4BOYA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
total genus 115
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4boyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4boyA01
2I3GA 1OMOA 3V1UA 5BNFA 2B4QA 3DHNA 1VJ1A 1E1NA 2F00A 2I66A 2QYSA 4DLBA 1EFKA 4DXHA 3ETDA 3R0IA 4YCAA 1HLPA 3OHSX 9LDTA 2I9PA 3O03A 3PHGA 1ZCJA 4IMPA 4CMIA 4E2ZA 1QSGA 4EI2A 2C5AA 1ZH8A 1YOVA 4UUOA 1YOVB 1RM3A 2JHGA 5I9MA 3WQQA 4MINA 2Q49A 3GEGA 2RCYA 3PQFA 5L3ZA 2VNSA 3KYDB 1NFFA 2ZB3A 3GFGA 1C1DA 4GX0A 5JAZA 2Q2VA 3C85A 3D4NA 5IXSA 3I6QA 2C0CA 3ON5A 2X9VA 3I9LA 5G4KB 4AFNA 5U1PA 1NXQA 3GK3A 2GERA 3JD1A 2AEMA 5JY6A 3K73O 2NSDA 5AYVA 4L4XA 2D8AA 2CMDA 4FOOA 3VPXA 3ITDA 1E7RA 1U2DA 2Y1GA 3DBHA 2GYYA 1I30A 2OP0A 3OIDA 4LVCA 1E3LA 1P45A 2B35A 2HSDA 4HY3A 3HNPA 2W98A 3G49A 2Y1OA 4LMPA 4NR0A 1BXZA 2YDYA 3QV1A 1YBVA 2O2YA 3ETGA 4XGIA 5JCJD 1O89A 3NUGA 3ZCXA 2X22A 3F4LA 4PFJA 5I7EA 5BNIA 3LT4A 1EK5A 3QP9A 4FS3A 2BI8A 5G0WA 1TA4A 5KJEA 4ALIA 4TRMA 2O50A 1JN0A 3JD2A 2G0TA 4Z9XA 1DLJA 2Q50A 3IKTA 3NYWA 3DR3A 5FI3A 1Q2XA 1V6AA 4QQRA 3ZNPA 3IP3A 3GQVA 4W6ZA 1Z45A 1SMKA 2YW9A 2Q1TA 5CDYA 2YQ4A 4PZEA 2DPGA 2POQX 4BGUA 4BMSA 5GZ1A 1EE9A 3CXRA 3BMQA 4MVJI 4OYRA 2OXIA 3V2GA 3FCOA 3MTGA 3DHEA 3WJ7A 1PJTA 3RC1A 3WB9A 4RZHA 5FWNA 1MFPA 4OO3A 4CQMB 4IDGA 2GN4A 2YFQA 3GZNB 2HMUA 4IIUA 4WEQA 5K6AA 5CG2A 4DA9A 4DBZA 1E6WA 3L9WA 1ONPA 4IZIA 1H2HA 3PQDA 1QYCA 2DBQA 3ZGYA 3E9QA 4ROSA 1WP4A 1BGVA 3BAZA 1LTHR 1U8FO 4MO2A 5EL0A 1ZW1A 4J16A 4NJMB 4Q3NA 1H9AA 3AM5A 1U5CA 1PX0A 3WTCA 3TPCA 3AY7A 4B3IA 4Z3KA 2AEFA 3PJFA 4B3JA 2ZQZA 1YJ8A 2NNLD 4KWHA 3GVXA 2X86A 4HNGA 1HEUA 1KVRA 3QY9A 3FD8A 1KC3A 3LSYA 5ITVA 4FFRA 1I01A 5DOZA 4WLVA 3RUAA 2EW8A 2DFDA 4DQVA 4CM6A 5TT0A 3VVCA 3LU1A 5FFFA 1YQXA 3WGOA 4NPCA 5G0SA 4YT4A 4E6PA 2ZCVA 2IEBA 3LYLA 1TEHA 2DLDA 1JWAB 4Q3CA 3VZSA 5JLAA 4FN4A 3UUWA 1P74A 3T7CA 1YL5A 3KM0A 4FCCA 1GY8A 5FF9A 3WYCA 4NH4A 1C3VA 1RM0A 1K6JA 3RQSA 4KQXA 1IY8A 1B26A 2YZ7A 1EMDA 1PJ3A 4AJ2A 4CL3A 1LSOA 1ISMA 1EDOA 3NT5A 3M1LA 3WGYA 4R16A 2FY8A 4CQLB 3ONFA 4NFHA 1LC0A 2CZCA 3WGTA 4XKJA 4EITA 1ADBA 1HTBA 4KDFA 4P22A 4LW8A 5L4NA 1HF3A 1ZSYA 1MV8A 4A26A 1HSZA 3JQBC 5G4KA 5KKCA 1C0PA 1DC4A 5B12A 1ENOA 4YT2A 2HMVA 4FPXA 4X54A 1PWZA 2HUNA 2WMDA 5GZ3A 2GZ1A 3AUUA 3BHJA 1OZAA 2FZWA 3JQBA 5EN4A 3KB6A 5A3JA 1MXFA 5DNAA 3PHIA 3PYMA 4L76A 4HKTA 3JQAD 3KO8A 4BMVA 2W90A 4R3WA 1G0NA 1CIVA 4IDDA 3C1OA 2BLLA 2JFFA 2O3UA 2C29D 4GLLA 4RPGA 2QRLA 4YQYA 4B7XA 4I08A 1P1JA 1LDMA 4TRJA 5HM8A 2IEDA 1M2WA 3PJDA 3ZWOA 4KTTE 4CQMD 2D59A 5B4VA 4WKGA 2J5QA 3M1AA 2AE2A 5KVCA 3KSZO 1R6DA 3P19A 4IY1A 3Q9NA 9LDBA 1X1EA 2EKPA 3LF2A 2EERA 3ZHZA 4URFA 1GEEA 3TFQA 1N2SA 3DL2A 1EEHA 1NHWA 2YHIB 2XOXA 3AU8A 3C24A 4M54A 1NVGA 1RYDA 1GD1O 4D3FA 5U4QA 1U4OA 4OKNA 4TWRA 2HRBA 4LVUA 2VHVA 5KVVA 1KBZA 4XEHA 5KWEA 5CAEA 4CLOA 4I9HA 2AXQA 3D1LA 3O38A 3PPIA 1X7HA 4GMFA 4TKLA 3DXFA 3JYNA 1EBFA 3DZIA 4CR6A 4Z6KA 1ZNQO 3G17A 3PIDA 2ZYGA 3KZVA 3W8FA 1GZ6A 4YJHA 3WLEA 1GQYA 4R69A 3DZBA 1DIAA 5JE8A 1B16A 3HWRA 3ICPA 3JD4A 2BH9A 3VOSA 3ENKA 4R54A 1P31A 4R5HA 1XWFA 4YRBA 4JN6B 3I4CA 4D79A 3H5NA 1HXHA 5ENVA 2C59A 3UICA 3ANMA 3NAQA 2X23A 1PQWA 4YJGA 3ZWXA 1LRJA 4CMKA 3BMOA 3RUCA 1SOWA 2PGDA 3EY4A 4FJ2A 3GOHA 3IIEA 4S3MA 4EJ0A 3W8DA 4GL4A 1Y8RB 1EFLA 1YBAA 1P1HA 1MLDA 1TT5A 3QVXA 4H15A 2J3HA 4DQUA 4JP2A 3I6IA 1R4MA 3QWHA 4FR5A 4RVUA 1ML3A 2AMFA 1VSVA 4YDRA 1XIVA 4HV4A 3QQPA 4L0QA 3E03A 1NVTA 4OGWA 3PEFA 3WGZA 4NBWA 4MP8A 4C4OA 4EEZA 4P4LA 4ZQGA 4JJFA 2A94A 3N7UA 2BI7A 5AOVA 1OC4A 1UDBA 1W73A 5JO0A 3BTSA 4J91A 5JC1A 3FF4A 5HS4A 3JQGB 1H9BA 5TLSA 5B37A 4CLRA 1BSVA 1W0CA 1XR3A 1IPFA 2ZTLA 3OQ1A 1EQUA 3JQ9A 4IGEA 2ZB7A 3D0OA 3JD3A 4ILKA 4J7UA 4E31A 4I5GA 1I36A 3DBLA 5TF4A 3GHYA 3KVOA 5H81A 3AK4A 1IOLA 3B20A 4WJZA 2OORA 3B70A 2XXBA 1KY5A 5IDXA 2E82A 3UFXA 1Q7BA 1B15A 2C2XA 4DBVO 3MWEB 3HDHA 1HZZA 2ZK7A 5I8WA 1NR7A 4Z3DA 2DBVO 2PH5A 5F5NA 1VJTA 2Y05A 3PRJA 1NR1A 3WX0A 4YAEA 5IJZA 1PS0A 3ZHYA 2RAFA 4XYLA 2WD7B 5LDHA 2W4QA 3TF5A 3LT0A 1OAAA 3SLGA 3S1LA 2NTVA 5L40A 4QXMA 4J2OA 4PIVA 4WE3A 3OA0A 1KEVA 1K89A 2D5CA 3WNVA 1OOEA 4NFSA 2EG9A 5EJ2A 2VZ9A 5ILOA 1DHTA 1ADCA 4RPJA 1AE1A 3AI1A 4J7XA 3WSVA 2PKQP 3D5TA 1HDXA 4FD3A 3F6YA 1SEVA 2G76A 4ND3A 1ZSVA 1U1IA 3L6OO 3KSDO 1ONOA 5G0UA 1JW9B 1NTOA 2EJVA 4RDHA 3P7MA 5G4LA 3RUDA 4XR4A 3ADPA 1UDAA 4E13A 4BNFA 4A73A 4A27A 4HUJA 5DN9A 4EBFA 3I9MA 1Y7TA 1P0FA 3HSKA 1IUKA 3U3XA 1AXGA 1HDOA 3H7AA 4YT8A 1U3TA 1LDNA 2W2KA 3L4BA 4GX2A 1HLDA 1T26A 2JCVA 3RWBA 4DL9A 2YHIA 3SEFA 3GN1A 1V0JA 6LDHA 4CLDA 2B69A 7ADHA 1X15A 3IS3A 3ZWCA 3D5QA 4LGVA 1DIGA 2E4AA 4CM9D 3E6AA 5KJ6A 1HDYA 3DAPA 2FP4A 3DQPA 3RBXA 1QYVA 5B4TA 2V6FA 3WBFA 1Z7EA 4R01A 1HYGA 4IQ0A 2PGLA 4PG4A 5A9SA 3DZGA 5LC1A 1Q0HA 2XAAA 3QRWA 1XDWA 1YBMA 3RVDA 4I5DA 4AJNA 5A9SB 5A04A 5GMOA 1TXGA 2GN8A 5ITWA 2C7GA 1WMBA 2CSUA 3E1KA 4NZ9A 2HMWA 1NYTA 1PJLA 3I52A 1LEHA 3KUXA 2YY7A 3E8XA 1VM6A 3HZZA 5KIAA 3JYQA 3EVNA 2X0RA 3GPDG 2I3AA 4IBOA 3RUHA 3L6EA 4KP7A 2Y68A 3UH1A 1MA0A 1IYZA 1W4ZA 2RHCA 4BB6A 2YV3A 1JTVA 2OGUA 2NQ8A 5KOIA 4BNIA 1PL7A 2EIHA 1KOLA 4C7JA 1B2LA 5JDCC 1N7GA 3L4SO 4CM4B 1XLTA 2CFCA 3S55A 1DEHA 3ORFA 3D3WB 3H9JA 3JQDA 2Y99A 1XELA 1VKNA 2OFPA 3F46A 2V6BA 4N54A 1BXGB 1YQGA 4MDHA 4NDNE 1L7EA 4E5NA 3UN1A 3PLNA 1H2BA 3H6KA 1LDYA 2ILTA 3TWOA 1M6HA 3GPIA 1ONNA 4DPKA 5GY7A 5C7OO 1FF9A 4B7CA 1GUFA 3HFSA 1V35A 4J1QA 4MKZA 5G0VA 3LF1A 3GC6A 4E4YA 2VUTA 1Y1PA 3H5RA 1S6YA 3UVEA 4JJIA 1X13A 1FDTA 1RKXA 3DWFA 2FSVA 1NASA 1P9LA 1B8VA 1JLLA 3EZLA 3AUAA 5JAQA 2RHRA 1NQOA 4C7KA 3KETA 1F8FA 4BO5A 5DBFA 4U5QA 1N5DA 1I32A 3DZJA 3OETA 3DC2A 3GY0A 2WDZA 1GYRA 1BXKA 1PJ2A 1W8DA 5JBIA 1Z74A 4NQZA 2YV2A 4PLZA 1IHYA 1A9ZA 1EQ2A 4GVXA 2HRZA 4ZQHA 4OXKA 2PZJA 2PTGA 3AU9A 1FMCA 4B4OA 3B6ZA 1R4NA 1YDWA 5F21A 1B3BA 5THQA 1Q0QA 3TOZA 5L9AA 4HFMA 3K31A 1WDMA 5HBRA 2EF1A 5DT9A 3LVFO 1YRLA 4GLOA 4R1NA 4CM1A 4DC1A 1F06A 4MVJH 3K2EA 3QE3A 3SC4A 3P2OA 3W8EA 4QUKA 1E6EA 2A35A 3PZBA 1U3UA 3ONDA 2AG5A 5T8KA 1L7DA 2E49A 4E2YA 3NTOA 1PQPA 4JX8A 1K0UA 4CJXA 4RQUA 2PK3A 5L51A 4BNTA 2Y1FA 3BMQB 1TVEA 4WLEA 4XYEA 5K9ZA 4O1MA 1DFIA 1E3WA 4FGSA 4ZQEA 1JU9A 4RVSA 1NHGA 1GQ2A 4U7WA 1NAHA 1V3VA 5FEUA 1YB1A 1H6AA 4OAQA 3RJ9A 2X9NA 3AWDA 1P0CA 4A0SA 5H82A 5TRTA 4E5PA 4ALKA 1BDMA 1X1TA 1LDGA 5BSEA 3W1VA 3Q3CA 4O63O 2PD6A 4BGVA 2NVBA 1EZ4A 1KYQA 4II3A 8ADHA 4O6VA 3M2TA 4LCJA 5EMHA 1HDGO 1I3NA 4JQCA 1GAEO 4QT0A 3CE6A 3UCXA 3ZWVA 3DBHB 4EZBA 4DTIA 4ND5A 5BSFA 2QQ5A 3BMOB 3PI7A 3SVTA 2BF7A 4OKIA 4RCVA 2OHXA 4HX5A 3RAJA 1JQBA 3SJUA 2Q1UA 4GH5A 3B1JA 1LI4A 4RF4A 1CWUA 4BVAA 4WGGA 4YA6A 3G0OA 1B7GO 3JCZA 3U4HA 3ROPA 4GQAA 1C1DB 5L45A 2GN9A 3H3FA 4JBGA 3WGHA 2D3TA 1DJQA 5IDWA 1GV0A 2OP1A 1E3SA 2IODA 1G1AA 1NQTA 2JHFA 3EVTA 1D7OA 1I2ZA 4W7IA 3F4BA 3LDHA 3PDUA 4H16A 3EZYA 2X1HA 3GNTA 2BHLA 2GNAA 1MC4A 1CJCA 1UAGA 4KOAA 4WLFA 3ZV4A 3PHJA 1HE4A 2VYNA 5G0TA 4TZTA 1X0VA 4GAEA 4CV0A 1BVRA 5F1KA 3KXDA 3DAGA 1A72A 5EQDA 4UVEA 4JK3A 2VWQA 4OJNA 3WIEA 2PV7A 4QO8A 4A7PA 4M87A 2QZ9A 1U3WA 4XIYA 4QX6A 2WJPA 4WECA 4N5LA 1K3TA 3H9GA 5KJCA 2CVOA 2R00A 3ZU3A 1HE5A 2AG8A 3WFIA 1T2EA 4B4UA 3C8MA 1ZUD1 3UGKA 4CM7A 1GU7A 4DPMA 1MX3A 2O4CA 1D1TA 4UUPA 1DHRA 1U7TA 3EC7A 4YJFA 4GKBA 4QFDA 5L7YA 2GASA 2Z1NA 2HK8A 4XJSA 3PHHA 2BFPA 4Z9FA 4R1TA 3GVPA 2NU7A 1LBEA 3COSA 2O23A 2VRCA 3C1TA 1B3RA 2EXXA 3ZU5A 2AA3A 2DQ4A 4DPLA 2IYPA 1CQJA 4NBRA 3TRIA 2UUPA 1ENZA 2B36A 3IUSA 1XKQA 1Z82A 2G1UA 4ID9A 3WR5A 1RJWA 2VOJA 3TFOA 5TGDA 3F5QA 1U28A 3F1KA 3ZW8A 1R66A 1ULSA 3IKVA 4BO9A 3IC5A 3A4VA 1UXKA 1NPTO 1GV1A 4PLCA 4AJEA 2FRDA 1NWHA 3AI2A 4E2WA 1UP7A 2P5UA 1ZXBA 4YYZA 1VPDA 2CNBA 4XJTA 1O9BA 5F5LA 3WYEA 4J9VA 4J1SA 3A1NA 1R12A 3RKUA 4RVDA 4BUCA 3QVTA 1H6DA 3GGPA 2BELA 5TX7A 3HUDA 4BNMA 4CMBA 4Y8VA 4CUKA 4ZHSA 1Y8RA 4L8VA 3FNGA 5JAIA 4HWKA 3RI3A 3IL2A 2PH3A 3TL3A 1EVIA 2C20A 1DC6A 3ZHXA 1E0DA 4Y9DA 1I8TA 2ET6A 3NTQA 2B5VA 5DOVA 4FC7A 3BMNA 3ZWPA 1ISJA 1SNYA 1XG5A 3JQ6A 4FBGA 4LISA 1RM5A 2YUTA 4WCDA 4E30A 1B0AA 4K28A 3HN7A 5AXBA 2VN8A 3OFSA 4RQTA 3ZWBA 4PLYA 1KEUA 1IE3A 1UR5A 5JSFA 4H3VA 1LLDA 2Q46A 3WWYA 1NQAO 2BFAA 5K6AC 4JP3A 5L53A 2UVDA 4D3SA 5J23A 2O7SA 1EUCA 1QYXA 1YKFA 4CMIB 4YAIA 1CYDA 4BNLA 5LDGA 3PWKA 1FDWA 3T4XA 4G81A 1P44A 2HMTA 4EEXA 4YRAA 5B4UA 1PEDA 1N9GA 3FR8A 4IXTA 4OMUA 2AEJA 4JBIA 1HT0A 3TOXA 4NIMA 4MIOA 2Q45A 2DKNA 4CPDA 1QKIA 4RF2A 1Y5MA 1U8XX 3WSWA 1E77A 1Y5RA 3RUEA 1VLLA 3OEWA 1DC5A 3QA9A 2AW5A 1ZO8A 4GSKA 1WWKA 4WLOA 1ZXLA 3A14A 3G79A 3C1AA 3U9LA 4A10A 2NUAA 4CV3A 3FI9A 1PIWA 1Q7GA 1J4AA 4J6FA 2ZB8A 1QXSA 3H4VA 1UJMA 2EGHA 4EJ6A 4E12A 1EVYA 3VPHA 2IDZA 1BMDA 3CMMA 5IN4A 3KYCA 2IZ1A 3GVIA 4CMEC 1LJ8A 5I8ZA 3DTYA 1XEAA 1ZKMA 4E33A 4YJFB 3INGA 3WXBA 4UEOA 2VTDA 4IMRA 1GPJA 3ST7A 4W9NA 3WFJA 1DIHA 3PWSA 2HMSA 3Q2KA 4Y98A 5DCWA 3G1TA 3PYXA 4CUJA 4R1UA 1D1SA 4KUHA 3SLKA 3TZQA 3T7EA 3K30A 3RC2A 1Q1NA 1R0KA 3D4PA 1X0XA 3ASUA 3K96A 2Q3EA 3OBBA 3A28A 4W9NC 2Y1EA 3H3JA 4BO3A 3L9XA 1YXMA 4JCOA 3O26A 2VZ8A 3DAFA 3PQEA 3ZV5A 4BNYA 1YQDA 2GZ3A 1ZK2A 1QMGA 4RPLA 2VWGA 5L4SA 1DSSG 1LSUA 6ADHA 2Y0CA 5EERA 2GUGA 5HRUA 2BD0A 3ROMA 1HE2A 1EUZA 5CDTA 4FC6A 1B8UA 3O8QA 3JQ8B 2Q2QA 1KEWA 1HDRA 4R41A 1GCUA 2LDBA 4LK3A 5JYFA 2X6TA 5JY1A 1VJ0A 2V7PA 2E48A 2QW8A 2ZQYA 3X2FA 1NBOA 3WYBA 1UDCA 2NTJA 3NEPX 4U8GA 3INRA 3WQSB 2VHXA 3LLSA 3GF4A 2BMAA 3OJFA 2J6IA 1YDEA 1I3KA 4MKRA 7MDHA 4XRGA 1V3TA 1YB4A 1AHHA 3ULKA 3Q9UA 2VNAA 3EYWA 5JW6A 5JMWA 1PQUA 4NBUA 3F5SA 4PN3A 4UUNA 2EHDA 4UEKA 1JAXA 5AQ1A 1RYEA 1ZK0A 3QSGA 4QEDA 4YJHB 1YO6A 2VT3A 3Q1LA 1N1EA 4B8WA 4OSOA 3L0DA 4M55A 1PJQA 3H9UA 3JYOA 3DZHA 1LXCA 1WZEA 4NK4A 2DTXA 4CLOB 3HDQA 2PNFA 3F3SA 4PG7A 4TRNA 4ZA2A 4J7CA 3VVBA 2JD2A 1Z7BA 4XGKA 1XGKA 2JAHA 3KYBA 4IM7A 4E32A 4OOEA 4PLWA 5JDCA 3RROA 4YRDA 3SC6A 2C5EA 1PZFA 1YVEI 5CDSA 4W4TA 4XZ3A 5G2OA 3C7AA 4O59O 4RORA 3GG9A 4M89A 2P9EA 4ZRNA 4W82A 3BYZA 4EUEA 4L4SA 3DHYA 1DAOA 4I9UA 1DRWA 1YONA 1M66A 1KY4A 4XYGA 2X9GA 3P2YA 1CQIA 4GX1A 4J1TA 2I5PO 2A92A 2VOEA 4CODB 1XCBA 3WS7A 1LQTA 3R1IA 1BW9B 3I9NA 2GZ2A 3JQ7A 1J6UA 4IJKA 1KS9A 1PL6A 3BTUA 3EDMA 3ZH2A 3U0BA 1IL0A 3QW2A 2FPPA 1E6UA 4CUZA 3HADA 4UULA 3HG7A 4J4HA 4TVOA 2G17A 3MJEA 4P38A 2J5KA 3FTNA 4B7UA 4D42A 1T2DA 2DBRA 4L75A 2HJRA 2WEKA 1A7AA 3GT0A 2QG4A 1D4FA 1PWXA 3ANLA 3ADOA 2Y67A 4AJ1A 2P9CA 1PJCA 4RF5A 1I0ZA 3TSCA 2GRAA 4CMAA 1H94A 1A4IA 2VHZA 3GMSA 2GCGA 3A9WA 3JQFA 2J3IA 4HNHA 1QYDA 1U5AA 4RVGA 3JYLA 2W2KB 3DBVO 2QHXA 3JTMA 1YGYA 1I3LA 3DOOA 1ORRA 1YL7A 4KQWA 3KYDA 4OM8A 5KNLA 4WK6A 2PR2A 3VZQA 4RVHA 4IDFA 3VKUA 4ZN6A 4FFLA 4YAGA 3SXPA 4BNGA 3FSRA 4YR9A 2P2SA 4CMGA 3S2GA 3BHIA 3SBOA 3DFZA 1ZFNA 3ITKA 4RPHA 1UXJA 3BMCA 4XA8A 2RBEA 4XRRA 3GUCA 4CR7A 1CETA 2EW2A 3RSHA 3OECA 4NNJA 3D3WA 3BMCB 3NTRA 1EK6A 3VTFA 4PLTA 3FN4A 5ENDA 4P4GA 1YE3A 2EKQA 2TMGA 3IP1A 5JMPA 3GAZA 4XB1A 4ESOA 1XQ6A 4I9NA 3GRKA 4IIVA 3ZNNA 2AHRA 2HCTA 4CV1A 4FQ8A 1VI2A 3ZI0A 4INAA 3WICA 2FMUA 1K6XA 2VWPA 3GR6A 4IDAA 5ILGA 2E37A 3CSDA 2WD7A 2XPCA 3QLJA 2JFHA 1P1FA 3WG9A 3LQFA 4TVBA 4N18A 1GYPA 3UCEA 3I83A 4YXFA 3RASA 3LLVA 4RL6A 1UZMA 3OIGA 3K8ZA 3DMTC 3GZNA 2QYTA 3RJ5A 3V1TC 2H63A 1ADGA 1BDBA 5MDHA 4MKXA 2NLOA 3RUFA 4TMFA 3W4JA 3ZHBA 2NWQA 5ADHA 4RGBA 4OIMA 3V8BA 5T64A 5A5FA 4MPDA 3DMTA 1WXDA 1YJQA 3H5AA 1N92A 3W4KA 2B83A 4IDEA 1OFGA 2CF6A 1C14A 3WMXA 1X7GA 1U3VA 3DTTA 1XHLA 4MVJE 5IZCC 1YWGO 4K26A 3NDJA 5JDIC 4Z0HO 3HDJA 3UAGA 4R5MA 2PZKA 1A4UA 2D1YA 2VTEA 4MIEA 4BO2A 1NWCA 3V5NA 5T67A 3OJOA 1I33A 1ENYA 2EEZA 4TQGA 2PD4A 4CMEA 4FFMA 3I9OA 1K5HA 2BGMA 2O2SA 2OBNA 4ZVVA 4RDIA 4J9UE 5DP1A 3KBOA 2PZMA 3W6ZA 1M76A 3OICA 4LMRA 1P1RA 1DFHA 1LLCA 1O95A 2XF8A 3IUPA 4OXNA 4JGBA 4OXYA 5DDIP 4HP8A 3WNQA 1NAIA 4XYBA 3D64A 1IB6A 2P9GA 2CY0A 4BV9A 3MJVA 5ES3A 4MVJD 5EESA 1SEPA 1T2AA 3QJ5A 4Q39A 4QTZA 4CM9A 2B4RO 2AQIA 3TN7A 3NJ8A 3GNSA 3ROQA 3ZV6A 1ZIDA 3GGGA 3PXXA 4RO0A 2FOIA 4XIJA 2DT5A 5I9LA 3FTPA 5A06A 2GPTA 4LRSB 2NVWA 2HQ1A 3S2EA 4BNHA 3DEYX 2DFVA 4U0KA 5KVQA 2NACA 1KERA 3Q6IA 3FWNA 1XSEA 2WWRA 1UUFA 5T73A 1AHIA 5CPFA 1PS8A 5B1YA 1NNUA 1E7MA 3UOGA 1BRMA 3OP4A 2O4UX 1EBUA 3DFUA 4YB8A 1F8GA 1NQ5A 4M86A 5CP8A 4L73A 2Q4EA 3CKYA 3X2EA 4BO7A 3FHLA 1Z75A 3GH3A 3QWIA 2CDCA 2AE1A 2HK9A 3VPGA 3DO5A 3MJSA 3CEAA 1E3IA 1PGPA 1ZBQA 4BOYA 2J3JA 3R3SA 5A02A 3I5MA 2IXAA 3U4CA 2G5CA 4BKPA 4I5FA 3AY3A 3VH3A 2Y93A 3VH2A 4KWIA 2JKVA 1SAYA 1XYGA 4H7PA 4CMHA 2UYYA 3GEMA 5JPIA 2P5YA 2R2GA 4FJ0A 4DC0A 3PVZA 3DBRA 4UVIA 4OOFA 1EE2A 1ZMOA 1SC6A 3O8QB 2WE8A 1HDZA 3FBGA 3ZU4A 3QWBA 1QV6A 4XGNA 4II2A 1V9LA 3UCFA 1GPDG 1E1MA 1H6CA 4NI5A 3WLFA 1WNTA 2V65A 2V6MA 5CDUA 2DC1A 1AGNA 1WW8A 4FSHA 5EPOA 5HTOA 2VRCD 3WMWA 4LSMA 5HA5A 2FPIA 3FWZA 1MC5A 5H83A 4NU5A 1KVTA 5TQVA 3GLQA 1ZZEA 2PY6A 1TLTA 5T5QA 1F12A 2ZTUA 1JWBB 1WPQA 1BWSA 5COAA 1UXGA 4XYMA 5HS6A 4WPGA 1C1XB 2LDXA 2DVMA 2X7HA 1N1GA 1T2CA 1YH3A 1SZJG 4L9RA 2H5LA 1HSOA 3RFVA 4D43A 1BG6A 1MG0A 3KLPX 1PGQA 5AXDA 4Z0TA 1MFZA 3WIDA 2IXBA 4ALNA 1ZEJA 4ZD6A 1NP3A 1L1FA 1AXEA 1UH5A 3GGOA 2C54A 3DBRB 3DZFA 2DTDA 5AXAA 3RU9A 4R68A 5KJ1A 1QV7A 3KV3O 3GVHA 4DYDA 1VE9A 1E7WA 4HADA 3H9QA 1NVMB 1H0KA 3IMFA 5A5EA 1IPEA 1HWYA 1QG6A 3FPCA 3LZ6A 3PZRA 3ZNOA 4BKRA 1R4NB 4IJVA 3GDOA 1SB9A 1LDEA 3T4EA 4K6FA 3V1YA 4ZICA 1LC3A 3IDSA 3OA2A 3ICCA 2OO5A 5C7IO 4BO4A 1YB5A 5JAMA 3LC7O 3OQBA 4B4VA 4IXWA 5F1OA 3K92A 2RH4A 3ONEA 5FI5A 5KTKA 1HYEA 4UEJA 3FPLA 3ASVA 4IINA 3QVSA 1DFGA 1VL0A 1DB3A 2D5AA 1ISHA 1NPYA 1G0OA 1V8BA 3MJCA 4J4BA 2UV8A 4CV2A 3ZWMA 2PFGA 2VUUA 5AVOA 2BGKA 3ANNA 3P5SA 4NJOA 2FSSA 4BO1A 4DIBA 3ZWWA 5DP2A 1C0KA 5ICSA 5A05A 3NKLA 4CLEA 4JJGA 3VDQA 2Z1MA 3GRPA 2YQ5A 4PRKA 4BO8A 2IRWA 1HKUA 3AOEA 1DOHA 1R16A 1PGJA 2RIRA 4BS9A 2YDXA 1X14A 1NFQA 3WOHA 3I9KA 5EQFA 4PG5A 4EDFA 4CQMA 2Z95A 1K2WA 2VYVA 4E3ZA 3PHLA 3N74A 2NU6A 3K6JA 1WAMA 4NG5A 4PZCA 1Y8QB 2ZJ1A 5CPBA 1X7DA 4WCFA 5CG1A 4UVGA 3VH4A 5A9TA 1ZK1A 3H2ZA 1I2CA 3KEOA 4QSMA 2ZYAA 1DJNA 3GUYA 1P77A 1AUPA 3RFXA 1KVUA 4Q3EA 4ZQBA 5FYDA 5CEFA 1I2BA 4YBZA 1XU9A 5IXYA 4WASA 2FPGA 4WEOA 4ALLA 2AQ8A 1GDHA 2P4HX 4R9SA 2GDZA 4TROA 3GAFA 4XX0A 4BB5A 4D0RA 3HE3A 1GCOA 4YEDA 5C5IA 4AJHA 4E2XA 3NT2A 3A06A 1QLHA 3DOJA 3L6DA 3BA1A 1GZ4A 2X0NA 4DMLA 4ND2A 1PZHA 5A3VA 1Z73A 2W2LD 3K2BA 1RM4A 1DXYA 1LDBA 4RZIA 1CF2O 1DPGA 3PJGA 2HLPA 3Q2IA 2X0IA 1I10A 1ZJZA 2HKIA 5F1PA 2VCYA 3AM4A 4XQEA 5TC4A 5TIIA 3FNHA 1H93A 3PYLA 3Q11A 3VC7A 1E92A 2JD0A 2Q99A 3AUTA 3ZN2A 4MVJF 1D8AA 2P4QA 3V2HA 3LC1O 1BVUA 4NFYA 3E5RA 4HBGA 3AUSA 4L74A 4FIZA 4CL8A 4DLLA 4ZQFA 4BIIA 2ZJ0A 1LSSA 3EMKA 4PGFA 3KTDA 1KEPA 3I1JA 1H6BA 4G65A 3IJPA 1U2GA 4BO6A 4J0FA 4UUMA 5CFZA 4XDYA 2HAEA 2I65A 1HE3A 2EJWA 1E1LA 4PZDA 4Q3AA 3G3EA 3RD5A 2EWMA 1I5RA 4E5YA 1ZJYA 1KVSA 2PGJA 1HZJA 3I23A 2SCUA 3NX4A 1T24A 4KTVE 3UW3A 5JYDA 5COQA 4DREA 1GADO 2OBYA 2Q4BA 4CMCA 1IHXA 8LDHA 5IFLA 3HHPA 3L07A 3ZZNA 5THKA 1B14A 1J5PA 4AVYA 1V3UA 4J2HA 1PR3A 3WGQA 1E7QA 1E5LA 1GFSA 5JXWA 3AY6A 3E5MA 2DUWA 3RU7A 1FK8A 2HO5A 4KZPA 4ZGWA 3VPFA 4DUPA 2J5RA 3IOYA 3ABIA 2TMDA 3RBVA 3PGJA 3CUKA 2VQ3A 1RPNA 1M6WA 4GSLA 1PR9A 3H9EO 3GDFA 2VZ0A 5KCZA 3F1LA 1JKJA 5T57A 3NGLA 3NJ4A 5TT1A 2Y1CA 3QWFA 5I7FA 3H2SA 4FJ1A 1FDSA 1LLQA 1VL8A 1KVQA 1UZLA 3OEYA 2R00C 4PVCA 4FFNA 1QRRA 1GUYA 3DBLB 3G1UA 4A5OA 4ZU3A 1PJSA 1JKFA 1RWBA 3TNLA 4Y6PA 4DVJA 2DM6A 3VKVA 1LUAA 4NHEA 4Y6RA 1EDZA 2DAPA 3IQDB 3PFFA 2NVUB 2O3JA 4OL9A 1BW9A 1PZEA 1Y6JA 5L7TA 2Q1SA 3HB4X 2W2LA 4AJIA 3B1FA 2FR1A 2Z5LA 1F14A 2DU8A 1AN9A 1CDOA 5JYEA 4BNKA 3ZDFA 1N9GB 4LCEA 3GFBA 5DULA 1DIRA 3LC2O 1O0SA 4B4WA 4RJTA 1VSUA 3O9ZA 1R0SA 4Q3BA 1MGOA 2XXJA 1T4BA 2O3RA 4BGIA 3HFGA 1HDCA 4WLUA 3ROKA 4WOKA 4Z0PA 1O6ZA 5KKAA 4I5EA 4E21A 3ZWAA 4RPKA 3C3XA 4RLSA 1UP4A 1E1KA 3GZ4A 4PLFA 3PWZA 4JBHA 3LK7A 1PTJA 5JO9A 5ICMA 4G2NA 1VRWA 3EGOA 2C07A 4CM8B 5IZ4A 1ZEMA 4Q9NA 3MWDB 5IF3A 3OIFA 3RBZA 3WBBA 4CM3A 4WNCA 2VYVD 4D44A 4XB2A 1MB4A 3AOEC 4YJGB 3CPSA 2D4AA 2HU2A 1WVGA 2ZTVA 1EVJA 1LU9A 3S2FA 4XDZA 4YQZA 5JYAA 1R37A 2YFHA 4OQYA 1UAYA 4GI2A 5COBA 5AXCA 2C2YA 3FRJA 4FFPA 3LT2A 5CEEA 4YPOA 3TZCA 1PL8A 3ZU2A 4R51A 1YL6A 1IZ9A 2QIOA 1DAPA 4Y67A 1KIFA 3RC7A 5T8KC 1F0YA 3MTJA 2YYYA 1I3MA 4WNIA 1Y81A 4QO7A 3MJ4A 5IDYA 3TDKA 4J3FA 5BT9A 1NFRA 2UDPA 3OQ6A 3JV7A 1BXGA 3PDJA 1TT7A 3KRTA 2QRKA 3E9NA 2FR8A 2JCYA 4L4RA 5CEJA 3GMDA 3VTZA 3BXXA 3EW7A 1VKOA 3KEQA 4J0EA 4J90A 5IZCA 1XQ1A 1QP8A 1PU2A 4IDCA 3WGGA 5J9GA 1FJHA 4KDEA 3WQRA 3U5TA 4J43A 1QLJA 2JJYA 4P8RA 2JAPA 4Y6SA 1ZSNA 4F6LA 4MVJG 1GQQA 2BFMA 3PP8A 4Z9YA 1DRUA 1ZVMA 4GGPA 1UZNA 4JIGA 1J49A 1SB8A 3SJ7A 1DDOA 1DO8A 1E7SA 1LA2A 2EP7A 4NBVA 4RVFA 4XQGA 4GKVA 2ZCUA 1HYHA 4PG6A 3DZKA 3V2UA 4ALJA 1CEQA 1IZ0A 1T2FA 2YHUA 1ISFA 2YV1A 1LRKA 4CLXA 4R4JA 4XD2A 4IQ8A 3OM9A 3U4IA 1C1XA 3QWAA 4F6CA 1BTOA 2X8LA 1Y8QA 4QECA 3EAGA 3UXYA 3VDRA 4ZRMA 3ETEA 3QIVA 4HFJA 1ZMTA 2VRBA 1SOVA 3WJAA 1E7YA 4NU6A 4F3YA 1QORA 5JCXA 2AQKA 4E5MA 3OJ0A 2ZB4A 2GR9A 4R1SA 1JVBA 4ND4A 2GSDA 1NX6A 3R6DA 2JL1A 4YWJA 2CF5A 3BZUA 1UP6A 1FDVA 3VAZA 2NM0A 3NGXA 3S8MA 4XQ9A 1C0IA 3PLRA 1PJ4A 4FDAA 2D0IA 4N5MA 3HQ4O 2X5OA 2NU9A 1QYWA 3KLMX 4KUEA 5M6DA 2DTEA 3HDYA 4GBJA 1EUDA 4IS2A 2G82A 2UAGA 3MOGA 4CQLA 5L95A 2NV6A 4J1NA 5DBIA 3CIFA 1JAYA 4K6CA 5TSDA 4EJMA 4S1VA 3BIOA 3E18A 1C0LA 5TS3A 3RC9A 1QR6A 4J49A 2CDAA 4BQPA 4D7AA 3PFWO 2WTBA 1D3AA 4BKUA 2Q2WA 3PIIA 3ZV3A 2I67A 3PJEA 3OH8A 4BV8A 3F47A 5K0ZA 3EHEA 4LRTB 1JDJA 1PGNA 4PCVA 4YT5A 2EV9A 1P1KA 1MXHA 3JSAA 3IAHA 3TJRA 2Y0DA 4R9RA 3M6IA 3GEDA 1MUUA 3MZ0A 2VHWA 4U6QA 2Q1WA 4TRRA 4UAGA 5GZ6A 1LRLA 3BHMA 1ADFA 3H8VA 5IAAA 1N7HA 3VPSA 3W4IA 2VYND 5EIOA 3PGXA 3VHRA 1SBYA 4OSPA 1PZGA 4BNNA 5BNTA 1JKIA 3HB5X 1DBVO 3R3JA 4BQRA 1A5ZA 4PLVA 1A71A 3GA0A 1XA0A 3MJTA 3BMNB 4BHTA 4MP3A 4MOWA 3JQAA 3NDRA 2C82A 4ITUA 5JNLA 2CVZA 2WM3A 2X58A 1HETA 3SX2A 5KVSA 3TZKA 4BNUA 1O8CA 4CM8A 4LSWA 1A27A 3HJAA 3TL2A 1A7KA 2ZKLA 1T25A 2FWMX 2PZLA 1R0LA 3NT4A 4M49A 2VHYA 1ZK3A 4FOSA 4AG3A 3D3EA 3JQGA 4RV9A 2OOSA 2DBZA 3AFMA 1MP0A 4F46A 3CMCO 4I8XA 2D2IA 4GMGA 1SO8A 3JQ7B 5EINA 4RLHA 3CZRA 3AW9A 3OF2A 4HXYA 4IJWA 2H1SA 2PLAA 3F9IA 5BSHA 3CTMA 3CH6A 4OQZA 1GZ3A 1DLIA 3AM3A 5IG2A 2FN7A 2WD8A 5CHEA 3WTBA 1R4MB 5A03A 1Q0LA 3WDSA 3GG2A 2O3SA 4DIOA 3RCBA 3WGIA 2PA3A 4YAKA 1TB4A 3B1KA 1WMAA 4JXKA 4O0LA 2X5JO 1HRDA 4NK5A 4OHUA 2CD9A 5A9RA 1FXSA 4BGEA 4DQXA 2F1KA 2O3QA 2NU8A 5JC8A 5KJFA 4B79A 3S2IA 3TQHA 3PK0A 2GLXA 1DIBA 1M67A 2FHSA 3EUWA 1FDUA 2QZZA 3RUIA 2H9IA 4ALMA 4I1IA 4U0JA 5F3RA 1M75A 4D45A 1ULUA 3O4RA 2PWZA 1UXIA 3AFNA 3GDGA 3RIHA 4D41A 4DIFA 4DYVA 4BNJA 4IPTA 3TZ6A 2I6TA 3VZRA 3AJRA 3GN2A 4D3DA 1ZK4A 1TT5B 4Q3DA 4AJOA 4IQGA 4BNVA 5A4DA 4E5KA 3UKOA 2I99A 1XU7A 4PRLA 1ISIA 4R3NA 4WOJA 2VUSA 3ZWNA 2AQHA 5ER9A 4CLHA 3DONA 4MP6A 2WYVA 4IUYA 2HJSA 2GO1A 1J0XO 4B8ZA 1U4SA 1Z6ZA 2GGSA 2PKRA 1E3JA 4GGOA 4JNKA 4BNZA 3JQ8A 4FW8A 2OZPA 4GX5A 1TI7A 4WLNA 5I7VA 2GF2A 2X4GA 1Y9AA 2IZZA 1OI7A 4EUHA 3LT1A 2OMEA 1LQUA 3GNQA 3C7DB 3GVCA 5ER6A 1U7HA 4MVJP 3U09A 2WYWA 1VL6A 2QRJA 5TNXA 3WWZA 4ND1A 1T4DA 3OMLA 2B5WA 3D4OA 4LN1A 4K1LA 2CUKA 5DF1A 3JQEA 4DMMA 2BGLA 3UF0A 2BRUA 2EGGA 4IZHA 4HFNA 4EYEA 3NV9A 3C7CB 1E5QA 3I9JA 3OJEA 4M1QA 4YJDA 5IN5A 4W7HA 1GL3A 4RF3A 1PS9A 2DPHA 4EW6A 4BKOA 2ZATA 3NDIA 4W99A 3MEQA 4K9DA 1CERA 4EGFA 4BNXA 3I4FA 2OUIA 2EP5A 4MIYA 1YS4A 4ZJUA 2GD1O 3KHUA 1WLYA 3QHAA 4KMSA 3FR7A 4O5OA 4WCFC 2HDHA 5JDIA 2QX7A 5L4LA 4XQCA 2A9FA 5IDQA 5I9NA 4GWGA 4WUVA 1GTMA 2NQTA 3JD0A 4FGWA 3DOCA 1IULA 3I3OA 5DCUA 5U9CA 4AL4A 1GEGA 2Y1DA 5JCJA 5BSGA 3FBTA 3GHHA 3JQAB 2BKAA 5DZSA 4AICA 3ZNQA 4DGSA 3FNEA 1LLUA 4MJLA 4TZKA 3D7LA 3KOUA 4M8SA 4UVHA 3UHAA 1O94A 2WE7A 2X0JA 2X5KO 4NMHA 2B4TO 5T6BA 5JS6A 3JQCA 5C37A 1E3WB 4PVDA 4YTEA 2Y66A 2YJZA 2WSBA 5TJ9A 3L77A 4PLPA 4GWKA 4NBTA 4PLHA 2WYUA 3U49A 1OC2A 1B8PA 4KUGA 2PKQO 4YAJA 5CDGA 4WCFB 4CM5A 4DRYA 2I76A 2UUOA 4AJLA 4UREA 3BTVA 4YVFA 4A03A 3KSUA 3JQ9C 1ARZA 1ISGA 3ENNA 3AOGA 3EK2A 2BFOA 4YACA 1DC3A 1ENPA 3K5PA 1OBFO 4FB5A 5L7WA 2H6EA 2P91A 2IZ0A 1JA9A 3VH1A 3CZMA 5JFOA 1GUZA 2B37A 2JCXA 2HK7A 3RKRA 4P4NA 4OH1A 1LNQA 2IYOA 4BL5A 5BR7A 4B3HA 2JFGA 3TZHA 4CMJA 2J3KA 2A4KA 2O7QA 4NJMA 1ID1A 1T1SA 3U62A 3PTZA 1BHSA 3L4BC 3JQFC 1CRWG 1GYQA 3AI3A 3DDNA 2JD1A 4E0BA 1I24A 1WZIA 4DLAA 1U9JA 3DMYA 4N5NA 2RH8A 1PGOA 4QFCA 1R15A 1N8KA 1F17A 4F45A 3U4DA 2GN6A 4AJKA 3HN2A 3STHA 3BTOA 4ONEA 1A9YA 4IJUA 4AJ4A 4AJPA 1HL3A 1H5QA 3VZPA 4CLRB 3JYPA 4EUFA 2ZIZA 2NTNA 4D0SA 4BO0A 2E6UX 1LSJA 1JVSA 3OSUA 1P1IA 3MOIA 4MVJM 1KETA 2CDBA 1P3DA 3ZWYA 2NADA 3OJLA 2OL4A 5DCYA 2FZEA 4FFOA 4XR9A 4JROA 1UXHA 2VWHA 5LCXA 2W8ZA 1SPXA 2Q22A 2C7VA 4XCVA 4A2CA 1SCUA 4AJJA 3K9QO 4IS3A 1WDLA 4CM4A 1G6KA 4TSKA 3E9MA 4IDBA 3Q0EA 1KC1A 3N58A 2ZTMA 2P68A 3NRCA 4BMNA 2CVQA 2IE0A 3IJRA 1P33A 2NVUA 4N7RA 4JLWA 2O3TA 5TJHA 3E82A 3INTA 5A1TA 2VT2A 1NM5A 2R6JA 3QVOA 4IGFA 1NPDA 4BNWA 5C3MA 4U6SA 4DWVA 5BQFA 3CINA 3W6UA 2EKLA 2O48X 1PSDA 4GVLA 5MGBA 4HFRA 4PLGA 4XWYA 5HWSA 4D46A 4CR8A 1T1RA 1W6UA 3QVWA 2FR0A 4GPD1 1LX6A 1GR0A 5C7LO 3KYCB 4G5HA 3H65A 5DBGA 1VC2A 1E3EA 3DB2A 1Q7CA 1S7CA 1PJBA 3ZW9A 2V6GA 3RFTA 1K6IA 2PD3A 4UVDA 1O5IA 3MCVA 4TKMA 2DUUA 2Y0EA 4J4TA 3M2PA 1MG5A 1WDKA 3E48A 4BKQA 1DRVA 4PG8A 3FNFA 1Y9EA 2ZYDA 1EVZA 2B0JA 2J8ZA 4MVJA 5I7SA
chains in the Genus database with same CATH superfamily
1VCHA 4OHOA 1F0PA 2ORWA 4RDXA 2DMRA 5D3MA 1AO3A 5BNFA 3ZQ6A 3AONB 3FCCA 1M6VB 1HDEA 1IDN1 2F00A 1XMIA 4DLBA 1EFKA 4MLCA 4YCAA 5D1HA 1HLPA 4HGNA 4BYMA 3DE5X 5JJBA 3OHSX 9LDTA 1FDRA 4ZAYA 2I9PA 3PHGA 4GF5A 1U0FA 4EI2A 1WDWB 4MW7A 1RPTA 2WTEA 3LUAA 1YOVA 2BE7A 5FB3A 4UUOA 3FWKA 3EZ2A 1N0IA 3MOSA 2AF3C 1L5QA 3LPLA 1RWPA 4R2IA 4DSAA 4HXGA 3IMEA 5CA1F 2B5OA 4DA6A 4F9EA 1CX9B 2RCYA 4US1R 3PEEA 2WQ7A 1EM8B 3UEOA 1OILA 1NFFA 4PICA 1KAGA 3AUKA 1I3CA 5LMUB 1F5NA 1LPPA 2Q2VA 4FR0A 5DGXA 1YTLA 5JAZA 3GCXA 3ZE1B 1YV9A 3JARA 4KO2S 5CXQA 1WSDA 5KWJA 3N3AC 3EIOA 2B98A 4AFNA 3K0KA 1KJ8A 5G4KB 2WYOA 5U1PA 3D6AA 1WKCA 5TF0A 4DCTA 3OAAA 4HATA 1N33B 2D8AA 1YR1A 2E5FA 2OCYC 2OD7A 4OKSA 4NMXB 4TLDA 4EY4A 3IFSA 4W5QA 2C5FA 2VJMB 1EAMA 1E7RA 4TKZA 5JD6A 1U2DA 1XNGA 1PVOA 2OP0A 4LVCA 4PTZA 3FVQA 1E3LA 1DINA 1MEJA 1PJAA 2Y1KA 3HPRA 5AIAA 5EKSA 3ZJ5A 3HNPA 2VAXA 2VP4A 2C98A 3G49A 3Q7RA 1ZCZA 1PNTA 1USUA 2R6ZA 3GRYA 3NC1C 2O2YA 2X6RA 3ETGA 1J1ZA 2IYVA 4NR0A 4RPIA 1O08A 3VH3A 3ZWQA 5LNK6 2ZIGA 3NUGA 4V0KA 4PFJA 1ZD8A 2HHHB 2C78A 1EK5A 3LT4A 4KXNA 2BI8A 4KX5A 5G0WA 4ALIA 4Y0AA 4TRMA 1YJXA 3R8CA 3JD2A 2HWXA 2QRVB 3FDXA 1DLJA 3T5GA 3WGLA 1DEAA 2CXHA 2F43A 4KQMA 1JIJA 5CW1A 1SXPA 1V6AA 3OZTA 2KLHA 2R85A 1M6NA 4LJLA 3EVFA 1ZUIA 4TWBA 3GQVA 2HREA 4W6ZA 1PD1A 3KPYA 5K20A 2A3RA 4KBGA 2X3UA 4Y6OA 5IKEA 5TARA 2PWBA 3GCWA 1UDWA 2CJWA 2J30A 3AEZA 2I87A 5E95A 4JLMA 5FTMA 4I6EA 5CFRA 2HD4A 4AX4A 4XWKA 1SBZA 3BMQA 3GJXC 3T54A 4BJ3A 4MVJI 4V2IA 2AXNA 3V2GA 3B8EA 3N0VA 3MTGA 3SY8A 1WNFA 2V9ZA 3B2QA 3QBEA 5CXUA 3BSYA 2OXTA 5FWNA 1RYZA 4INJA 3ZCTA 3FYUC 4IEFB 4LJ8A 3VGJA 5BYJA 2GCOA 4UARA 3ORYA 2XB6A 3LBHA 2A1UA 4H1TA 4IDGA 1TEZA 4HLUC 2ONZA 2R8RA 5FPTA 1NIJA 4IIUA 2HXYA 3K0CA 2AUTA 1NUUA 2KX7A 4RE6A 3TVTA 1YU6A 3VSCA 3WXMA 3ZV7A 2I8LA 3EXG1 3KTAB 2J46A 4EUFA 1ONPA 1WB6A 3PUXA 1I9GA 4Y2VA 4G4JA 4FMCB 2A5DA 2DBQA 2WZDA 2B4YA 4WZ6A 4YECA 4EG5A 5HZGA 1WP4A 4RFLA 4L6IA 3WZMA 1LTHR 4OPMA 4F86A 2P0EA 3O3CA 5EL0A 4J16A 3VR2A 4Y3UA 4AMYA 1U5CA 3Q3HA 3TPCA 1VOTA 3KVRA 2J32A 2IU0A 1IJBA 4MITA 5HJ2A 5ILQA 3EIHA 1JHVA 1OFHA 3CWCA 3EMDA 1VI5A 3IBSA 4MLZA 3WKDA 3D3NA 1PV4A 5E6RB 1HEUA 5K8IA 1PFWA 4GXQA 1KVRA 1VPTA 3MGKA 1KC3A 4R6XA 2DR3A 2VJLA 6PFKA 2P9QA 3NH9A 1TW2A 1L4GA 1VIYA 4U7PB 2BGTA 2OXEA 5TT0A 3RR2A 2IP2A 4CTKA 3ADDA 4LJ7A 3HU1A 3NQ41 3WGOA 1H2RS 4YUVA 4AWXA 3ZBUA 1L6RA 3O8BA 4CF4A 2IEBA 3QPBA 4OB7A 4DR3B 1VMAA 3FYDA 4Q3CA 2QIPA 3GW8A 3VZSA 3GLIA 4HMOA 5TGZA 3OZBA 1ODCA 4EL0A 3T7CA 3KGDA 1X2BA 1C80A 1GY8A 1XMSA 2VA8A 4N4AA 3IEVA 3WK9A 1EFTA 4OFXA 4BWFB 4NH4A 1C3VA 2QRPA 3D4IA 2XUQA 3W5DA 1AXRA 3EIFA 4CL3A 1IY8A 2B3TA 4KSBA 4BC1A 1C3OB 1LSOA 1TK3A 3NT5A 1CS0A 2AVDA 3JAWB 3RH0A 2B8NA 4QIHA 4CQLB 5DIZA 2XVMA 3A6EA 3CISA 3HY4A 3OX1A 3Q12A 3KQHA 1N4AA 3I42A 5DMHA 3WGTA 4EITA 2MR5A 4KDFA 3PEVA 4MV5A 4OGLA 4P33A 4JLBA 3I1FA 2B8TA 1YJAA 3JQBC 4IFIA 3F8SA 5TMPA 4OI0A 1TF5A 1X1CA 2IX9A 4LY6A 2OFFA 3IRVA 4NV3A 5AOCA 3BFPA 2I4OA 1B42A 1PWZA 1TEXA 1CZNA 3KWJA 5GZ3A 4FYWA 3BHJA 3MELA 4HGRA 2ZDHA 5FUBA 1QDEA 1M8KA 4P6VF 1JVNA 1IOWA 1C9JA 2NXEA 4C7XA 5IKPA 2PVSA 1FVFA 4YH1A 1ZUNB 4ND7A 4C88A 2FQXA 2ZJ5A 2HBYA 1P3Y1 4DAOA 1CY8A 2GHTA 2ARKA 1CIVA 4PHCA 1KP2A 4RY8A 5F4BA 3SEQA 5JWRA 4RK4A 4PANA 1W25A 3LO5A 5BVGB 3CY6A 1XFAA 5BV0A 4DCJA 1JG3A 1K5DA 1U1CA 4PZPA 2O3UA 4EUSA 5LA6B 3JWHA 4F9FA 4GLLA 3HEBA 4QPPA 4ZT5A 2Q41A 3B52X 4URXR 1P1JA 1E94E 1LDMA 3ABOB 2RGXA 1EH5A 4IMIB 1DAHA 1M2OB 1SCDA 2GZHA 3G9TA 2VP0A 5HM8A 4V02A 4PTLA 3FRIA 1M2WA 4ZARA 2R8PA 5SY9A 3ZWOA 3AL0C 3FAZA 4LSZA 2JW5A 1XRSB 3EEYA 2Q3FA 1JGTA 1IEQA 2XITA 4AXXA 4FB4A 2HU8A 4KXQA 3ZQJA 4GI1A 2AE2A 3L04A 3CH7A 1YRWA 2A1IA 4IY1A 2VJQA 3KJZA 9LDBA 2QAGC 4HXEB 2EERA 3PUJA 1C8BA 3S5JA 1T5IA 3K15A 2CUZA 3T5BA 1N2SA 4D5EA 8AT1A 1EEHA 5J2UF 3H16A 4ZEMA 1QBGA 1CB7A 1NC1A 1RYDA 5D7NA 1E1YA 5U4QA 1U4OA 2O1XA 4FZ5A 4OKNA 4R8SA 4TWRA 5LOVB 4F4FA 2J3EA 2II6A 5KAMA 2R9VA 1KBZA 1OFIA 3HRIA 1DV1A 4IIEA 4JA0A 4JDPA 5WRFA 2YR0A 1NM5C 2DFLA 3KQMA 4XEHA 5CAEA 3D1LA 3O38A 3OOWA 4ZI7B 1LI7A 5LFAA 1N8NA 3KVVA 3RTAA 1E6CA 1NN0A 2XX3A 4IIJF 4F84A 4Z6KA 4AF6A 3KEFA 4DM3A 2H92A 1Z35A 2ZYGA 3A9VA 4LDJA 4UHDA 1XMOB 1CDZA 3WLEA 2BM1A 3DDWA 3ADKA 3DZBA 5F73A 1DIAA 1Z4JA 1NU6A 3BD9A 3CO0S 2FPRA 1VSBA 3HWRA 4HR7A 3RTEA 3MWLA 1SK8A 4ECAA 5C32A 1PYGA 4FM9A 4IJMA 4LF6B 1I51A 2D3WA 4COKA 3RYFA 3H5NA 3I6BA 5E7QA 5EHQA 4RHFA 2IW1A 2A9QA 1OI4A 2MIIA 3SR3A 1CRZA 4A6PA 5JJKA 4HDKB 3KELA 4QATA 4AF7A 3U16A 1EDEA 1ANKA 3ZWXA 1X1RA 1BX3A 4WXHA 3C5WP 4JC0A 4EGSA 1UM9B 2FQWA 3NHBA 2QX6A 1C9YA 5KNDH 3PL5A 1M83A 3O0TA 4TL7A 4W1SA 1C4OA 2CVPA 2Y1WA 3CU5A 1H1LB 4D0LB 2ORYA 4U39A 2W2VA 4CLQA 4ER0A 3GPLA 1E8DA 3MT7A 4PX5A 4XUCA 1RWMA 1CUSA 2J3HA 1DTEA 5LP1A 2YMMA 1CUEA 4JP2A 1UAAA 3EXIA 3I6IA 2IOQA 4ARVA 5EIXA 3QU9A 2WICA 5E1DA 1JHYA 2NSLA 3AKCA 3QVLA 4RVUA 1ML3A 5AK6A 5FLKA 3L0ZA 2QJFA 2AMFA 4I1PA 4PFKA 1LH0A 4HV4A 3GLHE 1WBDA 1R9MA 4M7WA 2WVGA 1NVTA 1XLTC 3UT5B 4RNCA 3TIIA 3WYDA 4DY4A 2PPLA 2QTMA 1MORA 1OWLA 1QPGA 1ZM4A 2NXJA 2ZWVA 3N7UA 1OC4A 1U7XA 1UDBA 4Z4GA 4D1YA 5IP5A 5JC1A 1KJIA 2O8EA 1YZLA 5E9AA 2Q6OA 5BSWA 1OYVA 5TLSA 1R4ZA 4QM7A 1XR3A 3CB2A 1DEKA 2ZTLA 1KI8A 1SKQA 3JQ9A 4IGEA 2IEAA 2C5GA 1XKTA 2J7KA 2NXCA 2JARA 3JD3A 4I5GA 1I36A 1R4AA 5IC4A 4GR9A 2JLXA 2W43A 4PTYA 2YICA 2WQ6A 3B20A 2VF8A 2OORA 3B70A 3TW4A 1A4RA 2CLKB 3F3KA 1KY5A 4LJRA 1YNOA 1V1RA 2WYIA 1L5HA 3QXHA 1YQ9A 1ZI6A 1FRNA 3OZIA 4KYVA 2IUSA 2G9RA 3UQYS 4AS3A 3KC2A 4Z53A 1L4HA 3MWEB 5I8WA 4Q4AA 3KUUA 1D6JA 3N0WA 5DGDA 4Z3DA 2PX2A 5CYGA 3SWWA 4PGMA 4CF7A 2PH5A 1CR1A 1S9HA 4OK6A 4R40A 4LA4A 3CR7A 1G9XA 3W5CA 3NPAA 2QPLA 4E5UA 1N34B 1M2JA 2Y05A 1KK2A 3WX0A 3ZHYA 4XYLA 4LGCA 2WD7B 5BMVA 4FSDA 2B34A 3S81A 3SAJA 1D9XA 2APJA 2JGIA 2CXXA 2XQGA 3E9RA 3IAXA 3SBXA 2NTVA 5BOSB 1HX7A 4QXMA 3TOCA 4J2OA 4JBWA 4P81A 1ST3A 3T06B 3TXXA 5AK3A 3UMCA 4UDOA 4WDQA 1E79A 1OOEA 4HDKA 1SIOA 2VHEA 2BKLA 3A2MA 5ALZA 2ZSBA 1QGYA 1VP9A 5EJ2A 3TOSA 3MQ4A 1QWSA 3IKMB 1WM1A 3U7RA 1H2YA 1NNEA 3AI1A 1WP9A 1RWOA 3CVJA 3T3OA 1RZVA 3ROZA 3F6YA 1B6RA 1GITA 5HJ7A 2WU1A 3CF0A 3VO9A 3KDAA 3KSDO 5G0UA 5JS2A 2X4LA 1JW9B 2I62A 4BBJA 4KZKA 2BF4A 5BQXA 4WT7A 5JEDA 3P7MA 2D4HA 4XR4A 5AOBA 1H66A 2QUIA 3CONA 4FWBA 4ZPXA 2LE0A 1M33A 1ORHA 2GSWA 3G2MA 3KPJA 4MWDA 5K3BA 4A73A 4PXYA 4HUJA 5DN9A 4ZYVA 4QBFA 3QSYA 1A5TA 1FYEA 2L2QA 2AD5A 3ONNA 1A95A 1HDOA 1FLNA 3H7AA 1XCPA 5TXGA 4JB2A 3UHJA 5KOHB 3Q88A 5D3MB 2I4LA 1HLDA 2ASVA 4RDCA 4BFXA 3PR2B 4ZIRB 1OFUX 1UEIA 4ZO7A 5JMOA 1B76A 3EQ9A 2YBDA 4LXIA 4NARA 4KPGA 1L4BA 1XYVA 3D8BA 4JZYA 5CA0A 2HT1A 4IYJA 3ZCSA 3E6AA 2NAFA 3HO1A 1HDYA 1XZ8A 1O6FA 2Q5JA 3H0KA 1A8SA 2V6FA 3WBFA 1Z7EA 3AW8A 3V8QA 3AG5A 3L1UA 1RIFA 1SKAA 2PGLA 4MB2A 4YRFA 3FMFA 3DZGA 1OI3A 3W6NA 6CHYA 5LXTB 2G3YA 2FFBA 4GLJA 2FR8C 2XAAA 2XE7A 4RTOA 3O4FA 1XDWA 4DR5B 1RADA 3SZUA 1FOEB 4HNRA 3W04A 4D8VA 5ITWA 1KQPA 2P40A 3R6GA 4DQ0A 1CJTC 3EGXA 4EKNB 3KFXA 5FBWB 2CSUA 3E1KA 2HMWA 2D13A 2REQB 5BW8A 5AR1A 3KUXA 1DKLA 2A0UA 3E8XA 3TNDA 5HW0A 5AESA 3TW3A 1IMJA 2HPZA 3HZZA 3EVNA 4N6NA 3R3HA 2I3AA 4P5EA 2FFHA 4CT0A 5BN3B 5ADWA 2XQVA 4S24A 3L6EA 3SZOA 5GOZA 2P78A 4UNQA 1M72A 4FU0A 2AMLA 4P7FA 1PW7A 1MNQA 3O47A 2ZRGA 1H3NA 1X94A 1XD2A 2EJUA 3EZ6A 2NQ8A 2OGUA 4XE5A 2XCRB 3KU4A 3RO7A 4PZYA 1XJWA 2HT6A 5BPFA 1L3CA 2D7JA 5JDCC 2CFCA 2NU6B 5LBTA 1DEHA 4Q0MA 4UHCA 3RT7A 1PG0A 3D3WB 1ECCA 1KZ9A 3AR9A 2OWEA 4MIKA 4EMBA 4J6EA 1XWWA 1R8JA 3F46A 4MDHA 4E5NA 2P9YA 2XCLA 3HUUA 2P4UA 3TRFA 5LLSA 3TWOA 2OHJA 3HSSA 4WERA 2SCUB 1C7IA 1FF9A 3Q10A 3W06A 2PRJA 1RWWA 2JVKA 2FWAA 1T8TA 2J9FB 2TYSB 3DEIA 2I2CA 3Q85A 4H2DA 4MK4A 2ZITA 1AKUA 3GC6A 3LF1A 1YT5A 5G0VA 4F92B 3W9BA 3HM9A 5FWXA 2R1TA 1FDTA 2O0KA 3OZGA 3LUBA 2FSVA 2ZWMA 4G4GA 3EJWA 2I3BA 3EZLA 4TKUB 1GQSA 4Z7QB 3IT2A 5CCDA 2RHRA 2C99A 5P8WA 3EPLA 4WCVA 4GKJB 3B89A 5DBFA 2E9SA 2H7XA 1DQNA 2JBAA 3G88A 2FSIA 1N5DA 4IV0A 3UHAA 1AQ6A 1X7WB 1L8LA 3W5JA 3ZHVA 2PSEA 1GYRA 1NRIA 3T1HB 2OOKA 3OLZA 2YVAA 5BUSA 1CE8B 4N39A 3ND9A 1G291 5AHOA 4DCMA 1GP2A 4HQKA 1FFEA 4NQZA 3FOWA 1A9ZA 3VYRB 1IOVA 4Z9AA 4K0RA 3AU9A 5FWXB 4B4OA 3GEPA 1HYQA 1UKEA 2HHCA 4M76B 3L93A 1XO1A 2HW8A 2ZQ5A 1B3BA 2AOUA 2WF5A 1NSYA 5F21A 5THQA 2P2DA 2EATA 2IUTA 1FFCA 1UBUS 3RYTC 1R50A 3K31A 1LPNA 1C4WA 5D8DA 3ORRA 3LMKA 3IEMA 4R1NA 4CM1A 1F06A 3MT0A 4WZAA 3TGWA 1ZRHA 1E6EA 2A35A 3AX6A 1PG5A 4PSVA 2YVUA 4XARA 4XX0B 4YHBA 3SP1A 2VPXA 4Q3OA 4YCSA 4DV0B 1L7DA 1JAHA 2XH8A 2IOHA 3G0BA 4U63A 1NUQA 4YWHA 4DSTA 3R9WA 1XROA 1L4LA 4RFVA 3R9XB 4KX3A 1WUJS 3JR3A 5AJHA 2ZUFA 1Z25A 5IUJC 1TVEA 4WLEA 4FILA 4DC0A 1M2KA 1ULTA 4O1MA 3E15A 4EKDA 4BLQA 1SQ5A 3SE7A 4X6YA 3CNLA 3AHHA 1KFJB 1NHGA 1Z9BA 4RVSA 1SXJE 1UODA 1V3VA 4U7WA 5CB8A 3NXKA 2QD2A 2DJ5A 2P9FA 1SWWA 2GWRA 3AXSA 3DFIA 1YB1A 3GJYA 4L15A 3RF6A 3EFOB 3V7NA 2BE9A 2X9NA 1LVHA 2C77A 1XL0A 3PCTA 1XL1A 2ZAGA 3HS3A 4OX9Y 2R1UA 2OFWA 3M49A 4ALKA 1X1TA 4F4HA 1LDGA 1V8DA 3ZBTA 2Z2IA 3T5PA 3W1VA 4O63O 2PD6A 3CWZA 3I30X 1KYQA 4IIXA 2F8TA 1CD5A 1KWGA 2HCRA 3PPVA 2P0YA 3A6ZA 3ZWVA 2Q6TA 2VXCA 4KR9A 4DTIA 5BSFA 3BMOB 3ZHQA 5FPKA 3SVTA 1P9NA 2BC9A 1JKMA 1R5BA 5HPYB 2QZPA 4QOFA 3CLRD 4BP3A 2W6JD 2X76A 4Q5IA 1CWUA 1I1QB 1BS1A 4PO8A 4RF4A 4S1TA 4YA6A 4YGYA 4BVAA 3D81A 2CSXA 1KS2A 5ETJA 2IOFK 1B7GO 1GTSA 1WVMA 4D6XA 3GB9A 2XBUA 2H8KA 3BVPA 4PHGA 4GQAA 2R0QC 5I01A 1VQ1A 4KWTA 3DDZX 4JBGA 3WGHA 4YUAA 1YQEA 4DIEA 4GDFA 5IDWA 4DM7A 3C3YA 4KBFA 5E2AA 4MPPA 1RQXA 3KQPA 1G1AA 1AV7A 1MT0A 2HMAA 2IYLD 3GELA 4YO8A 4R0VA 1F4VA 4HX9A 4W7IA 2VUHB 2W6QA 2PGOA 4UNNA 3RJTA 1APBA 4NSNA 4EZEA 4FFBA 3QJGA 5J4LA 2H5EA 4RKEA 4TYQA 5BR8B 1CYEA 1CNMA 4B76A 1Q57A 3HBMA 1JEEA 4KOAA 3KLOA 4Y2TA 3L1IA 2CGEA 1KH1A 4U4AA 1WLSA 4ZMBA 3IB3A 2EEPA 1X0VA 2X5XA 3LV8A 3KOWA 4HNAB 5B55A 2ZIWB 4B82A 1P73A 2RGNA 1RNLA 1X7WA 2DWOA 4X1KA 5F1KA 2J5BA 4YMHA 2X1MA 4L8WB 1FW8A 2G9ZA 4IIHA 2YKGA 4AN1A 1EP3B 3DE1X 3CUVA 4JK3A 2R7NA 3HVIA 4QO8A 4A7PA 4GYYA 4HUQB 3O4GA 1PYDA 4QX6A 2IIPA 2X6QA 3O91A 2D00A 3QU7A 4AMUA 1SBQA 4N5LA 5C8ZA 4JUCA 5K0BA 5KQGA 5EXTA 5HFAA 1K3TA 2NPIA 3LX8A 4YHHB 3FKSD 3QM1A 1SY7A 3WFIA 1K75A 4YP9A 2AZXA 3UGKA 1MX3A 1DKNA 1T8PA 1TA9A 1D1TA 2ZE5A 3AIMA 4KHZA 4UUPA 4WXEA 1N5IA 2FSFA 3UTDA 1UBTS 5TVKA 4DXHA 2AIRA 2YIJA 2Q29A 1PDVA 3LPAA 4MNTA 2HADA 4XJSA 3UXMA 3WKBA 4F96A 2V7GA 3L8HA 3VU8A 3CC8A 4R1TA 4PNEA 1BD3A 4JJKA 2NU7A 4AKGA 1LBEA 3T7KA 3WLLA 5FUMA 1OLUB 2HDNB 4LEIA 1PSWA 2N9UA 1N5JA 2IL1A 3KJXA 4GOMD 2VRCA 3ZDYB 4Q37A 4Z1MA 1OIWA 2EXXA 3C98A 3LYHA 4GOJA 3THOA 3ZU5A 3ER8A 4XJVA 5THXA 2AA3A 2DQ4A 2GEBA 1XCJA 3C5HA 3EIXA 3SXUA 5CFQA 2IEZA 3NTLA 3TRIA 2B36A 3RRFA 4JYZA 1XLWA 3MMPA 2G1UA 4ID9A 4MTLA 1Z0DA 3B7PA 1T5HX 1KI6A 1U28A 5LIPA 1CB0A 1GFZA 3RIYA 2YWDA 3WGNA 1R66A 3U7GA 4IJ5A 4R2MA 3A4VA 5EVJA 2QZJA 3T7TA 5IPFA 1J7JA 3ANXA 4DCSA 3W78A 2QLBA 4MQEA 4PLCA 4RAOA 1KOJA 1XMQB 3FLEA 3TCXB 2FRDA 1SHKA 1NWHA 5AVQA 5I5EA 1KK1A 2B7LA 3CJRA 1XNJA 3H2IA 5DM60 1MMFB 1ZXBA 3ET5A 1QQTA 3PBKA 4QBHA 1VPDA 1NBWB 3VR5A 1PE0A 1C30A 1X7ZA 2I3ZA 3HCOA 4NICA 3I2IA 4GUAA 4XJTA 1XZKA 5F5LA 1GFIA 3T9CA 4J9VA 4RSHA 4LV5B 2I2XB 3FNQA 2H1FA 2OKCA 3U48A 4B6OA 1B0UA 1R12A 4RVDA 5FBLB 3WK5A 3BL5A 2REBA 3GGPA 1U1FA 2Y1LA 3HCNA 5TX7A 3QEMB 4Y8VA 4H7JA 5IT0A 4L8VA 2IUEA 1RFGE 3DCNA 3RI3A 3IVCA 4JB0A 4WRRA 1EVIA 3EDQA 5H70A 3F5MA 2AGVA 1E0DA 1TF7A 4HNQA 1B93A 3K6RA 4CYMA 4BNDB 2VZEA 3RK0A 4HGZA 3NTQA 3NM6B 2EKBA 5DOVA 4JI3B 5EIBD 2EFCB 2FEWB 2QRMA 3BREA 3RRNA 1ISJA 1SNYA 1U8AA 4LISA 5JBNA 3JX9A 1ODSA 2PYIA 4WCDA 3D3QA 1SOMA 4JEHA 4RQTA 5LBUA 1TRKA 4ZAFA 5DX8A 2QENA 5LQDA 1PT9A 1VDMA 1YBFA 2GDJA 4LBYA 1H0SA 4TV8F 4YJ2F 3ICVA 2O2ZA 4WQMA 2AS0A 1PAUA 4IICA 4HQNA 1TD1A 1RMQA 4JP3A 5L53A 2UVDA 4RD1A 1OXUA 4JUAA 2RK6A 3BWVA 3EQ7A 4G5XA 5KYXB 1VYVA 2XNSA 2AMYA 2HJGA 1BE0A 3G8BA 4MUFA 4QJ5A 5LDGA 1G17A 1JDBB 3EZNA 4KQCA 5GVRA 4KSCA 1FDWA 4G81A 1P44A 1RVV1 2WJIA 3CG4A 4Z7OB 1N9GA 1UIMA 4BLWA 2XYPA 1X8JA 3MAAC 2ZBRA 1HT0A 4JT9A 4D74A 4BFVA 2WRZA 3MCUA 1ZKDA 2DKNA 4HUTA 2OHHA 5K6TA 1XZMA 1Y5MA 1N3BA 2ZI3A 4HAOA 3U81A 3R7BA 5EFZA 3QVKA 2H2HA 1VLLA 2ZIXA 4RSRA 3RADC 3L43A 3QA9A 2AW5A 3ODPA 4GSKA 1WWKA 3T9EA 3CV3A 2NUAA 2Z6QA 3BRWA 3FI9A 1PIWA 1Q7GA 1T5BA 3NHMA 4UDXX 3E22B 1PSZA 3GFFA 3E4CA 3ZJ4A 1KJJA 3NATA 4ENVA 1F2TA 4K7JA 3TTTA 1QTRA 1FIUA 1JQKA 2J7PA 3ASYA 4UD6A 2P9ZA 4P84A 4YRTA 5IN4A 3CR8A 3KYCA 3GVIA 4S04A 1SN7A 4DOMA 3D0KA 4E33A 1AZTA 3WXBA 1LKZA 3ED5A 3PNKA 5D51S 1GCIA 1GPJA 1RAGA 2IP4A 3NWBA 4Q9AA 3ST7A 5K4GA 3KSBC 1GZUA 1O95C 1QHSA 1WZUA 1N6HA 3Q2KA 4DB2A 1C4KA 4MQMA 2HIAA 3UJ9A 4BFSA 3N6RA 3PUWA 4KUHA 3SLKA 3TD2A 3R0QA 4DBLC 5AVSA 1KEEB 3K30A 2IHBA 4OYLA 1N6OA 4D9JA 2V7QD 4XWTA 2UUAB 2Q3EA 3SFTA 4W9NC 5KX5B 4CKBA 1R8SA 4A8PA 1I13A 1PO7A 2WZCA 2W93A 1JEYB 1KQNA 3T94A 3F97A 4KITB 3DULA 3O26A 2VZ8A 2AZDA 3K16A 1MO4A 1RVDA 2HWKA 3CBGA 2PO7A 3G6WA 1DSSG 2IS2A 2Y0CA 4YPVA 3ESAA 4YK7A 5JH7A 5EXXA 1HV8A 1AQYA 2Q6IA 2QN1A 3AILA 2BVNA 3MJDA 4KJXA 4P1ZA 5T41A 4TYMA 2XQFA 1KEWA 4NNPA 4YN3A 3TSYA 4KWEA 1Z83A 1HMPA 3FVRA 3BJIC 3DD1A 2J3QA 2OBXA 3GNLA 3NUQA 2PQ0A 3DW3X 3FUVA 3IX7A 1GCUA 3GLSA 4F60A 1T4CB 5JY1A 2JS7A 2NYRA 3Q9LA 3Q8WA 1P9OA 1ZN7A 3NFYA 1U0OC 1EWKA 3WYBA 1S3SA 4CL8A 5DGHA 3A0UA 2V74B 2VHXA 3LLSA 2CXSA 2EFHB 2IY7A 2ZJ7A 3UB4A 2QDXA 1YDEA 1NW3A 1ODJA 2WWFA 3MRSA 1TA0A 2IVFA 2XGGA 2CUNA 3QVJA 3GUVA 2H06A 1QRAA 1YB4A 2HJWA 1WXWA 2ZGVA 3R5TA 4FHEA 4LJ9A 3V1NA 1ILEA 2ONJA 3KG2A 1B6SA 1VCOA 2I7TA 5DYWA 5EZYA 3ULKA 3Q9UA 2JLQA 5FA8A 4X84A 4II7A 2OGZA 1LBSA 1AHNA 1B1AA 3SBDA 1ZONA 3PXAA 1B43A 3Q1KA 4JY7A 4YGXB 1CFJA 1S2GA 3A32A 1X1SA 1UJ2A 2ZVDA 2O6LA 3F5SA 4BCDA 4OIFA 1HY3A 1I7DA 5KCMA 3ZTTA 1KFKB 4LK2A 1DCMA 4UEKA 1Z5VA 2C1XA 2WHPA 3DLTA 4EHFA 1BE8A 2O0HA 1A04A 1I9CA 3EGEA 6REQA 2VT3A 4TTTS 3MLEA 1E5TA 4D3ZA 4F12A 3HBNA 1IWOA 2QQEA 1DJLA 4FYYA 4M55A 4LGMA 3G8AA 2E4ZA 3TR6A 4LE2A 4HL6A 4L16A 2BP7B 1WZEA 2QNRA 2O9JA 2XA2A 3OZRA 4N82A 3W5VA 1L0BA 3NOQA 2PNFA 1U0LA 3VR0A 1G7TA 2VNHA 1OXSC 3EVZA 1KE1A 3KL4A 4F71A 3VVBA 2VH2A 3TW0A 2JD2A 1ZITA 5EE3A 5C4IA 4C9BA 3KYBA 4IM7A 4W8OA 1N77A 1D8TA 4GZ5A 3UWKA 2HGSA 4R71A 4K6HA 4AMGA 2QRZA 2R1VB 3BB1A 1US8B 1G38A 2ZUEA 1P7CA 1EU1A 1SQ6A 3LLUA 4CTNA 1QHXA 4TSFA 4ZCLA 1SK9A 2IPNA 3GG9A 3OCUA 1XTKA 2Z5VA 1IY0A 4LXGA 2CJWB 2P9EA 5DM0A 4ZRNA 1L9XA 2GN1A 1ZGCA 3BYZA 3QF7A 1K98A 4Q02A 3MYRA 4GR4A 4I9UA 4MS4B 1BA3A 1RCTE 4PR0A 5HGJA 3MS2A 1GZ5A 1YONA 5SYMA 2CB0A 1M66A 1SCIA 1ZMXA 5CIQA 3V9AA 5KQSA 4JU8A 5C35A 2QTFA 4TWIA 3RYCB 1F2DA 1CQIA 2I5PO 2A92A 2I78A 1XCBA 4V0ME 3VNBA 4G0NA 1FXUA 1LQTA 1QYIA 2XTNA 2FW8A 1BW9B 3P0IA 4Z2YA 4PPGA 4IJKA 3ZCUA 1J2EA 1N5KA 5KNCA 1T9AA 4DA8A 4R31A 3ZH2A 3HMKA 3ZDBA 3U3KA 1SUCA 3KKZA 2HFKA 4CUZA 1NKVA 1E6UA 3K9WA 4RE5A 1E59A 4US2R 5CB4F 1RS0A 2PMWB 3D9QX 3OX3A 2G17A 4Z4FA 1IN5A 1EK1A 4Z7NB 1RYMA 3TQIA 1W96A 1LZLA 3FGPA 3M4YA 4JITA 1FQWA 2HJRA 2EZ8A 2DERA 3GT0A 3QJYA 1XXHB 3QFTA 2FMXA 3AF5A 1EFVB 3F8WA 2P9CA 1N5LA 2B2NA 1KXZA 2BR4A 1I0ZA 5JRJA 5F3WB 1GU1A 3M6MD 2P0AA 1MIHA 1XJQA 2XLCA 1NJ5A 5K0LA 1NVXQ 4QU9A 3X2SA 3A9WA 4MUYA 4B85A 4MKGA 3MWKA 4ERXA 2HTEA 2J3IA 4QUEA 5LVAA 4GRAA 2QTVB 2ZBEA 2GXUA 2QZSA 2QN3A 2G9VA 2B1RA 3C6BA 5AI0A 4K3UA 2BMDA 2OLEA 3E53A 5KNLA 4E94A 2GCIA 2PR2A 1X92A 4O4HF 2RAPA 3NAMA 5CCBA 4TLBA 4N1AA 3VKUA 2J5XA 5EE5B 3A1VA 4E2FA 4YAGA 3IE1A 2XECA 3IB6A 4YR7A 2H2IA 2ACKA 2DE0X 5IJ0B 4JR1A 3SXPA 1SVKA 1U2DC 1QQAA 4WXRA 4F1KA 1TO2E 3R3XA 2H2FA 1ZC4A 4MYTA 3M82A 3GUCA 4E7OA 4G5SA 3PB3A 3IKLA 1L8OA 1CETA 1M6EX 2WFLA 5K7SA 3KPWA 4NNJA 3D3WA 3FY4A 4RAQA 3BMCB 4UHJA 3BD7A 1EK6A 4QL3A 4X45A 3P26A 4WXPA 4PLTA 3EVDA 2LCQA 1I14A 3FVTA 3ZUPA 3FN4A 4DDUA 2XCTB 2ZE8A 1NI4A 2TMGA 2VO1A 5B6PA 1CJKC 4XFDA 1XQ6A 3B48A 1UMKA 4UAJA 2GN0A 4I1SA 2VH1A 3ZI0A 1KDYA 1XRPA 3A31A 3VOBA 4EY7A 1ULAA 4J0DA 3CSDA 3FPBA 3ISVA 3QLJA 1P1FA 1MC8A 1UBJS 3CZPA 3FMPB 1OV6A 2ZJBA 3LQFA 4FMDB 4TVBA 4TN5A 3GPBA 3KYIB 2XE8A 3DZCA 3FUWA 1P7ZA 4O4HA 1E98A 1O3YA 4I66A 3TJMA 4EVQA 4NZZA 1Z4PX 3UCEA 4AY5A 2B7BA 2H54A 3MQFA 5F35A 2AVNA 1LBTA 1T10A 1QCDA 2WHYA 3BD8A 3RASA 1IUOA 2CXRA 4E5VA 1BDHA 3MWGA 1E4YA 2FCAA 4PBRA 1VGRA 3IHLA 3GZNA 3RJ5A 3STYA 3G9QA 4BVGA 1T2UA 4GXNA 4L5CA 4BCCA 5MDHA 4MKXA 2NLOA 4G25A 4CDMA 2HDOA 3JVIA 5AVKA 1B1CA 3ZHBA 2P1ZA 5SZJA 3AESB 3FDJA 4RGBA 2GK3A 2ORVA 3DOUA 3RFFA 3V8BA 5A5FA 2HWWA 4MPDA 4OXIA 3IBGA 2EFYA 2J4FA 4U1RA 1NE2A 2OYSA 3A26A 2OY0A 4L5AA 1OFGA 1M1YB 2CF6A 2L19A 4MQ5A 4BVKA 1F48A 1OIVA 2ETXA 4P2BA 1XAGA 3UGQA 1N2ZA 3FJ1A 1U3VA 2ZREA 3X0DA 3VNVA 2YWBA 4MVJE 1YWGO 4XEUA 3NDJA 5J2TF 4P32A 4E14A 2NU7B 3UAGA 4R5MA 5KNBA 4EB0A 4CG1A 1FFYA 1KPHA 1W9MA 2JFYA 3IUQA 2VNJA 4RHEA 2QSZA 2PD4A 2VEDA 1VMDA 5FI1B 1C5KA 2VHQA 4DR4B 3STXA 1UMCB 4OHFA 1QPZA 4QU0A 3I09A 5DP1A 3OFND 3Q41A 4CCYB 1LFAA 2YXBA 3W6ZA 3HB1A 3L6CA 4PCLA 4F85A 4OXNA 2E4UA 4KQ2A 3O1IC 2H3HA 1E2NA 4HP8A 2YZGA 4XYBA 4HNTA 3A1DA 1QC5A 1Z2CA 4MRNA 4ODIA 1X7XB 1JEJA 1E2PA 3B7WA 1O5OA 2AFHB 5FBRB 1NDHA 2O5EA 1ZM7A 3MJVA 4JWKA 4MVJD 2CMKA 1IAQA 2QW0X 3A58B 3OE4A 4XFKA 1BA2A 3ZVKA 3CNQS 4AZWA 2OV6A 3ZGZA 3HJUA 1XJ0A 4F3KA 1HEYA 3GNSA 4F4CA 1JALA 1MDFA 1N9KA 1ZIDA 3PGA1 1GFWA 1NUSA 1R0CA 3KALA 4LJAA 1Q15A 2DT5A 5I9LA 3AFHA 2GPTA 2MYPA 5FA6A 3S2EA 2QRGA 3KE9A 2WIKA 3QKWA 2O54A 4JT8A 3VTAA 4WZZA 1KZ4A 5A4AA 3O95A 4AO6A 4M0FA 1PNQA 4WMLA 2WWRA 3UH0A 5LQJA 3RSZA 1AHIA 1U0JA 5B1YA 3PT9A 3OP4A 2O4UX 3DFUA 3QFSA 2QX8A 2YRWA 1UMDB 4W9RA 4LX0A 3RTDA 2PUHA 1EGAA 1K9SA 2BFEB 1TUBA 1ECLA 3DWEX 4DV5B 1XDZA 1UC9A 1SUFA 3QWIA 3RVQA 3CA8A 2AE1A 2HK9A 4J0JA 1G3RA 2D1SA 2ETVA 3A3KA 4B2LA 2F3UA 4URVR 2OSBA 3KR0A 1YA8A 2PX4A 1KO5A 4IHJA 2JB9A 4YV1A 2ZT6A 1SXIA 3QPDA 3U4CA 1OROA 1AK2A 3LCCA 1D9ZA 3TSOA 2V4MA 2MDTA 5HXAA 3REOA 1OCEA 1T0HB 3LPCA 2CLOB 1XYGA 1OXTA 4CKBB 3WMRA 5AHXA 1G3MA 2V58A 1WUKS 4FJ0A 1JR3A 1L8XA 1JSLA 2I6QA 4UVIA 4WZAE 1AB6A 3DG9A 4QSHA 4OOFA 5BUCA 2FKNA 4ZMRA 1L3IA 3FBGA 3U37A 5KYUA 3ZU4A 3L1HA 4AU1A 3GBVA 2Z98A 1SVMA 3AFOA 3UCFA 1A9TA 3IDOA 4PIMA 3WLFA 3L6UA 2XVXA 4B3CA 5CDUA 2HMYB 2ZT8A 3GXOA 5DRTA 1YZTA 1QH8B 4V0MA 1Y3HA 4D02A 4ZOBA 2YH2A 1GLVA 1W1UA 2CYBA 2FEAA 5J58A 4R9NA 5LQNA 1OI2A 2IJGX 2ZSAA 2DR2A 5AJXA 2PY6A 1TK9A 1QPBA 3E84A 1YCFA 5T5QA 3T95A 1F12A 2X7XA 3DE0X 3E4DA 2ZTUA 4KI0A 2OZEA 1UXGA 1XDDA 4KU4A 4DVGA 2XODA 2QTWB 4KEAA 2LDXA 3SC2A 3R5XA 2ZSDA 1J8VA 1XFDA 2YY5A 3G89A 1CZHA 3C8UA 1U0BB 5BV7A 1D2MA 1YH3A 3MJRA 2P2NA 3D4BA 3LOUA 3VHXB 4L9RA 1SCJA 4QG3A 2H5LA 1MB3A 1CHDA 5J2TA 4DMUB 5SY4A 2PIDA 1ZD5A 1YFZA 1YS9A 3KLPX 4X97A 1Z4QA 3P32A 5AXDA 4Z0TA 3WIDA 1NZFA 2IXBA 1ZEJA 3LL7A 1NP3A 2FHPA 1VA4A 3DAYA 4ZD6A 1L1FA 2DTDA 1KSJA 1U0TA 2OGSA 1I79B 1QV7A 3GZJA 4GVPA 1VE9A 3NWPA 1I7PA 3D7MA 4REQA 1BCSA 1HWYA 3FPCA 2OV3A 5ALUA 4LHYA 1PZXA 1Q3KA 4RVCA 3UPTA 3N53A 4C5CA 1W4AA 3BWDD 5I9TA 2R6AA 3BWXA 3Q15C 2O8BB 5D5PA 2WWVD 3DUFB 1QVZA 4C4XA 1BMTA 2YFKA 2EX1A 3DVQX 4E3WA 3C8DA 5JZ9A 1FA9A 4FE3A 3AEQB 2FUG6 1JSRA 5TPZA 5BXYA 4IXWA 1C3XA 3JVVA 2EHJA 1FMTA 4NULA 5EJIA 3VRHA 5HSGA 1E96A 4HS4A 4UEJA 3FPLA 1G64A 4EHKA 3HBJA 1VL0A 1OTXA 5KDLA 1QONA 2WI8A 1L3BA 2QROA 1XZQA 3EGWA 2BM8A 1YJBA 4EYGA 4XM1A 3R3ZA 4KGDA 3ZWMA 3V42A 2AFVA 2VUUA 5AVOA 5KHAA 2IUUA 4G8JA 1YFLA 4ZVPA 2QT9A 1GM5A 4OP2A 3GL9A 5A7GA 1XVTA 1WJGA 1G9TA 1OGYA 1Z6QA 2ZUWA 5A05A 4LYEA 1M0TA 3FOZA 1DCFA 4LQCA 3AKZA 3CEHA 4PRKA 2YQ5A 5FPPA 1QQBA 3AOEA