4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
2YBUA 1B3WA 2XSBA 4BQ2A 3MANA 1L8NA 4D6CA 2D3NA 2ZUMA 1R85A 2BY1A 4AD5A 3N18A 4OBSA 5A6JA 2O92A 4HPGA 1QPKA 4J3TA 3KL3A 3MMUA 2VR4A 3AICA 3RJXA 3UG3A 1EXPA 4U2YA 1W1PA 5I6SA 2V5CA 2VJXA 1GOIA 1JFXA 2YLAA 4W85A 1L0PA 1QBAA 3L4ZA 1KBKA 1HKKA 3BC9A 1V6WA 2VT0A 4HA4A 1UWIA 2WBGA 1XSKA 4UOZA 3B9DA 3II1A 3BAYA 2ZXDA 4W7WA 4CN6A 3VNYA 3ZSTA 5E0FA 3WBAA 2PI6A 2JE8A 2OWWA 1WZAA 2E9LA 3K4DA 4KWUA 4AIUA 1AVAA 1UKSA 1QNRA 5AYBA 4HZ8A 4OJYA 5A3HA 3GXDA 1GZJA 3F95A 4XUYA 3VGBA 4BF7A 2X09A 2J74A 2OYKA 1J9YA 1JI1A 2WCSA 1MVYA 1C7SA 5GQBA 4ZXLA 1NWUA 4ZFMA 3VKKA 4XZWA 1WCUA 3K46A 2CPUA 2WVVB 2GDUA 1JI2A 1XH0A 1W3JA 1VEPA 2W92A 2OSXA 3NSMA 4MB5A 3VGHA 3F5JA 4IPNB 2J62A 3SUVA 1FH7A 1EA9C 3QHNA 3PTKA 1YHTA 2PBGA 3WF3A 4OKDA 3VGDA 3WD4A 3GXMA 1DWGM 4J3XA 1XD0A 1R8LA 1QI0A 1GQKA 3W81A 4YW7A 5D9MA 1M53A 5DT5A 3OLDA 1QVBA 3J7HA 3VM5A 2BHZA 4CPBA 4CKQA 4W5UA 1O7AA 3CUGA 1E56A 1LG2A 3FHQA 5I3DA 3W38A 3RIKA 4UNIA 5D9PA 2JFEX 1JGIA 4TVUA 3WH8A 5LA0A 3L2MA 2V3EA 3VMNA 4W84A 1IZKA 1B3VA 3A47A 2RGLA 4GINA 2VZTA 1HNYA 1EO7A 2IXVA 4QLLA 4Q22A 2E0PA 3VGEA 2V38A 3ARXA 1EOKA 1WDQA 1XV8A 4BZYA 4PUDA 2ZWYA 1W9PA 3M46A 1DHKA 1JD7A 3PZUA 2CEQA 1KXVA 3L4WA 1GOMA 3CZ8A 1WMXA 5I23A 3AIVA 2W91A 1J0YA 2WVVA 2ZX5A 4GZJA 4HU8A 4UFKA 5BRQA 3W28A 1OSEA 1YQ2A 1MW2A 1BTCA 1NOFA 3WEMA 4QP0A 4JFUA 5D9NA 2VX5A 1UR1A 2ZUWA 4LJHA 2WZHA 3WQVA 4AZBA 5AY7A 1C8YA 4KGJA 4AZGA 3W26A 4NRSA 2A3BA 3RDKA 1XH2A 2FGLA 4GQQA 3PTMA 2OYMA 1B31A 1J10A 1WP6A 3WH6A 1DWAM 4IUGA 5EMYA 1E0XA 5KEZA 3WEOA 1DTUA 1UR9A 2BVTA 2YJQA 1W9FA 2EJ1A 1LQ0A 3PZQA 3W53A 5DO8A 4CD5A 2GUYA 4M8UA 2WC7A 3SCSA 1WDRA 4GZIA 1W9DM 5HBFA 4AIEA 1H1NA 1R7OA 3CHFA 4PEEA 1PJ9A 3OB8A 4RE3A 4TXEA 2LRPA 4MADA 4DM1A 4ACZB 4J28A 2A3HA 1H2JA 1MW3A 5CLTA 1BGGA 4E8DA 1CTNA 4AZ5A 3VGGA 1FP8A 3EBVA 4KRUA 4HMCA 1E3XA 1E55A 3MS8A 2JALA 1UR0A 2A3EA 2D0FA 1OGSA 3DYMA 1C93A 4D6HA 5C8BB 1LL6A 1OBAA 1V6XA 4UQEA 4K68A 4TOQA 2OWXA 2JF6A 3OZOA 3CUIA 3AHVA 2J75A 1UR4A 1UYQA 1EHNA 2YDSA 1J0HA 1XRVA 2JEQA 1CDGA 4U5IA 3K8MA 4M56A 1W1TA 3W6MA 3A4XA 5A6AA 1WDPA 2BNJA 3SCOA 1TR1A 5HDRA 4M80A 2J7CA 4LYRA 3WNMA 3AS0A 4W7UA 1KXHA 1SMAA 1UWTA 3AXHA 1EHAA 5GNYA 3DECA 1HJQA 1EH9A 2G4FA 1V3JA 4ATDA 1HIZA 3WMBA 3DYOA 3WMCA 4ACZA 3VMOA 4AEFA 5M3WA 3ZIZA 2PWDA 1OM0A 1C3FA 2VVNA 1W2PA 1VFUA 5D9OA 3WF0A 2WHMA 1GQLA 4TTGA 5FKYA 4BCEA 4OUEA 1F4HA 3NDZA 3AIBA 4PMVA 3WUEA 1D2KA 1E4NA 3ZOAA 3OLEA 2XUCA 4HA1A 4OOUA 4PCSA 4AXNA 5JBFA 2DPEA 3VD5A 3W24A 5LA1A 3EDFA 2GK1B 4GPNA 5E0CA 2YL6A 3AROA 3PHAA 2CIPA 2VX7A 3LPPA 3VDAA 5ABHA 1HN1A 3WH9A 2WM0A 4B3LA 2WKGA 4J3WA 3RILA 3B9AA 2GSJA 2VR5A 4P7NA 1OT2A 1B2YA 4WF7A 2F2HA 1FOBA 3I3EA 1UWQA 4WJXA 1UA3A 1GORA 1WKYA 1TA3B 4P8VA 1ISWA 4N0RA 4LXFA 1UH2A 2WNWA 2XVNA 1BG4A 1W9BM 3AOFA 3DHPA 3ZJ7A 5D8ZA 4AD2A 2DIJA 4QCEA 4LKDA 1BLIA 4HZ7A 5CPQA 1MQRA 1TG7A 2O9TA 3MV11 1HX0A 4CN4A 2W63A 3POHA 3T0DA 5CPTA 5E6ZA 1GW1A 2Q8XA 1UZ1A 1J0JA 1E6SM 4W93A 1BG9A 1MW1A 1E9LA 3GNRA 1RP9A 4CU6A 4KGLA 2EBNA 2A3CA 2YL9A 2QHAA 1HJXA 1CZ1A 3WQ5A 4UZSA 4AZHA 1HVXA 4MTVA 1QI5A 1R7AA 2X8RA 4HMDA 1NQ6A 1UD3A 3WD2A 1UKOA 3A3HA 1LWJA 2DIEA 3FY1A 3W0KA 2GK1A 3CZJA 3PZIA 3PZMA 4B9ZA 1RP8A 1V3IA 1XSIA 4ACYA 1JZ7A 1KXQA 2X0YA 4AZ7A 3NSXA 4MB4A 3VD9A 3THDA 4P8XA 2XGIA 1FHDA 1TA3A 2CHOA 3WD3A 4PMOA 3CPUA 3AS2A 4DUVA 2DSWA 4HPHA 4B16A 1J0IA 1V03A 3RJYA 5ABFB 1BYAA 3MMDA 1KGWA 1HL9A 1OCQA 4D1JA 3BCDA 4B9YA 4CD4A 1WDSA 1E15A 4Z2HA 4MNLA 1IV8A 4BQ4A 2WHJA 3AMDA 5I5RA 1MXDA 2FH6A 4JHZA 5CG0A 1JZ6A 4RL3A 2ZOXA 1I1XA 3AMCA 3KL0A 3ARWA 3N12A 1GCYA 2ZUSA 1Q4NX 3A4WA 3SUTA 3SIMA 1JAEA 1PAMA 1HKIA 2CKRA 4AWEA 3UETA 2WHKA 3VIFA 2J25A 1W9VA 5ABEA 1CECA 2OYLA 1R86A 3WNOA 2WKLA 4PMZA 3M7SA 1EO5A 3BXWA 2QMJA 1UUQA 1ZU8A 3ARVA 4IPLA 4TX8A 2C24A 3CHCA 3VGFA 1FFRA 2E4TA 1W8UA 3CHDA 4H7VA 1UHVA 4TVDA 1E4MM 3BSGA 2F61A 3WF4A 4YW6A 2BY0A 1NWSA 4Z2KA 2XVPA 2WXDM 1LL4A 1HJVA 3IJ7A 3WN6A 5ABFA 1OD8A 2J8FA 4V2XA 5A2BA 2CYGA 1AQ0A 4P7OA 2DT3A 4YPJA 2WWCA 4F8XA 4P8UA 5CPSA 2E40A 2XFRA 3TTSA 4FLQA 1MQQA 3GH4A 1JG9A 4AZIA 2D0GA 1Q6CA 2GJPA 4DM2A 1U33A 3VMPA 5F7UA 2O14A 1SFSA 4BS0A 1W2VA 2J7HA 4GKLA 1J11A 5I24A 1QNPA 1QI2A 4J7RA 3VDHA 4WLCA 5I79A 1GVIA 3F5KA 1NH6A 4JIEA 4PYSA 4V28A 4JFVA 4A4AA 4E4PA 1JZ3A 1V0LA 3AXIA 3MUAA 2WMHA 2WSKA 4W88A 1Z32X 5EFDA 5BCAA 1XGZA 3SUUA 5AYIA 2J7FA 4PN2A 3MSDA 4PMDA 2W67A 4IM4A 4QDMA 2VURA 4AYSA 1VEMA 2QPSA 2EPNA 3VX0A 2WZEA 2PBOA 4UQDA 2OSYA 4JL1A 4TTUA 2MANA 2WW5A 2WMKA 4U3CA 1UWRA 1D7FA 2W4XA 3WDRA 5FD0A 4D6FA 4CVWA 4DWSB 4S3KA 3NCOA 2XSAA 5I2UA 1TCMA 1BPLB 3AFBA 5GPRA 1BFNA 3OLIA 2VRKA 5M17A 3BAWA 1N82A 3BH4A 1LWHA 4U5KA 1NP2A 2E8ZA 3ARPA 3WUBA 4P7LA 2NW0A 3PZTA 1VBRA 3AZTA 3VIHA 1NWRA 2V3FA 5A2CA 1EIBA 1K6AA 3WQWA 3N04A 1MW0A 5FIPA 1CWYA 3U7VA 3LPFA 1CXLA 1WO2A 4PMNA 2B31A 1WCGA 4MAZA 2QPUA 4DUXA 4R5EA 1WB0A 5IFPA 1NOUA 1KB3A 2WVUA 2VTFA 4QLJA 1B9ZA 1VJSA 2CESA 4AEEA 5BXPA 3PZNA 4BQ3A 1K9DA 3AYRA 1JF6A 3ZR5A 3AHXA 4D6GA 1HKJA 1CGXA 3OA5A 1E6QM 2ZUUA 3GYCA 3TP4A 1HJWA 1A47A 3AHTA 2J77A 1UOJA 1HJUA 4DWSA 1VFMA 2WMGA 3GH5A 3TOPA 4LPCA 3SEPA 2J8GA 4PTVA 7CGTA 1V0NA 1WNOA 3DC0A 1E1FA 1J18A 2W5FA 4KMQA 4UFIA 3CMJA 2YA2A 3NUKA 3MUZ1 3RO8A 1QHZA 5A2AA 1U30A 5A6SA 3L4YA 1B0IA 4Z2IA 3AMKA 3N1AA 2XIIA 2G41A 2ZX7A 2ZE0A 1J01A 1H0IA 2XFYA 3M07A 3QR3A 3NJ3A 2ZUTA 2NT1A 5A94A 3SCUA 4L4OA 1GOWA 4WKAA 4UR9A 1LLOA 2VZOA 2DSZA 1VAHA 3WDIA 1M7XA 5JIWA 3K1DA 3RMEA 5ECUA 3GNPA 5IHRA 1TFVA 2XPKA 2OSWA 4D71A 5A8MA 2J79A 3K8LA 4OOZA 4MAVA 5GNZA 4AIOA 3OBAA 1KR0A 5LA2A 1OT1A 4N42A 1C8XA 4Z2JA 3ZO9A 3BCFA 4PSPA 2A3AA 3FNDA 1DWIM 3PTQA 1ZBCA 2BY2A 2IXUA 1TMQA 2VQTA 4AZCB 1VJZA 1WZKA 2WMJA 1E43A 1GWKA 4F9JA 2WLYA 2Y5EA 4AISA 4ZE4A 1W90A 3GZAA 1W3HA 4B3KA 1RD6A 4IISA 4E2OA 2EXOA 2FHFA 3VIGA 3AIUA 4FLOA 3ZJ8A 5BRPA 2AOSA 4PMUA 4CPBD 4XV0A 4D6DA 3L4UA 1W8WA 2FHBA 3A4AA 3ZSSA 3POCA 4J3SA 3AZRA 4HP5A 3ZQ9A 2QLYA 5CXPA 2C7FA 3W25A 2XYLA 5CSYA 2WHLA 1V3LA 4TVCA 1JDDA 2D22A 3THCA 3T2OA 1GWMA 2RGMA 1KGXA 2ESCA 3VM7A 5E6YA 1Q6EA 1QBBA 1E3ZA 3CHEA 1VF8A 4JFTA 2XIBA 1V6YA 3MMWA 4PCTA 4EKJA 3UR7A 1JNDA 5E9AA 3FXYA 2V5DA 3EDDA 4NZCA 3CIVA 2Y24A 4C7GA 1QHOA 3CUFA 4PMQA 2YDRA 4XB3A 3DYPA 4YWAA 4AZCA 4GXPA 3UCQA 2EPKX 4JAWA 4JCMA 1UQYA 1PEZA 2ZX6A 5E70A 2EQDA 1PX4A 3NSNA 4CCDA 6TAAA 2VXJA 3UR8A 2BHYA 2FGZA 2ZXQA 3LPGA 3QOKA 4WSJA 1US3A 5HPOA 1XC6A 3VPLA 2X05A 1CNVA 3L4XA 3TA9A 1H41A 1ZJAA 3RM4A 3ZYFA 1FA2A 2VVSA 4AZ6A 4CD6A 3NDYA 4HZ6A 1O6IA 3CLWA 5A6LA 1RPKA 5HPCA 3AMLA 2VMFA 1KXTA 1JDAA 1XHGA 2O9OA 1CGVA 2O9RA 3AXXA 3VIOA 2QMKA 2ZX8A 3IAQA 1X6LA 3MSGA 4WKFA 2G3MA 1CGTA 4CUCA 2XHYA 5BWFA 2JIEA 2Y8KA 4E8CA 4EE9A 3MU7A 5BYWA 1XCWA 3ARTA 3CO4A 2E9MA 1H4PA 3ARZA 2J78A 1IZJA 4P7QA 1JZ4A 2G3JA 1MWOA 5CSUA 5HXMA 1VFFA 1C90A 1E73M 3I3DA 4GQRA 5JBEA 1P6WA 4CD7A 2ZWZA 4WIWA 1PIGA 4V27A 4FLRA 2WB5A 1SR0A 2F8QA 3AJ7A 2CERA 3PZ9A 1HT6A 4CN1A 1JDCA 1L7LA 3WUGA 3HMCA 4CVUA 1WZXA 3HJEA 3KE0A 2BFGA 1XYZA 5CJ5A 2VI0A 2YKKA 4Y7EA 2VZSA 1UR2A 1UWUA 3BSHA 3N13A 2DH3A 3VIPA 4MJ2A 1FFQA 1IT0A 4PTMA 9CGTA 3GXFA 3UESA 1JXKA 2VC9A 3WL0A 3AS3A 7TAAA 5E09A 1JZ5A 3L4VA 5CGTA 2X0HA 1BSIA 2GVYA 2PWGA 1CENA 3ZT6A 1PPIA 3VOCA 2D0HA 1VENA 4ATLA 4FK9A 1FH9A 3L4TA 2HVMA 3M6DA 3CTTA 4MPKA 3CH9A 2UY5A 4UFHA 4JKKA 3ZMRA 3CUJA 2AMGA 1NP0A 2FDMA 2ZUVA 4HU0A 4DUWA 3KZSA 4EK7A 1RH9A 3UEQA 4CCCA 3OZPA 5JUVA 3ARRA 1LF1A 3ZR6A 1HXJA 3EMQA 1AQMA 3EYPA 4J3UA 1CEOA 3ALFA 1G94A 1UD4A 2G8ZA 1Y7VA 1SMDA 4S3JA 1KQZA 2X2YA 3WF1A 3N17A 3BMWA 1E6XM 1DWJM 1MFVA 3ALGA 4LYPA 1US2A 4LKEA 2K46A 1ZJBA 1C7TA 1UKPA 3O9NA 4CU7A 5KZ6A 2XVKA 2XG9A 3B8SA 1EDQA 1PBGA 4F9DA 2Y4SA 2WPGA 4PRWA 4FF5A 2VZVA 3WEZA 3GXIA 1BAGA 3WIJA 4UFMA 4YHEA 4H2CA 2YOCA 3AS1A 3DHUA 1JF5A 2Z1KA 4GO9A 1J0KA 2W61A 3UG5A 1E72M 4LK7A 1FHLA 2DDXA 1QI3A 3VVGA 1BYBA 1OB0A 2X1IA 5I77A 4GI9A 4OBRA 2E3ZA 3EMZA 5CGMA 4ZXOA 3T08A 1VEOA 2WBKA 4Q7NA 2YLLA 1G1YA 1C92A 4AD4A 1UG6A 1CLVA 1JYNA 3U57A 1EDGA 1V3MA 5DT7A 3AIEA 3IK2A 3W82A 1VFOA 1E70M 3IANA 2NSXA 1TUXA 2C8NA 3WH7A 4A3HA 3VDBA 3S2CA 3SCNA 3GH7A 2J7EA 3T09A 1BQCA 5A6KA 2YIHA 4ZENA 1M04A 1TVNA 3N9KA 1G01A 3CZGA 1V3KA 3SCRA 5M03A 3WFLA 3AMGA 3TTYA 3WDJA 3AYSA 4JKMA 3N15A 2WCAA 3WD0A 5C71A 3SCWA 3RPMA 4PSRA 4AD3A 1V0AA 2Q1FA 3CMGA 2DH2A 2OWCA 1KBBA 4LYQA 2BY3A 1GOKA 1ODZA 3ZM8A 4A3YA 2XM2A 4X0VA 1UD8A 3AHZA 2TAAA 3FAWA 1MFUA 1QW9A 2VX6A 3MUY1 4MDOA 1H09A 2HISA 5LYRA 4F66A 5IXEA 1QNOA 4MJ4A 4UFLA 1W8ZA 2C0HA 5FL1A 1E4IA 3WBEA 4PUEA 2WC4A 5HOSA 3WNNA 3G6LA 3U5UA 1BF2A 2XJ7A 3SUSA 4LKFA 2CKSA 1FH8A 3ZJKA 3T0BA 4M81A 1E71M 2CNCA 5A6BD 4C7FA 2UY3A 2CITA 2WVTA 1UOKA 1ISYA 1HP5A 2QV4A 4UZUA 3WNKA 3O2LA 1W9XA 1PZ3A 4JFWA 2ZIDA 1J0ZA 1CXIA 4NI3A 2OLHA 4TX6A 1CYGA 2ZXAA 1ZBVA 1OIMA 1U2YA 4RE4A 1UKQA 2WAGA 3ZT7A 3PBGA 3WDPP 2V3GA 1ZBKA 4AW7A 3WQ8A 4CP9B 1KR1A 1H49A 3LMYA 4UQ9A 5A8NA 2W66A 2WANA 1ITXA 4AD1A 4CU8A 1CGYA 2CBJA 5IHSA 1XYFA 4MNJA 1HVQA 4HOXA 4H41A 3SCTA 2ZXBA 3OGVA 4X0NA 2GJXB 3RM9A 4M1RA 2BXYA 2EO7A 4W8LA 4XZBA 3UERA 5JBDA 4FMVA 5FCZA 5JIPA 1UQZA 1Q6DA 2VQUA 4U33A 2XM1A 3WKZA 3WQ6A 2WMIB 5BXTA 4Z2GA 2PWFA 1JNEA 1V0KA 2CBUA 3PZVA 5A1AA 3SCVA 2DT0A 3WD1A 2BS9A 3GBEA 1G0CA 2JF7A 3VINA 2WC3A 1H3GA 4R27A 3G6MA 4J27A 1HL8A 4UOJA 1XD1A 2VRQA 1E1EA 3MV01 1K9FA 2WZIA 4D6IA 3WSUA 3AQUA 1E0WA 4MB3A 1JD9A 3BLPX 4RE2A 5FOOA 3IAPA 1V02E 1EGZA 2DT1A 2PWHA 1FP9A 4AD0A 2UY4A 1LG1A 4PMXA 4QFUA 1ISVA 1KCLA 4CP9A 3B9EA 1ZB5A 3T2QA 4MB1A 4H04A 1GJUA 5D8WA 2EPMX 4PTXA 2VL4A 3VX1A 3IJ9A 2XFFA 3VO0A 1HF6A 1GJWA 1CXHA 2BVDA 1B90A 1V6VA 3SCPA 2QF8A 2DEPA 2GJXA 5EB8A 1UD5A 3FN9A 5DFAA 3T2PA 4LX4A 1W9UA 1UA7A 2VZUA 1KQYA 4JZ5A 1TE1A 1B1YA 2WMIA 2LROA 1WAWA 1PZ2A 4JFSA 4U2ZA 1M03A 1GVYA 3SUWA 4PTWA 4FLSA 1A3HA 2WYSA 2ZUNA 1GQIA 3VIMA 2WWDA 1VB9A 2O9PA 4W87A 1E40A 4CD8A 1HKMA 2GDVA 3A6OA 3AIRA 3BAKA 3AIQA 1BHGA 3K4AA 3OG2A 1UH3A 4PBGA 1EQPA 3NYDA 4DWSD 3I3BA 1H0GA 3W27A 1ODUA 1B3ZA 1F4AA 1EDTA 1ZL1A 1CIUA 3ARSA 1B3YA 3O6AA 4PMRA 5D4YA 1ITCA 2YA1A 2XVGA 1G9HA 2YL5A 3UG4A 1CXEA 1K9EA 3D3AA 1W3KA 1EOMA 8A3HA 2FHCA 4HTYA 2NT0A 3OGRA 3RCNA 2GFTA 4BA0A 1CXKA 3CBWA 2VX4A 3OLGA 3BAJA 1I1WA 3FHAA 4W89A 3JUGA 3N11A 1OIFA 5ABGA 4UQCA 3WMSA 1V08A 3VIKA 4UCFA 4JCLA 1GPFA 3MUIA 4WK9A 1OINA 5FL0A 1B30A 3HN3A 2WCGA 1B3XA 2WSPA 1WE5A 3VIIA 3MKKA 1TZ7A 3ORJA 4EANA 2D3LA 4YHGA 1GWLA 3FW6A 1CGUA 2J4GA 1H11A 2VCBA 4A6SA 3WDQA 2UWFA 1Q6FA 3CZKA 2GJRA 3WL1A 1HN0A 1W1YA 3CZLA 1MQPA 1ZS2A 5A8OA 1CLXA 4GZEA 1E6RA 4Z2LA 1JL8A 2Z1SA 2D24A 3MO4A 2CBIA 3OIHA 2JEPA 3ZYBA 2BV9A 5DMYA 4AC1X 1UR8A 3SCQA 2BVYA 4HA3A 3GTNA 1W1VA 3VD7A 5EBAA 4AY1A 2YA0A 4H8VA 1HP4A 4P7RA 2G3NA 5A6MA 1WZLA 2WYFA 3WDHA 1BYCA 3AHYA 1JIBA 4KH2A 4NSBA 2DSKA 1DEDA 4GI8A 2IUZA 3TTOA 1E6NA 3WNPA 1GOOA 4UQBA 1E5JA 3GM8A 4CGTA 4C7DA 3VD4A 3GBDA 1VRXA 4W7VA 1OH3A 1E6PA 4GIAA 1WZMA 5AC5A 1AQHA 3EMCA 4B15A 2DQXA 4JHOA 5HNNA 4W8AA 4AMCA 4UQAA 1E4LA 1G5AA 2FH8A 1UD2A 2CXGA 1NM9A 3BLKA 3U7BA 2JWPA 1MYRA 4KRTA 1QNQA 2XWEA 1V02A 1W8TA 3WELA 2J7DA 1E5NA 3WH5A 1OD0A 3E1F1 1CPUA 1V0MA 3LPOA 4MNKA 4D72A 3FAXA 1PIFA 3CZEA 4U3AA 1GONA 4F79A 1KCKA 4QAWA 2VCCA 4YN5A 3WENA 3KEHA 3OGSA 2XTKA 1GOQA 2J7BA 2ZICA 2W62A 2CHNA 1JFHA 3WF2A 1DP0A 2WLZA 3TTQA 4HOWA 4LGXA 3QGVA 3L2LA 4W5ZA 3KWXA 4OIFA 3QHOA 1JZ2A 1CBGA 1UZ4A 3PZOA 3S6TA 3NIYA 4MDPA 2EEXA 5DF0A 4QLKA 1UWSA 1JXJA 3ARUA 4LK6A 5A8QA 4GI6A 1JYWA 5A8PA 2J7GA 4LQ1A 4H8HA 5M5DA 2DSVA 1JZ8A 1W32A 2BHUA 3VTRA 1KGUA 1MXGA 2WK2A 1X1NA 5A95A 3AZSA 3W37A 1XH1A 1Q6GA 1E6ZA 4ATWA 1PX3A 3WQ4A 1ECEA 5IDIA 1UH4A 3K8KA 1LJYA 2XGBA 4M82A 2D20A 2E8YA 3EDEA 3ECQA 3ARQA 2YL8A 3BAIA 5CLWA 3HU7A 4NF7A 4ZE5A 3AI0A 3CUHA 2VOTA 1R87A 8CGTA 1BYDA 4WSKA 1HJSA 3W29A 1GHSA 4ZEPA 3IJ8A 4U31A 4XX6A 4D1IA 3BMVA 1OWQA 5C70A 3BGAA 3F4VA 4BQ5A 2EPOA 1NOWA 4UOQA 2D1ZA 4UTFA 5DEZA 2UY2A 4X9YA 5A69A 4AL9A 1JAKA 1AMYA 4URIA 3U5YA 2ZX9A 1S46A 5CZKA 6A3HA 4L4PA 2PF0A 4PMYA 2WVSA 4M29A 1LL7A 6CGTA 5GNXA 1KFWA 2G3IA 4W8BA 2D23A 1QW8A 3VIJA 2VO5A 1BGAA 1JYXA 3SURA 3WNLA 3ARYA 3APGA 1GUVA 4MNMA 7A3HA 3D5HA 2VUYA 1NARA 3TONA 2Y8VA 2VCAA 2JIWA 3PN8A 4NRRA 1UD6A 3GNOA 3VD3A 3ZT5A 3T0AA 5AC4A 2AAAA 1C91A 4P8WA 1E0VA 1SYTA 3CGTA 2CETA 1KWKA 1J12A 5IFTA 5BXRA 1X6NA 1OGBA 2VRJA 2PB1A 5I78A 3EDKA 3VUPA 4HOZA 4J3VA 1W91A 4H8UA 1M01A 1EQCA 3PZGA 2J47A 2CBVA 3RM8A 1UKTA 4ML4A 1ISXA 1DWFM 2KR2A 1I75A 4W86A 5BXSA 3VU2A 4D6JA 3GDBA 1V6UA 3ZYHA 1ZBWA 1D3CA 1OKOA 1XSJA 2EPLX 1K9TA 4UFJA 2DGAA 3AISA 1NWTA 4DWSC 5A6BA 3VILA 1QI4A 3WFZA 2PWEA 1XCXA 4D6EA 3EDJA 3AIWA 1OGGA 5BROA 1H5VA 3W6LA 2E9BA 1PX8A 3UT0A 1JYVA 5I0DA 2Y2WA 2CCRA 2DSUA 2BXZA 3WY1A 3VNZA 2XWDA 2YBTA 4QCFA 3W4RA 4JL2A 1GNXA 5EFFA 2D2OA 1KWGA 1BVZA 4HMEA 2XVLA 4WKHA 3VDCA 1QHPA 3KL5A 1ISZA 1VIWA 1GQJA 1TVPA 4CCEA 1V3HA 5D21A 3WUFA 4JKLA 3ZJ6A 3F5LA 5CQ1A 3QHMA 2WMFA 4M24A 2VNCA 1CXFA 4GO8A 1VBUA 1DWHM 4EAMA 2PC8A 1QNSA 1GHRA 1C8QA 1BVNP 4TUFA 3QOMA 1ESWA 1QOXA 2YDQA 4OZOA 5TD4A 1WPCA 1CGWA 2DT2A 1W3LA 2V3DA 3BAXA
chains in the Genus database with same CATH superfamily
4Q4W3 1IS5A 2R30A 2CFFA 2D73A 3MA8A 1ND2A 4Q4V2 1W6PA 5HBAA 1L8NA 5DAPA 2I9EA 4UTJA 1JULA 1W8FA 3QKZA 4IIGA 3PJQA 1H2NA 2O0OA 4CNOA 1QPKA 2UYAA 2ORXA 4WVZA 1VBD2 3AICA 4JTJA 3UG3A 4Q1RA 1OHFA 4YNIA 3KRSA 5I6SA 2V5CA 1PIIA 3FMGA 4H9TA 3JZEA 5F4WA 2ZHKA 4I7VA 2VNGA 1PGW2 3BV7A 1G9CA 1QBAA 5CPNA 2NSOA 3N9LA 1IQAA 1UWIA 2OFJA 3DX5A 3ME3A 1VBA2 2WBGA 4OQ9A 2W3ZA 2A71A 2ZXDA 5DN2A 2OT0A 4L0PA 1BWVA 5ABJC 4H2AA 4XO6A 4UB9A 3TA6A 3KP1A 1LEMA 1H63A 4K1WA 1H6YA 1G4PA 3VBUC 1V93A 5CAKA 4V2VA 3HQNA 4LXLA 2EG8A 3A5FA 5D2VA 1AVAA 1QNRA 5AYBA 1WYIA 4O65A 5A3HA 3NJXA 3GXDA 1OUSA 2PAJA 4XUYA 1DQ1A 3GCXA 1K7XA 2OYKA 1J9YA 1SW3A 1WX0A 3O15A 3UYJA 1C7SA 4K21A 1SPPB 4MY1A 2PGEA 2NV2A 4ZFMA 4Q4V1 5JH2A 2OLAA 3VKKA 1OF4A 4AI2A 2RJ2A 3K46A 4YGDA 2P17A 4RHV3 1FCQA 2WVVB 2GDUA 3L2YA 3I8TA 3BL3A 3OU8A 3F5JA 1XG4A 2BOFX 3QC3A 5FZHA 3LX9A 4N02A 5AHLA 2CGNA 2RKXA 1DYKA 1VBD1 1LNSA 3BW3A 4OKDA 4DUOA 3IV3A 4QPIC 5C9ZA 3NMBA 3WD4A 3TYJA 3MKVA 5CFCB 2JENA 1H5YA 4FS9A 5FF2A 3JQXA 4FTBA 4JTNA 4A3UA 3QFEA 1KKRA 3VKJA 4Q7IA 1LJ7A 2MEV1 3VM5A 1Q8QA 2HWD2 3DHFA 2JKAA 2REQB 1S1AA 4QHOA 4FTSA 5CBBA 1E56A 3O0VA 5IYYA 1VRH2 4ES8A 1DQ0A 4OMDA 2Q1ZB 4UNIA 3W38A 4WY0A 1QNWA 3T1LA 5D9PA 4UW5A 1Y9GA 4AAXA 5AC6A 3N9SA 3KBJA 4LEJA 4TVUA 3WH8A 4ZZ9A 1QMLA 1O8PA 1V6KA 1QEXA 1B3VA 1AYM1 4S1FA 3CEWA 5LSMA 3QF0A 4KG0A 4N9EA 2QCMA 2ES3A 3UWEA 2WJEA 5JMUA 3B5LB 4PQQA 2E0PA 3PWIA 3VGEA 4CP2A 3V35A 2CSGA 2V38A 4HHPA 5MKGB 1XF0A 3ARXA 1EOKA 2PDLA 2J42A 4ZO6A 4CEYB 2GDQA 3SQMA 2VBPA 3FJ4A 1HRI3 3M46A 1SPPA 3ILFA 1YC61 2YR1A 1OFOA 1KGYA 2CEQA 2ZA1A 3L66A 3L4WA 1DBNA 4LVDA 1KM1A 3I2JA 2B46X 4QJ4B 3STCA 3AIVA 1IXQA 5LNWA 1J0YA 2WVVA 2MUCA 4B5UA 4AFDA 5CZJA 3QPYA 1YQ2A 4FZIA 2W9XA 4LSBA 3I65A 1MW2A 1PCWA 5EJZB 3WEMA 2EXIA 5CFCA 5AY7A 4DYEA 3KS6A 4KGJA 2RH9A 1A5CA 1Q45A 3S5SA 1ASJ3 4KWWA 3E0LA 5BWAA 3HMYA 2I16A 4ZO7A 3N14A 1B31A 3NA8A 2REQA 3G3MA 1J10A 3WH6A 2HWD1 2R0FA 4IUGA 4Y96A 3TC3A 4DF0A 5EHDA 1DTUA 2EAKA 5HATA 2YJQA 1AR92 3AZXA 1NT0A 3PZQA 2A5ZA 1YDNA 3W7GA 3G1SA 1PNGA 1WUFA 3FL7A 4LVGA 4MY8A 4DAIA 4GXLA 1PIV3 5KTLA 2XG3A 5MKGA 4B4HA 5T3NA 2A7AA 3OB8A 2LRPA 4CEYA 1Q66A 4DM1A 3OTFA 4ACZB 1UXZA 3LOBA 4J28A 4K1ZA 2A3HA 2BSLA 1H2JA 4HN0A 2PDGA 3Q94A 1EYBA 4E8DA 4AZ5A 2YPJA 2ZEWA 4Q29A 1HGWA 2G37A 3EBVA 3NQ2A 3E6DA 4IG2B 3LU2A 1I1EA 4MUVA 4TX9A 4BWLC 4QDRA 3RPTA 1C93A 1EPVA 5CFDB 4W9TA 3LNMA 1KRIA 1QW7A 4MWAC 4Q4Y2 1AR62 3FXGA 4UQEA 3NNFA 2DZXA 4K68A 4MUPA 3P1IA 4BPZA 4Q32A 4JTIA 3TAKA 1EWDA 2XIMA 4M00A 4AAPA 3TFXA 1S0JA 3CUIA 2BW8A 5FP9A 4WVXA 3S6DA 5CKNA 2D2JA 4OHWA 4AU0A 4FFGA 4B5NA 1K8XA 1XLFA 1XRVA 3TVAA 3GKFA 4M56A 1W1TA 4A2RA 4NRQA 2HDJA 2FB3A 3W6MA 1E9YB 3A4XA 2CLOA 4HZFA 1AH3A 4FXSA 1XIGA 3QSRA 5HXVA 1OF8A 1LDCA 4I0AA 1TR1A 1ZJHA 3TOJA 2N7GA 3TN4A 4A2UA 2PU0A 5FKBA 1DE5A 3K30A 3EAUA 3GFZA 4JQ4A 3DG7A 4AFBA 1DYOA 1SMAA 1FWDC 1XXXA 2ABAA 2YXXA 1EHAA 4YFZA 3DECA 1EH9A 1UAIA 3DENA 3WQGA 4FP1A 4Q2FA 5IATA 3L7RA 5I3IA 2JE9A 1F9CA 3E9AA 2C18A 1KRBC 3W75A 4ACZA 2ENRA 4K6BA 4LTAA 3TWIA 2PU1A 3VMOA 1U5ZA 3XINA 4AEFA 3VDDB 1M41A 5M3WA 2PWDA 1WUVA 4A8NA 2WNEA 2ZC8A 4IG2A 4CZSA 1O68A 1VBB2 3H53A 3U11A 3WF0A 5JXQA 5CFDA 5FKYA 1POQA 4ECLA 1SZEA 3QQWA 3O05A 1F4HA 4RFRB 2C71A 3SRHA 4PMVA 2ZHMA 3FEMA 4Q4Y1 1W8OA 3U0ZA 4NJKA 3OLEA 1IR2A 1WW4A 4AXNA 5JBFA 3TNOA 3R5EA 3B8VA 2LTNA 3FK4A 3TROA 3U4AA 3EDFA 3GWQA 5E0CA 1R0MA 2YL6A 3VDAA 3LPPA 4MUZA 4GYPA 2QR6A 4H3DA 2G1MA 4NASA 4B3LA 1PZ1A 3S5NA 3RILA 3B9AA 3MB9A 3MW4A 3B02A 4ZTYA 4QX2A 3SH5A 2C1HA 3O8AA 4P7NA 3WY6A 1AFSA 3T2TA 3VBHB 1LBMA 5TBOA 4WJXA 1GANA 3TX9A 1TA3B 1ISWA 4IWWA 4QRNA 1YRRA 3SB0A 1YQ6A 4XDPA 4HONA 3WHUA 3BG3A 2PLV2 1XU2A 3H7UA 1XE8A 3WQDA 4LKDA 3SITA 2TUNA 1TG7A 3MV11 5FYCA 5E6HA 3GUWA 5D2XA 3VDDA 1BSLA 5E6ZA 1GW1A 4GE8A 4NPLA 1E6SM 1UU6A 1P1MA 3I7SA 2P3ZA 2WLQA 1V79A 4NOTA 1G4EA 5DELA 3HPSA 2A3CA 3DG6A 2YL9A 4Y26A 2CLIA 2V68A 3B9IA 5FJJA 1IR1A 3GUGA 4Y24A 1XB9A 2IXLA 1W5OA 2H8XA 3HPFA 4FPFA 4UZSA 1HVXA 1GSLA 4HMDA 3ZDVA 4Z1AA 4JHTA 1A53A 1Q7MA 4ICMA 2WKKA 1UD3A 3QGAC 3A3HA 4BXFA 3HD8B 2G9FA 4AFAA 1UZYA 3MI2A 4L64A 5FJRA 1RTVA 4KEUA 3PZMA 2G3FA 4B9ZA 2XJRA 4YZ5A 1F76A 3AXMA 1IXOA 1V3IA 4Y8FA 4GI4A 2ZX2A 5LBEA 4D3WA 1XSIA 1KXQA 2X0YA 4ZOEA 1L6FA 4Q1PA 3WLRA 4YGCA 4G1KA 2Q71A 4MB4A 3VBHA 5CJMA 4P8XA 4JQ2A 1TA3A 2QQUA 3M0YA 3AS2A 1QJX3 2ZEXA 4DUVA 1QWGA 4GOAA 4HPHA 3G1XA 1M3UA 4GFIA 3MSYA 1J0IA 3RJYA 5ABFB 3GVRA 4HNCA 1BQGA 1ULEA 3WUDA 4J9JA 2RAGA 4MG4A 2HEWF 4COZA 2E28A 4Z2HA 2VH9A 4YLZA 1UOZA 2I57A 3GSMA 4MNLA 5GLTA 3AMDA 1NCRB 5I5RA 3EKLA 2OGJA 4Y1YA 5CG0A 4DBUA 1IHMA 3BOPA 3TCSA 4RL3A 9RUBA 5EYXA 4RFT0 1I1XA 1XYOA 3K3OA 3HBKA 3AMCA 2E51A 3ZLIA 1DJWA 2A6VA 3KL0A 5D8AC 2NV9A 2PFHA 4A21A 3MO7A 3GNDA 1W9TA 5F4XA 4DPQA 2W3JA 5I07A 4M3CB 5FEPA 5LATA 4HU4A 1L8PA 3QTPA 1PAMA 3FJSA 3WV6A 2CKRA 3CU2A 3W01A 2BGCA 1WKFA 3KT7A 3RNSA 2J25A 2FCUA 5BPXA 1H1IA 2W1UA 3SCHA 4CDWC 2A5HA 2OQ7A 4A44A 4A7KA 4WDUA 4UMBA 1B5TA 3GQYA 4RX0A 1R86A 3D6NA 5LIUX 1BJQA 3NRUA 4PTNA 1EO5A 3BXWA 2QMJA 1ZU8A 3ARVA 1PXGA 4GWEA 4K8HA 1N3PA 4TX8A 2QQVA 2A7RA 4RA0A 2C24A 2ALDA 1NG0A 3ST7A 3CHDA 2I2SA 2X30A 3GTFA 1E4MM 3UU0A 3V0TA 1RUJ3 2BY0A 1NWSA 1XLMA 1Y8BA 2XVPA 5T50A 2BGSA 4R4XA 3IJ7A 4UTIA 5ABFA 2VECA 1PM4A 4BMBA 1QOTA 4RNFA 3SQOA 2PDIA 3VABA 1NCRA 2R24A 4PB3A 5CPSA 3QC0A 3W1RA 3TTSA 1MQQA 4YRDA 1FWSA 4AZIA 5HCBA 3KAOA 2GJPA 1UW9A 3NL5A 1EB3A 4UTLA 2Q8EA 2XLAA 4E2GA 1SFSA 2ARAA 3BPSA 2J7HA 4LE4A 3BB6A 3H21A 4M3CA 2YSWA 5I24A 3EPNA 3ZN4A 2WSQA 1QPQA 3U14A 2QV5A 2YX0A 2ZGOA 3KTSA 4QU2A 4JFVA 4LO7A 1F5ZA 1G7VA 1I6XA 5A7NA 3RLVA 4YZ2A 1FHUA 1S2CA 1CT5A 1IOAA 5DG1A 1V0LA 2YFZA 1H7RA 3ES8A 1LBLA 2XOMA 3OBKA 3V1HA 2WQ8A 2WO7A 5FV3A 1IQDC 1DGWX 5JR7B 4JNMA 2R16A 3SUUA 3HV8A 3R8HA 1CI1A 3FA4A 3W1UA 2A3WA 1RUH3 2RS53 4DY3A 4IM4A 4QDMA 4AYSA 4DO4A 2EPNA 3VX0A 2R042 1O4YA 1I2PA 1C8M3 4DYJA 1H50A 3V75A 4TTUA 5K9CA 1DLCA 3PR2A 1V4YA 4U3CA 1ZCOA 4LIUA 1YTEA 3W84A 4XILA 3TYDA 3UZJA 3B05A 1KA9F 3VAVA 2YCIX 1XFCA 3K4ZA 1ULPA 4S3DA 4S3KA 4DWSB 1KRAC 3U1XA 3PMEA 5C3PA 3VUOA 1VE0A 2R072 2Z7KA 5I2UA 1HW6A 4IV3B 3LDRA 4WXZA 1VH7A 3N7MA 4FA3A 1A5MC 2GC3A 2VRKA 1VR6A 2CGOA 2K9ZA 4CCMA 2Y5SA 4X6QB 2XHNA 3BAWA 4U5KA 5TIMA 2FDHA 1NP2A 3EWUA 1R9XA 3ARPA 1JW6A 3RMXA 3WUBA 5FRAA 2NW0A 3AZTA 4OGZA 5G1TA 3AO0A 5DCBA 3UCDA 2B7PA 3BANA 2ZBTA 4LA3A 5A2CA 3WQWA 1UP0A 2X10A 1CAUB 1CWYA 3SRDA 4PT6A 1AR82 1KLYA 3LPFA 3BLOA 5T26A 4MAZA 2QPUA 1ZALA 3GVVA 1WB0A 1LT8A 4NWWA 2A4AA 4XF9A 5H9RA 5F2GA 1B9ZA 1Z69A 1CB7B 2CESA 4GIYA 3PUSA 2BFUS 3FGCB 1XL9A 4J35A 4NKCA 5D33A 3EPOA 4Q8WA 4M7TA 5FZCA 3BMXA 3MF6A 3AYRA 3IARA 3KW3A 4GY1A 2TYSA 2VFHA 3OA5A 3VKAA 1E6QM 2ZUUA 4QX1A 1IT7A 4O8RA 2ZVIA 3Q2DA 3LS9A 1NZIA 5XINA 2WJDA 3AHTA 1ADOA 1I4NA 3RXZA 4DWSA 4ZOCA 4C6DA 1YKWA 2FGBA 2PDYA 3SEPA 3QRHA 1HO4A 3QGKC 4IV3A 2OG9A 4KMQA 4LBQB 1J18A 4Q4PA 3VZZA 3IVUA 5H6HA 1P0BA 3B94A 2GWGA 5A2AA 4PIYA 1U30A 3B8WA 5A6SA 5HMEA 2XB6C 1TQ5A 2QUNA 2ZFAA 4XK2A 1KITA 3AP9A 5C33A 3GO2A 5JSOA 1QJZA 3M07A 3QR3A 2ZUTA 1PO23 3LTSA 4B5XA 4LBJA 1QJWA 1BEV1 3I7QA 4WKAA 1XLBA 1ULDA 3JBG3 2VZOA 4JVAA 1O3RA 1CAUA 5DBUA 3WDIA 4KF1A 1KBIA 1B54A 5C3SA 4LPLA 3K1DA 4ZMGA 2LLEA 5IHRA 1UBSA 3V64A 2XPKA 2NVCA 4D71A 3NM3A 1AR81 1FXZA 1W3NA 5IK5A 1AX1A 3O7OA 1QDCA 4AIOA 4Y33A 1RUG1 3FDKA 5LA2A 2CLLA 4N42A 4YW3A 2Q8OA 1C8XA 3BWWA 1WBFA 4Z2JA 3BCFA 4PSPA 4D94A 3FGCA 2IXUA 3ACGA 4DJEC 2C13A 4HSNA 4S3AA 1T41A 3HBLA 4TU1A 4Q4X3 4C8DA 3UGVA 2ZX1A 4XD3A 3W2MA 2Z26A 4F9JA 2Y5EA 4AISA 4ZE4A 1W90A 4B3KA 1W3HA 5D03A 1AYN3 3W2UA 3VIGA 2GGGA 1MUCA 4GNVA 2QCLA 5F5QA 4XV0A 2PUZA 5JI7A 4LBQA 3L4UA 6REQB 4JTAA 3A4AA 4A45A 3PUDA 3GHMA 3ZQ9A 2GUBA 3W25A 1Y4WA 3IEBA 2D6PA 3PJYA 3USZA 2ABBA 3ZSLA 4WHBA 2ZA2A 2W46A 4OI2A 1DLLA 2H9AB 5BZAA 2D22A 2FZDA 4IMDA 5FPZA 2VW1A 1RCXB 6XIAA 3HVDA 2RGMA 1KGXA 1MO0A 1QJFA 1HW5A 2HH9A 3S2MA 4TIMA 2Z27A 1QGLA 4R52A 5E6YA 1E3ZA 1DJZA 2DCYA 2XIBA 3FSUA 4I8DA 2ZGUA 4ZB2A 1YDOA 3GR4A 1UIPA 4PCTA 2AYHA 2NMNA 5J1XA 5DCEA 2Y33A 4C65A 3UWWA 1KDKA 3FXYA 3EDDA 2GGHA 1JI6A 3UY8A 4M0NA 1IEXA 2FMOA 3TR2A 5A33B 3W7DA 3F1QA 4AVAA 2BGQA 4JAWA 3GZEA 3U2OA 1Q5OA 3W1PA 3CXOA 5GJPA 2ZX6A 3P3BA 2F38A 6TAAA 2VMEA 2FZNA 2BHYA 2XSXA 3P5YA 4M6VA 4IMEA 1JS9A 2OS2A 5C7GA 4A6OA 1IWPA 3VPLA 2OGYA 3KVAA 1D7PM 3W22A 1S0FA 1HB1A 4JD4A 2QAPA 6REQA 3PSVA 1KJLA 4Y9OA 5EPDA 4DLFA 3DG3A 1FA2A 4CD6A 5F4SA 3R8RA 3G24A 1O5LA 3JQWA 3M3IA 4LW7A 2BVVA 4BH9A 5GALA 5FR3A 3BGJA 2VMFA 5L9FA 5T52A 2EG6A 5A7QA 1KFEA 4GA9A 3WLOA 2H9AA 3UA3A 4JDNA 2E68A 5FPVA 4J25A 3L12A 3P93A 3QV7A 4DEVA 2QMKA 2IQ0A 3IAQA 2ZX8A 4WKFA 1TELA 2OQYA 2BWAA 2J1EA 1XS2A 2XHYA 3LA2A 1EAH1 2XH2A 3BOFA 4FPCA 1XIFA 4E8CA 2HZGA 2HYXA 4B7EA 5AYZA 1RUE3 4PIXA 2GAUA 4CP0A 4FSAA 1AJKA 2ZAAA 3J4UH 4P08A 2PDPA 3ARTA 3CO4A 1H4PA 2J78A 3NO8A 4LYKA 5T5OA 5A33A 4AY7A 2HWC1 4CYDA 1LESA 3Q37A 4MFEA 4YM3A 4H2HA 2CWMA 3I3DA 4ZSTA 4XHXA 3GYEA 2ZWZA 5EV7A 4WIWA 1IYXA 1OI6A 3ABQA 2OQLA 2BRTA 1PO13 4GJ1A 4R7JA 5KC6A 2C9AA 2VULA 2F8QA 2X1SA 3MGUA 1GVFA 4K6AA 5KINA 2P6CA 5H8MA 4LBLA 1I5ZA 4CDXB 1OY0A 2FDJA 1TJ0A 3C0QA 2VOKA 2I5GA 4GKXA 3C6CA 4HVQA 4IIBA 2VMDA 1K42A 3W1QA 4XMIA 5FREA 2ARXA 3GDRA 4FOQA 3R05A 4N9DA 3CNAA 1UWUA 3BSHA 3WX5A 4FPKA 2UWAA 4XZHA 2O8OA 1GZCA 3GGLA 5L6UA 1I0DA 3M7WA 1KFLA 3QPZA 2PLCA 4PTMA 4L5ZA 4LC8A 1OZMA 5AZ1A 1JZ5A 5JZGB 7TAAA 4BE3A 3O1PA 2B45X 2X0HA 2QZRA 2GVYA 1CENA 2D0HA 3V36A 2XBO2 2UY5A 3T0TA 3FKRA 2GNTA 3R94A 3ZMRA 1Q7QA 1F5FA 1UMLA 1MI3A 2FDMA 2ZUVA 4F83A 1D4M1 4HU0A 2Y7EA 5XIAA 2X41A 4XVEA 5FY4A 4WM8C 1RH9A 1FKWA 2BVWA 1LF1A 4FO4A 3N9QA 1OK6A 3UWQA 4IEUA 3PTRB 4TSVA 5I0TA 2A73B 5D38A 3EYPA 3M0MA 1GR3A 5CG9A 3FDGA 3LSCA 5FJPA 1F6YA 4AWUA 2GC1A 4J2PA 4CDXA 1SMDA 4DXZA 1M9HA 1KQZA 2Q02A 2X2YA 1NYWA 1XDLA 3R13A 1E6XM 3KUMA 1MFVA 3QBQA 2F84A 1FI2A 3ALGA 5FZMA 4G6CA 4E3TA 3IJ6A 3M5YA 1GGOA 3JUUA 1ND2C 4DO7A 4XJAA 4AHZA 5C54A 4ZHNA 2CC0A 1OK4A 1G6NA 2DUZA 3OBZA 1PBGA 3LCHA 1W99A 1G86A 4LH8A 4PRWA 4Z17A 2UBPC 5C2GA 5MF5A 2E7FA 1GK8A 2INFA 4JN7A 5JZGA 2V09A 3QW3A 2OELA 4REQB 1BAGA 3Q4DA 3WIJA 1TNFA 1MZFA 2Y6JA 1QFEA 2J1TA 2YOCA 1LLWA 5H9QA 2DP3A 2R0HA 4OHZA 2P3JA 1E72M 2Z1XA 1PUDA 4NN0A 2XBO1 2HCVA 1FHLA 4XTDA 5CB7A 3PMSA 1MDLA 4NJJA 4XJ8A 1OB0A 3EB3A 3DFYA 2W0XA 4GAZA 5F32A 2WWUA 3MPBA 5DXDA 1F3TA 5F1UA 5I77A 3WX7A 5H2ZA 3MF9A 2WJSA 2E3ZA 1OFAA 2Z1VA 1K3UA 4ASKA 3FOKA 4NU7A 3GDTA 3IM0A 1CLVA 4WD0A 1WCDJ 1CR7A 3MQTA 2BEOA 3S5QA 1Z8AA 2GC0A 7PTDA 4V1XA 3IWPA 2PHRA 3EMRA 1NLRA 4MSVA 1TUXA 4I6KA 7REQA 2VTXJ 4YS1A 2J7EA 1JUBA 1OURA 4KG8A 3POEA 5A6KA 1M04A 3VC5A 4RZ4A 4GC3A 1PKLA 4LBUA 1GPWA 1RUI1 1X50A 3IDBB 3S0CA 1QAPA 3NQBA 3OVRA 3AYSA 2CL2A 4REQA 3NVCA 3N15A 2PTZA 3KCXA 4D69A 4A42A 1H7OA 2WCAA 4IEOA 2Y64A 4XABA 4RR3C 3RPMA 4E4ZA 4PSRA 1V0AA 1UNBA 1H2LA 2OX1A 5U4NA 1R2TA 2P4EA 5DDJ2 2OWCA 4DJDD 3NQEA 2Z00A 1GOKA 3CAWA 1WBHA 1RHI2 3EA1A 4HN1A 2V69A 4CQ8A 4FNSA 2RDSA 3SW6A 2NXHA 3NOYA 1MFUA 1PS9A 4AHPA 1DG6A 3QFWA 3MUCA 4GLEA 2JJ6A 1F74A 4IGMA 4AXOA 3JVAA 1B3OA 1TWDA 5LYRA 3RWKX 2XN2A 3AAMA 5IXEA 3OG3A 1XICA 4IIDA 3CNYA 4GUIA 2RDTA 2C0HA 1OSGA 4IFOA 1E4IA 4Z1CA 4LA2A 4M19A 4DRVA 1Y5XA 2WC4A 4PUEA 5HOSA 1COV3 5BUVA 2CZFA 3H7YA 1BKHA 1SJAA 1TZZA 3G6LA 1KM4A 4XVHA 5FK7A 1CVNA 1I8JA 4LKFA 1VFSA 3IUDA 3RZHA 1E71M 2A6LA 2CNCA 4G5DA 4C7FA 2QCNA 1EF3A 2WVTA 3CJXA 1HP5A 2TBVA 2C14A 2QNEA 2CLEA 3Q8CA 4EXQA 1P0DA 4UZUA 1GP6A 1PGL1 2DZAA 1LGBA 1ENQA 3VYLA 2OXBA 3G3DA 1YQ5A 2IC1A 1CYGA 1F3WA 1MXSA 1EF2A 4RE4A 1JYIA 4PL1A 4FPGA 3PBGA 3WDPP 4MGTA 2VXRA 3CTLA 1BXCA 3H4XA 5CC3A 2INEA 1FOD1 1KR1A 4UQ9A 5IBXA 4UF0B 1XBYA 4RZ5A 2BBVA 2E77A 2F6XA 4AD1A 3O16A 1QH7A 2VCMA 5CFCC 4YTSA 3DKQA 4IH3A 1S2VA 1XYFA 3LV5A 5BOOA 1HVQA 2CYFA 1N2VA 3KDOA 3ACFA 3SCTA 2ZXBA 3BODA 4LAZA 1KM6A 3AJYA 3VNMA 4KBBA 4FPSA 3CWHA 4IEXA 2BXYA 4W8LA 4C90A 4HOOA 4NRPA 1OZQA 4IEPA 2PDNA 5JBDA 1F73A 4O11A 1FV3A 3TV8A 1HV0A 2G9GA 2WSVA 4JX0A 3JD72 4NYUA 3CQ0A 4U33A 3G1FA 3IGUA 3O1VA 2BU9A 3PZVA 3KWSA 3TIMA 1QF3A 2BS9A 1U5JA 3VINA 1OFDA 2WC3A 2DW7A 5FMBA 4R27A 4TO8A 1YXYA 4LT5A 2HROA 5AHFA 2FD8A 4J27A 2VW0A 3OP2A 4HBNA 4RGGA 5C0QA 4UOJA 4LIVA 3MLLA 5SV8A 3RAOA 1CESA 3MBWA 1KFKA 4XZMX 1URXA 3A0KA 3AQUA 4Y1VA 2AEZA 4RE2A 3DL3A 1LU1A 2RUSA 3R1ZA 2VC7A 5EJ3A 4ES9A 3WLSA 3KZPA 1EGZA 5DMNA 4AEOA 2QS8A 4AD0A 2UY4A 5FACA 1AUYA 3BJTA 2RS33 2AEYA 2OEJA 4UF0A 3T2QA 3U9IA 1RUC1 3CJPA 5FZAA 1UIJA 3QLDA 1WCSA 4MB1A 4RXFA 5D8WA 4SLIA 5CNAA 5AC8A 4PTXA 5DAWA 4LO8A 4XF0A 1VLIA 4AVNA 4FXRA 3VO0A 4DLMA 2ZTKA 5FF4A 4L6OA 3CO8A 3PG9A 2NQ5A 2BVDA 2ZQ0A 1C1LA 2QDRA 1V6VA 3SCPA 1RBLA 4KU8A 1A50A 1AG1O 3GU2A 3FN9A 3AZYA 3HGRA 3WG1A 2JD9A 3R4SA 3T2PA 4LX4A 4FPEA 4HKLA 1TPDA 4FAGA 4Y90A 2W08A 1JCXA 3KF3A 3HT2A 4IEYA 4CXWA 4HHLA 1NUKA 3VOJA 4PTWA 4F48A 4FLSA 1A3HA 3PAJA 3W59A 5HJYA 3N9OA 2WWDA 5LIKX 1F07A 1ELSA 4PUUA 1IKQA 2YYTA 2WO2A 3GC4A 5FZKA 2JB4A 4MXWB 2O9PA 5C3RA 4W87A 1E40A 3NZRA 5DPNA 4JTEA 3WP6A 4QPGB 2QQNA 3AIQA 3OG2A 1LOAA 4AFYA 3OZMA 1UH3A 1MNZA 3RYPA 4BK4A 3JXSA 4N9IA 2MPFA 3KHCA 1H0GA 2I5QA 4FALA 2QUVA 5CFDC 3KV5A 3W27A 4N7QA 3ITXA 4WGHA 1F4AA 3LIHA 3WZ0E 1ZZ6A 4QDPA 1ZZ8A 4OHXA 1ZZMA 2JK2A 3WT3A 1ITCA 3LHVA 2QVNA 1PHMA 4K39A 2O1QA 1ADSA 4DS0A 4CCKA 2DDUA 3W76A 5EBUA 1N1VA 4W4ZA 3WBXA 3ZFGC 8A3HA 1X9TA 1C57A 4QQLA 5CZTA 3BOXA 4NXKA 3RCNA 1A5BA 1PDYA 3GXTA 4BA0A 1CXKA 3V56A 2VX4A 3DUGA 3HOJA 3VBSB 3SEEA 1SSGA 2YC0A 5KXCA 4KBXA 3K4WA 4EPBC 1PTGA 4W65A 2QXWA 3G2GA 2TEPA 3FX3A 1V08A 2ZPXA 3BTZA 2GVJA 2MNRA 3EOSA 2WJZA 5IVBA 2BDQA 5HJXA 1XYCA 2XHKA 2ATSA 1JHJA 4FNPA 4BLJA 2WFF1 4M3PA 1B3XA 4MXWA 1MZHA 3I2DA 1Q6LA 3PSWA 4IERA 5JWPA 1TZ7A 3H2FA 2X7VA 4QPGA 4AQ2A 3RCYA 4EANA 1O3TA 4UBPC 5DUUA 1J8VA 3LSEA 4XAPA 3LCFA 1GWLA 1I45A 3AYEA 1FXQA 4Y1UA 1N3OA 3QYQA 4DI9A 2VUCA 2W79A 1EV12 3GG0A 4G2DA 3WDQA 3UJFA 1X33A 4IL7A 5FZFA 5DY2A 1S5TA 2ZKLA 2GJRA 5D32A 2W68A 5L9VA 4GZEA 4V15A 4N53B 4LKSA 4FOJA 5G2WA 1LENA 2KD7A 3PVBB 4W50A 4WBBA 4FFFA 5DMYA 1OJXA 1UR8A 1XIMA 3WLJA 4NX0A 2BVYA 1W1VA 4XZUG 3W1XA 5EBAA 4FXFA 4U28A 1XYBA 1HP4A 4NG3A 1W9SA 3VBSA 3LQLA 1A5UA 4QM8A 1QRQA 5A6MA 2WYFA 4H9YA 2ZE3A 5LNUA 3VKCA 1JIBA 2FTWA 5J04A 4N43B 3PFMA 4QITA 1ASJ2 3C8NA 4GI8A 3VZLA 1SLLA 4M0HA 3WNPA 1WD4A 2X7WA 4WY0F 2XZ7A 4H55A 4F8AA 1KRMA 3PTYA 2P76A 5H9PA 3GM8A 2JIJA 3NYZA 2QUTA 5E93A 3GZTB 5LWBA 3T1MA 3GBDA 4W7VA 5DZEA 4QX0A 1OH3A 3G8EA 1WZMA 2PD9A 4OV9A 5AC5A 3QKEA 1DJXA 2CZEA 3TYZA 5JXJA 4P9JA 3EMCA 1Q65A 2VEFA 4QB2A 4BM8A 2DQXA 2QQWA 3N6JA 4X8NA 4JHOA 5HNNA 4AMCA 1H8TB 2FH8A 3NGJA 1NKGA 3SAZA 2CXGA 5K7JA 1P7TB 1HUVA 3BZJA 1C28A 1RUF3 4N53A 5DBTA 3WELA 1VFHA 1QWKA 1P48A 3MIGA 1KKOA 3KCLA 5HR6A 5CEWA 2A70A 4PBFA 2XL9A 5JLVA 1PSCA 5FLJA 3LCXA 1W0PA 5BOFA 2IKJA 1MQTB 1VPXA 2GMPA 3URAA 1HGYA 3T1GA 1YQCA 3G1RA 5E16A 4E2SA 3O1OA 3MP5A 1W6OB 2VCCA 5DANA 3IUIA 3M9YA 3B0YA 2GMMA 1BBT1 3PK7A 1B35B 4XQ4A 2CHNA 5D02A 4LGXA 4N43A 3UJOA 2R9RA 1QOSA 1BTMA 3PZOA 1RMU2 4RE0A 3TJLA 1NXMA 2RMU1 4JX6A 2D3SA 3FJLA 1D0GA 1XLGA 4L4LA 3ZVIA 5CIRA 1QOOA 2EEXA 4KKXA 4C1LA 1QJEA 4QLKA 1UWSA 3TRSB 3FLPA 4LK6A 2NPIA 2FDGA 3ARUA 4NZJA 3QY6A 5HWNA 4GI6A 3ZSJA 2PHWA 4LEQA 5A8PA 1DIWA 3ES7A 1LORA 2J7GA 3TC7A 1LGNA 3ZN5A 3NGFA 3LB0A 1XRTA 4GGBA 3HG5A 3GBWA 5M5DA 2QULA 4Q8MA 3O1TA 2BYVE 4RQPB 1H8TA 1NDWA 1W32A 2BHUA 1RJ8A 1KS4A 1MXGA 1R9YA 1S2AA 1TTIA 2XFWA 5A95A 2PODA 1P7TA 1LECA 1RUD1 1KCXA 3K8KA 4QGLA 5FPLA 1YNYA 1LJYA 5CCZA 1IG3A 5FZDA 1GFF2 4AXKA 5ERLA 2HV5A 2E8YA 3EDEA 4N90A 5L73A 3HURA 4IICA 1UU4A 2HK1A 2Y6LA 4ZE5A 4MJMA 3AI0A 1MQTA 1LHUA 2ZMKA 3EX2A 1VBHA 2Y0OA 4KL1A 4MGIE 4WX2A 5A8GA 4ZA0A 1W6OA 4NY2A 5U7SA 5E9XA 2FZBA 3WHTA 4U31A 3WQ0A 4P9GA 3BMVA 2PGFA 1U5YA 1N47A 5AFBA 1B35A 2Q30A 1QXJA 3NFUA 4BQ5A 4Q0QA 1VCGA 4OQ8A 3MLKA 5L19A 3C0LA 5IRPA 1VAVA 1NY1A 1R1A2 1AMYA 4A8LA 3KT1A 3WDUA 5CZKA 4FIQA 4QS5A 4A6GA 2EA7A 1H0BA 1QWRA 4MZ8A 3VB9A 4MM1A 1S1RA 3C2VA 1FUYA 2EXKA 2PF0A 1HJGA 4KWLA 2K2SA 1OA4A 1EC7A 3UXIA 4FQ4A 4NT0A 3KBNA 3AKPA 3VBFC 4AAJA 4LAOA 3FKKA 3SN1A 1IZCA 3MDUA 1JYXA 3KDNA 1M65A 3MMTA 3WNLA 5H8PA 1TZOA 3QM3A 4OE7A 1NELA 3QMRA 2IPWA 2Y8VA 4I09A 4RQPA 4XO7A 1SZBA 1UD6A 1GVRA 5AC4A 1U1UA 5AHMA 3F7JA 4MX3A 3R7MA 1FDJA 5HCAA 5KXBA 3M5ZA 1KTCA 2RM21 1EP1A 3LZ5A 1QUMA 3UKNA 3UP8A 5IFTA 9XIAA 1DJHA 4C0HA 5I78A 4HOZA 4J3VA 3NG3A 4J2MA 2ZADA 1SFLA 2DVDA 1M01A 2SLIA 4YTUA 2DFAA 4C6IA 2QAFA 2QDDA 1DWFM 3SDOA 5FO7B 5AYXA 4W86A 4QEHA 5BXSA 1MEIA 1V6UA 2XIOA 5JU6A 4A3QA 3QY8A 1D3CA 2IWGB 1OKOA 6PTDA 1K9TA 1H1MA 4Q4V3 4HQVA 4L97A 1TUFA 3AISA 3BI3A 4DWSC 2GVEA 4A35A 1R1A1 1QI4A 1K5JA 3MVTA 1ALYA 2E53A 4PTDA 2FLIA 3LHYA 1JUHA 3ITCA 5CPLA 2PWEA 1XCXA 3EDJA 1OGGA 1XQKA 3G5EA 2POZA 1QJX2 4XMAA 1VBD3 5F1VA 3UT0A 5DZGA 5I0DA 4A7YA 2Y2WA 1DIKA 5C4WB 2DSUA 3P80A 4GC4A 4B91A 1M7JA 5E5CA 2JD4A 1XDMA 3QY7A 5KWRA 1B4KA 1T7LA 3SGZA 3M0KA 3NOEA 5DG2A 1KWGA 2VEMA 1BVZA 3O1MA 1AUSL 4HMEA 3W1TA 4C6MA 3DGTA 4JN6A 1VBA3 1PL9A 3VXGA 3IWZA 5D21A 2PLMA 4S23A 3IMNA 3QHMA 4HNTA 1I6NA 5AVPA 3ENLA 1QJY1 2NX1A 2AKMA 3FS2A 4DO0A 2VNCA 1CXFA 3KXQA 4HIBA 1VBUA 2ZHLA 2C6SA 4GVHA 2PC8A 1QNSA 2JDKA 1JEZA 3W58A 2F9RA 2BP6A 2I1OA 1QOXA 3G77A 2YDQA 1ZYBA 5TD4A 1N8IA 2DT2A 3EWWA 1W3LA 1R46A 5ANQA 3H8RA 2JIGA 3DCQA 3MANA 2C0ZA 2OZ0A 3J26N 4GQGA 2B7YA 1R9ZA 2ZGLA 3N34A 2BODX 3LTYA 5B7YA 2QQPA 2WSYA 2ZUMA 4XBQA 4AD5A 1M6JA 3I6EA 2GQ9A 1ZAIA 2J8TA 4OBSA 4I30A 3SY5A 1G9AA 7ODCA 4HPGA 2CTVA 4JOMA 1M06G 3KL3A 3IGSA 1CLKA 1TQXA 4Q8QA 4GYFA 2Q8CA 4U2YA 1HXS2 4ZOBA 5C4WA 5A3NA 3E0WA 2VZPA 4NAOA 3C5QA 1MVQA 3TK7A 1IPSA 4GUFA 1Q13A 5IDZA 4NJIA 2VJXA 1GOIA 1JFXA 1L0PA 3L4ZA 1XP3A 3B04A 2ZZJA 1KBKA 1TWIA 1V6WA 4CCNA 1OFQA 3VZXA 4B5WA 2QCGA 1HB3A 3II1A 2HWD3 3KV4A 2IS7A 4LORA 3POSA 2UZ9A 3QW4B 4CN6A 3VNYA 1KDMA 1XLDA 1BMV1 3BCWA 4TYSA 5E0FA 3WG6A 2BERA 3WBAA 2JE8A 1TVLA 1WZAA 2EIDA 1O66A 5G1MA 1XM3A 4NAMA 3W3OA 3B7MA 1K1DA 4LCRA 1V9U1 1A3WA 5C8CB 2HK0A 1UKSA 2YPIA 4ZY9A 4HZ8A 1KNWA 4E4DX 4DXKA 4U4MA 1GZJA 4NAEB 3F95A 3HGJA 3WSOA 1OUXA 3NQ7A 2WCSA 3E0VA 1YQ8A 1MVYA 2GSYA 3W20A 5GQBA 4QX7A 1EZ2A 2XU2A 3BE7A 4CQDA 1NWUA 2X40A 1ZCCA 2ZX4A 3SKVA 5HQMA 4PZVA 2P6HA 3ZXWA 3S7IA 5A70A 2QCEA 3ITLA 2W92A 4LVAA 4IPNB 4LO5B 5DMLA 2FMYA 3RJRA 3M5XA 1FH7A 4ROQA 4FAHA 1EA9C 3KOFA 3RRXA 1CGPA 2PZ0A 4ZXKA 1ULFA 2PBGA 3U37A 3VGDA 5JVLA 4JTGA 1LCLA 2VFIA 1DWGM 1J79A 3OTRA 3W07A 2PEVA 2OYZA 5CPMA 4IE0A 3J7HA 1QVBA 2Y0IA 4CPBA 1AX2A 2OZ3A 4ROPA 4W5UA 5IK8A 2VZQA 3E6EA 4HPJA 4M1BA 4R9BA 3RIKA 5IVEA 4EP8C 3AYCA 1VGAA 3EXSA 2XJSA 1AR93 3P14A 1Q8PA 1IT8A 3L2MA 2V3EA 3VMNA 1HIXA 3SCGA 1IZKA 3A47A 3LUTA 4GINA 4LB4A 4EE2A 5C8CA 4Z07A 4GIRA 1EO7A 2IXVA 2AGKA 4QLLA 1POV0 4YVXA 4NAEA 2E7QA 3GG8A 5CEHA 4XAAA 5ABJB 4IMCA 4QX3A 4E5TA 1XV8A 4BZYA 1H7PA 1W9PA 2ZWYA 1JPIA 2NZ9A 3VBUB 4G7EB 5FJHA 1KXVA 3P5ZA 2A7NA 3KT4A 3SM0A 1YADA 3X29B 4D8ZA 2BLEA 4MXVA 3NWRA 1W0MA 5J5RA 3W28A 3UCCA 3H12A 4Q4Y3 1AR63 3QLQA 1ZBA1 3VNIA 1OSEA 3MW2A 1ME8A 1W0OA 3HG3A 3RDIA 3KOZA 5GKAC 3OVPA 3THTA 1JJKA 2ZTJA 1LODA 3ZYJB 2F6KA 1ZFJA 2ZGKA 4JFUA 5D9NA 1UR1A 3UBPC 5DN1A 3GCWA 5A3WA 3WQVA 1BWKA 4YG0A 1W54A 1PNFA 3RDKA 4GYJA 4Q8NA 1GYMA 3I68A 3DXTA 2VFGA 3S1GA 3PTMA 1QPRA 2AMXA 5SV5A 4GX9A 2P53A 1E5SA 1WP6A 1YE6A 4J1WA 1VBC2 4QPIB 5FPUA 1DWAM 2YU2A 5EMYA 1E0XA 4JIRA 3WEOA 1UR9A 4N4QA 3BTYA 2EJ1A 2ZMNA 3VZJA 3W53A 1AH4A 1Q7ZA 5DO8A 4CD5A 2OQHA 4M8UA 3UV9A 2DFCA 2OO0A 2WC7A 4Z1YA 1BEUA 5K9XA 3H8OA 1CX4A 2ZEYA 3VKLA 4CDQC 1W9DM 1WDRA 4Q27A 2WNQA 2HWE1 1LHWA 5BNPC 5ABJA 3CHFA 4CU9A 4PEEA 1A78A 3OVGA 2VBBA 4MADA 1YPFA 2V4VA 3VBUA 4G7EA 2J1RA 2YBPA 2Y88A 5G4WA 4HANA 3R6SA 5CLTA 3AX4A 3C0JA 3V65A 2Z28A 4HMCA 1UR0A 5FJUA 3KZ4C 1OGSA 4JTCA 1DFQA 2IUWA 4UCGA 4D6HA 4YVWB 2BOIA 4LS0A 2JG9B 1LL6A 1OBAA 3B8TA 1V6XA 1DGRA 4O1FA 1AYN2 4TOQA 1SO4A 2ZAHA 5BOEA 3WK2A 2HWB1 3LXCA 4HJFA 4DXRA 1T2XA 3RK8A 2FCVA 4H9UA 4H9VA 1PVXA 3H8UA 4GJJA 4GXWA 3WD5A 5FKCA 4WOQA 1OLMA 3JR2A 4JN8A 5DX7A 3AHVA 4DOUA 1UR4A 1UYQA 1YTDA 3S83A 3TAYA 1J0HA 4YW1A 1WDWA 3D5OA 1KQRA 4ISQA 1YNPA 3B4YA 3WP5A 4QR6A 1WDPA 3ATGA 3U07A 2IXCA 4QPIA 3SCOA 4Q8TA 1J84A 3TXZA 1TMHA 3S4TA 2J7CA 5DAQA 2UWBA 2PTMA 1VBGA 3ANUA 3DUIA 4Q26A 4HBKA 3WNMA 4LYRA 3TU9A 3TW7A 4DJDC 3CM4A 1ONXA 3TN91 4W7UA 1KXHA 4AEMA 2PWUA 2DORA 5HANA 4TLFA 3FA3A 3AXHA 2PLV3 5KHGA 1N1SA 4UXAA 5GNYA 2DZPA 4RSUA 1F2NA 1MEC2 3TCEA 2G4FA 1H4HA 1R3RA 1EJSC 1CJPA 1RV8A 4ATDA 3WMBA 3DYOA 4EN6B 3WMCA 2BOJA 3IGHX 3H55A 2OQ6A 1ZVFA 1OM0A 5J09A 1JN2P 4J6GA 1YIPA 3E96A 1C3FA 4Q7BA 2GQAA 3P2VA 1U0AA 4QJ5B 2HXTA 2WHMA 4IPJA 3CAKA 2C0AA 5GJMA 4YVWA 1GQLA 1WBJA 3BJSA 2JG9A 4OUEA 5AZ0A 3KX6A 3NL2A 4LOCA 1GJPA 3NV4A 4JDBA 3W00A 3ZO0B 4HTBA 2VUDA 5CKQA 1SJBA 1D2KA 3WUEA 4Q8PA 2XUCA 4HA1A 4OOUA 1OQFA 2DPEA 3VD5A 4NP7A 1V7AA 5LA1A 3PPCA 3SISA 2O7QA 3AROA 3T30A 4KS0A 3PNUA 2V5LA 3KLLA 4MWAB 4CUBA 4IQDA 2WM0A 4US6A 1OD5A 2WKGA 2XISA 2VELA 1MRQA 3DXIA 1KW1A 4Q6JA 5FY5A 3L9CA 1Y0EA 1FOBA 3I3EA 1BVVA 1UWQA 1WKYA 2QEZA 4O1BA 5LW9A 4P8VA 3JCIA 3J7MA 2BXVA 3AP4A 3D4KA 1K3IA 2WNWA 1S0IA 4NIDA 3TOYA 1Y3TA 2IVIB 1RUE2 1OC5A 4BKNA 1SW0A 2BASA 3RX2A 1ZLPA 3GAKA 4L92A 2DIJA 2ZMLA 4QCEA 1J59A 1GG1A 3AUOA 4LOTA 1XKJA 1GVQA 3MP4A 3SGUA 1DORA 2O9TA 1BK0A 1UROA 4ZTXA 5EFUA 3C2RA 1HKVA 1MEC1 4OUIA 3T0DA 1LB2A 4H9MA 5A80A 1DJQA 4JCKA 2QUMA 4XQDA 2J1SA 2ZZ5A 1WV2A 1AW5A 2KM2A 1QDOA 4YTTA 2AENA 3BUVA 4QKNA 4YTQA 2Z4FA 1MW1A 3WR0A 4YWSA 4CU6A 3UXAA 1QPOA 1Z0HA 1P0EA 3ILRA 2QHAA 2ILMA 4P5UA 3GBGA 5EIYB 3NPWA 1HJXA 4DBSA 1CZ1A 3WQ5A 4R9OA 5CBIA 4AZHA 1Q8AA 1R7AA 1ZRIA 2X8RA 3T7VA 4ZCWA 2FPVA 5KZMA 3APYA 2JDHA 4AF9A 3R89A 3KWVA 2HWF2 4PUJA 1UKOA 4FFHA 2DIEA 2BOGX 3KHJA 3FY1A 4BWLA 3CZJA 2E7AA 4YW5A 3M4HA 4RDYA 5T9BG 5BXXA 1XC4A 1RP8A 2HEJA 2YHJA 4ALDA 1JZ7A 3H1MA 1ZRFA 4AZ7A 5I00A 2RE9A 3CJIC 1S2UA 3D6EA 5BV6A 3U4XA 2XGIA 1EY2A 3S3GA 3O12A 4PMOA 3CPUA 2VP8A 3I2OA 3CDZB 2H0VA 3PL0A 1IPJA 1Q8JA 2I14A 4RV3A 1TWZA 4B9YA 4CD4A 4WDWA 4XIOA 1IXNA 3GTIA 4XUOA 4EOUA 1VJIA 1AODA 1EYEA 4XFHA 1HRV1 1ONRA 4QEEA 1ZZ7A 5TF0A 2J88A 1W28A 1FWHC 2ZOXA 4UMCA 2WS92 4F3JA 4H1ZA 4O1CA 3C8XA 4QGMA 5ACA1 1FKXA 4MHUA 3A4WA 4UMAA 5XIMA 3SUTA 4GH3A 3R25A 3SIMA 3PLQA 4ZS3A 1JAEA 1HKIA 1UASA 2R82A 3UETA 4C5YA 2OVUA 3LDVA 4NZ3A 2WC2A 3TZNA 3RHGA 1C9WA 2V81A 3URQA 3O3RA 2DUQA 4E38A 1A4LA 1FCVA 1Y9QA 2V6AA 3WLHA 1I9RA 4J4KA 2XN1A 3H1WA 3SFWA 3RU8X 3FBMA 2ZX0A 5FZBA 3PUIA 4YJ5A 3VGFA 3CHCA 1NQJA 2E4TA 1U5IA 1W8UA 4KEZA 4GB32 3RYSA 1EIXA 3V5FA 4YW6A 3R58A 3OZYA 4DZHA 1MZ6A 4Z2KA 3S5YA 3IS4A 1RVGA 1LL4A 4LAMA 1OD8A 4IJCA 1PMJX 3H2EA 2XWBB 4XE9A 1XIDA 1SCRA 3B97A 4P7OA 2R073 4YPJA 1YIFA 4F8XA 2CWSA 3OO2A 2E40A 4PDWC 1YJLA 3ZIWA 2VVFA 2HQAA 1KFBA 1XLIA 1Q6CA 3MYOA 4DM2A 5EMLA 4GA8A 1ZPTA 1LBFA 1X97A 3TEXA 4E2VA 3AKRA 2O14A 1V77A 3OYWB 1RCQA 1YNQA 1J11A 4GABA 4C6LA 4DI8A 3VDHA 2W0UA 1FDZA 2ONEA 4X6RB 4UTWC 3VZKA 3F5KA 1NH6A 4JIEA 4V28A 3PUQA 4QB1A 2YPDA 1AR83 4EWEA 4B2DA 4DWDA 2EICA 2X1RA 2WMHA 1RUG3 2WSKA 3SFKA 5D8AB 2G96A 2RR11 3N2MA 4BI7A 5CBJA 4DQAA 1XGZA 4MOAA 2FDFA 3B9NA 1PKYA 5AYIA 2J7FA 4PN2A 1S1PA 4LB3A 4NHVA 2W67A 3RZMA 3LI1A 4CDWB 5FZEA 2QPSA 3ZX7A 1XYAA 1G69A 2WZEA 2PBOA 1PZ9A 2OSYA 2VM8A 3PB2A 3H2MA 4EPDC 5I3GA 3WDRA 2B8MA 1WLDA 1XIBA 2VFDA 5MHBA 4NHMA 3JU9A 1QK2A 1UU5A 1IE7C 3HFYA 1JDFA 4BA6A 2PLKA 1ZY9A 4BI6A 4PLNA 1FY6A 3IDCB 5GPRA 4C60A 1HQWA 4GCXA 3WG4A 3H3ZA 4QD2A 2VD9A 4TLGA 3DXUA 4AGGA 4RDWA 5M17A 3V5OA 5K4LA 4YL2A 3BH4A 1LWHA 2VWSA 2E8ZA 4MGGA 4FAMA 3OYWA 4P7LA 2YBVA 4KCTA 1POJA 1IGSA 3VIHA 4CXXA 4FOVA 3MWCA 2ACUA 4Y6GA 3VZYA 1EIBA 4H83A 3KOWA 2VQ0A 3N04A 1MW0A 4XISA 5FIPA 2YY1A 1VZWA 1W5NA 3APTA 1QY4A 2P50A 5T54A 2JDPA 2WO3A 1VP5A 4PMNA 2OT1A 5D8AA 2ISWA 1L3JA 1TPC1 4R5EA 3U3HA 1IGOA 2ISSA 3QPEA 3NNJA 2ZRWA 1A5KC 2HPIA 3SRFA 3O0FA 5I3KA 2E7TA 4AC7C 3S30A 4O0ZA 1OEPA 4O17A 1FX6A 1FAYA 1UPPA 4QSFA 4UAPA 1WW7A 4CDWA 3H54A 3DC8A 4XQWA 4XBJA 3N9RA 2VFEA 2PRMA 3ITQA 2J77A 2OZTA 4PUKA 2XQXA 1LOEA 2XLGA 3L0NA 4AEDC 4LPCA 2J8GA 7CGTA 1V0NA 1WNOA 4B92A 3DC0A 1UOFA 3JS3A 1OFRA 1Q2SA 3VNLA 3LCLA 3FVDA 2Y6ZA 3L4YA 4LEFA 3OEBA 1B0IA 3CASA 3N9MA 3AMKA 3N1AA 3TTEA 4ZQPA 4CXYA 3LSDA 2R8WA 2XIIA 2G41A 2ZX7A 4DXSA 1H2KA 1MS8A 5JQ9A 3NJ3A 5FY9A 1QXLA 4KWKA 1LULA 4DEQA 5A94A 4PCRA 1IEWA 1E9IA 2W9MA 4UR9A 4HNVA 2DSZA 3S7EA 1VAHA 4MKNA 1M7XA 2XH0A 3V0UA 5JIWA 3DGRA 3EX6A 3O14A 4PI2A 3RMEA 2DVBA 5FYTA 2B9UA 5A8MA 2J79A 5F5IA 3G1YA 4MAVA 3I10A 4ZSUA 3CLMA 2GSEA 3FYPA 3OBAA 1KR0A 1P0NA 3S6OA 1OT1A 1DYSA 1W9YA 3IUHA 4Q4W1 2OPKA 2QGYA 1W8GA 3DFPA 1JYCA 4I9MA 3ZO9A 3NV3A 3BIEA 3ZKUA 3PTQA 3GF6A 5FSDC 1ZBCA 3ZXGA 4UI9L 4IE7A 3BLFA 1VJZA 3GLCA 1GNYA 5DQPA 2QJIA 5EWSA 4AVSA 2WMJA 1J3QA 2WLYA 2RS32 2YB1A 2VE1A 2VFFA 4IXHA 3NM1A 2WWJA 2G9ZA 2EXOA 2VUJA 4B4QA 4FLOA 2FHRA 1R2RA 2JDAA 1HKDA 3GE7A 4D6DA 3HAGA 2DV0A 1BLZA 1W8WA 4GJYA 1YNAA 4COVA 1O1HA 1OLQA 3A23A 1PHQA 2NV1A 2P2KA 2C7FA 2JG8B 3Q8EA 3MP3A 4JY8A 3LTPA 4MLRA 3AM2A 1DIEA 2WHLA 3L0KA 5I0SA 4TVCA 4NXSA 4QBXA 2RJKA 4LT9A 1GWMA 2C91A 4DINB 4B5VA 2WO1A 3AZVA 4IP7A 4GQBA 1YHFA 1RA0A 4W6WA 3K48A 4FF7A 1DQXA 4JFTA 1AW1A 3EEZA 1V6YA 3OD0A 2GH8A 1R3SA 1VMFA 3MMWA 1Z41A 1YDVA 3UZ5A 1WMFA 3AP5A 1JNDA 3W86A 1D4VB 1DZQA 4LBSA 5E9AA 3WYZA 3N29A 4NZCA 1PKNA 5IJRA 3L21A 4C7GA 3HR9A 1XIHA 2WJFA 4GQ0A 3WO8A 4ZKTB 3NPVA 3L9JT 2YDRA 4XB3A 4YWAA 5FP3A 4LQRA 2H6CA 3OEXA 3UCQA 2EPKX 2RVAA 2E25A 2HNEA 3IDAA 4XBNA 4CCDA 3NSNA 1MQTC 4E4SA 3F2BA 2VXJA 4RHV1 3UR8A 2FGZA 1C5HA 1DBTA 2LUWA 4WSJA 1PHWA 5D09A 1JHNA 3LI0A 5HPOA 1CNVA 2XDFA 3L4XA 1TJRA 3MI3A 3W7IA 3WJWA 4V33A 1LAJA 2FDSA 2VR2A 3DN7A 3O0KA 2Z79A 4DO6A 2VVSA 2OX0A 2ZGTA 3J8F1 4R85A 4HZ6A 3CLWA 5A6LA 2G4JA 1T6BX 1RPKA 2JG8A 1C3HA 3GRIA 4H8NA 3S1WA 3AMLA 1X8MA 1XHGA 1EEXA 1REQB 2QCSB 2O9OA 1CGVA 2WINB 3REQB 1MUMA 3E5QA 4XBLA 4EN8B 1JBCA 2BB0A 4S3BA 2XJUA 3VIOA 3GTHA 1SBDA 2A6WA 1TME2 1X6LA 2G3MA 1CGTA 5K2ZA 2DYCA 3C56A 2JIEA 4DYKA 5FJTA 3GJAA 3UNTA 4GK8A 2V5YA 3MU7A 1XCWA 5EU9A 3DBPA 2XBO3 3HQ1A 5BYWA 3A3WA 4D7YA 2WQ4A 4RQPC 3P81A 1YLLA 4NE9A 1RBAA 3GTXA 2KXLA 1JZ4A 3AP6A 5CSUA 1UMHA 3MEPA 1GVSA 1HRI1 4C1XA 5GZCA 2DCKA 3NAVA 4K2SA 4LVFA 1Q8OA 4RNJA 1DQ4A 2EIGA 5CG8A 3A21A 3AZWA 2Q0AA 4URAA 1JU4A 1NF7A 1PIGA 5LGZA 5DCDA 1FPN2 4FR1A 3QV6A 1SR0A 4MGKE 3MCOA 4CN1A 1JDCA 1LHNA 4OHVA 3W1AA 1RGSA 4DJEA 4CVUA 3EWZA 4XXAA 2WN3A 3B3DA 2RJHA 3LG3A 1H6XA 1XYZA 1IS6A 4L9BA 1Y5VA 2YKKA 2VZSA 1UR2A 3B01A 1V6LA 2CZ5A 1XE7A 3N9PA 4D8AA 1REQA 4GFSA 3WDXA 1RUI3 4Q4RA 3EWBX 3REQA 4BF9A 1IT0A 4LHKA 3POJA 5AECA 3WP3A 3GXFA 2VC9A 3UZZA 3WL0A 1TV2A 4KFOA 5EY5A 4ENLA 2A6YA 1BSIA 1HJFA 2PWGA 1XPWA 4KQ7A 1N1YA 4XUTA 3H42B 5ENLA 4XXPA 1VENA 4MJZA 5I3HA 2VEKA 1FH9A 3VHOA 3L4TA 1GNZA 1K03A 2Z29A 1AXKA 3M6DA 1Z9AA 3BK0A 3DKLA 1RUNA 1EA0A 2ATMA 1PIV1 6ENLA 2NVDA 1ICQA 1AZDA 1LOFA 3CUJA 3GDMA 3SIZA 5DRCA 2ZZ4A 1E9ZB 1NDZA 4IV1C 2FCTA 1J6OA 4EK7A 3LGEA 1R081 2ET1A 5LIXX 2CY6A 3ZR6A 3E5BA 2E63A 1WMEA 4HK5A 4G56A 2VY0A 2PDXA 3LD5A 4UTHA 2DJLA 3GZ3A 1G94A 1UD4A 2OEMA 5BYNA 4GMP0 4PRTA 1RUF2 1FPN1 3FCPA 4I8YA 2E6AA 3TJ4A 2BG5A 2DCTA 3B06A 2PELA 4XSMA 4RR4A 3BMWA 5JH1A 4IMGA 4FR6A 4ADTA 1US2A 4LKEA 4O18A 1TMF1 3C7HA 3NV2A 4CU7A 1C7TA 1UKPA 3O9NA 1EFZA 3VE7A 5KZ6A 1XNBA 2I74A 1Q8SA 2GC2A 5A6XA 3MCNA 2TODA 3I7DA 3LBMA 2Y4SA 4NL1A 2WPGA 4FF5A 4B29A 4XD5A 2VZVA 2PFWA 3HIJA 4AIBA 3MWAA 1FOD3 1LROA 2JE7A 4GRSA 3VOGA 3NXLA 1RAKA 1FWJC 4AHYA 2D97A 4YHEA 3N9NA 3AS1A 4PBOA 1T40A 4Z2AA 3BZGA 5A7OA 4AE2A 3KOYA 4GO9A 2W61A 4BEQA 1YDYA 1GWJA 3UG5A 4KFNA 3SO7A 4F7ZA 1RHI3 2DDXA