B;  1UT9 A;  3KLS A;  1V5D A;  3SFY B;  1GAH A;  1KWF A;  2V3N A;  1TNU B;  1KRF A;  1GAI A;  3QT3 A;  1TNB B;  1K72 A;  1N4S B;  4DOE A;  3DPY B;  2BBC A;  2GOX A;  2H6H B;  4MU9 A;  1O6Q A;  2WIN B;  1IS9 A;  2WY8 A;  4LNG B;  3Q73 B;  4XUV A;  3RJ3 A;  3H3K A;  3M72 A;  5CD2 A;  4EL8 A;  3M75 A;  3EQA A;  4L9P B;  3OED A;  4GTS B;  4Q2B A;  4GTM B;  1N4R B;  2F6D A;  4ZRQ A;  2NOJ A;  5GZK A;  2XQW A;  3HXF B;  3S4A A;  1H13 A;  1O6R A;  5JPM B;  2WY7 A;  2JF4 A;  3E30 B;  4D4D A;  1H3A A;  1H39 A;  1AYX A;  3GZK A;  1SA4 B;  2AFA A;  1TNZ B;  1LD8 B;  3W7X A;  3HXC B;  1V5C A;  2D8L A;  2PN5 A;  2H6I B;  1O1R B;  1GHQ A;  2VN7 A;  1R76 A;  1X81 B;  3M78 A;  1H3C A;  1GSZ A;  1KZP B;  3ON6 A;  3DSW B;  2GZ6 A;  1FO2 A;  2P0V A;  5KKB A;  1G9J A;  4ONT A;  3X17 A;  1S63 B;  2AHG A;  4FXG B;  3PZ3 B;  4WVB A;  1SA5 B;  3E37 B;  3D5S A;  4CJ1 A;  3P2C A;  3EU8 A;  3RX7 A;  4V1R A;  3S4B A;  1D8D B;  1HCU A;  1C3D A;  3P5R A;  4GTQ B;  3KSL B;  3W5N A;  4ZG8 A;  3K7X A;  1UMP A;  4CJ0 A;  4BOJ A;  3EU5 B;  4LNV A;  3SFX B;  4CE7 A;  4ZH1 A;  1D8E B;  2WII B;  3W5M A;  1H35 A;  3SQC A;  1TN7 B;  1FBO A;  1FPP B;  3TF4 A;  2XWJ B;  1GLM A;  4KKI A;  4JJJ A;  3M76 A;  3H7L A;  3WKH A;  3D5R A;  2FV1 A;  5CZL A;  4DOD A;  1JCS B;  2GH4 A;  3PZ4 B;  3Q7F B;  4V1S A;  3Q78 B;  2A73 B;  4FUS A;  2R2L B;  3QXF A;  3WKF A;  2V8J A;  5DGR A;  1RQ5 A;  3M77 A;  1JCQ B;  3WUX A;  4C1S A;  3QDE A;  1L1Y A;  3CU7 A;  3M74 A;  3VXD A;  1KS8 A;  3WKI A;  2BB6 A;  1AGM A;  1W6J A;  5FO9 B;  5DGQ A;  1N4P B;  4KTP A;  2ZBL A;  3WIW A;  3WIQ A;  1KKT A;  1NXC A;  1NI1 B;  4AYP A;  1CLC A;  1KSC A;  3WIR A;  3S9V A;  1QQF A;  5FO8 B;  2IEJ B;  3WKG A;  1XW2 A;  3OXU A;  3W7T A;  1FT2 B;  3GLY A;  1LD7 B;  3PZ2 B;  3E32 B;  3SDR A;  3SDU A;  4D4C A;  3PMM A;  2SQC A;  2JJB A;  4GTO B;  2RGK A;  3G6J B;  4TXT A;  2RI8 A;  1MZC B;  5E2J A;  3DSU B;  4YDE B;  3QFY A;  1O5M B;  4GTP B;  3S4D A;  1HZF A;  3M7C A;  4LIX A;  2V8I A;  2PMV A;  2VN4 A;  3T33 A;  1DOG A;  1WU6 A;  1H14 A;  3RX8 A;  5M7Y A;  3PYB A;  2RI9 A;  3DSS B;  1WU5 A;  1O79 A;  1V7V A;  1L2A A;  1N9A B;  3E33 B;  5MEH A;  3DSX B;  1X9D A;  3Q79 B;  1TNO B;  1O1S B;  4AYR A;  4Z4L A;  3QT9 A;  5FOB B;  1LF9 A;  1NL4 B;  1F9O A;  3M71 A;  1FO3 A;  3QWT A;  3DRA B;  2FUZ A;  2YIK A;  4GL3 A;  2ZIR B;  1JS4 A;  2BB5 A;  3H2W A;  1N4Q B;  1F9D A;  1O6H A;  1WU4 A;  4FXK B;  2B39 A;  2DRQ A;  2EAD A;  3ANJ A;  1VD5 A;  3CIH A;  1IA6 A;  1TN6 B;  1N94 B;  1CEM A;  1H37 A;  2H6F B;  3VW5 A;  3RSY A;  4D4A A;  1H3B A;  3A3V A;  5FO7 B;  2NVP A;  4M76 A;  2AHF A;  1H12 A;  1O1T B;  2FV0 A;  3KSQ B;  5JPN B;  1H54 A;  4QT9 A;  3M7L A;  1GA2 A;  4EHM B;  1QSJ A;  2XFG A;  1V7X A;  3WC3 A;  4LNB B;  2FBA A;  3QG0 A;  1WZZ A;  2I07 B;  1LTX B;  3ACS A;  2G0D A;  3REN A;  1TNY B;  5CA3 A;  4BOK A;  2EAB A;  3HXB B;  2DRO A;  1G9G A;  1GXM A;  3W7S A;  2OKX A;  2WYN A;  3E6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...