4BOLA

Crystal structure of ampdh2 from pseudomonas aeruginosa in complex with pentapeptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
MSSGPRLNTDYTSANQDSRVQFIVLHYTSTDLPHSLGILTHGGVSAHYLIGDDEPATVYRLVDENRRAWHAGVSEWQGRTWLNATSIGIEIVNQGYRDTPQGRVWYPFSEAQIQALIPLLKDIAKRHGITPDRIIGHSDIAPGRKVDPGPLFPWKRLADAGLVPWPKPGELARRLAELNGQLPDVRWFQQQLARHGYLVPQTGELEKDTRDVIGAFQMKYRPARFDGEPDLETAALLLAVPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPDH2
publication title Reaction Products and the X-Ray Structure of Ampdh2, a Virulence Determinant of Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 72
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
A PF01510 Amidase_2 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 4bolA02
3.40.80.10 Alpha Beta 3-Layer(aba) Sandwich Lysozyme-like Peptidoglycan recognition protein-like 4bolA01
4LPQA 3BKHA 1S2JA 1L6JA 3CORA 1LBAA 4KNLA 1LBUA 1YCKA 2EAVA 4FNNA 4BPAA 4BXJA 3CG9A 5E0AA 3EP1A 3QV4A 4BXDA 2AR3A 5E0BA 4X36A 1Z6IA 2WKXA 3D2ZA 3QJ1A 3D2YA 4GF9A 4Z8IA 2Z9NA 1SXRA 1EAKA 1OHTA 2APHA 3OGXA 2Y2CA 2Y2EA 5DWFA 3T2VA 3BKVA 2Y2DA 3USXA 4OLSA 2R90A 1J3GA 4BJ4A 2F2LA 2XZ4A 3HMBA 1TWQA 2Y28A 1SK4A 1AROL 2XZ8A 3UMQA 2F2LX 3T39A 4Q9EA 2R2KA 3NW3A 2L47A 5CTVA 4OUGA 3UMLA 3CXAA 4Q8SA 3O4KA 4IVVA 4BXEA 4BOLA 2Y2BA 4G54A 4ORVA 3NG4A 3UILA 2RKQA 3NNOA 2EAXA 1YB0A 4KNKA 3C2XA 3QS0A 2BH7A 3LATA 4ZXMA 2CB3A 3TRUA 1SK3A 3RT4A 3RDRA 4OPPA
chains in the Genus database with same CATH superfamily
4LPQA 3BKHA 1S2JA 1L6JA 3CORA 1LBAA 4KNLA 1LBUA 1YCKA 2EAVA 4FNNA 4BPAA 4BXJA 3CG9A 5E0AA 3EP1A 3QV4A 4BXDA 2AR3A 5E0BA 4X36A 1Z6IA 2WKXA 3D2ZA 3QJ1A 3D2YA 4GF9A 4Z8IA 2Z9NA 1SXRA 1EAKA 1OHTA 2APHA 3OGXA 2Y2CA 2Y2EA 5DWFA 3T2VA 3BKVA 2Y2DA 3USXA 4OLSA 2R90A 1J3GA 4BJ4A 2F2LA 2XZ4A 3HMBA 1TWQA 2Y28A 1SK4A 1AROL 2XZ8A 3UMQA 2F2LX 3T39A 4Q9EA 2R2KA 3NW3A 2L47A 5CTVA 4OUGA 3UMLA 3CXAA 4Q8SA 3O4KA 4IVVA 4BXEA 4BOLA 2Y2BA 4G54A 4ORVA 3NG4A 3UILA 2RKQA 3NNOA 2EAXA 1YB0A 4KNKA 3C2XA 3QS0A 2BH7A 3LATA 4ZXMA 2CB3A 3TRUA 1SK3A 3RT4A 3RDRA 4OPPA
chains in the Genus database with same CATH topology
4LPQA 3BKHA 1S2JA 1L6JA 3CORA 1LBAA 4KNLA 1LBUA 1YCKA 2EAVA 4FNNA 4BPAA 4BXJA 3CG9A 5E0AA 3EP1A 3QV4A 4BXDA 2AR3A 5E0BA 4X36A 1Z6IA 2WKXA 3D2ZA 3QJ1A 3D2YA 4GF9A 4Z8IA 2Z9NA 1SXRA 1EAKA 1OHTA 2APHA 3OGXA 2Y2CA 2Y2EA 5DWFA 3T2VA 3BKVA 2Y2DA 3USXA 4OLSA 2R90A 1J3GA 4BJ4A 2F2LA 2XZ4A 3HMBA 1TWQA 2Y28A 1SK4A 1AROL 2XZ8A 3UMQA 2F2LX 3T39A 4Q9EA 2R2KA 3NW3A 2L47A 5CTVA 4OUGA 3UMLA 3CXAA 4Q8SA 3O4KA 4IVVA 4BXEA 4BOLA 2Y2BA 4G54A 4ORVA 3NG4A 3UILA 2RKQA 3NNOA 2EAXA 1YB0A 4KNKA 3C2XA 3QS0A 2BH7A 3LATA 4ZXMA 2CB3A 3TRUA 1SK3A 3RT4A 3RDRA 4OPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPQ A;  3BKH A;  1S2J A;  1L6J A;  3COR A;  1LBA A;  4KNL A;  1LBU A;  1YCK A;  2EAV A;  4FNN A;  4BPA A;  4BXJ A;  3CG9 A;  5E0A A;  3EP1 A;  3QV4 A;  4BXD A;  2AR3 A;  5E0B A;  4X36 A;  1Z6I A;  2WKX A;  3D2Z A;  3QJ1 A;  3D2Y A;  4GF9 A;  4Z8I A;  2Z9N A;  1SXR A;  1EAK A;  1OHT A;  2APH A;  3OGX A;  2Y2C A;  2Y2E A;  5DWF A;  3T2V A;  3BKV A;  2Y2D A;  3USX A;  4OLS A;  2R90 A;  1J3G A;  4BJ4 A;  2F2L A;  2XZ4 A;  3HMB A;  1TWQ A;  2Y28 A;  1SK4 A;  1ARO L;  2XZ8 A;  3UMQ A;  2F2L X;  3T39 A;  4Q9E A;  2R2K A;  3NW3 A;  2L47 A;  5CTV A;  4OUG A;  3UML A;  3CXA A;  4Q8S A;  3O4K A;  4IVV A;  4BXE A;  4BOL A;  2Y2B A;  4G54 A;  4ORV A;  3NG4 A;  3UIL A;  2RKQ A;  3NNO A;  2EAX A;  1YB0 A;  4KNK A;  3C2X A;  3QS0 A;  2BH7 A;  3LAT A;  4ZXM A;  2CB3 A;  3TRU A;  1SK3 A;  3RT4 A;  3RDR A;  4OPP A; 
#chains in the Genus database with same CATH topology
 4LPQ A;  3BKH A;  1S2J A;  1L6J A;  3COR A;  1LBA A;  4KNL A;  1LBU A;  1YCK A;  2EAV A;  4FNN A;  4BPA A;  4BXJ A;  3CG9 A;  5E0A A;  3EP1 A;  3QV4 A;  4BXD A;  2AR3 A;  5E0B A;  4X36 A;  1Z6I A;  2WKX A;  3D2Z A;  3QJ1 A;  3D2Y A;  4GF9 A;  4Z8I A;  2Z9N A;  1SXR A;  1EAK A;  1OHT A;  2APH A;  3OGX A;  2Y2C A;  2Y2E A;  5DWF A;  3T2V A;  3BKV A;  2Y2D A;  3USX A;  4OLS A;  2R90 A;  1J3G A;  4BJ4 A;  2F2L A;  2XZ4 A;  3HMB A;  1TWQ A;  2Y28 A;  1SK4 A;  1ARO L;  2XZ8 A;  3UMQ A;  2F2L X;  3T39 A;  4Q9E A;  2R2K A;  3NW3 A;  2L47 A;  5CTV A;  4OUG A;  3UML A;  3CXA A;  4Q8S A;  3O4K A;  4IVV A;  4BXE A;  4BOL A;  2Y2B A;  4G54 A;  4ORV A;  3NG4 A;  3UIL A;  2RKQ A;  3NNO A;  2EAX A;  1YB0 A;  4KNK A;  3C2X A;  3QS0 A;  2BH7 A;  3LAT A;  4ZXM A;  2CB3 A;  3TRU A;  1SK3 A;  3RT4 A;  3RDR A;  4OPP A; 
#chains in the Genus database with same CATH homology
 4LPQ A;  3BKH A;  1S2J A;  1L6J A;  3COR A;  1LBA A;  4KNL A;  1LBU A;  1YCK A;  2EAV A;  4FNN A;  4BPA A;  4BXJ A;  3CG9 A;  5E0A A;  3EP1 A;  3QV4 A;  4BXD A;  2AR3 A;  5E0B A;  4X36 A;  1Z6I A;  2WKX A;  3D2Z A;  3QJ1 A;  3D2Y A;  4GF9 A;  4Z8I A;  2Z9N A;  1SXR A;  1EAK A;  1OHT A;  2APH A;  3OGX A;  2Y2C A;  2Y2E A;  5DWF A;  3T2V A;  3BKV A;  2Y2D A;  3USX A;  4OLS A;  2R90 A;  1J3G A;  4BJ4 A;  2F2L A;  2XZ4 A;  3HMB A;  1TWQ A;  2Y28 A;  1SK4 A;  1ARO L;  2XZ8 A;  3UMQ A;  2F2L X;  3T39 A;  4Q9E A;  2R2K A;  3NW3 A;  2L47 A;  5CTV A;  4OUG A;  3UML A;  3CXA A;  4Q8S A;  3O4K A;  4IVV A;  4BXE A;  4BOL A;  2Y2B A;  4G54 A;  4ORV A;  3NG4 A;  3UIL A;  2RKQ A;  3NNO A;  2EAX A;  1YB0 A;  4KNK A;  3C2X A;  3QS0 A;  2BH7 A;  3LAT A;  4ZXM A;  2CB3 A;  3TRU A;  1SK3 A;  3RT4 A;  3RDR A;  4OPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...