4BPXB

Crystal structure of human primase in complex with the primase- binding motif of dna polymerase alpha
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
181
Chain Sequence
ISLIEFENLAIDRVKLLKSVENLSKLESELRKLRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLDERLQPLLNHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Human Primase Reveal Design of Nucleotide Elongation Site and Mode of Pol Alpha Tethering
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA PRIMASE SMALL SUBUNIT
total genus 50
structure length 181
sequence length 217
chains with identical sequence D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.80 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transcription Elongation Factor S-II; Chain A 4bpxB00
4BPXB 4BPUB 4BPWB 4RR2B
chains in the Genus database with same CATH superfamily
3VRNA 3ZNIA 4P4IA 3BI1A 4OC3A 4NGQA 5HKZA 5AXIA 3PFVA 2PVVA 3D7FA 4OC1A 2OR4A 4OC0A 2C6CA 2XEJA 3OP0A 4LQGA 3HPHE 4MCPA 3KASA 2PVWA 2CBLA 2C6PA 4NGSA 2OOTA 1Z9EA 2N3AB 4NGTA 4BPXB 3OB1B 3BHXA 2XPOA 4OMEA 2UV8G 1WJTA 4BTFA 5ELYA 3BUOB 4OC4A 3FEEA 3OAKA 2B4JC 1FBVA 4MCSA 4NGMA 4MCRA 4A4CA 3S9NA 2JBJA 4P4FA 4RR2B 4NGRA 5HKYA 3BUNB 3D7HA 5F09A 3VRQA 3SJGA 3VRPA 2XPPA 3RBUA 2C6GA 3IWWA 3VGOA 3HMJG 4P45A 1CX8A 2Y1NA 4NGNA 3VROA 3SJXA 3D7DA 3FEDA 4OC5A 2CIJA 2VKZG 3SJEA 4BPWB 3BUXB 3VRRA 3S9LA 5J3XA 3PT1A 3S9MA 1DE4C 2XEGA 3PLFB 3BXMA 4MCQA 4A4BA 3NFQA 2XEFA 2XEIA 2XPLA 2Y1MA 3OB2B 3D7GA 3HPGG 1Z8LA 5BY0A 1YVHA 4W9YA 4X3RA 4JYWA 3FECA 4P4JA 2DLAA 4P44A 3O8ZA 3F9KC 4OC2A 2JBKA 1EO0A 3BUMB 4JZ0A 5HKWA 3FF3A 4P4BA 4NGPA 5D29A 4P4EA 4GPLB 2XPNA 3SJFA 4BPUB 4P4DA 5F13A 3U88C 3BI0A 3BUWB 1B47A
chains in the Genus database with same CATH topology
3PT1A 5F13A 4BPWB 3HMJG 4BPXB 2VKZG 2DLAA 4RR2B 4BPUB 5BY0A 2UV8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPX B;  4BPU B;  4BPW B;  4RR2 B; 
#chains in the Genus database with same CATH topology
 3VRN A;  3ZNI A;  4P4I A;  3BI1 A;  4OC3 A;  4NGQ A;  5HKZ A;  5AXI A;  3PFV A;  2PVV A;  3D7F A;  4OC1 A;  2OR4 A;  4OC0 A;  2C6C A;  2XEJ A;  3OP0 A;  4LQG A;  3HPH E;  4MCP A;  3KAS A;  2PVW A;  2CBL A;  2C6P A;  4NGS A;  2OOT A;  1Z9E A;  2N3A B;  4NGT A;  4BPX B;  3OB1 B;  3BHX A;  2XPO A;  4OME A;  2UV8 G;  1WJT A;  4BTF A;  5ELY A;  3BUO B;  4OC4 A;  3FEE A;  3OAK A;  2B4J C;  1FBV A;  4MCS A;  4NGM A;  4MCR A;  4A4C A;  3S9N A;  2JBJ A;  4P4F A;  4RR2 B;  4NGR A;  5HKY A;  3BUN B;  3D7H A;  5F09 A;  3VRQ A;  3SJG A;  3VRP A;  2XPP A;  3RBU A;  2C6G A;  3IWW A;  3VGO A;  3HMJ G;  4P45 A;  1CX8 A;  2Y1N A;  4NGN A;  3VRO A;  3SJX A;  3D7D A;  3FED A;  4OC5 A;  2CIJ A;  2VKZ G;  3SJE A;  4BPW B;  3BUX B;  3VRR A;  3S9L A;  5J3X A;  3PT1 A;  3S9M A;  1DE4 C;  2XEG A;  3PLF B;  3BXM A;  4MCQ A;  4A4B A;  3NFQ A;  2XEF A;  2XEI A;  2XPL A;  2Y1M A;  3OB2 B;  3D7G A;  3HPG G;  1Z8L A;  5BY0 A;  1YVH A;  4W9Y A;  4X3R A;  4JYW A;  3FEC A;  4P4J A;  2DLA A;  4P44 A;  3O8Z A;  3F9K C;  4OC2 A;  2JBK A;  1EO0 A;  3BUM B;  4JZ0 A;  5HKW A;  3FF3 A;  4P4B A;  4NGP A;  5D29 A;  4P4E A;  4GPL B;  2XPN A;  3SJF A;  4BPU B;  4P4D A;  5F13 A;  3U88 C;  3BI0 A;  3BUW B;  1B47 A; 
#chains in the Genus database with same CATH homology
 3PT1 A;  5F13 A;  4BPW B;  3HMJ G;  4BPX B;  2VKZ G;  2DLA A;  4RR2 B;  4BPU B;  5BY0 A;  2UV8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...