4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
4JL1A 2ZX5A 4QFUA 3CZEA 3KEHA 4Q7NA 1E1FA 1JIBA 2V5DA 3GZAA 4JZ5A 1XH2A 3LPGA 1GQJA 3K1DA 6TAAA 3OLDA 1JZ6A 1WCUA 4AWEA 3WH6A 1VEPA 1CLXA 3AMCA 3ZYHA 3AS3A 4EKJA 5CLWA 4AEEA 1CGTA 1WZXA 4LK6A 1QHZA 3BH4A 2WZHA 4EAMA 1C93A 4UFMA 3VDAA 2VX6A 4XZWA 3W6LA 3AI0A 1QNSA 2WMFA 3WMSA 1EHNA 5FIPA 3SCNA 2EXOA 1EO7A 4P8VA 3OB8A 1R7AA 5DFAA 3GM8A 1HT6A 2J62A 3WH5A 4W85A 4W8AA 5A94A 7A3HA 1LL7A 1DHKA 3PZUA 1V6VA 1R85A 2W62A 2VRJA 4LX4A 3K8MA 2DEPA 2BY1A 1TE1A 3AMDA 4GQRA 1WPCA 1C8QA 2GDVA 5DO8A 4MB4A 2WSPA 3EDFA 1AQHA 1W32A 2E3ZA 1W91A 2ZXAA 5E6YA 3CHDA 5KZ6A 4S3JA 5CPQA 3WF3A 1FA2A 2YL8A 1J0KA 4DUWA 4IPLA 5HDRA 3WNOA 4V2XA 3G6MA 5I23A 3L4WA 3OGVA 4URIA 1UD5A 2WCSA 1MW0A 4OIFA 3O6AA 5D4YA 5C70A 1O7AA 4P7NA 4A3YA 1W9BM 3AZRA 1W9FA 1JXKA 1JI1A 1UWRA 1V0KA 1DP0A 4UFKA 3VU2A 1W1YA 2QMKA 4JHZA 4AMCA 3ZT5A 3L4ZA 3VDHA 2Y8KA 4LYPA 3W53A 4JFUA 4PTXA 2WMJA 4MB1A 1US2A 1NWTA 4HPHA 4CCCA 1FHLA 4P8WA 1B3VA 2A3AA 2QMJA 4RE4A 2E8ZA 1ZU8A 2CBJA 1ZBKA 4BQ2A 1LQ0A 4LXFA 1UUQA 4W5UA 1Y7VA 1JD7A 3CIVA 2W4XA 4MNJA 4UFLA 2F8QA 3VIJA 3OBAA 3T0BA 1KBBA 1IZJA 3VGGA 1NM9A 5A1AA 2BVTA 1JD9A 4HA3A 4E8CA 2EEXA 2QPSA 2XFRA 1KGWA 1PJ9A 1WCGA 2PB1A 1ZBVA 2VT0A 1F4HA 7TAAA 3ZYBA 1W1TA 3WIJA 2ZUMA 2WB5A 5BXRA 1W9XA 1M53A 4IM4A 1W90A 3CUIA 1OWQA 4HOXA 1S46A 4F66A 1C7TA 1I1WA 2ZE0A 1FHDA 1NOWA 5E9AA 3VGBA 4U31A 1TFVA 2DIEA 1MW3A 4ML4A 4ZFMA 4W7VA 1V6XA 4XV0A 4U2ZA 1EDQA 1B3WA 1OD0A 2XHYA 2W91A 4D1IA 1OSEA 1VFOA 2GK1B 3KL0A 5IXEA 2DSWA 3BLPX 4W89A 2OYLA 1MW1A 2TAAA 2WVTA 3SCTA 2OYKA 1E1EA 4H8HA 5I2UA 4E2OA 3SUUA 2J47A 1W3KA 1J9YA 4KGJA 4MAZA 4B15A 1SFSA 1CXLA 2X2YA 3CZ8A 1B0IA 1UR0A 3RM4A 3UEQA 3MUIA 1RD6A 3ZSSA 3WUBA 1ECEA 2YIHA 2D1ZA 5ABGA 3VO0A 1V3MA 3AIBA 1ISXA 3GTNA 1ITXA 3VIGA 3L2LA 2OYMA 1QVBA 3U57A 3AMGA 4BA0A 4D6JA 2YBTA 1W3JA 3SCOA 1UH3A 1M7XA 5FKYA 2GSJA 4V27A 1PAMA 2Q8XA 2PWFA 1QNRA 3MSDA 2J77A 3AJ7A 3CBWA 2GJXA 3CUJA 2G3JA 3SUSA 2RGMA 4CN4A 1BLIA 4OOZA 4BQ4A 5TD4A 2ZXDA 3FAWA 1MQPA 4W7WA 3ARSA 3BAYA 3VX0A 3VM5A 5I6SA 4DM2A 2CEQA 2EPOA 4JKLA 4M29A 1UA7A 3K4DA 4PMUA 1QI2A 3QOKA 4D6HA 3O9NA 1GWKA 2KR2A 3ARRA 1WNOA 2ZOXA 2G4FA 1E6RA 4F9JA 1HL8A 1H4PA 2NT0A 1E71M 3A3HA 3WD0A 1H41A 1NOUA 5BXSA 3AIEA 2J8FA 5EBAA 1FH9A 2XVGA 3WELA 1E0VA 1UD4A 3K8KA 2EO7A 3T0AA 4DWSA 4NF7A 2VURA 4GZJA 4MJ2A 1JL8A 5A2BA 5HBFA 4B9YA 1UR8A 4ZEPA 4GI9A 1BG9A 1BYDA 3AS1A 1MFUA 2AOSA 1DTUA 2VL4A 3RILA 1Q6DA 4LGXA 3TONA 3BAJA 3MMUA 2X05A 2VZVA 1EHAA 3VDBA 1E4LA 3A6OA 1TG7A 1D2KA 1VB9A 2DT1A 4R27A 4LQ1A 4AD1A 4W86A 5ECUA 1RP8A 2DT0A 4AZ7A 5A6LA 1U33A 1E4IA 3CUFA 2JF7A 2J79A 4IPNB 1GORA 5I77A 1SMDA 3NYDA 5CGTA 2YA0A 3F5LA 2J8GA 2VVNA 3DYOA 2WPGA 2D24A 1FH8A 1NWUA 5A6SA 1SMAA 3TTYA 1EDTA 1ZBWA 4WKFA 2WWDA 4QCEA 1KCLA 2W63A 3GNRA 3CMGA 4UQDA 3AHXA 5EFDA 1VEMA 2ZUVA 3F5KA 1BYAA 2WCGA 1C7SA 4C7GA 2PWGA 4ZE5A 4V28A 3BXWA 2WHMA 4YW7A 2FH6A 1DWHM 3BGAA 1JXJA 3AIRA 2Y4SA 1JNDA 1J0IA 4AEFA 1ODUA 2XGIA 1B1YA 1HP5A 4WKAA 1FFQA 1W8WA 4PMOA 5CLTA 2A3HA 3KWXA 1JYWA 5CZKA 3U7BA 1CGYA 2E9BA 3SCQA 1HL9A 3IK2A 1KQZA 1GW1A 2CNCA 4PMYA 3GBDA 4UQCA 4PCSA 5D8WA 3WD1A 2K46A 2J7HA 1WE5A 3N12A 3AHTA 3DHPA 2GFTA 2D2OA 1WB0A 2VZTA 1YQ2A 2HISA 1HIZA 1XSIA 3OLIA 2JIWA 4N0RA 5CSUA 4S3KA 3MKKA 1E6NA 2BV9A 4M80A 3EDJA 2D3NA 3AS2A 4GINA 3AMLA 3SCSA 3W81A 3WDRA 1R8LA 2HVMA 1GWLA 3VD7A 2XG9A 4PEEA 3UG3A 1OT2A 4U5KA 1E5JA 4M8UA 3BAKA 4AZHA 4A6SA 1CGUA 8CGTA 1JZ7A 1V3JA 1GCYA 4ACYA 1QHPA 4TX8A 1JFHA 1J01A 1ISWA 4MPKA 5FD0A 1UH4A 3UESA 3VGDA 1XHGA 2X1IA 1KGXA 2YBUA 5AYBA 2WVSA 1E56A 3II1A 2QV4A 4CU6A 3JUGA 2ZX7A 3N17A 1MQRA 1HKIA 1CXIA 2W66A 1G5AA 2FDMA 3TOPA 4DUXA 1X6LA 4E8DA 3MANA 4KH2A 4OZOA 3RDKA 1UG6A 1GJUA 4PRWA 4HA4A 3WDIA 3A4WA 1N82A 2E9MA 1O6IA 3OG2A 2ZX6A 3VOCA 1GNXA 4PSPA 2NW0A 1CBGA 2CHOA 2XFYA 1UD2A 1KWGA 1Q4NX 2WVVB 5LA1A 4GO9A 3UT0A 2VCAA 4U5IA 4UFHA 4JKKA 1PIFA 1OH3A 4WK9A 1CYGA 5A6AA 3PHAA 1NWSA 2Z1KA 4L4OA 3L4VA 1F4AA 3CTTA 4RL3A 3BCDA 2JF6A 1KR0A 1DWJM 5JBEA 4MNKA 1QW8A 1WZMA 3U5UA 5E0FA 1E15A 2ZXBA 3WKZA 1UKPA 3CZGA 1B9ZA 3PTQA 4J3VA 1RP9A 3ZMRA 3B9EA 4CCEA 2DSZA 1JAKA 5HPOA 1ISVA 2Y8VA 3ARXA 5A6BA 3DYMA 1UWUA 3CHCA 2J7FA 4NZCA 5FL0A 3WUGA 4B3KA 1OB0A 3WH9A 3ZM8A 5D21A 2LRPA 2IUZA 3KL3A 4CU8A 2J7GA 2PI6A 1WDRA 4L4PA 1V3IA 1E4NA 1E73M 3PZNA 1W3HA 4BZYA 1EA9C 3ALFA 3DC0A 2D0FA 2F61A 3THCA 3W6MA 5M3WA 2YLAA 4DWSD 1BYBA 5GQBA 1C90A 1NP0A 5ABEA 5EFFA 2CCRA 1E55A 2A3BA 1OCQA 4IUGA 3EDKA 3AZSA 1C8XA 1QBBA 4Z2IA 3WDQA 1E0XA 3NSNA 3IJ7A 3NSXA 1B90A 1HN1A 2CETA 3WSUA 3WH8A 2ZUWA 4TVUA 1EO5A 2DDXA 4AYSA 3WNKA 1UZ1A 1GHRA 5BCAA 4Q22A 4J3WA 1R87A 4B3LA 3SCVA 2VVSA 2VMFA 4FMVA 2EPLX 2E0PA 1UR2A 4GO8A 3MU7A 1JZ4A 5A2CA 1BVZA 1GOOA 3GXMA 3GXFA 3KZSA 1JYNA 1H09A 2OLHA 4CD4A 1QHOA 1UWIA 3OZPA 1X6NA 1QOXA 3AROA 5ABFB 2XVPA 1I75A 4N42A 3QGVA 3L4XA 1JDDA 2XUCA 4HTYA 2DH2A 3GDBA 2G3MA 3AQUA 3WEMA 3KE0A 1XGZA 3VIFA 3GYCA 1E0WA 1GVIA 2ZUSA 4HA1A 5HNNA 4CD8A 3QHOA 3RPMA 4UFJA 3ARWA 2EBNA 1EGZA 1C92A 2XTKA 1NOFA 3ZJKA 1UQYA 2VUYA 4PTWA 5A8MA 1SYTA 4UZUA 3AYSA 3CO4A 5I79A 2G8ZA 1HJVA 3CMJA 4LK7A 3CZKA 4NRSA 5LYRA 3WEZA 1VEOA 4CN6A 2W5FA 3VIIA 1VRXA 4NSBA 5IHRA 1E72M 2DT2A 1UD6A 3WQVA 3AISA 4UCFA 3WL0A 1GONA 3CHFA 2X0YA 3L2MA 4HU8A 3T2OA 4B16A 2AMGA 5ABFA 4KWUA 4QP0A 2YLLA 4TX6A 2C0HA 2NSXA 3VX1A 3ZQ9A 2V3EA 2Y24A 2CITA 3WQWA 2E8YA 4HMEA 3VNYA 4ATWA 2VC9A 2XWEA 1PIGA 1CECA 4TVCA 1E43A 2VO5A 1AQMA 4AZCA 1OIMA 4ZXOA 1W8TA 4Z2LA 1B3YA 1CENA 3AMKA 2FGZA 3POCA 4B9ZA 1MQQA 5LA2A 3SUTA 2YKKA 4BQ5A 4TTUA 4XB3A 3BCFA 1US3A 3IANA 5CGMA 4WSKA 2VJXA 1GWMA 1WDPA 3GH5A 1CXHA 4FLSA 1UKSA 4R5EA 5E6ZA 1C3FA 4H7VA 4LKEA 2YDRA 1W9VA 4JCLA 3VDCA 4TXEA 2VNCA 2FGLA 2Y2WA 1KXVA 4D6DA 3IAQA 3N15A 1L0PA 1LWJA 2CBVA 1UD3A 4LYRA 2J7CA 3LPOA 4UQBA 3ARPA 4QAWA 3VGEA 4CKQA 1BQCA 3CHEA 1ZS2A 2UY2A 2D23A 4GI6A 3LPPA 1E40A 4Z2HA 3E1F1 4ZE4A 2VI0A 3D5HA 3W82A 2YOCA 4P8UA 4AD3A 2D0GA 2WNWA 4KGLA 2DT3A 2DPEA 1OGGA 1UH2A 1A3HA 3AHYA 3ARQA 2V38A 5DF0A 1LG1A 4W5ZA 3VVGA 4W7UA 1W8UA 1VBUA 1E3XA 1ODZA 1JI2A 4U3AA 1L8NA 3UR8A 5IHSA 3PZVA 3AFBA 2UWFA 1JF6A 1IV8A 4HMDA 1J11A 2BY3A 4X9YA 2Y5EA 3A4XA 4OBRA 3WUEA 4D6FA 1WAWA 3TA9A 2XGBA 4DWSC 2W67A 2GVYA 3WF4A 5I78A 2WM0A 3QHNA 1W9DM 3WD3A 1GOKA 3LMYA 4JIEA 1Q6CA 4P7RA 7CGTA 3SCUA 3BMWA 4NI3A 4AZ6A 1J10A 3GH7A 3W25A 2WLZA 1K9TA 1BFNA 4DWSB 2ZXQA 4WKHA 4LKFA 1BAGA 3CUGA 5CQ1A 4C7FA 3J7HA 5BXTA 1MFVA 1XD1A 3AIUA 3K46A 1AMYA 1UKOA 2OSXA 1V03A 1HJUA 1QNPA 1NARA 3T08A 1UOJA 3WF0A 1NWRA 4HP5A 2V3FA 3DECA 1CDGA 3VIPA 1CLVA 4U33A 1Q6FA 3BC9A 3AHVA 4CD6A 1JZ3A 1V0AA 2EQDA 3FNDA 1Q6GA 3IJ9A 1NH6A 2DIJA 3O2LA 3RIKA 3ARTA 1WZKA 1QNOA 1VENA 2BVYA 4GQQA 1QI0A 2DSUA 2D20A 1GUVA 3NIYA 1GQKA 3VIHA 1ZB5A 3S6TA 3AOFA 1TA3A 2V3GA 3UCQA 3W4RA 1UOKA 2O9TA 2XFFA 2CERA 3WMCA 4AZIA 3CH9A 4OKDA 4W93A 2WHLA 4YN5A 2G3IA 2VCCA 4MNLA 2G41A 2VR4A 5A69A 3PN8A 2VRKA 4PYSA 4DUVA 2CIPA 1UKTA 2QHAA 3S2CA 1G1YA 1HP4A 3HJEA 4OOUA 3ORJA 4UZSA 1M04A 2VOTA 2ESCA 1VJSA 2OWWA 2XVKA 3WQ6A 1M03A 3AXIA 4P8XA 1OINA 5A6JA 3PZQA 4J27A 2QPUA 2EPMX 3K4AA 4CPBD 3N9KA 4KRTA 1V6UA 5AY7A 1E6SM 3W37A 2ZIDA 2VCBA 4QLKA 1H11A 4HOZA 2CKRA 5JIPA 2BXZA 5LA0A 3FHQA 1UR9A 2WLYA 4UOZA 3PZMA 4PSRA 4UQ9A 2VX5A 1I1XA 2JEQA 1GPFA 1B3ZA 3I3EA 3WENA 4YHGA 1RH9A 1UWQA 4M24A 2VZSA 3B8SA 1EDGA 2DSKA 4CCDA 2GUYA 4M56A 3AICA 2VQTA 3UETA 1YHTA 2DSVA 1BSIA 1UZ4A 1V02E 5DEZA 4HU0A 2UY5A 4W87A 4WLCA 3PZIA 1E4MM 3N11A 4AD0A 2BY0A 4AD4A 1WO2A 4EK7A 3I3BA 3CZJA 3EDDA 3AIQA 4F9DA 1UYQA 3EDEA 1VJZA 4BCEA 3TTSA 2BNJA 2RGLA 4C7DA 1GJWA 4HPGA 4MB3A 3AIWA 3AHZA 1UR4A 4CN1A 3WBEA 1EQCA 1K9EA 1UWSA 9CGTA 1G01A 2J78A 1MXDA 3MMDA 3OLGA 1KQYA 4WIWA 5EB8A 3OGSA 4MNMA 1V0LA 1LJYA 1KR1A 1EOMA 3ZSTA 1PZ3A 1UQZA 1TVPA 3GNPA 1JZ2A 3U7VA 2WVUA 1GQIA 2GDUA 4CP9A 1M01A 1HJWA 2VZOA 1BVNP 2ZWYA 4AZBA 3HN3A 3VUPA 3A47A 3BAXA 2FHCA 4Z2KA 3VMNA 2J74A 1HJQA 1EQPA 1WZAA 3N18A 3DHUA 4AIEA 1U2YA 4D6CA 2WYSA 4JL2A 3IAPA 4F79A 3VNZA 2CHNA 3VTRA 5FOOA 2NT1A 5D9PA 4PMXA 3ZO9A 5EMYA 3QOMA 2VTFA 1ZL1A 1A47A 4AISA 1XYZA 4FLOA 2WMHA 3HMCA 5KEZA 2WZIA 3F95A 2MANA 2VZUA 3UG4A 2O9PA 1KXTA 4PMRA 3L4UA 5M5DA 3NDZA 3EMQA 4AIOA 2YA1A 3VIKA 1V0MA 1CWYA 4PTMA 1HXJA 4MTVA 4HOWA 1LL6A 3MO4A 4OBSA 3M07A 3MS8A 4GXPA 1RPKA 2PWDA 1XCWA 1V3LA 5A3HA 3VKKA 2D0HA 2XIIA 1WMXA 5BROA 3WFLA 2AAAA 3VIMA 2CBIA 1KGUA 4JFTA 3ALGA 1GOQA 4QCFA 1CXFA 2YJQA 1G9HA 2GJPA 1ZJAA 5BXPA 1W3LA 3MSGA 1FH7A 2WC4A 1AQ0A 2F2HA 3OA5A 4D71A 2X8RA 1FOBA 2ZUNA 4WJXA 1FP9A 5CSYA 4PMDA 4XUYA 5BWFA 1CNVA 1OIFA 3GXDA 1LWHA 4JKMA 1J0JA 2PF0A 3WDJA 4QLLA 4UOQA 3TP4A 4H04A 1B3XA 4UR9A 4FLQA 2YL5A 2ZX8A 4JHOA 2BS9A 1D7FA 1W2PA 2J25A 3T0DA 4BQ3A 1GOMA 2JALA 1FFRA 3AZTA 4GI8A 3N1AA 2OSYA 2BHYA 2J7DA 1H5VA 1OBAA 4A3HA 1VFUA 1DWAM 3VD5A 1MVYA 3ZYFA 2OWCA 1CXEA 1TMQA 2WBGA 2E40A 2LROA 2VX7A 4ZXLA 4GKLA 2WVVA 1ZJBA 4YPJA 1WZLA 4AD2A 4HZ8A 1V02A 1JDCA 5JUVA 1DWIM 2IXVA 1PBGA 1E6ZA 4M81A 3MUY1 4FF5A 5BRQA 1BGGA 3ZJ6A 3WQ8A 3NDYA 1L7LA 3GXIA 1MWOA 3L4YA 1KFWA 4D1JA 1B30A 3EMCA 3ARZA 4UQEA 3SCPA 5CXPA 3OGRA 3GH4A 4TOQA 3RM8A 3AXXA 4CPBA 5JBDA 1H0IA 2E4TA 3OLEA 3THDA 1JYXA 1H3GA 3MV01 3NCOA 2WKGA 2YDSA 1E3ZA 3WUFA 2EJ1A 3NJ3A 1V6WA 5JIWA 3WD4A 4ATDA 1TUXA 1BG4A 3ZIZA 4UQAA 1W1PA 2XWDA 4FLRA 4GZEA 4AD5A 1TCMA 4P7QA 4M82A 3VGHA 3L4TA 2VXJA 3PTKA 2JIEA 3N13A 3ZR5A 1E6QM 4IISA 5JBFA 5A6MA 4UNIA 3WY1A 1W9PA 6CGTA 3FXYA 1ESWA 4AW7A 2FHFA 1W1VA 5ABHA 3VINA 3CZLA 1R86A 3CGTA 1HNYA 1XC6A 1KCKA 4M1RA 4MAVA 3W26A 3FAXA 1DWFM 1KB3A 2XJ7A 1J0ZA 4KRUA 2J7BA 3WQ4A 3SEPA 4Y7EA 4H8VA 3EYPA 2VQUA 1BYCA 1MYRA 1IZKA 1Q6EA 2QLYA 2ZUTA 3WD2A 2PWEA 3WF2A 4LYQA 2XM2A 1K9DA 3AS0A 2BY2A 5AYIA 3FN9A 4CU7A 3WNPA 2YA2A 4WSJA 1DEDA 1QI4A 2FHBA 1XH1A 3M7SA 3SCWA 4J3TA 1OKOA 1VF8A 1H1NA 1HVXA 3G6LA 1EH9A 4CUCA 2A3EA 5A6KA 1XRVA 1HKKA 1GVYA 3PZOA 3GBEA 4UFIA 5D8ZA 3OZOA 3VMPA 3M6DA 1KWKA 3ZR6A 1HN0A 3PZGA 1AVAA 4W8BA 2WHKA 2OSWA 1JNEA 5F7UA 3ARYA 5M17A 1OT1A 5C8BB 3OIHA 1GHSA 4XX6A 1PZ2A 2X09A 1V6YA 1BGAA 4JFSA 1GZJA 1V08A 1XSKA 1JYVA 1UKQA 2DH3A 1QBAA 1EIBA 3RJYA 1JZ8A 1JGIA 1XYFA 1ITCA 1PX3A 2WC3A 3W0KA 3K8LA 2JEPA 3RO8A 1UHVA 1E70M 2CPUA 1NP2A 3F5JA 3SUVA 4LJHA 4HZ7A 4QDMA 4YHEA 3I3DA 2XSBA 1CGWA 4YWAA 4OJYA 2YDQA 3QHMA 4GZIA 5BYWA 3W38A 3IJ8A 3SUWA 1ISZA 2Z1SA 2IXUA 1WDSA 4ACZA 1QW9A 2WBKA 3MMWA 1EXPA 4H8UA 1C91A 3RCNA 4W8LA 1BF2A 3B9AA 3PBGA 4MJ4A 3WBAA 1BPLB 2XVNA 4AZGA 1XV8A 1H49A 3CLWA 3MUZ1 1FP8A 2J4GA 5I3DA 5FL1A 4F8XA 4A4AA 2JWPA 1WKYA 1PX8A 1VFMA 3WH7A 2XVLA 3WNLA 1U30A 1J18A 5A8NA 1JDAA 3WF1A 1VAHA 4D6EA 1HF6A 2PBGA 3U5YA 3MUAA 3W28A 3WDHA 3QR3A 1QPKA 1CIUA 4D72A 2C8NA 1J0HA 1E6PA 1LG2A 2YL9A 1UR1A 3VD4A 1KXQA 5D9OA 3W24A 1C8YA 3BAWA 2WZEA 1Z32X 5HOSA 3LPFA 4E4PA 4ZENA 2CBUA 4ACZB 3VPLA 1G0CA 1V0NA 4MDPA 2VX4A 2EPKX 2W61A 3RJXA 5IFPA 2WC7A 3ARUA 1JAEA 1GQLA 5CG0A 2WANA 4AC1X 1DWGM 4WF7A 1OGBA 3BSGA 1PPIA 2O14A 2BVDA 1EOKA 4RE3A 3APGA 3ZJ7A 4NRRA 5A8QA 1X1NA 4MDOA 3VD9A 1TZ7A 1QNQA 3SCRA 1V3KA 1PEZA 4D6GA 5D9NA 2XM1A 3POHA 3RMEA 3UG5A 3WFZA 1E9LA 4XZBA 2DQXA 1CTNA 4X0VA 5D9MA 1P6WA 4AZ5A 4BS0A 1K9FA 3WN6A 1ISYA 4JCMA 1TA3B 1D3CA 2D22A 1CZ1A 4PMNA 4D6IA 4MB5A 5DMYA 4U2YA 3FW6A 1JZ5A 2XYLA 1MXGA 3WNNA 5DT7A 1W8ZA 4TVDA 5HXMA 3EMZA 4MADA 3UERA 1K6AA 1R7OA 1B2YA 2ZUUA 4PMVA 1ZBCA 3W29A 2VR5A 4ATLA 3WMBA 3ZT7A 3ZT6A 1E6XM 1HKMA 2J7EA 2WYFA 1GOIA 2D3LA 2A3CA 2WHJA 5A8PA 2ZICA 3AIVA 5I0DA 1HJXA 2BHUA 5GPRA 3VGFA 2WAGA 5IDIA 1VBRA 2WMGA 4YW6A 3ZOAA 3CUHA 3BLKA 4JFWA 2WWCA 1B31A 1H2JA 2WCAA 1KBKA 3WNMA 2O9OA 1W2VA 4AZCB 3VILA 3B9DA 1HX0A 4LKDA 1SR0A 4LPCA 3RM9A 3D3AA 3PZTA 1BHGA 1UD8A 3W27A 4JFVA 5AC5A 3MV11 2GJXB 1PX4A 1W9UA 5A6BD 3AXHA 2PC8A 1GOWA 3EBVA 1J0YA 1MW2A 1XSJA 4AIUA 4HMCA 3ARVA 1J12A 5E09A 1XD0A 3KL5A 1H0GA 1KXHA 3BSHA 4QLJA 4GPNA 2WK2A 2BFGA 4H2CA 1VFFA 2V3DA 5E0CA 4UTFA 3FHAA 2XPKA 3T2QA 1UA3A 4H41A 4TUFA 5CPTA 1WP6A 3BAIA 6A3HA 1HKJA 2C24A 1OM0A 4CGTA 2EPNA 2XIBA 4PMZA 1OGSA 4CD5A 1TR1A 4U3CA 3WQ5A 2BHZA 2Q1FA 4K68A 3PZ9A 4HZ6A 3VM7A 4UOJA 1CGVA 2WXDM 8A3HA 3VIOA 5A95A 4OUEA 4AXNA 3N04A 4Z2JA 4KMQA 4PBGA 5BRPA 1QI3A 4X0NA 3BMVA 4J7RA 3UR7A 4BF7A 5C71A 4PUDA 3T09A 2X0HA 3F4VA 1LF1A 1XCXA 5IFTA 2GJRA 4J3UA 4CVWA 2PWHA 2ZX9A 4W88A 1E5NA 2FH8A 3T2PA 2GK1A 5GNZA 1V3HA 3FY1A 1IT0A 5A8OA 5CPSA 3WDPP 5AC4A 4P7OA 2UY3A 2B31A 4PCTA 1TVNA 2BXYA 2CKSA 2UY4A 4TTGA 3AYRA 4CD7A 4PTVA 3M46A 1JG9A 2VRQA 2ZWZA 3SIMA 4W84A 3NSMA 2J75A 1NQ6A 1XH0A 3WEOA 3VD3A 2WW5A 2QF8A 3A4AA 4PUEA 4JAWA 2O92A 3NUKA 3ZJ8A 2CXGA 2WSKA 5DT5A 2OWXA 5CJ5A 2W92A 3PTMA 4FK9A 2CESA 4J3SA 4PN2A 2XSAA 2YL6A 3WL1A 1G94A 5M03A 1CXKA 2V5CA 1UWTA 4DM1A 2DGAA 2O9RA 4EANA 3TTQA 2G3NA 5I24A 1JFXA 4J3XA 1HJSA 1QI5A 2C7FA 4EE9A 5E70A 5I5RA 4CVUA 4J28A 1HVQA 1BTCA 3HU7A 2JE8A 5GNXA 4P7LA 1JF5A 3CPUA 2WMIB 4RE2A 4AY1A 4AL9A 5FCZA 2E9LA 1CEOA 4PMQA 3SURA 5HPCA 3DYPA 2WMKA 2PBOA 4GIAA 1LL4A 1OD8A 1VIWA 1CGXA 2JFEX 3TTOA 5GNYA 2WMIA 4Z2GA 1WDQA 5A2AA 2WKLA 1LLOA 3GNOA 1CPUA 2CYGA 4CP9B 3ECQA 3VMOA
chains in the Genus database with same CATH superfamily
3MDPA 2ZX5A 3HBZA 3KEHA 3IPVA 4Q7NA 4RZ4A 2V5DA 4JZ5A 4D6QA 1OA2A 3NAPC 3AL6A 1W5OA 5KHKA 3MIDA 3LPGA 3CO2A 3BIEA 3AXDA 3WLLA 2JBMA 3BV7A 3J8F3 2HE8A 4Y9AA 1VEPA 1M5WA 2VOMA 3GVGA 3GTFA 1WOAA 3ZYHA 1IQAA 4C6MA 5EYXA 5T5OA 5EY5A 5LGXA 4O61A 5CLWA 4AEEA 1RVF1 2EICA 3W1RA 1WZXA 1Z41A 5I0SA 4DZIA 1BBT2 4O1CA 3BH4A 3T40A 2WZHA 1ULPA 5G05L 1C93A 2VX6A 2DUOA 1I0DA 2NQJA 4JRAA 1QNSA 3FVMA 4O0ZA 4QXIA 2FMOA 4P8VA 5DFAA 3P74A 4POCA 2R7EB 4IUOA 5FP4A 3CB8A 1HT6A 1CAXA 2J62A 4W85A 3H55A 4UT5A 4IP5A 5FF2A 4LV9A 2OW4A 3PZUA 3B40A 1XLKA 4E2GA 3DPRB 1DZTA 4Q4V1 1OVSA 4BIFA 3D5OA 3L2HA 4IE7A 4Y1YA 3VKFC 4MIMA 1D8CA 4WXYA 5KETA 1EGMA 5AZ1A 1WPCA 3T07A 6ALDA 5FBJA 4WQ6A 4KH9A 3HA1A 4MB4A 1GYNA 4YZ1A 1TVGA 5IVFA 2OEKA 3PIJA 3Q8AA 4M5PA 1YXDA 2JD9A 1QWKA 4OWGA 3UZJA 3D3FA 1YFYA 1T6BX 4FPLA 1GP6A 4L97A 1AZ1A 1W04A 1W91A 1RUH2 5E6YA 4IT1A 1VBA2 1YC61 3CHDA 2PDBA 3AKPA 2QQ6A 5CPQA 3WF3A 3FL7A 2RJKA 1TWZA 5CKMA 3UYJA 4DUWA 1BWKA 3G6MA 1US0A 3IVUA 5J04A 4G8TA 1MW0A 4OIFA 3E5BA 2AYHA 3O6AA 1K5MA 4ZOBA 3SN0A 3QEZA 4YWIA 3T78A 5FO7B 1JXKA 1WBFA 3LENA 1RUH1 3POIA 2PDXA 1ONEA 2YXSA 3GUGA 1RUG2 3RMYA 2ARXA 2PDJA 1W1YA 3SY5A 2WNVB 3ZT5A 3MI2A 2Q5TA 3CF6E 3L4ZA 1M7OA 1Q65A 5H9SA 3WSOA 4LF2A 4NXKA 4IETA 1AXYA 2HWD1 3TC7A 5J98B 4H55A 1EZWA 4YXGA 4HHMA 4PTXA 3AMQA 3FEQA 3BLLA 1P0KA 4HPHA 1C9WA 1SFNA 3MHUA 5BOFA 1GOFA 4CCCA 4QR6A 1XNTA 1S5TA 1DTNA 2YB4A 4EWND 1X1ZA 2CW6A 4C6BA 1RVGA 4ASKA 4KEVA 3RS6A 3NV3A 1AR83 1CIYA 5A7PA 5C4WA 2CBJA 4Y1ZA 2WJDA 4BQ2A 1U5ZA 3G0UA 5A32A 4RPQA 3R58A 3UJRA 1YDVA 1E57A 2W4XA 1WUFA 2Z2BA 3V64A 5GLZA 3WJXA 4RE0A 3SJ3A 4UFLA 1VD6A 3VIJA 3R05A 5I07A 5FLHA 1WMFA 4EYUA 3QPYA 3SN4A 3OQEA 4ZA0A 2G37A 1X98A 1IZJA 4IMEA 3VGGA 5JQ9A 4KESA 4ERIA 4OHVA 2FDSA 2XBO3 1ZBVA 2VT0A 3DHFA 4OQVA 5C5YA 1RVF2 3ZYBA 3SRFA 3WIJA 2ZAHA 4Q4W2 3BZGA 2J6XA 1R1A3 3GE7A 2RS31 1FTXA 1I6NA 1OWQA 4M7SA 3E49A 3S1UA 4QDPA 1B09A 1FHDA 5CFCB 3U10A 1UY3A 3WJYA 4OU1A 2BMBA 3GGLA 3KM8A 1A4MA 2RDWA 2PDWA 4OHXA 3RZLA 4BISA 1GNYA 1WV2A 5C6MA 1KFLA 4ZFMA 4W7VA 4KCTA 1V6XA 4DO0A 4OI1A 5GALA 1PZ8A 1HW6A 2PU1A 1H4GA 3F2BA 1PDYA 2PAKA 3BB6A 3QN3A 3MLJA 4CE8A 2GK1B 1OPMA 2VC5A 4UXDA 5IXEA 5T3NA 4QJ1A 3BLPX 1TNFA 4W89A 3DG7A 1AX2A 2OYKA 1BXCA 1QPRA 3MHFA 2JB8A 2J47A 1W3KA 4B15A 4PL2A 1B0IA 4RV8A 3W2NA 4M3CF 3NPWA 5AC93 3RLGA 1UF2C 2BGSA 1PGSA 2ANUA 5JVVA 2YIHA 3ABQA 4GQ7A 2PCQA 1IEIA 3W88A 1V3MA 4N43C 2C0ZA 1YEYA 3L2LA 3VIGA 3TJXA 1HO4A 2V68A 1FT9A 3H70A 3AC0A 5BNNB 3SCOA 4O50A 3RMJA 1M7XA 1F8IA 1REQB 3EBRA 3JR2A 3VZOA 1TZZA 4U4MA 3J9SA 3WW3A 4BZ4A 3PU8A 2J77A 1NAL1 3IVTA 1VBE1 4DJFD 4YU1A 1W6NB 4QB6A 3M41A 4QROA 5EJ1B 4MJZA 4RL7A 4CN4A 1ICSA 3CT7A 1TJRA 5E1RA 1A6CA 3FAWA 4FALA 1MQPA 1GOHA 4DNMA 5I6SA 2VBBA 2ZFAA 2RR12 4QDSA 4GMP0 1NDWA 4LTSA 2QCNA 4JKLA 2HWC2 4XIMA 2N7GA 1MEC1 3QOKA 1ND2C 4IESA 3B02A 1NZIA 2P88A 4F9JA 2DBIA 2RDQA 3K2GA 1H4PA 4Q4X2 4MO3M 4OUSA 2PDQA 1OFSA 3N9QA 4MOAA 2GGJA 3O6DA 3WELA 5CNAA 4IFRA 4RNHA 1UD4A 2NV9A 1POV3 1A8MA 3S5AA 3T0AA 2EO7A 2ARCA 2QZRA 4MJ2A 2WR9A 2I5IA 1JL8A 4FNRA 4E8GA 3SGZA 3CV6A 4GVHA 3THUA 4B9YA 2W68A 4DPNA 3M0LA 3R89A 2PDHA 4E5TA 1BYDA 3G24A 1MFUA 2VL4A 3BUVA 3C8FA 4Z07A 1JXNA 1N1TA 1Q6DA 2L9LA 3WQOA 1NFBA 3BAJA 2VZVA 1EHAA 3TW7A 1E4LA 3W1UA 2IVIB 4JYFA 3IUDA 1D2KA 1KTCA 1DDLA 2ZZQA 5GKAC 2ZZJA 3LOIA 1PWLA 2P4EA 3MTWA 2QUUA 5A6LA 1E4IA 1R1ZA 4PJYA 4MWAC 3VOGA 4DJDD 1JS9A 1THFD 1BXBA 1J3RA 4XZNX 1NIUA 1TIWA 2J8GA 4Z0JA 2VVNA 5LK7B 4UAPA 3CL6A 1AD4A 2WPGA 4IHCA 2O4MA 2D24A 4DYEA 1WX0A 2HWF1 1R9ZA 1FH8A 5D02A 3MUCA 2JX9A 1YHFA 4P5YA 4AQ2A 5D2AA 1EDTA 4B5TA 1X36A 2YX0A 3GNRA 4IZGA 2VH9A 1SPQA 3AHXA 3NO5A 2R9RA 4YS1A 3DUIA 3F5KA 4GH1A 2A71A 4K1GA 4M51A 1O94A 2J1UA 2XUEA 3EWUA 1C7SA 1RUI3 1S5WA 2PWGA 2OGJA 4US6A 4V28A 5HR7A 1YIPA 3MPGA 4Q0SA 3QC3A 1KBLA 2XKOA 4J25A 4DY3A 1EB3A 3PUHA 2PHRA 1RL3A 3BGAA 1VS1A 3EWWA 3TDFA 4KG8A 1BVP1 1JNDA 1J0IA 4BK9A 1X39A 2RMU3 4IMAA 3OYXA 1TV8A 4BR1A 1HP5A 5CJMA 3GBWA 3HV9A 3SH3A 1FFQA 3B0XA 4LIVA 3ITVA 4PMOA 3MIGA 2A3HA 2R062 4JQ4A 2VEPA 5TF0A 4NXSA 5CZKA 1UJPA 4QDWA 3U7BA 2J6VA 2VMGA 4ASLA 4RZBA 1KBJA 5KHIA 4I9AA 1VZWA 2BP6A 4FOQA 5F5QA 4UBHA 5J36A 2WV8A 4ORIA 4HCDA 1TRIA 2JG9A 2K46A 3PPFA 3W7NA 2XG3A 1RB8G 3WLQA 1S0DA 4DY5A 3NQFA 4AI0A 4XDPA 1OCJA 2HISA 5AYZA 1W05A 3V3WA 2C3ZA 4O28A 3QOPA 3MIHA 2D6NA 2EF6A 4OI0A 2NX3A 3MKKA 1E6NA 4JY8A 3BW3A 2BV9A 2XSXA 3AJZA 4PFMA 3RX4A 1HXS1 4CCKA 4QEHA 4L6DA 4EN9B 3AS2A 4GINA 3BOXA 3WDRA 1OEPA 3KX6A 4COZA 5FPUA 4A29A 1RQBA 4MG4A 3BI3A 4GZ7A 3LFMA 2QUOA 2ZX0A 2QGHA 3FKRA 1RUI1 3RZMA 3FBYA 3QYQA 3L0KA 4EN0A 3JVAA 3RPDA 3IPWA 8CGTA 3LKJA 2OJPA 1QJY2 3WUDA 5F2MA 1JFHA 2W3JA 2O55A 4FPOB 5AYXA 1XL9A 3HOBA 3ZVHB 1LU1A 3UESA 1E5HA 2X1IA 4IEXA 2WVSA 5HNUA 3GG8A 5AVAA 2HK1A 3JUGA 2ZX7A 3LK6A 4I6VA 1HKIA 1CXIA 3AMNA 3PLQA 4CXWA 1M06G 5DELA 3AMHA 4GUHA 3MANA 4KH2A 3OPWA 5I3GA 2ACQA 4PRWA 3P6BA 3CYJA 3K1GA 1U5JA 3HG4A 2B9UA 5D8AB 1ENSA 2RS11 2E9MA 3VYLA 2AREA 1JPHA 1A5OC 1EWDA 4DZHA 4PSPA 4UF0B 2NW0A 4YG0A 2XDFA 4XMIA 1HQLA 3MJMA 4BHYA 3DI0A 4PB3A 4PUJA 3C7HA 1EV11 3U2EA 3FDGA 2DJXA 3Q2DA 3W7MA 2X1TA 1LEDA 5AVNA 4S3GA 3WQDA 2VCAA 4U5IA 5C2CA 3NNFA 1TV7A 4NZJA 4Z42C 3O6CA 1OX5A 4WRHA 1VCFA 5A6AA 1L7RA 1PM7A 1E9ZB 4M7TA 3OCPA 2RJLA 4NJGA 2Z1KA 1AL8A 1UOBA 3S5NA 2PHWA 5JPNB 4RL3A 3W7EA 2Y70A 3BCDA 2JF6A 3TXZA 2ADEA 1A5LC 4M4PA 1KR0A 5FF4A 2ADAA 1I4NA 4MNKA 4AMAA 2ZABA 1JCYA 4C8DA 1S1PA 4OBTA 4MHBA 2J1TA 3WQBA 3U5UA 4I9MA 3G77A 2G9ZA 5E0FA 1E15A 4QDQA 3GAKA 1K42A 4AHZA 2X1SA 3VB9A 4XUNA 4GWJA 1RP9A 3KRUA 3B9EA 4FPYA 4E2QA 2DSZA 4L92A 1PL9A 5HPOA 1JPDX 4PMJA 1ISVA 4YVVA 1FWIC 4D6RA 2J7FA 4HSNA 1DHKB 4ATFA 2D5FA 5U4NA 1IS3A 4NZCA 3DV8A 3WUGA 1OB0A 3FLTA 4GXLA 4AIBA 4XBSA 4P08A 3FFZA 4AAPA 2IUZA 4LLOA 3B3DA 3DENA 3IV3A 1S5MA 3OODA 4L4PA 5JMOA 3ZZ1A 2PFWA 2PELA 4OZXA 1Q8PA 4BZYA 4JXCA 3KQRA 3IJIA 2QJMA 1GTEA 1RINA 2VELA 3MFCA 2Y7DA 3BMXA 1SZFA 3ZKYA 2EKGA 5M3WA 2PTYA 4DWSD 4RS5A 2QDRA 1BKHA 1LZOA 1CD3G 5A70A 1NP0A 4YCOA 5EFFA 2CCRA 2A3BA 1OCQA 1LGBA 4NIIA 2DCTA 3IJ6A 3WSUA 5AYYA 4EPBC 1K8YA 3KBVA 1B54A 4NHMA 2ZZ2A 4TVUA 3BJSA 2Y7GA 3HMYA 3WNKA 4LUSB 5BCAA 1A5KC 1A0DA 1MXSA 4Q22A 1K7XA 4B3LA 1ND3B 3RRDA 2VVSA 2QQUA 2IKHA 2VMFA 3KGLA 4AQ6A 4FMVA 4HT3A 1MS3A 2EPLX 3B4YA 4LFYA 4IFKB 2FQPA 3CAWA 4FF7A 3FBMA 2E68A 1I5PA 2WSVA 3KMHA 3P61A 3GXMA 5C7VA 1ECQA 1JYNA 3DL3A 3PUIA 4FSJA 2OLHA 3DFYA 3G5EA 4CD4A 1MZ6A 1QHOA 3PUSA 3OZPA 3QFWA 3W5NA 1QOXA 3OVRA 3TH6A 2XVPA 3I2KA 1ULCA 3T1GA 1FPN1 2V2DA 3KT4A 1XIMA 2INFA 3GG1A 3KE0A 3GJBA 5IJRA 1XGZA 3VNIA 4UMCA 3WDVA 4HA1A 4O14A 4PBEA 4CD8A 4L6HA 3QHOA 4QKBA 1D0GA 1FXZA 3ZKUA 3AMPA 3OVQA 3T4VA 4UFJA 4M3CE 2EBNA 4MF4A 1WXJA 2C16A 5EPDA 1DGRN 4KU7A 1G9FA 4PTWA 5A8MA 4XEZA 1LRNA 1S1AA 3VBFA 4AF0B 2QE3A 3PDQA 4A2UA 4PB5A 1K3UA 4TX9A 2ZA1A 1F2JA 3CXOA 3C3VA 4JTNA 3P67A 4XXAA 4AF9A 2VNRA 3HQ1A 3KHBA 2QEZA 4B4HA 2W5FA 4M0XA 4FPFA 2D2GA 1E72M 3CEWA 2PURA 2WNQA 4FIQA 1WXZA 2RDXA 4BA6A 4PIYA 2P8CA 4YW5A 3BVJA 5CCZA 4RZ5A 1PO9A 2H6BA 1VP6A 1CPNA 2ABBA 3RFRA 4QBXA 4MXVA 2POTA 4R85A 2HJIA 2RE9A 4GABA 5ABFA 3AJXA 5FK8A 2Q09A 4KWUA 2PMQA 4QP0A 1DZRA 4EP8C 4A44A 2NSXA 4PUMA 2B42B 1TX0A 3BU0A 4XAZA 3AWNA 1IIGA 2XH4A 3B01A 2YC0A 3JQXA 3BCJA 5KITA 1WBJA 1Q8SA 1SQ7A 2PSNA 3KCOA 2VM8A 4HSLA 3TZNA 2VC9A 2XWEA 5D1IA 3S5YA 3TC6A 5IBXA 4L1XA 4D6SA 4TVCA 1F8MA 4AZCA 1AR82 2NQ9A 1RUD3 4XIKA 1SDDB 1W8TA 2ZHMA 3WP4A 2R94A 1F35A 3UY7A 1ULOA 1BQGA 1PZ7A 3KRSA 3KLKA 3SUTA 2YKKA 4BQ5A 4TTUA 1R38A 1ZUAX 3TCEA 5CYYA 3IANA 1NA1B 3NQHA 2FDFA 3GXTA 3ZYGA 4R5EA 3F2CA 1C3FA 3B9NA 2SLIA 1HRV3 1D7PM 3WBXA 3KBSA 1JDFA 1EAH1 3VDCA 3WJZA 2FPVA 1IEQA 2A6VA 2FGLA 1LHUA 2DZTA 3N15A 3FYYA 1R1A2 3HN1A 1LWJA 2GP3A 3H2NA 4LYRA 5KZMA 3ARPA 1I9RA 1XUZA 1A78A 3BANA 4JTSA 2WJSA 1BQCA 1TME2 3CHEA 4XJAA 1ZS2A 3MWAA 5A5WA 2UY2A 1EP3A 2UY8A 3OPZA 4GI6A 5G1TA 5DBUA 1ASJ1 3UJSA 2NVCA 3LERA 1E40A 1YCIA 2C9AA 1NLQA 2NQYA 2QZ3A 1OFQA 3KZ4C 3E1F1 5DXXA 4Y9MA 5FKBA 2VI0A 3UKTA 3W82A 4NZ4A 1W3VA 2PTDA 5DN2A 4AD3A 4FX6M 2Q8ZA 3RX3A 5K9CA 4CDWA 4AX6A 2DT3A 1LODA 2UYAA 3OF1A 4Q4X1 4QX7A 3KT7A 1OGGA 1AR72 1UP0A 1A53A 2DPEA 3AHYA 5FZHA 4FB7A 2EIEA 2V38A 5A3WA 4V1XA 2QCMA 5A32B 3FIGA 1GLHA 4XQWA 1GVFA 2VEFA 1ODZA 1ASJ2 5IHSA 1KKRA 4OHQA 5JPMB 2VFGA 3PZVA 2A3XA 3AFBA 3TYBA 5I03A 2ACSA 3U2CA 3G1YA 2BY3A 4IL2A 1SO4A 4BIOA 4OBRA 3WUEA 5H6HA 3TA9A 3DAQA 2G5WA 2XJPA 4CDUC 3WK2A 2W67A 3DXTA 3WF4A 3LHVA 1EY2A 4HKOA 4QB2A 1XLIA 1W9DM 3I3MA 3LMYA 2ENRA 1PYMA 4JIEA 7CGTA 1WA4A 3QLDA 1KFEA 3BMWA 3H26A 3VV1A 1J10A 4BE3A 4RNIA 4QG9A 3KW3A 1K9TA 5AFBA 2DU2A 1BFNA 4DWSB 2ZXQA 3CUGA 2HLEA 4CUGA 5JDBA 3IK4A 3J4UH 2FZ8A 4FO9A 2X5IB 5M2FX 3SQOA 1MFVA 3PJTA 3TC3A 1EUTA 3S9IA 1DIOA 1Q8QA 1TIMA 1UKOA 1HJUA 1OFOA 3IIVA 1NARA 1A3XA 1UOJA 4FTEA 1B57A 5IT6A 1NWRA 4XO7A 4HP5A 4Q7IA 2VOWA 1BTMA 1HX6A 2OG9A 2V3FA 3DECA 4FFHA 4WVVA 1PCKA 4XVHA 1CLVA 4Y5TA 3CAVA 4IMCA 4OV4A 3WX7A 4CD6A 1JZ3A 4NIDA 2X0SA 4BEUA 2FLIA 4XBLA 1QAPA 4FAMA 2UWAA 1BJQA 3IJ9A 1EYBA 2DIJA 4FVVA 3O2LA 3HJZA 1WZKA 1QNOA 1OLQA 4FNQA 2ZZ5A 1RMU1 2BVYA 3M2MA 3NNGA 1XBZA 2DJLA 1GUVA 2GLKA 5LASA 4PT6A 2REQA 2I2SA 3B93A 3SZ8A 4AGGA 2JDNA 4UXAA 3BUCA 2NLYA 3W4RA 5L9FA 1MI3A 2XLFA 4MZUA 2CERA 2XFFA 1ML1A 4W93A 2WHLA 1YX1A 3N9MA 2C9KA 4L9ZA 1QUMA 2G3IA 2D6KA 4ECLA 3UVIA 3ZX7A 4F7ZA 1TYGA 2YBVA 1QO5A 2G41A 1OC5A 2QQNA 3TR9A 1H7OA 3PN8A 2VRKA 1MEC2 4U2AA 2QQJA 2CWNA 3O6YX 3T7VA 4JTFA 3S2CA 1G1YA 1HP4A 4LUKA 3ORJA 4JTIA 4XFGA 1K45A 1ZBE1 3ZPOA 2ESCA 1WMDA 4EXBA 4B29A 1YE4A 2HBVA 2NLIA 3VFCA 3WQ6A 4MKSA 4LALA 5FP7A 4COWA 1IEWA 3PZQA 3W74A 1MVEA 1H8VA 1OUSA 2QAPA 3TYAA 5LKYA 4KIRA 7REQA 1SQ4A 1HB2A 1V6UA 4MFEA 2VNGA 4A6GA 1SFTA 2XJVA 1H4HA 1VBGA 4QLKA 2EIGA 2AQWA 4HQVA 1AHSA 5E8AA 4HOZA 3QZAA 3NM3A 5LA0A 4KGGA 1RUC1 2VX5A 1I1XA 2P8BA 4OMCA 1GPFA 3EKZA 2PP3A 3FC0A 1AR63 2D3PA 3CM4A 4M24A 2GAUA 1I0BA 4JX6A 3O1MA 4PUUA 2V67A 3AZZA 3I4IA 2BPA2 4D8LA 1V9U3 1UROA 2VPVA 2VQTA 3DEMA 3PNAA 4QPIC 3GQYA 1FWWA 3M4HA 4S2FA 4JX4A 4CQDA 4PUNA 2ZGOA 4HU0A 1W2NA 2Y88A 2Y64A 1E4MM 4GVGA 4H8NA 2XN0A 2WJFA 2QCDB 5DRCA 1OX6A 1WO2A 3I3BA 4E4ZA 4N6FA 3S1XA 4F9DA 1UYQA 2FIQA 3TTSA 2RGLA 4YG3A 2O7QA 1Y3TA 1VP5A 4V2VA 3QVQA 4MB3A 1VAVA 5I8TA 1UWSA 3Q8FA 1G01A 3MMDA 1KRBC 1P6CA 4WIWA 5EB8A 3M5ZA 3LFIA 4OT7A 1V0LA 1EV12 3I54A 4LY8A 1Y5VA 1PZ3A 4QQ3A 1OQDA 3GNPA 3MGUA 3U7VA 4B7KA 2FTPA 4PI0A 1GQIA 3VBOC 4CP9A 3QPZA 3GHRA 1U83A 4LUTB 1QIQA 2VZOA 3KGZA 1QT1A 1X7NA 4XJ8A 3WT3A 3VUPA 3BAXA 3J7MA 1RVKA 4FEZA 2J74A 1HJQA 2Q8DA 4ROQA 4OQ8A 3ZXLA 5KZDA 1XI3A 2XISA 4A7KA 3TNOA 3FA3A 2TNFA 4BMBA 1R2RA 4O53A 1NFGA 3VHRA 2RV9A 4LBQD 1W5QA 3IAPA 3SH5A 4MOZA 2WFF3 1FYUA 3G2GA 3NDOA 3H2FA 2VDGA 5BXXA 1IKQA 2IC1A 2WJZA 4OV9A 3DBNA 3TTEA 3ZO9A 3G1VA 5DY2A 5EMYA 2VTFA 4UTLA 3NVCA 1P6BA 4AISA 2BQPA 3M43A 4Q4OA 1H9PA 3CJIC 3HMCA 1BWLA 4I0WB 2FHRA 5KEZA 1MS8A 1WKFA 4HCLA 3UG4A 4PMRA 1GKBA 3BW4A 3BWWA 3HQOA 3NDZA 3EMQA 4GY0A 3TROA 1F3EA 4AIOA 3R4UA 4J3ZA 1CAWA 1O95A 3HFYA 4WVWA 3EGJA 4D2JA 3WJWA 1D2SA 3PC0A 3K13A 3N14A 4XVDA 4TLGA 4YW2A 1HXJA 4COYA 1PZ9A 2O7SA 1DZQA 3W07A 3RK8A 6REQB 3HD8B 3E2RA 2WUHA 4CCMA 3M07A 5DAXA 4NG3A 3DF0A 1NX9A 3R8HA 1WWYA 2A4AA 4BMEA 1RPKA 2PWDA 2QKDA 5BWAA 4Y9OA 3VKMA 4XVEA 3VKKA 3BU7A 2YFZA 5FYBA 2TSYA 3EJKA 3ZFFC 2V5BA 1GP4A 1LKNA 1KKOA 2ALDA 4DXKA 4M6PA 1HLCA 1KCXA 5FSEC 1IEVA 1XNCA 4JFTA 3ALGA 4P61A 4MLOA 1GOQA 2ZADA 4QCFA 2YJQA 1OFAA 4XK2A 4XABA 1QGLA 1W3LA 4FFFA 1MRAA 3JBG1 1UU6A 4AOCA 2WC4A 4MFDA 3F1QA 4UTHA 1MEIA 2F2HA 2WFF1 1FOBA 4Q33A 2YPIA 5FJJA 3VGIA 2FB2A 3I2OA 4RFRB 4R4ZA 4YSFA 3DCPA 2KX9A 1LWHA 3VBRC 1J0JA 3WDJA 3N7KA 4QLLA 4UOQA 3TP4A 1PNGA 3UBPC 1PVC3 1W9WA 1PVNA 2W3ZA 4LKSA 3N2TA 3FA4A 3TU9A 2QXWA 4QTGA 2J25A 3GVQA 2WL1A 4BQ3A 3BARA 3EWYA 2VEKA 3HPFA 3AZTA 1WKEA 3CNAA 3MC5A 1O4UA 4LH8A 4YFZA 4HPJA 1H0BA 1DQUA 1OBAA 2Y85A 1OFDA 2J24A 5HAOA 1T2XA 3VFLA 2ADDA 2QUVA 5C8CC 3GZ3A 2OWCA 4N6EA 1K77A 4ZOAA 4BEQA 1DQ2A 4LOTA 1LB2A 2REQB 3NKGA 3ITTA 1LOEA 1DLCA 4YPJA 1SM9A 3QXBA 4LHNA 4AI2A 1CAUB 1SMVA 4HZ8A 4JGZC 1V02A 2C13A 1Q43A 4KWKA 2X5IA 1FOD1 3OY8B 3ABRA 3MUY1 5CFCA 3BLEA 5CBLA 2PEVA 3B8UA 3WLRA 1UX7A 1BGGA 3O14A 3WQ8A 3UZXA 1MWOA 2Y5JA 4D1JA 1FMD2 1PK6B 2Q0AA 2XQRA 3EMCA 5CXPA 3GH4A 1VPYA 5IM51 1YJKA 3JCIA 3LSBA 1OX4A 3VI2A 1P1MA 2ETEA 5EZWA 1X50A 1H1YA 4EOUA 4ZPIA 3THDA 1IEXA 4I5RA 1H3GA 2HRWA 3NCOA 3LN3A 1EX1A 5A3NA 1I1EA 2G9GA 2WDBA 1K12A 1OVPA 3AKRA 3NJ3A 1V6WA 3WD4A 2JDAA 1NZCA 1BG4A 1EC7A 3C56A 4UQAA 2ISVA 3H3ZA 1CN1A 4KPLA 2BBAA 2BRTA 1CJDA 3EX6A 4FLRA 3CL7A 3RNDA 1LTDA 1ZZ7A 4YARA 3REQA 2YYOA 4P7QA 3AVSA 2INEA 3VGHA 3P5YA 2C6QA 1JBCA 1YLLA 1LHVA 2HTMA 3W2MA 3P0XA 3L4TA 3PTKA 2ZDRA 4O12A 2A6NA 5CG9A 3NL2A 4HANA 2VBPA 1PE1A 1GT8A 4B1LA 1QK2A 5EXOA 3WY1A 2V6AA 1GNHA 3QW4B 6CGTA 3V0BB 4KT2A 5DXYA 1XR2A 2B0MA 4AW7A 3GW3A 4PF1A 4P9IA 4X22A 1ZVFA 3VINA 3CZLA 3FJ4A 4R52A 5HV0A 1K7FA 3CGTA 2VXRA 4IV3C 1KCKA 1UUMA 3O7OA 2P3YA 3RR1A 4XZPA 2A7RA 4KRUA 1J0ZA 3SRDA 1X7IA 4Y7EA 5BU6A 3EYPA 3BICA 4XF1A 2QLYA 3WF2A 2FZDA 4KU8A 2XM2A 2OEMA 4G3YC 2HNHA 3VN4A 4CU7A 3CEUA 5D8AC 1LCLA 2HWD3 4Q6XA 4WSJA 3R8GA 3UNPA 2P5BA 4YNIA 1DEDA 3SCWA 3M7SA 2VW1A 1VGAA 3T3YA 1QNYA 1VF8A 5LZLA 2EIBA 3TUUA 1LYXA 1H2KA 1TPVA 3EB3A 3BPZA 2NQ5A 4LT5A 1FDZA 2HQAA 1NCRA 1FWTA 1GVYA 3LCIA 3NEVA 2FCUA 3B0UX 1UCWA 3AYVA 1CONA 1PGL1 5J96B 3K4WA 1XJBA 1QQP1 1OFRA 4W8BA 1IZCA 2J8TA 2YU1A 2WHKA 3OYWA 1OT1A 3AYDA 5C8BB 3M1ZA 5EV7A 1IOAA 3EOEA 3ES8A 4DXXA 5C55A 3EWZA 2X09A 1PZ2A 3VDDA 2ATMA 4KBXA 1XSKA 3PAOA 2XBO1 1CIWA 4RD7A 2GSHA 1QJU1 2E51A 2DH3A 1QBAA 1EIBA 2E5DA 1FRBA 1H1IA 4CDQB 1JZ8A 1JGIA 4O9GA 1ITCA 1YTDA 5FA5A 2X7WA 2X2GA 2E31A 2OQ6A 5T5JA 3TNBA 3K8LA 3O07A 1UHVA 3ID7A 1KDMA 4M0HA 3GW0A 3PNUA 1NP2A 2BSLA 4NJIA 4X61A 2GWGA 2ET7A 1DQ1A 2ZX3A 3SUVA 4AU0A 1ACCA 1FWJC 1RUD2 3I3DA 1J79A 4MUPA 3RI9A 1UPMB 3B4UA 2AR6A 1QWRA 1VB2A 1CGWA 1UOFA 4YWAA 2IXKA 4OJYA 3QHMA 4GZIA 3I6TA 3KWVA 1GZWB 4C6DA 5BYWA 4IEZA 3C2UA 2GZXA 1ISZA 2Z1SA 3O1PA 1J6OA 1LLZA 4BQWA 1HL2A 1TNRA 2V09A 1EXPA 4H8UA 4X8NA 5BMWA 3F2ZA 3UNDA 1R47A 3RCNA 4W8LA 1EFZA 1BF2A 3Q9OA 5ECVA 3G0SA 2XVNA 3SCGA 4AZGA 4GUGA 2R061 1V6NA 1XV8A 3AM2A 2Z0IA 3PSVA 3VDDB 3CLWA 9XIMA 4NRPA 2DORA 3ZXDA 2WZR1 1NCQA 4K8HA 1AR91 2OPKA 2P2KA 4A4AA 1GYLA 1TE1B 2VC6A 3Q8CA 3UJOA 1PX8A 3SNMA 3W1XA 3IS4A 1SO5A 3SB0A 3HGOA 4V33A 4XJWA 1U30A 2NLRA 4QSHA 4DI8A 1IG0A 3XIMA 1UY4A 4IGQA 3U3HA 4IL0A 3ZVIA 2GNBA 1A0CA 2PBGA 3MUAA 2BZNA 4L56A 3FLRA 1AQFA 1FNZA 2DYCA 4Y33A 4ALDA 5K9XA 1CZTA 5CB7A 4GB31 4GKYA 3ZSJA 3VD4A 1AJZA 3BW2A 2CLMA 4AZZA 3N25A 5I0RA 1NF0A 4O8AA 1YJLA 2GQ3A 3RU8X 1H1AA 1R3QA 2PRLA 2IKGA 1J8VA 2RH9A 5CU1A 4ZENA 3N4MA 4R33A 2CBUA 3H2EA 3VPLA 3ERPA 4OYUA 4GCAA 4DLMA 1ZLPA 1FY6A 1HRV2 2WC7A 4LUIA 2JG9B 1UP2A 2DTWA 3W23A 1JAEA 1GQLA 4US5A 3N2MA 1DWGM 4LWWA 1QPQA 4WF7A 1DG6A 3UGHA 1V6JA 1PPIA 3G3MA 4DB7A 2O14A 2Y6JA 3ZXEA 4I0AA 3R5EA 1EOKA 4EN6B 4ZQRA 3KRBA 2QCEA 2IPFA 4EWDA 1X1NA 2G4IA 2OQHA 5LHEA 3QH6A 1ME8A 3G1HA 2RS12 5J48A 1GEHA 1OCNA 2BWGA 3LRLA 1Q5MA 4XXPA 3WQPA 1NDVA 1HZYA 4XHXA 2PLMA 4HYVA 3HOJA 2X8KA 2AQVA 5C7GA 3H8RA 1K9FA 3L12A 1JW6A 3D0SA 1JUKA 1SBFA 3CYVA 4Q4MA 1RQEA 4JCMA 4V1PA 4MKNA 1S0BA 1ZFJA 2Q1ZB 1CZ1A 3CWOX 4D6IA 3K30A 4C6EA 5D38A 2OT7A 2OYZA 3FW6A 4U28A 2D69A 1JZ5A 2HVOA 1MXGA 3UQNA 2Z4GA 1H7RA 1ITUA 2V2HA 1TB3A 2GL5A 2PGRA 4MGIE 4GK8A 1K6AA 2TPSA 1R7OA 3TYEA 2BV4A 4H2AA 5ACA2 3VOHA 4FXJA 1QHDA 3W29A 4LF1A 1IR2A 3TBDA 1K70A 2AL2A 1H1ZA 4QXHA 2FJKA 3GS6A 1E6XM 1XXNA 4FXGB 4RPPA 4H83A 6PTDA 3LGRA 3K5XA 2NYYA 2WHJA 1VRH2 2JKAA 2GGIA 5A8PA 3S8HA 1HJXA 4G1NA 1NFPA 1YEWA 4ZY9A 2VUCA 4W6YA 4IG2B 4BJHA 3OEXA 3ZOAA 1V00A 2LALA 3AALA 1VFTA 3V36A 2A1XA 4JGDA 3VILA 3B9DA 1LRHA 2B9VA 4GWNA 5KXBA 1O5XA 3TAYA 3QC0A 4FOWA 2ZZ6A 2GUUA 3Q8EA 4LPCA 3WG2A 3RM9A 4HU4A 3D3AA 3PZTA 2EXIA 1PSCA 2PMWB 1VFSA 2QVSB 4LE4A 1UD8A 1L7QA 3KDNA 1F07A 1AL23 3E5PA 3W58A 1HKWA 2C1GA 1MQTB 4MV2A 3S2JA 3EBVA 2R1BA 2YDAA 1W3TA 4GYPC 1SBDA 1Y43B 2DZBA 2DU1A 1KXHA 4ZR8A 2QV5A 1AVBA 4E6MA 2WK2A 2YGLA 1F3TA 1SZEA 2BFGA 3QV9A 1QXJA 4H2CA 2J22A 1VFFA 2A6ZA 5E0CA 3FHAA 2VEMA 1Q2SA 3T2QA 1OYAA 3IGXA 3LEGA 4O4WA 3Q65A 3S7EA 1BEV3 4QU1A 4XW3A 1WP6A 4X8PA 5SV8A 3TEXA 2P5NA 4CGTA 2GVJA 3NL1A 4QQLA 3PUEA 2EPNA 1P48A 4LT9A 5DN1A 2QDDA 4QDRA 1G4SA 4XO6A 5FEXA 3MDWA 5DCDA 2Q1FA 4K68A 3VM7A 2RM23 1XUUA 2WXDM 2IXIA 2OUJA 3NAVA 1O4TA 5D2YA 1HKDA 3WQ1A 2CZFA 2GU9A 5JZGB 4ZU5A 4DZAA 5JR7B 1SEFA 4LO5B 1LORA 4LAMA 2OELA 4XSLA 1KA9F 4EZHA 4DINB 1F5ZA 3EX4A 1QI3A 4JHMA 3PVEA 1HKVA 3BMVA 1I60A 2WSYA 3CWNA 1I2NA 4N7UA 5DQ0A 4Q4PA 3V0SA 3S6PA 4XAYA 4WZCA 3LMZA 4FI4A 2OQ7A 4CXXA 3OYWB 4O15A 3UWVA 3WLMA 4AWTA 5F6KA 4C1XA 3F4VA 3V5CA 3UWWA 2DFBA 2C26A 2ZX9A 4W88A 1C1LA 2PA7A 5EYYA 2BBVA 4WR3A 3I49A 3A4UA 2B7PA 2WZMA 2B81A 1IT0A 3MIBA 3MP3A 3V16A 5CC6A 3HGRA 4A41A 3W7KA 4OCTA 3U14A 1TEIA 1R5YA 1NY1A 2ZOEB 2B31A 1E9YB 1MZEA 4DX3A 2EAKA 3AFKA 4CD7A 3KHJA 3IM0A 3QKEA 1DQXA 1NSJA 1C8NA 1G7YA 1NE6A 1KFJA 4YVSA 3OO2A 4KIEA 2ZWZA 3SIMA 3VZLA 3A9BA 1NQ6A 2WN2A 4RQPC 5FKCA 3T30A 3V56A 3VZMA 4QNEA 1JULA 4F3HA 2WW5A 2QF8A 4DQAA 3QV7A 3VOFA 2YC2A 4HZFA 4HSHA 4BDVB 1JCXA 2EG6A 4JAWA 3R11A 2O92A 3NUKA 1OF6A 4EIVA 1P0NA 2WSKA 4UTWC 1REDA 5DT5A 2XZ7A 5EMJA 5BRBA 5F3GA 4KFOA 3A3XA 1CXKA 3LLDA 4NYUA 3W84A 1UUOA 2AGKA 5FEPA 4DM1A 1MS0A 3SC7X 5J3UA 2ZBJA 4EANA 4PCNA 5I24A 4JTAA 1RUG3 4J3XA 2Y62A 1XWYA 4GYKA 4ZFCA 3LCXA 1TO3A 1T7LA 4LAKA 3SSZA 4Y8EA 1I8JA 4DHGA 5I5RA 3W86A 3MCNA 2CAUA 3KV9A 3EKLA 4EROA 1DFQA 3CPUA 5FZDA 1KS4A 2E9LA 3LCGA 5H9PA 2WOQA 4LA3A 3IWPA 5HPCA 3OUIA 3DYPA 1G69A 1PHWA 4IEOA 2IW0A 3TW9A 5I3JA 2PBOA 5IVCA 1YADA 3TTOA 4LE3A 4QQUA 2UURA 4PIXA 3E12A 1OJXA 1GJPA 2OEJA 3U1XA 3RCYA 3VBHA 1NYWA 3P2VA 2MEV1 2Y5SA 3VLBB 4ZKTB 1AW2A 4O0KA 1HGWA 3ECQA 5MKGA 5HATA 3GZAA 5LWBA 2I5QA 1KRCC 4QPIB 2DZAA 3AMMA 3N4EA 4A3RA 4Z1CA 1GQJA 1LDCA 4PLNA 1EAH3 2E32A 1WCUA 1W0OA 3VKAA 9RUBA 1JUIA 3LXCA 3AXEA 3ATGA 1QCWA 1DQ4A 2OO0A 3AMCA 1JRCA 1ZX5A 4EKJA 4ZB2A 3E2QA 1CGTA 3ZFEA 3U48A 2IXJA 3C7GA 1T96A 5DUWA 1AUYA 4XZUG 2JDHA 3KVAA 4I30A 2PZ0A 1VMJA 4XOGA 5K0UA 5KSWA 1KXGA 4BWOA 1NDYA 3VDAA 4B4RA 3O1SA 1RLDA 4XZWA 2OX1A 2CXEA 2PP1A 4FNTA 3AI0A 3W6LA 1IZ3A 3RYRA 1EHNA 5FIPA 2WQPA 1W6PB 4G9PA 2VZ3A 1EO7A 2EXHA 4Q8NA 1A5CA 2F17A 1SFJA 2G9FA 4KKXA 3WH5A 2OZ8A 4XDQA 4W8AA 1A3WA 4H9VA 3EA3A 3WZ1A 3W7RA 4AUBA 4XAFA 1G4EA 4DQWA 2V82A 5SWUA 1LL7A 2C15A 1X97A 2P34A 4GJYA 1Z42A 3W1LA 2PHFA 2ZGQA 1DHKA 3UGFA 3LD5A 3INPA 1V6VA 1UMYA 5CFDA 2D93A 2W62A 3PUGA 3L2IA 2VRJA 2LUWA 1NE4A 2V0TA 3AMDA 3UR2A 1IS5A 1RHCA 4CTEA 2ZMNA 5TBOA 4TMCA 1UIKA 1PXGA 2GDVA 2YY1A 1VBHA 1GFF2 5KC5A 4MGZE 4XD5A 5T9CE 2HWE3 4UW4A 4HK6A 2Y6HA 3RPTA 2I9UA 3FLPA 1VHNA 2D98A 4YRDA 3MP5A 2E3ZA 3EPNA 4MMWA 3I8TA 3S5OA 1NTHA 3LIHA 3ZXKA 3GR8A 4LB3A 4FXKB 1FA2A 3LQLA 1IQ8A 3EXSA 3NJYA 4Y5Z0 4F2TA 1J0KA 1ZENA 3WNOA 2YGYA 4UR7A 3UFYA 1QDOA 1UD5A 2J1SA 5DDJ3 4E2VA 1YRRA 4YVWC 1GG1A 5FZ6A 2GGHA 3EX1A 5JVLA 1R3SA 5D4YA 5C70A 1JPIA 1W9FA 4W9TA 5DAPA 3FDKA 1LQ2A 4Q6JA 4UBPC 1XLHA 1YNYA 1DP0A 3L5LA 3WQCA 3P62A 4ML9A 3H7UA 3QD6A 3VU2A 5C3PA 2XIQA 3H8UA 5FWJA 4L11A 4AMCA 2C19A 4UF0A 3PVFA 3QM3A 3GR7A 3VDHA 5IBXC 3UU0A 4JFUA 5F4WA 4HVXA 4INFA 1NWTA 3UWYA 3N6QA 1UMHA 3MCOA 4GH3A 2RG4A 3AKTA 4K1YA 1XRUA 3RWNA 1S5NA 5LBCA 1B3VA 4H7CA 3GLCA 1OCBA 2NQLA 1VLNA 2CDPA 4Z1YA 2QMJA 3HPAA 3IACA 1BK0A 1ZBKA 3REQB 2P53A 4N9EA 5CFDB 4PCRA 1Y7VA 1OFPA 2EVXA 1JD7A 2E5CA 4GC4A 4JQ1A 3SCHA 3LSCA 3WHUA 4KWSA 3JZUA 1R9YA 3QQ0A 2D3SA 3U2OA 2Y6KA 3JZVA 4IJCA 2F8QA 4K8FA 3OBAA 4R88A 1F74A 4AY7A 4I3PA 5DUXA 3T0BA 5FRAA 4MYXA 1KBBA 3S46A 4H9XA 3MW4A 2BVTA 4E8CA 1JD9A 1GVRA 2EEXA 2H8ZA 5F8PA 2OIIA 1B9BA 1KGWA 5AOUA 1XIGA 2PB1A 4YLZA 2RM22 7TAAA 2P6CA 3M16A 5HNRA 4DEVA 1W1TA 3I2IA 1M53A 3RRAA 2Y6ZA 3CUIA 4RUBA 1SPPA 1S46A 1MUWA 1DIWA 4S39A 2ZE0A 1I1WA 4FOKA 9XIAA 2CLPA 1HB1A 3N9OA 2HYXA 4FTSA 5BNOB 1MW3A 3QGAC 4AEMA 1E1CA 3ONBA 5FXWA 5JH2A 1EDQA 1D4M1 5HANA 1B3WA 4QHOA 3J26N 3PWIA 2XHYA 2W91A 3IN9A 1TCDA 4D1IA 1S2EA 3TFXA 4GIYA 1MZHA 4NIHA 3ITXA 4IV3B 1W8OA 3M0YA 5I2UA 3JZEA 2P50A 1J9YA 3KFTA 2VG9A 4KGJA 1SFSA 4K1ZA 4QX4A 1YPXA 3D46A 4G56A 3JBG2 5DZFA 3RM4A 4B3ZA 2QIIA 3ZSSA 1R3RA 3MVTA 2BVBA 1OF4A 5A6YA 1LT8A 5ABGA 5IRPA 1MZFA 2VFFA 3W7DA 1ITXA 4JVAA 3UV9A 1M3UA 4IGHA 1TMF1 1ZBA2 2P3KA 3M7AA 4D6JA 2YBTA 3NNTA 1UH3A 1CJPA 1AXZA 4P9JA 4I8DA 4V27A 1PAMA 3W1MA 4UTTA 2PWFA 1QNRA 3C4UA 4KETA 3LCFA 1Z3NA 4B8EA 2F7FA 3BTZA 1QASA 2W47A 3CUJA 4LS2A 3SUSA 2RGMA 3UGVA 5K2ZA 5TD4A 3A5FA 3ARSA 3BAYA 3VX0A 3E0LA 3RZGA 4DM2A 1S2WA 4ZTYA 4QE5A 2BBFA 4DUOA 2VVDA 4AG0A 1ME7A 2EPOA 3PTYA 3NL6A 3VBHB 3ZR4A 1ZM1A 3QTGA 1QRQA 1TPB1 3TN92 3DHDA 4XAPA 1PIIA 2P1BA 1RK5A 3M9YA 1ONWA 4MXWA 2FCTA 4DBDA 2NV1A 2NT0A 5AHLA 3E74A 1OA4A 1MS4A 1H41A 1NOUA 3WD0A 3AIEA 1VPHA 4IMDA 1RGSA 2ATFA 2J8FA 4MYAA 4ZSTA 1FH9A 2DU0A 2RS32 3DFPA 4BI6A 3I2FA 4MM1A 4UTTC 3LAGA 2FJUB 4DWSA 3U2ZA 4RYDA 1A5BA 4B5XA 2XXZA 3I68A 3QYSA 1M7PA 1UR8A 1VBC1 4GI9A 1BG9A 1FWNA 1T8QA 3L9CA 1RJPA 3W83A 2AOSA 1Q45A 6ENLA 5A7OA 3TOJA 3MMUA 2XL7A 3MW3A 3N35A 5AC92 1DJNA 3VDBA 3JD73 1E0UA 3VCRA 1SZGA 3A6OA 1TG7A 1UY0A 4WY0A 5GZEA 4PULA 3OU8A 2ZTNA 3TE9A 5KHGA 2J1AA 2VQAA 4W86A 2ID4A 2DT0A 5C3QA 4AZ7A 1U33A 2D7FA 4IE0A 1ICQA 1CZVA 4XCAA 4TLFA 4CEYA 3MZHA 4IPNB 1GORA 3POGA 4JTRA 2HDJA 1SMDA 1LM1A 1PTGA 3KM5A 2YA0A 3VBSA 4PBFA 4MY8A 5JOXA 3RUBL 1SMAA 2OQLA 4GA8A 4JICA 4UW3A 1H8TA 3SQMA 4LVBA 1ULEA 4FR1A 4UYBA 2WWDA 1V9U1 1KCLA 3GU9A 4G6CA 2W63A 2PUZA 3CMGA 4HGXA 5C33A 3UKVA 5EFDA 1VEMA 2ZS6B 3NV2A 2ZUVA 1UYZA 2V30A 4XAAA 2A6WA 3ANYA 3HG5A 3W1QA 4C7GA 4ZE5A 4DYJA 2RJHA 3BXWA 1NXMA 2WHMA 3GFZA 1JGMA 4YW7A 4TN7A 4HKWA 2FH6A 5ABJB 3CIHA 1DWHM 4XFAA 1JXJA 3MBWA 3AIRA 3UCCA 2ZCGA 2G1MA 5JWPA 1POJA 4KS0A 1EP2A 2XGIA 2J1VA 4WKAA 1YDOA 4J2PA 1W8WA 4S38A 3GD6A 2NWSA 4Y1UA 1JYWA 2RS13 2YXGA 5D04C 4QITA 4RJEA 3IK2A 4AI9A 4WX2A 1KQZA 5HI0A 1TUFA 2CNCA 3WG1A 3CK5A 3GBDA 4UQCA 1Q6RA 3TNPB 1KITA 1ZAHA 1PO22 3WD1A 3IV8A 3B0VC 1EKOA 3N12A 3WLPA 1AR73 1SJBA 2D2OA 2VZTA 4M19A 2ZCWA 1HIZA 1XSIA 5TIMA 3TFCA 3K3OA 2JIWA 4FSAA 3RN6A 5CSUA 4S3KA 4XFIA 1W39A 1P5BA 1HB4A 4Q4V3 5FYUA 3EDJA 3S2MA 3TWAA 5AC6A 2VE1A 2P10A 1UYXA 1R8LA 2ZRXA 3S57A 4C1LA 1LOCA 3O16A 1QKQA 2XG9A 3M0IA 2FYMA 4U5KA 1E5JA 1Q6OA 3BAKA 1OXCA 3W7HA 3HF3A 3QY6A 2JXAA 1CGUA 4L9BA 4ZO6A 1KCZA 4O57A 5IW0A 1Q8JA 1QHPA 2X40A 3GNEA 1R091 4TX8A 4B90A 1OPOA 4WDUA 3DFQA 3JU2A 4W65A 4ADUA 4JEJA 4L4MA 1K02A 3GJAA 3VGDA 3QPEA 5B80A 4NAFA 1NUKA 3B0YA 1IHIA 1AYM2 1E56A 4Z8BA 2ZZ4A 2QV4A 5J5DA 2KM2A 1RA5A 1DOSA 5A3PA 2W66A 4DUXA 1P0EA 1ZYBA 2QTWB 4JNYA 2E5BA 3IUIA 1GJUA 4NAMA 1AL22 1BRLA 1S2BA 2V69A 3A4WA 1MEHA 4LMFA 1N82A 4XE9A 4DJFC 3VOCA 1GNXA 3BPWA 4C1WA 5FZ8A 1A0EA 4C6FA 2XFYA 2Y6FA 5A6TC 1KM0A 2WVVB 1D7KA 3H8XA 1V6LA 4UFHA 2A6YA 4L1GA 4UB9A 4S2GA 4NZ3A 2PTWA 3O1TA 1DIEA 5IWFA 1NWSA 2AL2B 4IJBA 4Q4QA 3N9NA 3CTTA 2B4GA 2PF8A 5I3IA 2D6LX 3OEAA 3BODA 2XWJB 3APBA 4KCUA 2F4PA 2OOFA 4CU9A 1WLWA 1MUMA 4NX5A 3LZ3A 1LRTA 3DH7A 4JV4A 4F0SA 3WKZA 4PF5A 4O1DA 5FEWA 5ANQA 4YVPA 1XYPA 2QQVA 1G9BA 3RZKA 3W1NA 4ASTA 3KSCA 3IIZA 1J3QA 4Y5SA 2WWJA 2D6OX 3AP7A 2PODA 4BHPA 2QNEA 1SU5A 1YRZA 1I2RA 1Q3EA 2E6VA 2VZPA 4Q1PA 4IFKA 5A6BA 1UWUA 5HWNA 2XBO2 3N2OA 4E4UA 1K4GA 3H2MA 3IKWA 4O19A 3AAMA 1XNKA 5FL0A 2C91A 5F2IA 5CAHA 3STFA 5G4EA 1UL9A 2PI6A 3U8GA 1ZRCA 1OZMA 4BKNA 2F38A 5DAWA 1QJY1 1V3IA 1E4NA 2OOGA 3MSRA 2CZ5A 3PZNA 5LIUX 1W3HA 3OVPA 3WW1A 1BVVA 1EA9C 2HSAA 2XZ9A 4YMZA 3ALFA 1RZMA 3DC0A 3GCXA 2NZLA 3O12A 3HT1A 3WDXA 3O1RA 1TPFA 2NQHA 2YLAA 3TWBA 2YSWA 4C6JA 4O1FA 4HPKA 3L2YA 1C90A 4CNTA 5ABEA 4AFCA 3T4CA 4AY8A 1I2QA 4I90A 1YIXA 1KM3A 3PVOA 1OOPB 3O15A 4I9JA 1JR1A 3AZSA 3EDKA 2FVKA 2NV2A 5C3RA 2HS6A 3W7QA 1ME9A 1E0XA 2CL2A 4LPLA 2R072 4AYUA 3L66A 4JY9A 1B90A 4GC3A 1HN1A 3WLNA 1ALYA 4LXLA 2ZUWA 3PB0A 2SFPA 1EO5A 2DDXA 1YXCA 4DBEA 1UZ1A 3C52A 4OI4A 4ZQMA 2Q01A 2GC3A 4J3WA 1UZVA 5BU9A 1W2UA 1AR81 4NILA 4EWAA 3LV5A 1BKZA 1Q7MA 1TQ5A 1GICA 2E0PA 3ATYA 2VGDA 3MU7A 1JZ4A 5A2CA 1QR7A 2ABAA 1EPZA 3FFSA 3GXFA 2RDSA 1XIIA 1KFXL 1GZWA 2W1UA 4AAJA 1NCQB 4C0HA 3WR0A 2NXHA 2OFJA 3BDKA 4QJ4B 4A45A 3PL0A 1I75A 1EIXA 4CCZA 2Y61A 4N42A 1UZHA 4E2SA 3L4XA 1SLAA 4CA9A 2XUCA 4MZ1A 1LULA 4AEKA 2G3MA 2ZHNA 2W08A 3FX4A 3TQ0A 1BQPA 2VUAA 1R1A1 1OMIA 3VIFA 1TPUA 2ZPXA 4LR4A 3UNTA 4FXSA 3A23A 2HEJA 1EGZA 3CIXA 4L0PA 3GNXA 4PHZA 1NOFA 1DJQA 2TODA 4LO6B 1IXOA 3O06A 1IGWA 1PTAA 3AYSA 3VKBA 4ES4A 3DDMA 5IAXA 1X8MA 5FAGA 4R7WA 1AYN1 1LOLA 3NPVA 4Y4YA 4LK7A 2RDRA 2LW8A 4XISA 1M68A 5LYRA 1XKYA 1GYMA 3BPSA 3KTCA 1VEOA 2VZQA 5TNVA 4QE1A 4DLFA 1H6YA 5IHRA 5J8LA 3W76A 3RPQA 2OT0A 2DT2A 1QTWA 3DX5A 2X29A 2PE4A 3QH7A 2J1RA 5L7OB 1ZZ8A 3WQVA 1NLSA 3AISA 1QFEA 4NJKA 1GONA 1SVDA 2P1FA 3L2MA 2Q8LA 1XIBA 3TJ4A 3RJRA 1KFBA 5APAA 1QOSA 1U5HA 2J9XA 3LYEA 4CNUA 1U1UA 5T55A 4ADTA 4CEYB 1I45A 4XBQA 2I17A 5FP9A 2YLLA 4KCWA 3LGEA 2B4KA 3O8AA 5BMXA 2V3EA 2Y24A 3GTIA 4ZZ9A 2CITA 4KL1A 2X7VA 3NPUA 1P4CA 1QXPA 1V5XA 1F3WA 2CTVA 1MEWA 3HFTA 4GFSA 4B2DD 1OLRA 3CO8A 4N53B 1O12A 3EPMA 2Y8UA 4IE4A 4XJZA 4PEKA 3W2LA 4FOJA 4LUYA 3R4SA 1B3YA 4AEDC 2FGZA 3POCA 1Y7BA 4W4ZA 1MQQA 3WHTA 5FPAA 2DZPA 5CPOA 3DBPA 3RHGA 3Q4DA 4EZ4A 1GPWA 5D05A 4FXFA 1H7PA 1SJDA 4HIBA 3W7PA 1TMF2 1K5MC 2VJXA 1CXHA 4ROPA 5EA9A 2BDRA 1UKSA 4H7VA 4WBBA 3EOSA 3BVCA 4PFHA 5L9BA 3E6CC 3B8VA 1YQCA 2YCEA 4TXEA 4F2BA 2IXLA 2CU0A 3IAQA 1W9TA 1KD7A 3NJVA 3MT1A 2J7CA 3LPOA 4UQBA 3TR2A 4QAWA 4R9OA 1G7VA 4O7XA 4GXMA 1WLDA 4K21A 2VMDA 3NOEA 4RR3B 1OFNA 1XX1A 3PVNA 2DCKA 5C5UA 4MGYE 3STEA 3G7DA 4JEQA 2UZ9A 3BQ5A 2YG0A 3R4IA 1XLBA 4L9YA 5G2WA 2WZR3 4I9TA 1ODNA 2YOCA 4DB5A 2GOUA 4GOAA 1YKWA 1OH4A 4BCUA 2LLEA 4H9YA 3EB7A 2H8XA 3D4KA 4KGLA 3I7DA 4XD6A 3URBA 1OT5A 3M3EA 3A9IA 3IGHX 1UH2A 1A3HA 3ARQA 1KV8A 3CEPA 3NG3A 5FDBA 3JXSA 4S23A 3EMRA 4W5ZA 1AR62 3ZFGB 4GGBA 4W7UA 4Q8OA 1JI2A 1J58A 4U3AA 5KINA 5XINA 2XWBB 2I07B 4NJJA 2A6XA 1LGCA 3QBUA 2Z7GA 4Y22A 2UWFA 3TYDA 1XLJA 1J11A 3N2XA 3NQCA 2Y5EA 3KB5A 2XLAA 5L9VA 1B3OA 4YYCA 4ORMA 4DWSC 4LCQA 4M6UA 2QQOA 3MKVA 2GVYA 3GB6A 4AI8A 3QHNA 4JC1A 3TRSB 3WD3A 1GOKA 3R8RA 4Y3OA 2XOMA 5CFCC 1Q6CA 4JN6A 1CT5A 1XICA 1J93A 4ZQNA 4GJ1A 4NI3A 4AZ6A 1XKJA 4AVTA 3GH7A 5AHNA 1OD5A 4WKHA 2ZEYA 5A80A 2VEIA 1GVEA 1OF8A 4C7FA 5A6XA 1BCXA 1GQHA 3N2BA 3GYDA 3P82A 4IE5A 5EL1A 3K46A 5DDJ2 4QU2A 5FY7A 3H7JA 1KRIA 2FMNA 4NJ4A 5HR6A 2XHKA 3PB2A 4IOTA 3PJWA 3L68A 3M3OA 3P93A 3B04A 3DXIA 4M3PA 2Z29A 4O8RA 4U33A 4G1KA 1QDSA 2ZGNA 3HPNA 4W8JA 4NASA 4Y90A 2NVAA 1V0AA 2EQDA 4B5NA 1SDWA 2RDTA 3TZFA 3T4WA 4IMGA 4JTDA 4CQ8A 1MZRA 1VENA 4MPQA 3LHUA 4GQQA 2FDJA 4JDBA 1FNYA 3RYSA 3FJ6A 1EJUC 4BK5A 3PBWA 2E7TA 1QI0A 2IQDA 4KWOA 1OOPC 4META 5AHEA 1AUSL 1YNPA 5JZGA 3NIYA 3UF9A 3HIJA 3V5FA 4HXCA 1FDYA 2NMOA 2TBVA 4K9SA 3UPWA 2B5HA 3CPRA 2V3GA 1H50A 4AZIA 1VR3A 1TTPA 4OKDA 2FB3A 3APTA 5KTLA 4JDMA 4CLMA 5FUIA 1X9TA 3WY6A 1QJZA 4KG0A 1EP1A 5A69A 4XQDA 3FSTA 4D3WA 2WQDA 2CIPA 1RUE1 1UKTA 4C1KA 4ERAA 3VKLA 2WT0A 4IDZA 3NZ1A 1V7AA 1SFPA 3LWCA 4QB1A 4UZSA 1FWHC 1TQJA 3BO9A 2B7NA 3M3IA 2XVKA 4AEOA 3ILFA 1M03A 1OINA 1QH6A 4N90A 1QOQA 2VXNA 3ITLA 4YJ5A 1PIV1 3AP5A 2WA3A 1W6NA 3AB0A 1LBFA 2ACUA 4CPBD 2YW4A 5AY7A 1MDLA 2R16A 5JH1A 4L7ZA 4PCFA 6REQA 2EHHA 3AYTA 3SH4A 2OB3A 1OVDA 2EXKA 2G19A 4F48A 3ZN5A 3FHQA 5C9WA 4S3EA 1R093 1UR9A 2Z26A 3OVGA 3UD6A 2WN3A 2DP3A 1YQ5A 1GEQA 1BSLA 1XU2A 4Q5OA 1XINA 1RUSA 5FJRA 3I3EA 1XDLA