4BOKA

Crystal structure of bacillus circulans tn-31 aman6
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
340
structure length
340
Chain Sequence
b'AYTASDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHRNSDHIVDGNWAGQLLSGTYESWSSAAAVQALNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title The Structure of B. Circulans Aman6 Defines the Fold and Mechanism of the Gh-76 Mannoprotein Transglycosylases and Bacterial Mannosidases
rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 136
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4bokA00
1JCQB 1MZCB 1O79A 3Q79B 3KQ4A 2BB5A 3OXUA 4D94A 2PN5A 1O1SB 1H37A 1TNZB 4D4DA 1H3AA 1TNBB 1W6KA 2WY8A 4FXGB 1W6JA 2G02A 1N94B 4V1SA 2WIIB 3DSVB 4GTQB 1O1TB 2A73B 1LD7B 1QQFA 1S63B 4GTPB 5FOBB 1H39A 1TN8B 2XWBB 2ZIRB 1SA4B 2SQCA 1N95B 1FPPB 1NL4B 1GXOA 3SQCA 1GHQA 2H6GB 4MBGB 4ZH1A 2WINB 3Q75B 2NOJA 1JCSB 2V8IA 2B39A 2V8KA 4GTOB 1N4QB 3HXDB 4KKIA 1LTXB 4L9PB 5JPNB 4ZRPA 4YDEB 3E34B 3DSUB 3OEDA 1NI1B 4YDOB 1C3DA 4ONTA 1TNYB 2BEDB 5FO9B 2V3PA 1O5MB 3G6JB 3K7XA 3Q73B 5JPMB 3E37B 1X81B 4GTRB 1S64B 3KSQB 3DSWB 1O6RA 2V8JA 4BOKA 2GOXA 1N4SB 2H6FB 1O6HA 1R76A 3E33B 3KSLB 1D8EB 1D8DB 2I07B 2R2LB 1H3BA 2WY7A 3PZ2B 4V1RA 3DRAB 1TNOB 3KLSA 4D4BA 1N4RB 3EU5B 4MU9A 2XQWA 1UMPA 2XWJB 2F0YB 3SFYB 1LD8B 4FXKB 1SQCA 3PZ1B 1JCRB 3SFXB 3HXEB 4M76A 3Q7AB 5FO7B 3DSSB 3HXFB 3PZ4B 3RJ3A 3E30B 4EHMB 3EUVB 2PMVA 1QSJA 1GXMA 3DSXB 1H35A 1N9AB 3DSTB 2BBCA 1O6QA 1FT1B 1N4PB 2H6HB 4LNGB 1KZPB 3Q7FB 4GTMB 4KKJA 4D4AA 1TNUB 4LNBB 1FT2B 1HZFA 3Q78B 2IEJB 1TN6B 2G0DA 3PZ3B 4LNVA 4D4CA 1GSZA 4GTSB 3D5SA 1KZOB 3HXCB 2H6IB 1O1RB 3C72B 4ZRQA 3DPYB 4C1SA 2ZISB 1QBQB 1GXNA 2BB6A 3D5RA 1H36A 5AGDA 4BOJA 3E32B 3CU7A 1DCEB 4GTTB 4GTVB 1TN7B 2V3NA 1H3CA 3HXBB 5FO8B 1SA5B
chains in the Genus database with same CATH superfamily
1GA2A 2VN7A 3Q79B 4NEIA 1UT9A 2BB5A 3OXUA 4D94A 2PN5A 1X9DA 1HM3A 2BRWA 4WVBA 3D3IA 1WU5A 2WY8A 4FXGB 3WKGA 3M74A 1CEMA 3ANKA 1CB8A 1KWFA 3DSVB 4GTPB 1TN8B 3EZ8A 3PYBA 3WKHA 5IKAA 5IL8A 1HV6A 2NOJA 4GAXA 1H12A 4GTOB 1N4QB 1V7XA 3S4AA 2CQSA 2GH4A 4YDOB 1LXKA 2V3PA 4CJ0A 3Q73B 3W7TA 4AYRA 3SAEA 2QNOA 2V8JA 2ZZRA 2OKXA 5ILYA 1R76A 2I07B 2WCOA 5ILKA 3DRAB 3KLSA 4TXTA 2VN4A 3WC3A 2NVPA 2RI9A 3SFXB 1OJOA 3ANIA 3ACTA 4M76A 3Q7AB 1IA6A 2ZBLA 3HXFB 2B4FA 4F13A 1UG9A 2FUZA 1H35A 3DSTB 1GAHA 1O6QA 4AYPA 4OJZA 5EATA 1FT1B 1RWFA 4LNGB 1KZPB 3RRSA 5JMDA 1HXGA 1C82A 1V7WA 3SDRA 2AHGA 3M71A 1HN0A 4Q2BA 3M78A 4WVCA 3S4CA 3Q78B 3QRYA 1TN6B 2G0DA 3CIHA 3NFVA 3RX5A 1VD5A 2E22A 4OK2A 2RI8A 4D4CA 2DRRA 1N20A 2P0VA 1KZOB 3HXCB 2H6IB 3VSMA 3SDTA 2EABA 3S4DA 1GXNA 1CLCA 2BB6A 1L2AA 5IL3A 1V7VA 2FV0A 4FUSA 3CU7A 4GL3A 2AHFA 3M00A 1OJMA 3PMMA 3A3VA 1KREA 1K72A 1X1HA 1FCEA 2FV1A 4MMHA 4FNVA 3QXFA 1HMWA 1H37A 1H3AA 1W6JA 2DROA 1RWGA 4V1SA 4GTQB 4Z4JA 2A73B 4OK4A 3QSPA 1EGUA 1H39A 1N7NA 1ULVA 3AFJA 3VXDA 2SQCA 3RENA 5M7IA 2H6GB 4FJQA 3Q75B 2V8IA 2B39A 2V8KA 3EQAA 4KKIA 5E2JA 5DGQA 4L6XA 3DSUB 4YCRA 3OEDA 3M7BA 1F9GA 1C3DA 2DRQA 3M75A 1KFGA 3KSQB 3DSWB 2D8LA 4CJ1A 3M77A 1HXCA 4OZWA 2R2LB 2WY7A 3SDUA 3VSNA 4Q88A 3VW5A 2RGKA 1FO3A 3G4FA 2XQWA 1UMPA 1N24A 2F0YB 1N1ZA 2JF4A 1TF4A 1N7RA 3WIQA 3E30B 4EHMB 2PMVA 1GXMA 5IKHA 3W7SA 3GZKA 4ZG8A 1N9AB 3M02A 1X1IA 4DODA 1G9GA 3E80A 4KKJA 5DGRA 4D4AA 4KTPA 1V5DA 5GZKA 1G87A 1LXMA 1FP3A 1H54A 1GSZA 4GTSB 2X03A 1LOHA 3S9VA 1O1RB 4C1SA 3DPYB 3M73A 2BRPA 3ANJA 1WZZA 3RX7A 2EAEA 1HX9A 1F9OA 2WYNA 1DCEB 5ILHA 1TN7B 2V3NA 1H3CA 3E6UA 1FAEA 3G4DA 1KS8A 2Q1FA 3HXBB 3M7CA 5FO8B 3SDVA 1JCQB 3P5RA 3W7XA 5IK0A 1MZCB 1O79A 4E1YA 3M01A 2FBAA 3S4BA 3QFZA 4DI5A 2DRSA 3E7JA 2WIIB 3WUXA 4CE7A 1XWTA 1LD7B 2ZIRB 1J0MA 1SA4B 1N95B 3GT5A 1NL4B 1GHQA 5EAUA 1JCSB 1RWCA 3HXDB 1LTXB 4OZVA 4ZRPA 1AGMA 4EL8A 3W7WA 3EU8A 1KSDA 1W3YA 5CA3A 2JJBA 1O5MB 3QDEA 5JPMB 3E37B 2FUTA 3H2WA 1QAZA 4GTRB 1O6RA 4BOKA 1LF9A 1N4SB 3E33B 5KKBA 2A8ZA 3X17A 1NC5A 1H3BA 3PZ2B 1RW9A 1TNOB 5CZLA 4KTRA 4F10A 4MU9A 2AFAA 5IM1A 2XWJB 1F1SA 1LD8B 1WU6A 3N0FA 5DHKA 2EADA 2JG0A 5FO7B 3DSSB 1DL2A 3ACSA 1HXAA 1QSJA 3DSXB 1J0NA 2FUQA 2H6HB 5JMFA 3QT9A 3WKIA 1FT2B 1HZFA 2IEJB 4LNVA 1I8QA 2CQTA 3QT3A 1V5CA 1WU4A 1HCUA 4RNQA 3C72B 4ZRQA 5GW7A 2ZISB 1N21A 3WKFA 1JS4A 2XFGA 4Z4LA 1H36A 5AGDA 4BOJA 3NNBA 2D5JA 3E32B 4GTTB 4L0GA 3GLYA 1RWAA 1KSCA 2Z07A 1LF6A 5ILJA 5ILZA 3H3KA 1XW2A 3KQ4A 3RSYA 1AYXA 3W5MA 3ON6A 1O1SB 2E24A 1N7QA 1TNZB 4D4DA 1FBWA 1TNBB 1W6KA 3QXQA 1H13A 5ILIA 2G02A 1FO2A 1N94B 1HM2A 3QWTA 2WDAA 1GAIA 5GY3A 1O1TB 4ZH5A 1QQFA 5FOBB 1S63B 2XWBB 3SDQA 3M76A 1XWQA 1FPPB 1GLMA 4QT9A 1GXOA 3SQCA 1L1YA 4MBGB 4ZH1A 2WINB 5DHIA 1F9DA 4J5TA 5JPNB 4L9PB 3PYAA 4YDEB 3E34B 1IS9A 3P5PA 1NI1B 2ONHA 3W5NA 4ONTA 1G9JA 1TNYB 4JJJA 2BEDB 3H7LA 5FO9B 1HMUA 3G6JB 3K7XA 3T33A 4MMIA 1X1JA 1X81B 1S64B 1N7OA 3AFLA 2BRVX 2GOXA 1RQ5A 2H6FB 3A0OA 1O6HA 3QG0A 5MEHA 3KSLB 1D8EB 4AYOA 5C05A 1D8DB 5EASA 4V1RA 1H14A 4D4BA 1OJNA 1N4RB 3EU5B 1DOGA 1N22A 3P2CA 3RX8A 3K11A 5IK9A 3SFYB 4FXKB 4WU0A 1IA7A 1SQCA 3PZ1B 1JCRB 1KRFA 3HXEB 3TF4A 3M7EA 3W7UA 3PZ4B 3RJ3A 5CD2A 3WIWA 1N23A 3EUVB 1NXCA 1N1BA 1KKTA 2BBCA 4XUVA 1N4PB 2GZ6A 3QPFA 3Q7FB 4GTMB 4WVAA 1TNUB 4LNBB 4LIXA 1OJPA 3PZ3B 4AYQA 2YIKA 3QFYA 3M72A 3D5SA 1RWHA 3LZ9A 1FMIA 5M7YA 5ILDA 1QBQB 2EACA 2J5CA 4TF4A 3D5RA 5IK6A 3M7LA 1N7PA 4DOEA 1FBOA 4GTVB 3E73A 1G6IA 2F6DA 2ONGA 3N0GA 3WIRA 1SA5B
chains in the Genus database with same CATH topology
1GA2A 2VN7A 3Q79B 1UT9A 2BB5A 3OXUA 4D94A 2PN5A 1X9DA 4WVBA 3D3IA 1WU5A 2WY8A 4FXGB 3WKGA 3M74A 1CEMA 3ANKA 1KWFA 3DSVB 4GTPB 1TN8B 3EZ8A 3PYBA 3WKHA 2NOJA 1H12A 4GTOB 1N4QB 1V7XA 3S4AA 2CQSA 2GH4A 4YDOB 2V3PA 4CJ0A 3Q73B 3W7TA 4AYRA 3SAEA 2QNOA 2V8JA 2ZZRA 2OKXA 1R76A 2I07B 3DRAB 3KLSA 4TXTA 2VN4A 3WC3A 2NVPA 2RI9A 3SFXB 3ANIA 3ACTA 4M76A 3Q7AB 1IA6A 2ZBLA 3HXFB 2B4FA 1UG9A 2FUZA 1H35A 3DSTB 1GAHA 1O6QA 4AYPA 1FT1B 4LNGB 1KZPB 3RRSA 1V7WA 3SDRA 2AHGA 3M71A 4Q2BA 3M78A 4WVCA 3S4CA 3Q78B 3QRYA 1TN6B 2G0DA 3CIHA 3RX5A 1VD5A 2RI8A 4D4CA 2DRRA 2P0VA 1KZOB 3HXCB 2H6IB 3SDTA 2EABA 3S4DA 1GXNA 1CLCA 2BB6A 1L2AA 1V7VA 2FV0A 4FUSA 3CU7A 4GL3A 2AHFA 3PMMA 3A3VA 1KREA 1K72A 1FCEA 2FV1A 3QXFA 1H37A 1H3AA 1W6JA 2DROA 4V1SA 4GTQB 4Z4JA 2A73B 3QSPA 1H39A 1ULVA 3AFJA 3VXDA 2SQCA 3RENA 5M7IA 2H6GB 3Q75B 2V8IA 2B39A 2V8KA 3EQAA 4KKIA 5E2JA 5DGQA 4L6XA 3DSUB 4YCRA 3OEDA 3M7BA 1C3DA 2DRQA 3M75A 1KFGA 3KSQB 3DSWB 2D8LA 4CJ1A 3M77A 2R2LB 2WY7A 3SDUA 4Q88A 3VW5A 2RGKA 1FO3A 2XQWA 1UMPA 2F0YB 2JF4A 1TF4A 3WIQA 3E30B 4EHMB 2PMVA 1GXMA 3W7SA 3GZKA 4ZG8A 1N9AB 4DODA 1G9GA 4KKJA 5DGRA 4D4AA 4KTPA 1V5DA 5GZKA 1G87A 1FP3A 1H54A 1GSZA 4GTSB 3S9VA 1O1RB 4C1SA 3DPYB 3M73A 3ANJA 1WZZA 3RX7A 2EAEA 1F9OA 2WYNA 1DCEB 1TN7B 2V3NA 1H3CA 3E6UA 1FAEA 1KS8A 3HXBB 3M7CA 5FO8B 3SDVA 1JCQB 3P5RA 3W7XA 1MZCB 1O79A 2FBAA 3S4BA 3QFZA 2DRSA 2WIIB 3WUXA 4CE7A 1XWTA 1LD7B 2ZIRB 1SA4B 1N95B 3GT5A 1NL4B 1GHQA 1JCSB 3HXDB 1LTXB 4ZRPA 1AGMA 4EL8A 3W7WA 3EU8A 1KSDA 5CA3A 2JJBA 1O5MB 3QDEA 5JPMB 3E37B 3H2WA 4GTRB 1O6RA 4BOKA 1LF9A 1N4SB 3E33B 5KKBA 2A8ZA 3X17A 1NC5A 1H3BA 3PZ2B 1TNOB 5CZLA 4KTRA 4MU9A 2AFAA 2XWJB 1LD8B 1WU6A 2EADA 2JG0A 5FO7B 3DSSB 1DL2A 3ACSA 1QSJA 3DSXB 2H6HB 3QT9A 3WKIA 1FT2B 1HZFA 2IEJB 4LNVA 2CQTA 3QT3A 1V5CA 1WU4A 1HCUA 3C72B 4ZRQA 5GW7A 2ZISB 3WKFA 1JS4A 2XFGA 4Z4LA 1H36A 5AGDA 4BOJA 2D5JA 3E32B 4GTTB 4L0GA 3GLYA 1KSCA 2Z07A 1LF6A 3H3KA 1XW2A 3KQ4A 3RSYA 1AYXA 3W5MA 3ON6A 1O1SB 1TNZB 4D4DA 1FBWA 1TNBB 1W6KA 3QXQA 1H13A 2G02A 1FO2A 1N94B 3QWTA 1GAIA 5GY3A 1O1TB 4ZH5A 1QQFA 5FOBB 1S63B 2XWBB 3SDQA 3M76A 1XWQA 1FPPB 1GLMA 4QT9A 1GXOA 3SQCA 1L1YA 4MBGB 4ZH1A 2WINB 1F9DA 4J5TA 5JPNB 4L9PB 3PYAA 4YDEB 3E34B 1IS9A 3P5PA 1NI1B 3W5NA 4ONTA 1G9JA 1TNYB 4JJJA 2BEDB 3H7LA 5FO9B 3G6JB 3K7XA 3T33A 1X81B 1S64B 2GOXA 1RQ5A 2H6FB 3QG0A 1O6HA 5MEHA 3KSLB 1D8EB 4AYOA 1D8DB 4V1RA 1H14A 4D4BA 1N4RB 3EU5B 1DOGA 3P2CA 3RX8A 3K11A 3SFYB 4FXKB 4WU0A 1IA7A 1SQCA 3PZ1B 1JCRB 1KRFA 3HXEB 3TF4A 3M7EA 3W7UA 3PZ4B 3RJ3A 5CD2A 3WIWA 3EUVB 1NXCA 1KKTA 2BBCA 4XUVA 1N4PB 2GZ6A 3QPFA 3Q7FB 4GTMB 4WVAA 1TNUB 4LNBB 4LIXA 3PZ3B 4AYQA 2YIKA 3QFYA 3M72A 3D5SA 1FMIA 5M7YA 1QBQB 2EACA 4TF4A 3D5RA 3M7LA 4DOEA 1FBOA 4GTVB 3E73A 1G6IA 2F6DA 3WIRA 1SA5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCQ B;  1MZC B;  1O79 A;  3Q79 B;  3KQ4 A;  2BB5 A;  3OXU A;  4D94 A;  2PN5 A;  1O1S B;  1H37 A;  1TNZ B;  4D4D A;  1H3A A;  1TNB B;  1W6K A;  2WY8 A;  4FXG B;  1W6J A;  2G02 A;  1N94 B;  4V1S A;  2WII B;  3DSV B;  4GTQ B;  1O1T B;  2A73 B;  1LD7 B;  1QQF A;  1S63 B;  4GTP B;  5FOB B;  1H39 A;  1TN8 B;  2XWB B;  2ZIR B;  1SA4 B;  2SQC A;  1N95 B;  1FPP B;  1NL4 B;  1GXO A;  3SQC A;  1GHQ A;  2H6G B;  4MBG B;  4ZH1 A;  2WIN B;  3Q75 B;  2NOJ A;  1JCS B;  2V8I A;  2B39 A;  2V8K A;  4GTO B;  1N4Q B;  3HXD B;  4KKI A;  1LTX B;  4L9P B;  5JPN B;  4ZRP A;  4YDE B;  3E34 B;  3DSU B;  3OED A;  1NI1 B;  4YDO B;  1C3D A;  4ONT A;  1TNY B;  2BED B;  5FO9 B;  2V3P A;  1O5M B;  3G6J B;  3K7X A;  3Q73 B;  5JPM B;  3E37 B;  1X81 B;  4GTR B;  1S64 B;  3KSQ B;  3DSW B;  1O6R A;  2V8J A;  4BOK A;  2GOX A;  1N4S B;  2H6F B;  1O6H A;  1R76 A;  3E33 B;  3KSL B;  1D8E B;  1D8D B;  2I07 B;  2R2L B;  1H3B A;  2WY7 A;  3PZ2 B;  4V1R A;  3DRA B;  1TNO B;  3KLS A;  4D4B A;  1N4R B;  3EU5 B;  4MU9 A;  2XQW A;  1UMP A;  2XWJ B;  2F0Y B;  3SFY B;  1LD8 B;  4FXK B;  1SQC A;  3PZ1 B;  1JCR B;  3SFX B;  3HXE B;  4M76 A;  3Q7A B;  5FO7 B;  3DSS B;  3HXF B;  3PZ4 B;  3RJ3 A;  3E30 B;  4EHM B;  3EUV B;  2PMV A;  1QSJ A;  1GXM A;  3DSX B;  1H35 A;  1N9A B;  3DST B;  2BBC A;  1O6Q A;  1FT1 B;  1N4P B;  2H6H B;  4LNG B;  1KZP B;  3Q7F B;  4GTM B;  4KKJ A;  4D4A A;  1TNU B;  4LNB B;  1FT2 B;  1HZF A;  3Q78 B;  2IEJ B;  1TN6 B;  2G0D A;  3PZ3 B;  4LNV A;  4D4C A;  1GSZ A;  4GTS B;  3D5S A;  1KZO B;  3HXC B;  2H6I B;  1O1R B;  3C72 B;  4ZRQ A;  3DPY B;  4C1S A;  2ZIS B;  1QBQ B;  1GXN A;  2BB6 A;  3D5R A;  1H36 A;  5AGD A;  4BOJ A;  3E32 B;  3CU7 A;  1DCE B;  4GTT B;  4GTV B;  1TN7 B;  2V3N A;  1H3C A;  3HXB B;  5FO8 B;  1SA5 B; 
#chains in the Genus database with same CATH topology
 1GA2 A;  2VN7 A;  3Q79 B;  4NEI A;  1UT9 A;  2BB5 A;  3OXU A;  4D94 A;  2PN5 A;  1X9D A;  1HM3 A;  2BRW A;  4WVB A;  3D3I A;  1WU5 A;  2WY8 A;  4FXG B;  3WKG A;  3M74 A;  1CEM A;  3ANK A;  1CB8 A;  1KWF A;  3DSV B;  4GTP B;  1TN8 B;  3EZ8 A;  3PYB A;  3WKH A;  5IKA A;  5IL8 A;  1HV6 A;  2NOJ A;  4GAX A;  1H12 A;  4GTO B;  1N4Q B;  1V7X A;  3S4A A;  2CQS A;  2GH4 A;  4YDO B;  1LXK A;  2V3P A;  4CJ0 A;  3Q73 B;  3W7T A;  4AYR A;  3SAE A;  2QNO A;  2V8J A;  2ZZR A;  2OKX A;  5ILY A;  1R76 A;  2I07 B;  2WCO A;  5ILK A;  3DRA B;  3KLS A;  4TXT A;  2VN4 A;  3WC3 A;  2NVP A;  2RI9 A;  3SFX B;  1OJO A;  3ANI A;  3ACT A;  4M76 A;  3Q7A B;  1IA6 A;  2ZBL A;  3HXF B;  2B4F A;  4F13 A;  1UG9 A;  2FUZ A;  1H35 A;  3DST B;  1GAH A;  1O6Q A;  4AYP A;  4OJZ A;  5EAT A;  1FT1 B;  1RWF A;  4LNG B;  1KZP B;  3RRS A;  5JMD A;  1HXG A;  1C82 A;  1V7W A;  3SDR A;  2AHG A;  3M71 A;  1HN0 A;  4Q2B A;  3M78 A;  4WVC A;  3S4C A;  3Q78 B;  3QRY A;  1TN6 B;  2G0D A;  3CIH A;  3NFV A;  3RX5 A;  1VD5 A;  2E22 A;  4OK2 A;  2RI8 A;  4D4C A;  2DRR A;  1N20 A;  2P0V A;  1KZO B;  3HXC B;  2H6I B;  3VSM A;  3SDT A;  2EAB A;  3S4D A;  1GXN A;  1CLC A;  2BB6 A;  1L2A A;  5IL3 A;  1V7V A;  2FV0 A;  4FUS A;  3CU7 A;  4GL3 A;  2AHF A;  3M00 A;  1OJM A;  3PMM A;  3A3V A;  1KRE A;  1K72 A;  1X1H A;  1FCE A;  2FV1 A;  4MMH A;  4FNV A;  3QXF A;  1HMW A;  1H37 A;  1H3A A;  1W6J A;  2DRO A;  1RWG A;  4V1S A;  4GTQ B;  4Z4J A;  2A73 B;  4OK4 A;  3QSP A;  1EGU A;  1H39 A;  1N7N A;  1ULV A;  3AFJ A;  3VXD A;  2SQC A;  3REN A;  5M7I A;  2H6G B;  4FJQ A;  3Q75 B;  2V8I A;  2B39 A;  2V8K A;  3EQA A;  4KKI A;  5E2J A;  5DGQ A;  4L6X A;  3DSU B;  4YCR A;  3OED A;  3M7B A;  1F9G A;  1C3D A;  2DRQ A;  3M75 A;  1KFG A;  3KSQ B;  3DSW B;  2D8L A;  4CJ1 A;  3M77 A;  1HXC A;  4OZW A;  2R2L B;  2WY7 A;  3SDU A;  3VSN A;  4Q88 A;  3VW5 A;  2RGK A;  1FO3 A;  3G4F A;  2XQW A;  1UMP A;  1N24 A;  2F0Y B;  1N1Z A;  2JF4 A;  1TF4 A;  1N7R A;  3WIQ A;  3E30 B;  4EHM B;  2PMV A;  1GXM A;  5IKH A;  3W7S A;  3GZK A;  4ZG8 A;  1N9A B;  3M02 A;  1X1I A;  4DOD A;  1G9G A;  3E80 A;  4KKJ A;  5DGR A;  4D4A A;  4KTP A;  1V5D A;  5GZK A;  1G87 A;  1LXM A;  1FP3 A;  1H54 A;  1GSZ A;  4GTS B;  2X03 A;  1LOH A;  3S9V A;  1O1R B;  4C1S A;  3DPY B;  3M73 A;  2BRP A;  3ANJ A;  1WZZ A;  3RX7 A;  2EAE A;  1HX9 A;  1F9O A;  2WYN A;  1DCE B;  5ILH A;  1TN7 B;  2V3N A;  1H3C A;  3E6U A;  1FAE A;  3G4D A;  1KS8 A;  2Q1F A;  3HXB B;  3M7C A;  5FO8 B;  3SDV A;  1JCQ B;  3P5R A;  3W7X A;  5IK0 A;  1MZC B;  1O79 A;  4E1Y A;  3M01 A;  2FBA A;  3S4B A;  3QFZ A;  4DI5 A;  2DRS A;  3E7J A;  2WII B;  3WUX A;  4CE7 A;  1XWT A;  1LD7 B;  2ZIR B;  1J0M A;  1SA4 B;  1N95 B;  3GT5 A;  1NL4 B;  1GHQ A;  5EAU A;  1JCS B;  1RWC A;  3HXD B;  1LTX B;  4OZV A;  4ZRP A;  1AGM A;  4EL8 A;  3W7W A;  3EU8 A;  1KSD A;  1W3Y A;  5CA3 A;  2JJB A;  1O5M B;  3QDE A;  5JPM B;  3E37 B;  2FUT A;  3H2W A;  1QAZ A;  4GTR B;  1O6R A;  4BOK A;  1LF9 A;  1N4S B;  3E33 B;  5KKB A;  2A8Z A;  3X17 A;  1NC5 A;  1H3B A;  3PZ2 B;  1RW9 A;  1TNO B;  5CZL A;  4KTR A;  4F10 A;  4MU9 A;  2AFA A;  5IM1 A;  2XWJ B;  1F1S A;  1LD8 B;  1WU6 A;  3N0F A;  5DHK A;  2EAD A;  2JG0 A;  5FO7 B;  3DSS B;  1DL2 A;  3ACS A;  1HXA A;  1QSJ A;  3DSX B;  1J0N A;  2FUQ A;  2H6H B;  5JMF A;  3QT9 A;  3WKI A;  1FT2 B;  1HZF A;  2IEJ B;  4LNV A;  1I8Q A;  2CQT A;  3QT3 A;  1V5C A;  1WU4 A;  1HCU A;  4RNQ A;  3C72 B;  4ZRQ A;  5GW7 A;  2ZIS B;  1N21 A;  3WKF A;  1JS4 A;  2XFG A;  4Z4L A;  1H36 A;  5AGD A;  4BOJ A;  3NNB A;  2D5J A;  3E32 B;  4GTT B;  4L0G A;  3GLY A;  1RWA A;  1KSC A;  2Z07 A;  1LF6 A;  5ILJ A;  5ILZ A;  3H3K A;  1XW2 A;  3KQ4 A;  3RSY A;  1AYX A;  3W5M A;  3ON6 A;  1O1S B;  2E24 A;  1N7Q A;  1TNZ B;  4D4D A;  1FBW A;  1TNB B;  1W6K A;  3QXQ A;  1H13 A;  5ILI A;  2G02 A;  1FO2 A;  1N94 B;  1HM2 A;  3QWT A;  2WDA A;  1GAI A;  5GY3 A;  1O1T B;  4ZH5 A;  1QQF A;  5FOB B;  1S63 B;  2XWB B;  3SDQ A;  3M76 A;  1XWQ A;  1FPP B;  1GLM A;  4QT9 A;  1GXO A;  3SQC A;  1L1Y A;  4MBG B;  4ZH1 A;  2WIN B;  5DHI A;  1F9D A;  4J5T A;  5JPN B;  4L9P B;  3PYA A;  4YDE B;  3E34 B;  1IS9 A;  3P5P A;  1NI1 B;  2ONH A;  3W5N A;  4ONT A;  1G9J A;  1TNY B;  4JJJ A;  2BED B;  3H7L A;  5FO9 B;  1HMU A;  3G6J B;  3K7X A;  3T33 A;  4MMI A;  1X1J A;  1X81 B;  1S64 B;  1N7O A;  3AFL A;  2BRV X;  2GOX A;  1RQ5 A;  2H6F B;  3A0O A;  1O6H A;  3QG0 A;  5MEH A;  3KSL B;  1D8E B;  4AYO A;  5C05 A;  1D8D B;  5EAS A;  4V1R A;  1H14 A;  4D4B A;  1OJN A;  1N4R B;  3EU5 B;  1DOG A;  1N22 A;  3P2C A;  3RX8 A;  3K11 A;  5IK9 A;  3SFY B;  4FXK B;  4WU0 A;  1IA7 A;  1SQC A;  3PZ1 B;  1JCR B;  1KRF A;  3HXE B;  3TF4 A;  3M7E A;  3W7U A;  3PZ4 B;  3RJ3 A;  5CD2 A;  3WIW A;  1N23 A;  3EUV B;  1NXC A;  1N1B A;  1KKT A;  2BBC A;  4XUV A;  1N4P B;  2GZ6 A;  3QPF A;  3Q7F B;  4GTM B;  4WVA A;  1TNU B;  4LNB B;  4LIX A;  1OJP A;  3PZ3 B;  4AYQ A;  2YIK A;  3QFY A;  3M72 A;  3D5S A;  1RWH A;  3LZ9 A;  1FMI A;  5M7Y A;  5ILD A;  1QBQ B;  2EAC A;  2J5C A;  4TF4 A;  3D5R A;  5IK6 A;  3M7L A;  1N7P A;  4DOE A;  1FBO A;  4GTV B;  3E73 A;  1G6I A;  2F6D A;  2ONG A;  3N0G A;  3WIR A;  1SA5 B; 
#chains in the Genus database with same CATH homology
 1GA2 A;  2VN7 A;  3Q79 B;  1UT9 A;  2BB5 A;  3OXU A;  4D94 A;  2PN5 A;  1X9D A;  4WVB A;  3D3I A;  1WU5 A;  2WY8 A;  4FXG B;  3WKG A;  3M74 A;  1CEM A;  3ANK A;  1KWF A;  3DSV B;  4GTP B;  1TN8 B;  3EZ8 A;  3PYB A;  3WKH A;  2NOJ A;  1H12 A;  4GTO B;  1N4Q B;  1V7X A;  3S4A A;  2CQS A;  2GH4 A;  4YDO B;  2V3P A;  4CJ0 A;  3Q73 B;  3W7T A;  4AYR A;  3SAE A;  2QNO A;  2V8J A;  2ZZR A;  2OKX A;  1R76 A;  2I07 B;  3DRA B;  3KLS A;  4TXT A;  2VN4 A;  3WC3 A;  2NVP A;  2RI9 A;  3SFX B;  3ANI A;  3ACT A;  4M76 A;  3Q7A B;  1IA6 A;  2ZBL A;  3HXF B;  2B4F A;  1UG9 A;  2FUZ A;  1H35 A;  3DST B;  1GAH A;  1O6Q A;  4AYP A;  1FT1 B;  4LNG B;  1KZP B;  3RRS A;  1V7W A;  3SDR A;  2AHG A;  3M71 A;  4Q2B A;  3M78 A;  4WVC A;  3S4C A;  3Q78 B;  3QRY A;  1TN6 B;  2G0D A;  3CIH A;  3RX5 A;  1VD5 A;  2RI8 A;  4D4C A;  2DRR A;  2P0V A;  1KZO B;  3HXC B;  2H6I B;  3SDT A;  2EAB A;  3S4D A;  1GXN A;  1CLC A;  2BB6 A;  1L2A A;  1V7V A;  2FV0 A;  4FUS A;  3CU7 A;  4GL3 A;  2AHF A;  3PMM A;  3A3V A;  1KRE A;  1K72 A;  1FCE A;  2FV1 A;  3QXF A;  1H37 A;  1H3A A;  1W6J A;  2DRO A;  4V1S A;  4GTQ B;  4Z4J A;  2A73 B;  3QSP A;  1H39 A;  1ULV A;  3AFJ A;  3VXD A;  2SQC A;  3REN A;  5M7I A;  2H6G B;  3Q75 B;  2V8I A;  2B39 A;  2V8K A;  3EQA A;  4KKI A;  5E2J A;  5DGQ A;  4L6X A;  3DSU B;  4YCR A;  3OED A;  3M7B A;  1C3D A;  2DRQ A;  3M75 A;  1KFG A;  3KSQ B;  3DSW B;  2D8L A;  4CJ1 A;  3M77 A;  2R2L B;  2WY7 A;  3SDU A;  4Q88 A;  3VW5 A;  2RGK A;  1FO3 A;  2XQW A;  1UMP A;  2F0Y B;  2JF4 A;  1TF4 A;  3WIQ A;  3E30 B;  4EHM B;  2PMV A;  1GXM A;  3W7S A;  3GZK A;  4ZG8 A;  1N9A B;  4DOD A;  1G9G A;  4KKJ A;  5DGR A;  4D4A A;  4KTP A;  1V5D A;  5GZK A;  1G87 A;  1FP3 A;  1H54 A;  1GSZ A;  4GTS B;  3S9V A;  1O1R B;  4C1S A;  3DPY B;  3M73 A;  3ANJ A;  1WZZ A;  3RX7 A;  2EAE A;  1F9O A;  2WYN A;  1DCE B;  1TN7 B;  2V3N A;  1H3C A;  3E6U A;  1FAE A;  1KS8 A;  3HXB B;  3M7C A;  5FO8 B;  3SDV A;  1JCQ B;  3P5R A;  3W7X A;  1MZC B;  1O79 A;  2FBA A;  3S4B A;  3QFZ A;  2DRS A;  2WII B;  3WUX A;  4CE7 A;  1XWT A;  1LD7 B;  2ZIR B;  1SA4 B;  1N95 B;  3GT5 A;  1NL4 B;  1GHQ A;  1JCS B;  3HXD B;  1LTX B;  4ZRP A;  1AGM A;  4EL8 A;  3W7W A;  3EU8 A;  1KSD A;  5CA3 A;  2JJB A;  1O5M B;  3QDE A;  5JPM B;  3E37 B;  3H2W A;  4GTR B;  1O6R A;  4BOK A;  1LF9 A;  1N4S B;  3E33 B;  5KKB A;  2A8Z A;  3X17 A;  1NC5 A;  1H3B A;  3PZ2 B;  1TNO B;  5CZL A;  4KTR A;  4MU9 A;  2AFA A;  2XWJ B;  1LD8 B;  1WU6 A;  2EAD A;  2JG0 A;  5FO7 B;  3DSS B;  1DL2 A;  3ACS A;  1QSJ A;  3DSX B;  2H6H B;  3QT9 A;  3WKI A;  1FT2 B;  1HZF A;  2IEJ B;  4LNV A;  2CQT A;  3QT3 A;  1V5C A;  1WU4 A;  1HCU A;  3C72 B;  4ZRQ A;  5GW7 A;  2ZIS B;  3WKF A;  1JS4 A;  2XFG A;  4Z4L A;  1H36 A;  5AGD A;  4BOJ A;  2D5J A;  3E32 B;  4GTT B;  4L0G A;  3GLY A;  1KSC A;  2Z07 A;  1LF6 A;  3H3K A;  1XW2 A;  3KQ4 A;  3RSY A;  1AYX A;  3W5M A;  3ON6 A;  1O1S B;  1TNZ B;  4D4D A;  1FBW A;  1TNB B;  1W6K A;  3QXQ A;  1H13 A;  2G02 A;  1FO2 A;  1N94 B;  3QWT A;  1GAI A;  5GY3 A;  1O1T B;  4ZH5 A;  1QQF A;  5FOB B;  1S63 B;  2XWB B;  3SDQ A;  3M76 A;  1XWQ A;  1FPP B;  1GLM A;  4QT9 A;  1GXO A;  3SQC A;  1L1Y A;  4MBG B;  4ZH1 A;  2WIN B;  1F9D A;  4J5T A;  5JPN B;  4L9P B;  3PYA A;  4YDE B;  3E34 B;  1IS9 A;  3P5P A;  1NI1 B;  3W5N A;  4ONT A;  1G9J A;  1TNY B;  4JJJ A;  2BED B;  3H7L A;  5FO9 B;  3G6J B;  3K7X A;  3T33 A;  1X81 B;  1S64 B;  2GOX A;  1RQ5 A;  2H6F B;  3QG0 A;  1O6H A;  5MEH A;  3KSL B;  1D8E B;  4AYO A;  1D8D B;  4V1R A;  1H14 A;  4D4B A;  1N4R B;  3EU5 B;  1DOG A;  3P2C A;  3RX8 A;  3K11 A;  3SFY B;  4FXK B;  4WU0 A;  1IA7 A;  1SQC A;  3PZ1 B;  1JCR B;  1KRF A;  3HXE B;  3TF4 A;  3M7E A;  3W7U A;  3PZ4 B;  3RJ3 A;  5CD2 A;  3WIW A;  3EUV B;  1NXC A;  1KKT A;  2BBC A;  4XUV A;  1N4P B;  2GZ6 A;  3QPF A;  3Q7F B;  4GTM B;  4WVA A;  1TNU B;  4LNB B;  4LIX A;  3PZ3 B;  4AYQ A;  2YIK A;  3QFY A;  3M72 A;  3D5S A;  1FMI A;  5M7Y A;  1QBQ B;  2EAC A;  4TF4 A;  3D5R A;  3M7L A;  4DOE A;  1FBO A;  4GTV B;  3E73 A;  1G6I A;  2F6D A;  3WIR A;  1SA5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...