4BPXB

Crystal structure of human primase in complex with the primase- binding motif of dna polymerase alpha
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
181
Chain Sequence
b'ISLIEFENLAIDRVKLLKSVENLSKLESELRKLRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLDERLQPLLNHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMASE SMALL SUBUNIT
publication title Structures of Human Primase Reveal Design of Nucleotide Elongation Site and Mode of Pol Alpha Tethering
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 181
sequence length 217
chains with identical sequence D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.80 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transcription Elongation Factor S-II; Chain A 4bpxB00
4BPUB 4BPXB 4RR2B 4BPWB
chains in the Genus database with same CATH superfamily
2XPLA 3O8ZA 3OP0A 3SJXA 5F09A 4MCPA 5HKZA 3D7DA 4P4JA 3D7HA 3ZNIA 3D7GA 2VKZG 2C6CA 3IWWA 1YVHA 4JYWA 2C6GA 1Z9EA 3HPHE 3VRNA 4A4BA 3BI0A 2Y1NA 4BPWB 2UV8G 3SJGA 2OOTA 5HKWA 4NGPA 4NGTA 4P4DA 3S9MA 4P4BA 3HPGG 4P4EA 2XEFA 5F13A 3BUOB 2C6PA 3BUMB 4P45A 3BXMA 3VRPA 5J3XA 4W9YA 4RR2B 4OMEA 1DE4C 1WJTA 4BTFA 4GPLB 5HKYA 3PFVA 4BPXB 2JBJA 2CIJA 4NGQA 3BI1A 5BY0A 1Z8LA 4P4FA 4OC0A 3VROA 4P44A 3FECA 3BUXB 2XPNA 4OC1A 4LQGA 3VGOA 4X3RA 2XPPA 3KASA 4P4IA 2XEJA 3BHXA 4MCRA 4OC3A 3FEEA 2XEIA 2PVVA 3OB1B 2N3AB 3SJEA 3SJFA 5AXIA 3U88C 3VRQA 2CBLA 5D29A 1B47A 3RBUA 4MCSA 2XEGA 1EO0A 3PLFB 4NGSA 3S9LA 4BPUB 2JBKA 2PVWA 3FF3A 3D7FA 4JZ0A 3VRRA 4NGRA 3BUNB 3OB2B 2XPOA 4OC4A 5ELYA 2B4JC 4OC5A 4A4CA 4NGMA 1FBVA 2DLAA 3PT1A 3BUWB 1CX8A 3OAKA 4MCQA 3NFQA 4NGNA 3HMJG 4OC2A 2Y1MA 2OR4A 3S9NA 3FEDA 3F9KC
chains in the Genus database with same CATH topology
5F13A 4BPXB 4RR2B 3HMJG 4BPWB 2UV8G 2DLAA 3PT1A 5BY0A 4BPUB 2VKZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPU B;  4BPX B;  4RR2 B;  4BPW B; 
#chains in the Genus database with same CATH topology
 2XPL A;  3O8Z A;  3OP0 A;  3SJX A;  5F09 A;  4MCP A;  5HKZ A;  3D7D A;  4P4J A;  3D7H A;  3ZNI A;  3D7G A;  2VKZ G;  2C6C A;  3IWW A;  1YVH A;  4JYW A;  2C6G A;  1Z9E A;  3HPH E;  3VRN A;  4A4B A;  3BI0 A;  2Y1N A;  4BPW B;  2UV8 G;  3SJG A;  2OOT A;  5HKW A;  4NGP A;  4NGT A;  4P4D A;  3S9M A;  4P4B A;  3HPG G;  4P4E A;  2XEF A;  5F13 A;  3BUO B;  2C6P A;  3BUM B;  4P45 A;  3BXM A;  3VRP A;  5J3X A;  4W9Y A;  4RR2 B;  4OME A;  1DE4 C;  1WJT A;  4BTF A;  4GPL B;  5HKY A;  3PFV A;  4BPX B;  2JBJ A;  2CIJ A;  4NGQ A;  3BI1 A;  5BY0 A;  1Z8L A;  4P4F A;  4OC0 A;  3VRO A;  4P44 A;  3FEC A;  3BUX B;  2XPN A;  4OC1 A;  4LQG A;  3VGO A;  4X3R A;  2XPP A;  3KAS A;  4P4I A;  2XEJ A;  3BHX A;  4MCR A;  4OC3 A;  3FEE A;  2XEI A;  2PVV A;  3OB1 B;  2N3A B;  3SJE A;  3SJF A;  5AXI A;  3U88 C;  3VRQ A;  2CBL A;  5D29 A;  1B47 A;  3RBU A;  4MCS A;  2XEG A;  1EO0 A;  3PLF B;  4NGS A;  3S9L A;  4BPU B;  2JBK A;  2PVW A;  3FF3 A;  3D7F A;  4JZ0 A;  3VRR A;  4NGR A;  3BUN B;  3OB2 B;  2XPO A;  4OC4 A;  5ELY A;  2B4J C;  4OC5 A;  4A4C A;  4NGM A;  1FBV A;  2DLA A;  3PT1 A;  3BUW B;  1CX8 A;  3OAK A;  4MCQ A;  3NFQ A;  4NGN A;  3HMJ G;  4OC2 A;  2Y1M A;  2OR4 A;  3S9N A;  3FED A;  3F9K C; 
#chains in the Genus database with same CATH homology
 5F13 A;  4BPX B;  4RR2 B;  3HMJ G;  4BPW B;  2UV8 G;  2DLA A;  3PT1 A;  5BY0 A;  4BPU B;  2VKZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...