4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
2QF8A 1KQYA 2PB1A 1BSIA 1US2A 1KBKA 2XVGA 3VIKA 4WK9A 3CZJA 4FLOA 3ARSA 1CPUA 4HMDA 4GQQA 1GUVA 1C7SA 4S3JA 5M3WA 3VTRA 4IPLA 3KL3A 3M46A 2J7DA 3W37A 1GOOA 2X2YA 3ZIZA 2ZXDA 2Y24A 4TVDA 3F5JA 1SMAA 1BAGA 4M24A 1XH2A 4QCEA 2XVKA 4P7NA 4GO9A 4DWSB 2CCRA 1FHLA 4MB1A 4P8VA 2X05A 1ZB5A 5A6SA 2J7HA 1LWHA 5BWFA 1V0NA 2ZX9A 3ARUA 1E6RA 4AZ6A 3M07A 3IJ8A 4LXFA 1V3JA 2ZX8A 4MAZA 2PC8A 4GI6A 5D8WA 3NSNA 1FHDA 1UWIA 2CBJA 4LYRA 3WFZA 1ZL1A 2UY2A 5IHRA 1HN1A 1V6YA 2VX7A 1MXGA 1WKYA 1UHVA 1GVYA 3T09A 3WN6A 5A3HA 2WZIA 5CGTA 2DH2A 4M82A 1H49A 4ATDA 1X1NA 2GDUA 4UFLA 1CECA 1E1FA 5A6AA 3BGAA 4JL1A 1PX4A 2ZWYA 4KRUA 4HU0A 4WKFA 3VDAA 5BXRA 3ALFA 4UCFA 4NRSA 4B9YA 3QOMA 1JFHA 4M81A 3T2QA 5AC5A 2ZXBA 4AD2A 1ITXA 2WCGA 2F61A 4WKAA 3ORJA 1JI2A 5GPRA 4K68A 3MSGA 5D21A 3T0AA 3AHTA 2F2HA 4W84A 2V38A 4P8XA 1JZ5A 3W38A 1H2JA 2VX4A 1QBBA 4QDMA 1EHAA 2VXJA 2YKKA 1W9UA 2BVYA 1C8XA 4PTVA 1AVAA 2ZXAA 2XIBA 2YL8A 1IZJA 2AAAA 1HIZA 4MNKA 4F8XA 1LL7A 2GDVA 2VQUA 3PZVA 3ZT7A 5BCAA 2X0YA 4N42A 4P8WA 2KR2A 1DEDA 4E2OA 1W9BM 3DYOA 3CGTA 3S2CA 3S6TA 1E6ZA 3ARQA 4D71A 4WKHA 2YIHA 5I78A 2WNWA 5E6YA 3A4WA 4LPCA 3PHAA 5AYIA 3WFLA 3L2MA 4UQBA 1G0CA 2CERA 2DSKA 2VRQA 3GNPA 2CHNA 5BRQA 3OBAA 5JBDA 5IFTA 1UR8A 4AYSA 1L0PA 3N12A 1HJXA 5ECUA 3GNOA 2OYMA 1BYAA 3EYPA 1B1YA 4AEEA 3WF3A 1X6NA 3WD0A 1M53A 1WP6A 5HXMA 4M56A 3WQ8A 4EK7A 4W8LA 3VGDA 1EQCA 5IXEA 4X0VA 4AZIA 1V6VA 3VNYA 3VKKA 1NOUA 1W9PA 1DP0A 4D6FA 2WAGA 3BMWA 5M03A 1KXQA 2BNJA 4GXPA 1C7TA 2YDRA 5HOSA 3VIFA 2XIIA 4EANA 4PMVA 1EOMA 3WUGA 1C90A 4AZCA 2C8NA 3L4TA 1I1XA 4WIWA 3NDZA 3PZIA 3VD9A 3I3EA 3CBWA 3SCNA 1V08A 3K1DA 3MS8A 5GNZA 1LL4A 4TXEA 4GZJA 4A3HA 4E4PA 2Q8XA 1BLIA 3OIHA 2XSBA 2GK1A 1UQYA 1V0LA 2VRJA 4R5EA 3BAWA 1R8LA 4AMCA 2E3ZA 5DT5A 1E3ZA 4AD5A 1UA3A 2ZX6A 2DSWA 4MNJA 1TG7A 4HPHA 3WNKA 1TVPA 2Y4SA 3WF4A 4KWUA 1HKMA 2WHJA 3T0DA 1JZ3A 6A3HA 1FFRA 2O92A 2X0HA 5D9OA 2W92A 2J7CA 3W26A 1C3FA 4XV0A 3WQVA 2AOSA 4D6CA 3EDEA 1J01A 2EPOA 1WZKA 3WBAA 4D72A 5LA0A 1CXFA 2ZWZA 1QHPA 5CPTA 2WMGA 4EAMA 2PWFA 1E3XA 1EDQA 4CPBA 2WANA 2ZUWA 4URIA 3AMKA 4JKLA 2Y8VA 3BAIA 3OLEA 4P7RA 2C24A 3VIPA 1Q6FA 3WNNA 1UH3A 3RJXA 1JF6A 4ZENA 1W8TA 3JUGA 3IANA 3SURA 2XPKA 1JF5A 3UT0A 1JI1A 1UR9A 1V3HA 2BXZA 4PMUA 3UCQA 2VVNA 4W5UA 4ACZB 3SEPA 2D3NA 2E0PA 1K9DA 3AS2A 4UFIA 4JFUA 2DSUA 3GDBA 1TZ7A 2VVSA 3WNOA 2WVSA 2V3FA 3ARWA 3BLPX 1L8NA 2DT1A 2WCSA 3VD3A 3WIJA 3KL0A 4B3LA 1UD6A 5CSUA 1JZ2A 1FH8A 2WW5A 3W28A 3BAYA 3BCFA 2FDMA 4RE4A 1OGSA 1NP2A 4OBRA 4UFJA 2XWDA 1TMQA 3VGBA 3VMPA 5KZ6A 3APGA 4H8HA 4UQCA 4U3AA 2EPLX 3FAWA 4Z2LA 1RPKA 3CHCA 3OG2A 1PIFA 3WELA 1M04A 1UKQA 4GI9A 1UD4A 1UUQA 4D6IA 4AW7A 1FFQA 4OJYA 3VMNA 2WVVA 1HT6A 2ZUSA 3WUBA 3G6LA 3U7VA 4TTUA 1EOKA 3WQWA 1V3MA 2W63A 1EXPA 4TX8A 3UR8A 4N0RA 1J0IA 1W1TA 1BFNA 2JWPA 1V3IA 3PZUA 4JFSA 4PTWA 3GM8A 1BYCA 4DUWA 3ZT5A 1W1YA 1US3A 4AC1X 3F5LA 4D6GA 3LPPA 4UR9A 4PYSA 1Q6GA 3BSHA 3K8KA 4LK6A 2UY4A 2EXOA 2A3AA 3AIBA 3WQ4A 3UESA 3LMYA 3WNMA 4D6HA 1GWMA 1HVXA 2WMIA 4JZ5A 3MSDA 2X1IA 1WE5A 4OUEA 2WMKA 5CSYA 1W32A 1FP8A 2DPEA 4FMVA 3CUIA 2BHYA 1R7AA 2DGAA 3EBVA 5ABFB 2XWEA 1PAMA 3K8MA 3W81A 5I77A 3KWXA 3AZTA 1FOBA 5JIPA 3MUIA 1A3HA 1R85A 1LQ0A 4PBGA 3FHAA 5D8ZA 5ABGA 3WBEA 2JEQA 3W6LA 2LROA 3CMJA 5HPCA 1EO5A 5A6BD 1QHOA 1KCLA 3WF0A 2JFEX 1E40A 2XM1A 4W8AA 3GYCA 2WYFA 2EPKX 3SUWA 4AIEA 5GQBA 1CXLA 2J7BA 1B2YA 4GI8A 3LPGA 2YJQA 2E4TA 2GJRA 3VIHA 4QCFA 1AQMA 2O9PA 3CLWA 4V2XA 3MKKA 4EE9A 3CZGA 4CCEA 3U57A 3LPFA 1YQ2A 3KZSA 2DSVA 3ZSSA 5HPOA 5EFDA 1E73M 2VZSA 2WVVB 1OCQA 3GBDA 2XG9A 2JEPA 1Z32X 4AXNA 4GPNA 4W88A 4AD1A 1W9VA 1XH1A 3WDQA 3K8LA 7A3HA 2ZIDA 5BXTA 1OT1A 3ARRA 3VIIA 2XVPA 3AS0A 2RGMA 3UERA 3CUFA 3PZNA 1EO7A 3MMUA 1KR1A 4ZXOA 1P6WA 5I2UA 1CENA 1UKPA 3RILA 1PZ2A 1JD9A 1V6WA 2VX6A 2E9BA 3MO4A 4CGTA 2LRPA 5ABHA 1UKOA 3K46A 2IUZA 2W62A 4C7DA 5FCZA 3W82A 3AI0A 2CXGA 4JKKA 4W87A 4BCEA 3OLIA 1OKOA 1UWUA 1LF1A 4PN2A 1E71M 3OLDA 3T2PA 3ZR6A 1MFVA 4IM4A 3QHNA 3KE0A 2G41A 4AWEA 3AMDA 4CD8A 1E55A 1EQPA 1VFOA 1PPIA 4KGLA 3VUPA 3PZ9A 4JHZA 4W89A 2A3EA 1SFSA 3WNLA 3CUHA 3AYRA 2VL4A 4BF7A 2BY0A 1JD7A 2G3NA 2XYLA 1GHSA 1QNQA 1ZJBA 1XCWA 1GQKA 3L4UA 1QPKA 3ARTA 4HU8A 2D0HA 1W2VA 2E9LA 4U5KA 3VINA 2YOCA 5CGMA 3BLKA 2WBKA 1ITCA 2YL6A 4HOWA 1CGUA 3BAJA 4F66A 4UQEA 4PEEA 4TUFA 4LJHA 1HXJA 3AJ7A 3ZR5A 1E72M 2J47A 1AQ0A 5DO8A 3AISA 1BHGA 3PZMA 1GONA 4ACZA 3TA9A 2BFGA 1WZXA 1PEZA 3WUEA 4UZSA 3VDBA 4FK9A 2VTFA 5A6BA 1FA2A 3ECQA 3A47A 4M8UA 4YN5A 1Q6CA 1NH6A 2VT0A 4PUDA 1VF8A 4ML4A 4DWSC 1C92A 2MANA 2D0FA 3WQ6A 2J4GA 2VCBA 4PMOA 4HA4A 3DYMA 2J7EA 2ZUVA 4AISA 2DDXA 4UOQA 4XZBA 2A3BA 1MXDA 2Y5EA 5LA2A 4CD5A 1GW1A 2XGBA 1HVQA 2XSAA 1ISZA 2GFTA 1EGZA 1B90A 2FHBA 2O9RA 3WF2A 2YA1A 4U2ZA 4DWSD 1LWJA 5FL1A 5F7UA 3NYDA 5A8NA 1GOQA 3EMCA 2BXYA 4Z2HA 1J9YA 4LKFA 4U2YA 2PI6A 1CNVA 1C91A 5DEZA 4U31A 2WVTA 3OZOA 4HA3A 2J75A 1KXHA 2WMFA 4AIOA 2WHLA 3U5UA 1QNRA 2CEQA 2YBUA 4KRTA 1B31A 3UETA 3B9EA 1E56A 3AMGA 2Q1FA 2V5CA 1NWUA 1J0YA 1BF2A 1LG2A 1UA7A 2J8GA 2CYGA 1ZBCA 2PBGA 1HJWA 1CTNA 1ZBKA 4QFUA 1GCYA 3HN3A 4JCLA 1TUXA 2ZICA 3M7SA 4AD4A 4UOZA 3THDA 5A6JA 4GKLA 2O14A 2JF6A 3CHDA 3WEZA 2XFRA 5BROA 1TVNA 3SUUA 5I6SA 1NWRA 4BQ5A 3PZOA 4H41A 4L4OA 5CLWA 1UWTA 3U5YA 2J25A 1KXVA 1BPLB 1PBGA 5JIWA 5FKYA 1JDDA 2CIPA 1MQPA 4AZCB 1CXIA 1KGWA 5ABEA 5JUVA 1BYDA 4AY1A 1UWRA 1N82A 2O9TA 2BS9A 4AZBA 1MFUA 4J3SA 4UTFA 1W91A 4CCCA 3U7BA 3WMBA 4Q22A 4CVWA 4PSRA 2E8YA 5TD4A 3WDJA 1H4PA 1TA3B 2DSZA 5M17A 1XD0A 5A2AA 3ZYBA 3CO4A 1NOWA 3D5HA 4IUGA 2D24A 2ZE0A 1QNPA 3QR3A 2E40A 2XGIA 1OGGA 2PWGA 3WH9A 2A3HA 4GIAA 4CPBD 2YL9A 2QHAA 3MUAA 1RP9A 2D2OA 1VFMA 5A2BA 4H8VA 2RGLA 5HBFA 1DWGM 3WUFA 1V02E 1OIMA 1E9LA 1G9HA 2CBIA 3L4XA 5CPQA 4M80A 4PMDA 3VM7A 5BXSA 4WLCA 1R87A 1OSEA 4J3WA 2VURA 2BY2A 3RPMA 1HKKA 3W29A 4UQAA 5DT7A 1B0IA 2CESA 1VBUA 4LK7A 1UWQA 1CLVA 2DEPA 4CN1A 2K46A 2WMJA 3AYSA 4ZE5A 3SCRA 2WM0A 4GINA 4CVUA 5C70A 2VCAA 4QLLA 4L4PA 1JG9A 1NOFA 2ZUUA 3CTTA 3IJ7A 4LYPA 2Y8KA 1S46A 4DM1A 2VNCA 3BXWA 5I24A 4W7VA 1UWSA 1UD2A 1HL9A 4FLQA 4EKJA 1JYNA 2BV9A 1HNYA 3WMCA 1UD8A 1W9DM 3PTQA 4Z2KA 3AHXA 1OGBA 2G8ZA 4JL2A 1WDSA 6TAAA 3MMDA 4ZEPA 3GNRA 1J11A 5BXPA 5IHSA 4JCMA 4FLSA 1HJVA 3UEQA 2JIEA 1J12A 3MU7A 3UG4A 4RE2A 1Q6EA 1GOMA 1V02A 1DHKA 3N13A 3ZMRA 3TTQA 3I3DA 2EO7A 3BC9A 1CIUA 1VIWA 4H2CA 1JZ4A 2EQDA 3WY1A 4RL3A 3KEHA 1C93A 1WAWA 2IXVA 3PZQA 3VGGA 3ARZA 4CU7A 1KB3A 2V3EA 1JAEA 3NDYA 1E70M 1UKSA 5GNYA 4D6JA 1KR0A 2VZVA 4HMCA 1E6PA 1ECEA 1J0JA 4UQDA 2E8ZA 3VM5A 2GJXB 2WCAA 1G1YA 1W1VA 5E0FA 1HKIA 1W3HA 2QMKA 1CZ1A 4UOJA 1O6IA 1ODZA 1UZ4A 2OWWA 1J0ZA 1CGYA 1PIGA 3TTYA 1XD1A 2ZX7A 3VPLA 1M01A 4MNLA 4PMYA 3DHUA 1XSJA 2XJ7A 4PMRA 1E6NA 1JYXA 3AHZA 3MMWA 5EBAA 4ZFMA 5DMYA 1BG4A 1D2KA 2OWCA 3HU7A 2YDQA 1E4MM 1K9FA 4HZ8A 3CZKA 1J0HA 2WZHA 2XVNA 4KMQA 2D22A 2FHFA 3N9KA 2PBOA 1DWFM 3SCVA 1NWTA 1WNOA 3SCSA 1DWHM 3OZPA 4HOXA 1W1PA 3PTMA 5C8BB 2Z1KA 2ZX5A 3OB8A 2VCCA 1J0KA 1SYTA 2V3DA 3AXXA 2D0GA 4Z2JA 3WENA 5A6KA 2EPNA 3L4ZA 5FL0A 2D23A 5LA1A 1ZU8A 2GVYA 4CD4A 1XC6A 1KBBA 2V3GA 2QPSA 1W8UA 3RO8A 3FAXA 2WMIB 1WZLA 5FIPA 4AZ5A 1V0KA 4TOQA 1VFFA 1UG6A 1JYVA 1LG1A 2J7GA 1QW9A 2V5DA 2NT0A 1GQIA 5CXPA 3WD3A 2OYLA 1WDQA 3B8SA 5BRPA 2XFFA 3MUY1 3MUZ1 1IZKA 4P7OA 4IPNB 3AZRA 4JFWA 3RDKA 1E0XA 1JDCA 3WDHA 1WZAA 4PMZA 2PF0A 7CGTA 3GH7A 3II1A 4W93A 1VJZA 2VOTA 2W66A 3BSGA 5I23A 4GQRA 3T0BA 1QI4A 4YHGA 1G5AA 2BY1A 2YDSA 1GJUA 4QAWA 3CUJA 1DWIM 4FF5A 4QLKA 2OSYA 3D3AA 1XGZA 3A4AA 1VENA 3OA5A 3WH6A 3MV11 1TR1A 2J78A 3AIQA 1V3LA 3QOKA 3WMSA 5I5RA 1IT0A 1LJYA 1MW1A 2CKSA 5CZKA 1E5JA 1JNDA 3L4YA 2WZEA 2ZUMA 3CHFA 1WMXA 8CGTA 3W24A 1I75A 4BQ2A 1GOKA 3RM4A 5A8OA 1XSIA 2Z1SA 1MW2A 4CD7A 3UG5A 3GH4A 1UD3A 4TX6A 5I0DA 2GJXA 4XB3A 1B3ZA 3AFBA 3WH8A 2ZUNA 2VRKA 3ARXA 3HJEA 3WEOA 5D9MA 1PZ3A 4QLJA 1A47A 4B9ZA 4W85A 3VMOA 4PMXA 4XX6A 4TVCA 1GHRA 1H1NA 2J77A 2E9MA 3VNZA 3HMCA 4W86A 3L4VA 1VEMA 5CPSA 1KGUA 1H0IA 3RCNA 1UH2A 3TTOA 1OT2A 2WKLA 2XFYA 1CDGA 2XM2A 3WH7A 4R27A 1BVNP 1ODUA 2BY3A 2VO5A 1BG9A 2WHMA 1FH7A 1QNOA 1E1EA 4XZWA 3IK2A 3AIRA 2BHUA 4JIEA 2WSPA 3FHQA 2G3MA 4B15A 3AHYA 3CPUA 5CJ5A 4LKEA 1VB9A 3AS1A 2TAAA 1HJSA 3GTNA 4F9JA 1WPCA 4LGXA 1XH0A 4AIUA 1QW8A 2CETA 2CPUA 1B3XA 3FW6A 4UFKA 3CZ8A 1TFVA 2W61A 4V27A 4AZ7A 1UR0A 3AIWA 4E8CA 1CYGA 4C7FA 1ISWA 3RMEA 4BZYA 3CH9A 2WLYA 4GZIA 4NZCA 1NP0A 1HX0A 4PMNA 1JFXA 3WDRA 1E6XM 1OH3A 3GXFA 4M1RA 1OIFA 1BGGA 1W3KA 1JDAA 1OB0A 1KWGA 4U5IA 4OBSA 4HOZA 4BA0A 1QI2A 3ZJ7A 3BAXA 3W27A 5M5DA 1BGAA 1MYRA 3AHVA 3N15A 1U2YA 4P8UA 3NJ3A 3ZQ9A 1K6AA 2WBGA 4MB5A 2DT3A 5GNXA 4AL9A 3WDPP 4MB3A 1WDRA 2OSWA 3CUGA 2VMFA 1OD8A 3GXIA 2PWEA 2YA2A 3BAKA 1B3VA 1UD5A 3AQUA 1R86A 1R7OA 3BH4A 1C8QA 3POCA 4NF7A 5A94A 1O7AA 2WYSA 2OWXA 2VZOA 5FOOA 5JBFA 3QHMA 1CLXA 2QLYA 2XUCA 4HA1A 1GQJA 2VUYA 2YL5A 2DIJA 2GUYA 1KQZA 1E6QM 1HN0A 4LX4A 3WQ5A 1W8ZA 4MB4A 2A3CA 3GBEA 3WL0A 3AZSA 5A2CA 2WWDA 2EEXA 5A8MA 1AMYA 5D9NA 1UOKA 2W4XA 1TCMA 4W8BA 2C0HA 1HJQA 1GOWA 1KWKA 4WF7A 1EA9C 2UY5A 3PBGA 1E43A 3CHEA 1V3KA 3IJ9A 3WDIA 1EH9A 1E4IA 1DWJM 4U3CA 3KL5A 1UR4A 2BVDA 1CBGA 1JZ6A 1UOJA 1GORA 5DF0A 3W0KA 5AYBA 2DT0A 3WKZA 2PWHA 2ZOXA 1GWKA 1W8WA 1W3LA 3VIOA 2QMJA 2HVMA 1MW3A 1FP9A 1UZ1A 5I3DA 5EB8A 4OIFA 1W2PA 4W5ZA 4M29A 1ZS2A 5CLTA 3N1AA 2IXUA 1K9EA 1BTCA 3EDDA 3CIVA 3MV01 1E0WA 4HPGA 4NI3A 2NSXA 3N17A 4D6EA 2FH8A 3N11A 1QI5A 2WK2A 1V0AA 1KFWA 5E70A 4UFMA 2WSKA 1W9XA 2CKRA 4P7LA 1B30A 4W7UA 4BS0A 1H11A 1W9FA 2WVUA 3F4VA 3WEMA 1E4NA 1F4HA 4JFTA 4MDOA 4ACYA 1RD6A 1JIBA 1Y7VA 4KH2A 1CGWA 1WDPA 3IAPA 1WB0A 1XYZA 3SIMA 2B31A 2WC7A 3THCA 4W7WA 1MVYA 2WC4A 1CXEA 2EBNA 4UNIA 3B9AA 1RH9A 4J27A 8A3HA 3ZJ6A 1ZJAA 3EMQA 3WD4A 4MAVA 1D7FA 2FGZA 1EIBA 2W5FA 1UH4A 4GO8A 1EDTA 4B3KA 4HZ7A 3AXIA 1JL8A 3VGFA 4TTGA 3UR7A 1HF6A 1RP8A 1J18A 4J3VA 4MPKA 6CGTA 1PX3A 1QOXA 1XYFA 3N04A 1XRVA 2GK1B 1Q4NX 1V03A 5HDRA 2DQXA 9CGTA 4OOUA 3PZGA 4A3YA 1NQ6A 3WD1A 1HL8A 2CBUA 4PTXA 4UQ9A 1HP4A 3FN9A 1WZMA 3RM8A 3AROA 4UZUA 1OINA 2G3JA 2YA0A 2FGLA 1WO2A 4BQ4A 1H09A 2GJPA 3W6MA 1WCUA 1OWQA 4J3UA 4AZHA 1GZJA 3DHPA 1VFUA 2WHKA 1LLOA 4P7QA 3SUVA 3CMGA 4YWAA 4J7RA 3ZJ8A 2J8FA 2WLZA 1QBAA 3SUSA 1QI3A 2CITA 1CWYA 1ISVA 1JNEA 3VIGA 5KEZA 3NSXA 3OGVA 5AY7A 1UQZA 2YLLA 4S3KA 1W3JA 3GXMA 5EMYA 1W90A 4HZ6A 4Y7EA 4KGJA 4PCSA 3FXYA 4U33A 3EDFA 2ZUTA 2J7FA 3ZM8A 4MNMA 5I79A 3TP4A 2EJ1A 4OKDA 4CN4A 3AMLA 1JAKA 2OLHA 2PWDA 2BHZA 4J28A 3MANA 1V6XA 1UR1A 4CKQA 3F95A 3B9DA 3A4XA 1GJWA 2EPMX 1CGTA 4J3XA 4D1JA 1HKJA 5CQ1A 3AS3A 1JZ8A 1UR2A 2D3LA 1QNSA 1CGVA 3LPOA 4Z2IA 2FH6A 4H04A 1VEPA 3ARYA 4TVUA 4CUCA 2VQTA 3A6OA 1OBAA 4J3TA 3W53A 2WWCA 5EFFA 4XUYA 3VIMA 3ZO9A 1PX8A 4QP0A 2J79A 1V0MA 3VDCA 4DUXA 4WJXA 1QHZA 1ISYA 3RM9A 1BVZA 1KGXA 4D6DA 1MQRA 3QGVA 2VX5A 4A6SA 1CGXA 3T08A 4GZEA 3IAQA 4ATWA 3SCWA 1AQHA 1ZBWA 1QVBA 3DYPA 4WSJA 3WNPA 3OLGA 3VO0A 4A4AA 1BQCA 2W67A 2WPGA 3AIVA 4AD0A 1H5VA 1IV8A 1I1WA 4H7VA 4JKMA 1XV8A 1GQLA 1B3WA 5HNNA 3ZT6A 4FLRA 5ABFA 1JGIA 2JF7A 2VJXA 1D3CA 3W25A 3ZOAA 3G6MA 2CBVA 4PCTA 7TAAA 4HMEA 3PZTA 4DUVA 1J10A 2OYKA 1V6UA 5DFAA 1MWOA 4PRWA 3QHOA 3SUTA 1MW0A 5C71A 3VDHA 1TE1A 2VR5A 4DM2A 1MQQA 1OM0A 1SMDA 3F5KA 2HISA 3RJYA 2XHYA 1VEOA 1YHTA 1LL6A 5CG0A 2YBTA 5E09A 4HTYA 2W91A 4CCDA 5A8PA 3ZYFA 3SCQA 3VGEA 3RIKA 1CXKA 4YPJA 2BVTA 4AEFA 3AMCA 3VOCA 1NARA 1U33A 4OOZA 1JYWA 5FD0A 5BYWA 2CNCA 3VIJA 3EDJA 3M6DA 4X0NA 2WB5A 3FY1A 4E8DA 3UG3A 4YW6A 5A1AA 1L7LA 3GXDA 4C7GA 3FNDA 3OGRA 4ZXLA 2YLAA 2X8RA 1VAHA 1OD0A 3VD7A 1JXKA 1WCGA 4Q7NA 3TTSA 2AMGA 3L2LA 2X09A 4F9DA 3WH5A 3CZLA 3AIEA 2Y2WA 1NWSA 5IDIA 4CD6A 2OSXA 1X6LA 3BMVA 3GZAA 4CU6A 1DWAM 4PMQA 3L4WA 1GOIA 4NRRA 2GSJA 1EDGA 4LYQA 3W4RA 4CN6A 2D1ZA 2DH3A 1XHGA 3VD5A 1F4AA 3ZSTA 4YW7A 1M03A 1Q6DA 3DECA 3AOFA 1H0GA 2WC3A 3CZEA 1XCXA 4OZOA 4CP9A 1QI0A 1FH9A 2O9OA 4BQ3A 3ALGA 1GPFA 2NW0A 2NT1A 1JXJA 3OGSA 5D4YA 1UYQA 3K4DA 3O9NA 3AXHA 1H41A 1KXTA 4B16A 4YHEA 1VRXA 3POHA 1ZBVA 3WF1A 4ZE4A 1G94A 3E1F1 1E5NA 2XTKA 4LKDA 1H3GA 2UY3A 3K4AA 5D9PA 5A8QA 2ZXQA 2F8QA 2J74A 3PTKA 1K9TA 3NSMA 2WKGA 5A69A 4Z2GA 2JE8A 3NCOA 3ARPA 4JHOA 4D1IA 4CP9B 1M7XA 2WXDM 4V28A 3I3BA 1CEOA 3AICA 3T2OA 1HJUA 1GNXA 2UWFA 2VC9A 3WL1A 2FHCA 2CHOA 3GH5A 4MADA 1TA3A 4MDPA 5JBEA 3J7HA 1XSKA 4F79A 3EDKA 2J62A 4JFVA 3VGHA 4LQ1A 3VX1A 5AC4A 4PSPA 4X9YA 1EHNA 3PN8A 2QV4A 1GWLA 5IFPA 1SR0A 2VR4A 1G01A 4IISA 5A6MA 1KCKA 4PUEA 1VBRA 2ESCA 2DIEA 2QPUA 3BCDA 4MJ4A 4DWSA 3ZJKA 2DT2A 3O2LA 2D20A 4ATLA 4H8UA 5E6ZA 4NSBA 3WSUA 2JIWA 2VZTA 1BYBA 4RE3A 1PJ9A 1DTUA 2JALA 2G4FA 5E0CA 1C8YA 2VZUA 4WSKA 3VU2A 3A3HA 4CU8A 5E9AA 1JZ7A 1VJSA 4UFHA 3O6AA 1E15A 3NIYA 3ARVA 1ISXA 3ZYHA 3TONA 5A6LA 3NUKA 4PTMA 5LYRA 5A95A 3SCUA 3VX0A 2XVLA 4MJ2A 3AIUA 4HP5A 3DC0A 1HP5A 4AD3A 1E6SM 2VI0A 3VILA 1U30A 3SCPA 3EMZA 1B3YA 1E0VA 1NM9A 3VVGA 2WMHA 1B9ZA 4JAWA 1ESWA 2C7FA 3N18A 2G3IA 3SCOA 3WD2A 1CXHA 1UKTA 4AZGA 1E4LA 3TOPA 4MTVA 3VD4A 1GVIA 3SCTA
chains in the Genus database with same CATH superfamily
5EKYA 1KBKA 3BB6A 4RFT0 4ZO7A 2Q02A 2LUWA 2B7NA 3G22A 3ZXEA 4MGIE 4OHXA 4LB4A 4H1ZA 2PS2A 1CPUA 4GQQA 4K8HA 4UNLA 4YU1A 4IGOA 1S2AA 3F4NA 3W88A 1QJY2 2YPJA 3VTRA 5A3TA 1DYOA 1DOSA 4MZ8A 4Q4KA 3VBHC 2ZXDA 3QTGA 4WJEA 1SDWA 2VMHA 1G67A 3F5JA 1SMAA 3O6DA 1DHKB 2BBFA 1XH2A 4WUIA 2W39A 4P7NA 4GO9A 3N9PA 2CCRA 1HDKA 2BGOA 4GIQA 2RS33 3DV8A 1OCBA 1K70A 2X05A 4O61A 3UA3A 1LWHA 1YIPA 1E6RA 5BNQA 3Q4DA 4LXFA 1Q8OA 1PIIA 3O14A 4GI6A 3NXLA 1VJIA 3IUIA 2IKJA 5C6MA 4ZCWA 3NSNA 4H7CA 3UD6A 4H14A 4MWAD 4F2TA 4OHVA 2GWNA 1ZL1A 5C9AB 5IHRA 3UGGA 3VKDA 5FJOA 1UHVA 4HYWA 1UPMB 3NYZA 5FY9A 3WN6A 1XLIA 3ZXJA 5BOFA 5E1RA 3GX9A 4FSAA 4ZVJA 3LBOA 3VBHA 1PS9A 1YYNA 5G05L 4O1FA 5A6AA 3WOGA 4JL1A 4F40A 1H30A 1AF9A 2ZWYA 4KRUA 1FT9A 3NDOA 4MVTA 4WKFA 4AXKA 3VDAA 5T5JA 5L7OA 3QOMA 1VBE3 1JFHA 1V6KA 5AC5A 4PBOA 5GLVA 2WCGA 3ZFGA 5FXWA 3ZXAC 3QV8A 5GPRA 3TA6A 3MSGA 2Q8EA 1N3OA 4PGLA 3S2LA 1PK6C 3PLQA 3VOFA 2W47A 2PDFA 3W22A 4KETA 2P8BA 1SGJA 2WJDA 1QBBA 2ZTKA 5AVAA 1W9UA 2BVYA 4PTVA 4BXFA 1VHNA 2ZXAA 1Y4WA 4FP1A 3IVUA 5IK5A 1UOFA 4M51A 1RVKA 4PIZA 4YM1A 4WM8A 1LL7A 3PZVA 4C1LA 2X0YA 4JD4A 4P8WA 4CEYC 1JRCA 2KR2A 1XIDA 2ZZJA 4E2OA 1RXOB 3W7GA 1W9BM 1BWVA 3CWNA 2UY8A 4COUA 5CFDC 1PKYA 1W5NA 1ZZCA 4GXLA 1JW6A 2JDYA 2XXZA 3ARQA 4YM0A 2JKBA 3GVVA 3DKJA 3A4WA 4KWOA 3PHAA 3O06A 4MWAC 1H1MA 1PHMA 1NCRB 4JAAA 1VBA3 3E6EA 3FGCA 4WY0B 3DFTA 1D0GA 4PH6A 4LULA 5FZ6A 1LOLA 4KWLA 4AYSA 5A3MA 4K1WA 2NX1A 1TTPA 1VYSX 5AC7A 3VZLA 2ZDRA 4UCGA 3MICA 3BU7A 1K02A 4CDUA 4OI2A 2R1DA 2ACQA 1FMD2 1BWKA 4AEEA 2ZEZA 4XXPA 3CM4A 3WMLA 4JN6A 1N8IA 5F2WA 1FMD3 5A7WA 6PTDA 4REQB 3H7JA 3WQ8A 4HVQA 3BVJA 4W8LA 1JCYA 4AWDA 5IXEA 1VYPX 5JPMB 1I9CB 2HNHA 2WZ8A 1T8XA 1V6VA 2PHXA 2UU8A 4R52A 4C6BA 1NOUA 4ZS2A 1W9PA 1XUUA 1EC8A 2AMXA 4XTIA 2QGHA 4D6FA 2EAKA 2HNEA 2GGEA 3H24A 2BNJA 5J37A 1C7TA 2YDRA 4FI4A 5FAGA 2XIIA 3VIFA 4EANA 3N7MA 2RDUA 1RQHA 2QUOA 1YPFA 2BASA 3W6YA 4JX6A 1VRDA 1K3UA 3KP1A 1ZBA1 3DBPA 4IEXA 3U8GA 4XOGA 5CFCA 1D9EA 2YXSA 2BLEA 4Z0JA 1I1XA 3OTRA 4RGAA 2JD9A 3NDZA 3WW2A 4A3QA 5F5QA 2XWJB 3SCNA 3WLOA 3HQ1A 1V08A 5K9XA 3GY1A 3F1QA 4TXEA 3MBDA 1Q6RA 3R58A 3U0ZA 1RCXB 1XSRA 4GI4A 1REDA 2HLEA 1V0LA 3GB6A 3WDTA 3RFAA 3A64A 4Z2WA 4JYDA 4GMP3 3ENRA 2PXJA 1R8LA 3KLLA 3ZZ1A 4RHV1 4IP4A 5DLCA 2E3ZA 3P82A 3APYA 5DT5A 1NLSA 2YYOA 2DSWA 3O7OA 1TVPA 5JQ9A 2GMPA 3WF4A 2PZ0A 1HKMA 4M3CA 2WHJA 4IEVA 3OZYA 3S5QA 5JOXA 1XU2A 1AR61 5CG7A 4O11A 2BXVA 1C3FA 4O8RA 1K5MA 4QKNA 2Q8LA 3WQVA 3TRSB 1R9YA 1LWIA 4LV4A 1H7WA 1J01A 1W5QA 1WZKA 5I0RA 3QH7A 5LA0A 4M19A 4NZ5A 1CXFA 4YVSB 1YPXA 1YQCA 1QHPA 2RVAA 1SJCA 4UTTA 1SLIA 2WS92 3PMEA 5T5PA 4IHCA 2PLJA 2J66A 4FXRA 2ZUWA 1XXNA 1H8VA 1JTZX 1GWJA 5LK5A 2E7FA 4YTRA 1Q6FA 2JQXA 2W1SA 3D5OA 4O18A 4HK6A 4UF0A 1MZFA 4ZONA 2J1EA 1R3WA 1W2NA 2QQPA 3N4MA 1RK5A 4GGBA 7ODCA 1JF5A 3KUMA 1JI1A 1UR9A 1V3HA 2XKPA 4E2VA 3HBLA 4I01A 3QZ6A 1JCTA 2VVNA 5LNSA 1POKA 5KSWA 2Y64A 4MZUA 3TFXA 2E1WA 3C2OA 3SEPA 4RA0A 1MDRA 1QPQA 3W7MA 4EZHA 1ZRQA 2D3NA 4UI9L 1S0FA 2Y63A 4IIEA 3TNBA 4JFUA 1KFLA 1TZ7A 3WNOA 2V6AA 3ABQA 3G77A 3AP7A 3AMNA 4KS0A 4Q0PA 4O1BA 3NV4A 3SH4A 2I5QA 1DGWA 5GJ6A 3BLPX 3MWCA 4NXSA 4RV8A 1ZZ6A 4HKLA 3SRDA 1QOSA 2WSYA 3NOEA 3UVIA 4RNIA 3BAYA 1PNGA 1QWKA 2FDMA 1OGSA 3POJA 1ZP4A 2RJGA 3VMPA 4MOZA 3Q65A 3CUZA 4H8HA 3MB9A 3R4IA 4YNGA 1FNZA 4H4IA 1R3YA 4JTUA 3WHTA 2WNUA 1OYBA 3CJIB 5FF0A 4ADTA 4JTGA 1UUQA 3LOIA 1P5BA 3TQVA 3WCZA 2OLSA 5FY0A 4KEUA 3VMNA 1DLCA 5I3KA 1N1YA 2ZZ6A 3WUBA 4GKTA 5FBZA 2XFWA 3G6LA 3RMXA 5CSSA 4TTUA 1YE6A 2AENA 3LNMA 2YDEA 3VC6A 3I49A 1W1TA 1E0TA 1BFNA 4JFSA 3PZUA 1AR91 2E53A 4J40A 4Q4OA 3DERA 3R6SA 3F5LA 3RCMA 7XIMA 4D6GA 2ZGOA 3WUCA 4C5ZA 1FPN2 4QG6A 1Q6GA 4ICNA 4FIRA 1LGNA 2EXOA 4Y26A 1M41A 3VNJA 3WJYA 1D8CA 3AIBA 1C1LA 1QXPA 3LMYA 1EV12 3VBFB 1L9WA 1UMYA 4YTQA 2GL5A 4JZ5A 2X1IA 5GLZA 5I8SA 4OUEA 1WE5A 4P9YA 1FY6A 4YZ2A 3SC7X 1UBPC 5CSYA 2X5IA 1FP8A 1EJWC 4OGZA 1FNYA 4H83A 3UJSA 1R7AA 2YW4A 4Q2FA 1DZTA 3RX3A 2EKCA 3EBVA 5ABFB 5FBJA 1FWAC 4F0LA 3ETQA 5EV7A 3G1RA 5FA5A 1UIJA 1AH3A 1FOBA 3N36A 1IPSA 3I8TA 4JN8A 1PMHX 4ROQA 3OJBA 4WX2A 1R85A 2HS8A 1IF2A 3TU9A 1W6MA 3VKMA 3N3TA 4LE3A 4GJIA 1XGEA 3MI2A 1PO21 1BXCA 3VBRC 3IRSA 3DOPA 5DDJ3 2Z1BA 2JFEX 3IIZA 1E40A 5LNVA 4XPVA 3GYCA 5AHLA 3JZEA 2NX3A 3TAKA 4YM2A 4AIEA 1FWSA 2ZKLA 5GQBA 1CXLA 4IF2A 2JDUA 4BF9A 4O13A 3Q58A 3ZXFA 3FEMA 4HPXA 1W6QA 1DZRA 1XG3A 2JECA 1YBQA 1VBGA 2PLKA 3POFA 3MKKA 4XW3A 2HWB2 1S2VA 4AFBA 1E73M 2WVVB 4UBHA 1GP6A 4DJDA 1LBFA 1OCQA 3QEZA 3WQBA 1F8VA 2XG9A 1Z32X 1EPZA 3N2BA 3V0BB 4IG2B 4AXNA 1W9VA 3COTA 3VOIA 1OCJA 1A5MC 3M0HA 2Y5SA 5BXTA 4FNQA 3VIIA 2E6YA 2AGSA 4XDQA 2P3KA 1OF3A 3AS0A 1EO7A 3MMUA 5C4WC 3LGEA 3AUJA 3OPWA 1J5TA 1JD9A 4QDWA 4JC1A 1H63A 2G4JA 3ZVHB 3KDNA 3NZRA 1E1CA 2FDJA 2LRPA 2TODA 5ABHA 5FZHA 1TQJA 1VJ2A 3M3EA 3VN4A 3CASA 4MFEA 3V5CA 3NMBA 2XJTA 5HXVA 3AI0A 2CXGA 1IT8A 1B57A 1FYUA 1FWCC 1B3OA 1OKOA 3QQ0A 4O1AA 2YC4A 1UWUA 4PN2A 1G86A 4YLZA 3OLDA 4Q27A 3J7MA 4AVSA 1I2RA 2ZX3A 3KBJA 5CKNA 5E89A 3WINE 4D8AA 4BA6A 4CD8A 3FLTA 3HN1A 4QX7A 1EAH3 1ZHAA 1PPIA 1VLWA 1LOGA 4BWLA 4JHZA 1BKZA 1Q45A 2BNOA 1P0EA 3U2CA 3I3QA 3L2YA 5CPMA 1TZ9A 3A13A 5A1LA 5L9VA 2BY0A 3DIPA 4LHSA 4AVNA 4TV6A 1YIFA 3A22A 3O1SA 2JGYA 2ZA1A 1HXS2 2XYLA 1ZJBA 3RLHA 4AEDC 3SW6A 5G1TA 2D0HA 1Q6QA 2E9LA 1UYZA 3TIMA 3VINA 1PO9A 3FJNA 1H50A 1R6WA 5FJIA 1OXCA 3BAJA 4BJHA 4PEEA 4LUTA 2Z2BA 4G5DA 4A3RA 4XZHA 3AISA 4MXWB 1PO12 3H2AA 4LBQD 3W1MA 1SLBA 2BFGA 1H61A 1W8OA 4A7KA 3VDBA 1C57A 1MR5A 4FK9A 2CLHA 4MKSA 1J3QA 5A6BA 1CB7B 1FA2A 2PEVA 1IPKA 4E0CA 1MQTC 2TSYA 3A47A 4PF5A 1ULPA 1Q6CA 2VT0A 3BN6A 4ML4A 1YXYA 4DWSC 3C7EA 4M4RA 1G4EA 4HNLA 1GVSA 3A0NA 1TYGA 2D0FA 3QOPA 3WQ6A 2J4GA 5FZBA 1XLMA 4PMOA 4IH3A 3VB9A 5FLJA 2ZUVA 2MNGA 1VIWB 5AC8A 4DN1A 5A32B 3VUSA 4NP7A 2Y5EA 4CD5A 4NIIA 3PTRB 2XGBA 1HVQA 5B4XA 1OZQA 1S4CA 1RUJ2 1L2QA 2FHBA 4ZXKA 3MKCA 4DWSD 3ALQA 4FFHA 5F7UA 5A8NA 3EMCA 5DN2A 4Z2HA 3W1NA 4LKFA 1CZSA 4U2YA 2G3FA 1C91A 2WVTA 3B03A 1DGLA 2X41A 5FEPA 5H6HA 2AGTA 2WMFA 5ACA1 1ZY9A 5DXYA 3MHGA 1QATA 2WFF2 1DJNA 2J8TA 4HHPA 1TMF3 1VBB1 4Q4V3 4G7FA 2BBVA 1NWUA 1J0YA 4ADUA 5FV3A 4V1YA 1BF2A 3L2HA 3PVNA 1MS3A 3HVDA 5FPVA 3S9IA 1HJWA 3KW3A 4Q8KA 2XHNA 1CTNA 4NIRA 1ZBKA 4A29A 4ZMGA 1PTGA 5F4WA 3VK5A 1PZ9A 4NJ4A 2OOFA 5D2TA 2XDFA 5C7GA 4ZO8A 3HN3A 1GZWB 2W2IA 4AD4A 3WK0A 3THDA 1F73A 4S2DA 3TEXA 3HGOA 3U07A 5IVJA 5FJTA 2IFWA 3IDAA 2ZMNA 1MRAA 3I2HA 4Q4MA 3SUUA 1GOXA 2JG9C 3H26A 4BMBA 5I6SA 2WKKA 4OQVA 2RDQA 3WK3A 1QO2A 1RD5A 4S2HA 3GNNA 1ZPTA 4L5ZA 2POZA 2RMU2 1PHQA 5J98B 1K7FA 2Y0FA 2PDHA 1F74A 4GGHA 1BPLB 3NA8A 1GOFA 5FKYA 4NWVA 4AAPA 1V9U1 2CIPA 3CB8A 3QYSA 2B45X 2J1AA 4XQWA 2BOFX 3WQGA 1H7OA 4UWDA 1BYDA 1UWWA 1WUFA 2D3SA 4IG2A 2PGEA 2YC2A 2YZ5A 2BS9A 5AVNA 2J6VA 4QX3A 2JDHA 2QS8A 4L61A 5IVCA 4XXAA 3JD73 1H4PA 1TJ1A 4KCWA 5HQEA 3NO5A 4GJYA 3OP2A 1VAMA 4GYKA 4FAHA 2R071 1X1ZA 2NN8A 5EL1A 2PDMA 2BBAA 2E40A 3DCPA 2A3HA 1G8WA 2J24A 4RZ6A 2R6QA 1G9AA 4HPKB 2FMNA 4LSBA 1LOQA 3PR2A 5DCDA 3UY8A 3M5YA 1BXBA 4AH7A 3LEGA 4LY8A 4RUBA 2UV8G 3WUFA 3J26N 3LA7A 4Y1ZA 1G9HA 1EL3A 2NXGA 5MKGA 4M80A 4I6VA 4LUTB 3A9BA 3CPGA 4O17A 3DESA 3W01A 3VZKA 3GC2A 1Y9QA 1IG3A 1OSEA 4NG3A 4MH0E 4QQHA 2QCLA 2AEZA 4FR1A 4J3WA 5T5OA 2VURA 3RPMA 1HKKA 3W1RA 1FWGC 3NKGA 2XL9A 1B0IA 4GYJA 4LK7A 1UWQA 2CLOA 4XVDA 1OX6A 2WMJA 3SCRA 4Y3OA 5F8PA 4CVUA 1F8MA 4GINA 4QLLA 3R8RA 5A6ZA 2R063 3ZFEB 3IJ7A 5HUPA 2OFJA 2X7VA 4LYPA 5I09A 2VQAA 2Y8KA 1DQ2A 4DM1A 5EJ3A 3RHGA 3BIWE 3BICA 4W7VA 1TQ5A 3C2RA 5CAHA 3ITYA 4JCKA 4CCJA 1SR9A 3NNMA 4N7IA 5IOBA 1HL9A 2QZ3A 1G6NA 4CCNA 5CFCC 2WS91 5DRCA 4BKNA 1EJTC 2P50A 1W2AX 3ZN6B 3NQFA 3W9ZA 3P14A 3SRKA 1QJZA 1XYBA 3RNDA 4QR6A 5CPLA 1W9DM 1ODMA 4R9DA 4M6QA 1KFUL 1RQEA 1X96A 1MEC2 3U10A 4JNZA 3UU0A 5BNNC 2B9VA 4I9AA 2CLEA 2I74A 5LRRA 4A2SA 2Y70A 1KD7A 2FJUB 4GUGA 1DU3D 4FLSA 4H3WA 2IUWA 4XJ8A 3WHUA 1FTXA 2JXAA 1J12A 1H8TC 1POQA 5DZEA 4AQ2A 1A0EA 4XILA 4COZA 4XDPA 4BR1A 3RI9A 3NEVA 3L9CA 3N13A 3PHMA 3TTQA 2EO7A 3BC9A 1VIWA 4KQNA 4H2CA 3EOUA 4JDMA 1W04A 1OFNA 3MIHA 1GVFA 3PPFA 2C4XA 2WA3A 1C93A 4GVFA 2WNZA 2F6BA 5JWPA 5J7MA 2IXVA 3B5LB 1OZMA 3PZQA 1ND2B 4E4HA 1RALA 1JJKA 4TN7A 5FUIA 4OQ9A 1GEQA 1LOBA 3LRLA 3SM0A 1UW8A 3NDYA 1ZGDA 3OOXA 1R1A2 2VZVA 4YVPA 4H6RA 2PRMA 1ECEA 5H8UA 3EQEA 3NL2A 4AF9A 2PTZA 1RV8A 3VM5A 3JD71 5HNTA 4DXRA 3LXBA 3LRMA 2WCAA 2DZBA 1S38A 2C13A 8XIMA 2QCSB 3WCRA 1W3HA 3FKKA 3SN4A 3AB0A 1PZ1A 1O6IA 1UZ4A 4CQ9A 4FPLA 4N43B 1GKPA 1TPEA 2GNTA 3VZNA 5CH9A 3KTCA 3DC8A 1CAUB 2O7SA 3LA2A 4B5XA 1W2UA 1OSGA 3TYJA 4MIMA 3LZ3A 3P6BA 3CZUA 3TOYA 2XJ7A 5FO7B 5I07A 2WO7A 2VAUA 5EBAA 3FZ3A 3GD6A 3S0CA 5EYWA 1XS2A 3GUGA 2IFRA 2DU1A 3QJAA 3H0OA 3BW4A 1FKXA 3SEEA 4HZ8A 3CZKA 3HNMA 1KFKA 2G9GA 4KMQA 1VBJA 2BNNA 1JCLA 2Y0IA 4HSLA 2CFFA 4NO4A 3GG7A 4IEUA 3K2GA 2PLV1 1LRQA 4W6WA 4TXWA 1JHNA 3PANA 3THTA 4Y9MA 2Y1HA 1WLTA 4IJBA 4NHVA 3KLKA 4DJEA 1KRIA 4HOXA 3IDCB 1W9SA 2AL1A 1J0KA 4IE7A 2V3DA 2D0GA 2VOWA 4DHGA 4M3CB 3RAOA 4NPRA 3PVOA 3ONBA 4R9OA 5A6KA 2HRWA 4PIXA 5FL0A 2RM21 4E4ZA 3M0IA 2ZQ0A 1XC6A 3N35A 3CV7A 4XJ9A 1GYNA 2XR4A 3BLEA 1F15A 2XJRA 4ZXEA 1TME3 2J22A 1V0KA 1W3XA 1CR7A 4NX5A 5CBIA 2AYHA 1JYVA 1J3PA 1LG1A 3O0FA 4K6BA 4FS9A 5CB7A 2R91A 2YHJA 4K39A 5BRPA 4CEWC 4EIVA 2ZZ4A 3MUY1 3MUZ1 3L5AA 3S5YA 1IZKA 1S0CA 3AZRA 4JFWA 4QJ4B 4IP7A 3VNMA 1HRI3 4QITA 3M4FA 1GT8A 1GVRA 4A6OA 4BB3A 3C56A 4PMZA 3V4BA 2VOTA 4BYYA 2W66A 4RR4A 2D73A 3H12A 4LO5B 2P3EA 5C6CA 1J58A 1TTQA 1P48A 4LH8A 4CCZA 1QI4A 4S3EA 2A3XA 2BY1A 1I60A 1FX6A 1GJUA 3XISA 2XH2A 4Z17A 5ISLA 2R9RA 2E32A 1UNBA 1FV3A 3PF3A 3W1XA 3TBDA 2IVIB 3D3AA 5ABJC 3K30A 4HT1T 2IQDA 1RBAA 5KC6A 4GMEA 2GWGA 2RFGA 3ZLGA 1UF2C 3NAVA 2ARAA 1PVC2 4JHTA 4ATFA 4GISA 3R79A 3WW3A 2Y8UA 3WQPA 5I5RA 3V75A 3CQKA 1ZUAX 1MW1A 2CKSA 3KHBA 3GTIA 4F4RA 1RUOA 2VM9A 1EJRC 3D4KA 3N73A 1OFEA 3BUCA 4QX0A 4IXHA 1RUSA 2Y61A 1DGWX 4GMP0 5HJYA 4GY7A 4HN4A 1XSIA 3E49A 2MPFA 3DN7A 3GH4A 5I0DA 2C6QA 3WFAA 1IEIA 4RDVA 1ZNPA 1F05A 3PJTA 3WH8A 2FZMA 1WCKA 3FJSA 2DW7A 3TYBA 1IG0A 4MSSA 5D9MA 3E0VA 4DEFA 1W28A 4QRNA 4QLJA 4DXSA 3QRHA 3D47A 4W85A 3ZSLA 4YVSA 4Z1VA 1W0PA 5EQUA 4CP2A 4UTIA 1GHRA 3F2CA 3SBFA 2Q5TA 3IIIA 3VNZA 2Z42A 4W86A 5FFOC 3NAPA 1J1LA 1BMV2 1H0IA 1K1DA 2ZC1A 5HWMA 5A33B 4GUJA 2WKLA 2XFYA 1ZSXA 1RBLA 3WH7A 4R27A 1BVNP 2HWD2 2B39A 1A3KA 1M5WA 3LFIA 3RLUA 5EY5A 5FYCA 2BP6A 1SO4A 5C7VA 4BK4A 4NI8A 1E1EA 4XZWA 3IK2A 4WHBA 3AVRA 2FIQA 3W86A 4LTAA 4JIEA 2WSPA 4H9MA 3FHQA 2Z5WA 2CWXA 1V8EA 2WWUA 3LSDA 1WXJA 4JRLA 4XQDA 1F5FA 3I2GA 5K4XA 1YJLA 2OT0A 1HJSA 3DPRC 3OUIA 2WZR2 2NZLA 4FPHA 3GG1A 4AIUA 3PUIA 2VXRA 3O1OA 2HKXA 3W76A 3O1RA 1FI2A 1XF0A 3ZFGB 3IPVA 2GJNA 4V27A 5A3WA 1E9ZB 4KNCA 3AIWA 3BZGA 1NF7A 4DJED 3VKLA 2HSAA 4EN0A 2QCCA 1RVGA 2JG9A 2WSQA 4CUBA 2VGBA 3GVWA 3N3MA 5EJ1B 4GZIA 4JIRA 4NILA 1HX0A 5AC92 3LSCA 3WDRA 2C91A 1OH3A 3O07A 1WGPA 1EX1A 2PA6A 2ZZ3A 4KCTA 1W3KA 1JDAA 5FUNA 1X9TA 4OBSA 4HOZA 2G97A 4BA0A 4LBJA 5FXXA 2GNBA 1P1XA 4O15A 3RVHA 3RYPA 3VZJA 2OGJA 4GUHA 4NHYA 3RI8A 1JPKA 1QMLA 3PY2A 1X33A 5G2WA 3RZKA 3AYVA 5DMMA 1H2KA 2PHFA 4AQLA 4AL9A 5FZOB 3VBUC 1WDRA 2OSWA 3ZFFA 2VMFA 1W2TA 4XTDA 3C2UA 2QIWA 3GXIA 1SZFA 1V6MA 4NZFA 2OA2A 1A4MA 1B3VA 3W7CA 1RBOB 1TWZA 2VWSA 3R5EA 3WQCA 1R7OA 2QDRA 4WVZA 1B35A 1C8QA 2PP3A 3BH4A 4OFCA 3POCA 5LGXA 1V7YA 2A3YA 3ELNA 2PLCA 2OWXA 5C5YA 5JBFA 3QHMA 3C0JA 1VBB2 4AXOA 3TNQA 5GJNA 4ZFCA 3HNBM 1XPYA 5IWFA 4HHMA 4MZYA 2YL5A 5A7NA 2GUYA 1WDDA 4QT6A 5J48A 2RE9A 4E2QA 3EPMA 3D6EA 1W99A 1K5MB 1SW3A 3T1MA 4QDQA 3PB0A 1S2WA 2J1RA 4MB4A 1OABA 3PUQA 1NFGA 3Q37A 3ZN5A 1WUEA 1DIOA 2A3CA 2Q6ZA 3GBEA 3WL0A 1CAWB 1X38A 4JR5A 3LHUA 2INEA 2RR11 3VL9A 2V82A 1MEHA 3C0SA 1UOKA 4AAXA 4GBUA 4IXLA 1L6YA 4OECA 5XINA 1TCMA 1XNAA 2QBXA 3TJXA 1HJQA 2ZZ1A 2OYZA 4K40A 1KWKA 4P14A 2O8QA 2WRAA 1A53A 3UXIA 2RS11 4WBBA 4G9PA 3AKTA 4CRQA 4R7WA 4JTSA 3HFTA 4N02A 3WQ7A 4YVSC 5DF0A 4DRVA 5AYBA 3T4HB 3IVTA 3QQWA 2XMLA 1WW7A 4N9IA 1GWKA 3UJQA 5HV4A 3WY6A 2H8XA 1W3LA 1WLCA 5I3DA 3LAGA 2A6LA 3QMSA 1IT7A 1W2PA 3M64A 3KCLA 4H6KA 4W5ZA 1K45A 2GJLA 1EB3A 5FJPA 2HZGA 4XUOA 1K9EA 4LCRA 1TE6A 5G04L 4JS3A 4CUGA 1BTCA 2I1OA 3EX1A 1VIZA 3ES1A 2A71A 4CCOA 1ONXA 4D6RA 3KZPA 2OKOA 3SZ8A 5FKBA 2X1SA 2J1UA 2ZRXA 2HQAA 3BLLA 3B0VC 2QQWA 3FE5A 4OUIA 5A7WB 2HTMA 3F03K 2CXEA 4Z2AA 3H23A 3CO8A 2WSKA 1W9XA 1W8NA 4P7LA 4QM9A 4W7UA 4BS0A 1U0AA 2FCUA 1IKQA 4QHBA 1R081 4G56A 2EIDA 1E4NA 4I6KA 1TCDA 4FP3A 5DMLA 3IIOA 1WA4A 1RD6A 1JIBA 3O16A 2BGPA 1YO8A 4KBZA 4HKPA 3IAPA 3ZS4A 3SIMA 3AU6A 2H8ZA 2B31A 3THCA 4BDVB 2WC4A 1SFTA 3GZEA 1CXEA 2EBNA 2F6KA 4GYPC 5I0UA 1AW2A 3KFTA 4QAIA 8A3HA 5D2AA 3MIBA 4S23A 4KFPA 3SKVA 3WD4A 2ZHMA 4I02A 4MAVA 4CDXB 1XC4A 4XUPA 1D7FA 2FGZA 4C6CA 3RU6A 3H1MA 2Z1XA 3NQ8A 4GO8A 4H19A 5D1IA 4B3KA 1HKWA 1JL8A 4CEYA 4TTGA 2D5FA 4EVZA 3UR7A 1DYKA 3O5SA 3PNZA 4IZGA 3P81A 1RVF2 1RUJ3 3FXGA 2FVMA 5J8LA 3Q2DA 4YWIA 1PX3A 4GKYA 2LALA 1AR63 4NU7A 4FPJA 5JR7B 3K2OA 1Q4NX 4P5YA 5HDRA 1XSQA 4UWMA 4EQVA 1SPQA 2DFBA 2PMQA 1QO5A 1J1TA 4R4XA 4OOUA 3HGRA 1NQ6A 4AGGA 2J6XA 4IX2A 4XVEA 3WD1A 3TQ0A 2FDIA 2CBUA 2QQUA 5CKQA 1DJZA 4UQ9A 3TC6A 4ZGYA 1F2NA 4PDWC 2W6RA 2X2GA 3RM8A 4RHV3 2PAMA 3SN0A 2DZXA 2G3JA 2BODX 2YA0A 5CFCB 5FYVA 3EXRA 3MW4A 2GZXA 1CX1A 4L1WA 5C9RA 1NCRC 1VFUA 4LEQA 4JY8A 3URFA 5GALA 1LLOA 2WHKA 5FSEC 5K0UA 1DG6A 4YWAA 3ZJ8A 5FJKA 1KRMA 3PAJA 1CWYA 5FYZA 1ISVA 4GH1A 2BUKA 2V68A 2YW3A 3VIGA 5KEZA 3L21A 5JVLA 4ES8A 3H2EA 5EMLA 3B69A 4BZ4A 1W3JA 3JB4C 1XKYA 4XABA 5I3FA 4A45A 3PB2A 1JEZA 2ZTJA 2D69A 3POWA 4Y7EA 2UURA 4HCDA 1AQFA 5DPNA 4U33A 3CEPA 3ATGA 3NW4A 4CDUB 1PL9A 2IQ0A 3BW2A 1HB1A 4LVDA 4DLMA 1H1IA 4ZQOA 4N9EA 4XJUA 4OKDA 4FAGA 4CN4A 1ADOA 3NV1A 1H62A 1YFWA 5LIKX 3HQUA 2DCZA 1RYYA 1JS9A 3J7NA 1FMD1 4IEQA 3NM1A 1OADA 3OBKA 2DORA 4CKQA 3F95A 3A4XA 4L99A 2EG8A 2QCMA 2FLIA 2ZC8A 4L4MA 1BEUA 5CQ1A 5BNNA 1OYCA 3AS3A 4XAZA 4YYFA 4ZR8A 2POTA 3P93A 4PUJA 1JQVA 2D3LA 4DAFA 1NUKA 3BO9A 1PV8A 3BV7A 4AHPA 4IQLA 1YBQB 4FX8A 4YCOA 4H04A 5JAXA 2EALA 4TVUA 5LKYA 2VQTA 3OVQA 3A6OA 4E4SA 1OBAA 1UOZA 2R1PA 1PX8A 1JUEA 4RL7A 3VDCA 1V0MA 4WJXA 1QHZA 4M3CE 5F6KA 5F3IA 3W7PA 1C8NA 1OI6A 4D6DA 2HVOA 2LS6A 2PMWB 5FMOL 3UFYA 1UASA 3S0MA 1KA9F 3HIFA 3DEMA 4LEJA 3ZWSA 1BCXA 3RXZA 3QGVA 4A6SA 3T08A 3SCWA 1AQHA 4BXSV 1DQUA 2BDRA 1ZM1A 3LA3A 1Q2SA 3I59A 4A4AA 2W67A 2W68A 3ZVXA 3VZXA 1VGAA 3B05A 3P62A 2P3IA 4FLRA 5ABFA 3FFQA 2RUSA 5DAXA 4YVVA 5JU6A 4HMEA 4DUVA 2OYKA 2XJSA 2NV2A 4PRWA 5CIRA 5FSDC 1XX1A 4L9XA 1U22A 4DF0A 4LEFA 1F2JA 3H22A 3ZWTA 4B5VA 1COV1 3PJQA 1EC9A 4Q4X3 2ZVRA 4H9XA 3RJYA 2A70A 1VEOA 5HQMA 2OXNA 2ZRUA 2DDUA 2W91A 2PLMA 4AEDB 1R1A3 1GPWA 4XMAA 3GR7A 3OD0A 3G1XA 3G0SA 3RIKA 4DS0A 5EPAA 1RHI2 3UGVA 3S7IA 3VOCA 1GZGA 1S39A 2R042 4I0BA 5E0KA 1JYWA 1QIQA 2YB4A 2YY1A 5BYWA 4QHZA 5LK7B 3GZTB 1TIWA 2W9XA 5AFEA 2FB2A 3BPWA 2NVCA 4HJFA 1JU4A 4YW6A 3TW6A 2XH4A 3PDQA 1AZDA 2YCLB 4YZ5A 1VAHA 3VD7A 5AVHA 1UX6A 1XLJA 4Q7NA 3TTSA 2HBTA 2Y33A 4FPSA 1NCQB 2E7AA 1FCUA 1DQWA 4HN1A 3KTXA 4CP1A 4JICA 4ZTXA 2Y2WA 2KX9A 2HJPA 3RX4A 5IDIA 2B7QA 5FF2A 3GDMA 1XWYA 1W39A 1DWAM 4PMQA 1UZZA 5JSOA 3ICJA 3GXNA 4FNRA 4EWJA 4KEZA 2GMEA 4SBVA 4C6PA 3W58A 2RS31 1AX0A 1H6YA 3TZFA 1FPN3 3NQHA 1TWWA 1XPGA 1MACA 1A78A 4ARYA 5DQPA 1F4AA 3MHUA 4PBFA 4US5D 3DECA 3EWZA 1R47A 1Y8BA 4FZIA 1CIWA 3VCNA 3WLLA 2WC3A 4YW5A 4OZOA 4CP9A 2GC1A 1QI0A 3M2MA 3RJ2X 1AZ1A 2VFHA 3ZPOA 1XBXA 2O9OA 4BQ3A 4ICMA 1W9WA 1N1VA 3N9LA 3QTPA 1SUXA 2QR6A 4U4MA 2NW0A 4MY9A 2QVNA 3GFXA 2NT1A 2H0VA 1PUDA 2DZSA 1OUXA 1CESA 2KM2A 3GR8A 3H4GA 4JX5A 3O9NA 3AXHA 3E5QA 3KVBA 1IOAA 5T52A 5FP9A 1G4SA 2RDXA 2HBUA 4OVEA 3W7JA 1RL3A 4Q8PA 3HAGA 3MY9A 1Q63A 4LBQA 3E1F1 3GNEA 1E5NA 1EJ7L 4KL1A 4XKYB 4RNFA 4LKDA 1H3GA 4HJWA 3K4AA 1KTBA 3PTKA 3OHIA 1K9TA 4GJJA 2WKGA 3RZZA 5A69A 1DL3A 2D98A 5HJXA 2A4AA 3MIDA 3RZMA 1TNRA 4DRRA 4DYKA 5J5RA 1H4GA 2XJUA 5HQLA 3LDBA 3LEMA 1T41A 2ZYFA 1M7XA 1YQ6A 3I3BA 1CW2A 3AICA 4E2SA 4NJHA 2AC1A 1HRV1 3T2OA 4ATEA 4L7ZA 1L8PA 1HKDA 2VG9A 3L66A 3WLMA 5LY2A 5FOBB 4AHZA 1NCQC 1XSKA 4QEHA 3LN3A 4AX7A 4F79A 4LBLA 2J62A 3BIEA 2O1QA 4JFVA 3D0JA 1OVDA 4FPFA 1ZBE1 2ZABA 2F2KA 5A7QA 3N29A 3ZFGC 1KBJA 4XFBA 5SV8A 4CXWA 1X8EA 1XDLA 1W8SA 1KCKA 4PUEA 2OR2A 3G1SA 4N9HA 2V8ZA 3EB4A 4LVBA 2GVJA 1KM3A 2QPUA 3BCDA 4MJ4A 4DWSA 4EN7B 1W3IA 3O2LA 5IBXC 2BOGX 1XYNA 3OO2A 4XUGA 4NSBA 3DAQA 2GQ8A 2CZFA 2PHWA 2VZTA 1PJ9A 4UW4A 3NQGA 3FDGA 3NV3A 3CV6A 1XBVA 5E0CA 2VZUA 3S5AA 1C8YA 3F4CA 4WSKA 3TH6A 4OHQA 3A3HA 4CU8A 3WZ0E 1JZ7A 2LW8A 5BNKA 4Q4RA 3WLKX 2MHFA 1E15A 3LGGA 4UTJA 2BOIA 1Z41A 2AL2A 4KWWA 5H9PA 4RV3A 5IRPA 5D8AB 2X42A 2CU5A 2QFEA 3GSMA 5HMSA 3NGJA 3P3BA 3VX0A 4PBEA 4RS5B 3URAA 1K7EA 1S3TC 4ADSA 5JZGC 4MJ2A 3WP4A 3AIUA 4K7VA 4G9SB 4DY3A 3R94A 2WFF3 3O1NA 1NY1A 4PT6A 1KTNA 1E6SM 2VI0A 1TELA 3SCPA 3X29B 3HGSA 2BPA2 1CJDA 3ACGA 3I2IA 2PDGA 3AJZA 1B3YA 1E0VA 1NM9A 3CYVA 1H2MA 4D8LA 1CONA 1ESWA 1ICSA 2EJAA 1LHOA 3N18A 1YKWA 3ZXLA 4QB2A 4JYEA 3SFWA 1JYTA 4HHHA 2HWC1 3WD2A 1CGPA 2BQPA 3LCLA 2ZEYA 3U4XA 4AZGA 2ZBJA 2CW6A 1EC7A 3KHCA 5FJRA 3GG8A 2Z27A 1YDVA 3GQYA 4IQPA 3T0CA 3T4CA 1GVIA 4P8UA 3AXKA 2QF8A 2RJHA 4US6A 3N4FA 5M1TA 3PTDA 3VIKA 3I2FA 3CQ0A 2O8OA 4WK9A 4KKXA 1P4CA 4GIYA 1IXOA 3ARSA 3D3FA 5CBBA 4IPJA 4HMDA 1OC1A 4QXHA 1EZ2A 3W02A 4AHYA 4HB7A 4S3JA 3AXEA 5M3WA 2NQJA 1JOJA 2PURA 4IPLA 3KL3A 3W37A 1BQGA 4Y4RA 3ZIZA 1YTDA 3FKRA 4AFAA 4C5YA 3JR2A 1AUYA 4TVDA 1DZQA 4M24A 3WVJA 4QCEA 1RUG2 3IT8A 1H7RA 2XVKA 1GJPA 2RS52 3DGBA 1RUI2 2G9FA 3P7YA 3R1ZA 4WM8B 4U28A 4MB1A 1JULA 4HLTA 2J7HA 3QCWA 1EUTA 3K5XA 3YPIA 1PO13 4PBPA 3B00A 2GQAA 2ZEWA 4UB9A 1DXEA 3TYDA 1D4M3 2PC8A 2EF6A 3S8HA 3I4IA 2ZGLA 1SJDA 1KCXA 3FWEA 3BLDA 2XG3A 1GFF2 1MZRA 3CAQA 1UWIA 2HMCA 2VCMA 5JDBA 4LYRA 4I7UA 2UY2A 3UXLA 5HNUA 1MXGA 3I65A 1HFBA 2WZPP 1YNYA 1HXS3 5A3HA 3M7AA 3ZFHA 2DH2A 1AJZA 4M82A 4EJRA 1O68A 1C8M2 4CQCA 4LKSA 2R6OA 2VBDA 1CECA 2XH0A 1JUIA 1VS1A 2PWUA 3BGAA 4NPMA 2J88A 3V0AA 2W94A 1AL22 3UZXA 4MPQA 4HU0A 1S0EA 3NFUA 1ULCA 1RVF1 3RZHA 4UCFA 3GTFA 4A2RA 3IKWA 1LUCB 4JQ4A 2ZACA 4AB4A 4CCMA 4L11A 4NWWA 1R9XA 4GWIA 4QDRA 1RITA 5D37A 1GANA 2ZXBA 3GIQA 4AD2A 2D7FA 1ITXA 1C28A 2PDLA 1RCOB 1KFEA 2F61A 2DZTA 4WKAA 3ORJA 4K68A 3G0XA 5D21A 3AHTA 3RG0A 2V38A 1JZ5A 4P8XA 5K4ZA 3W38A 1A4LA 2VX4A 2BFUS 4LNCA 1K8ZA 1O5XA 4QDMA 3KWSA 3EB7A 1DJHA 2EICA 1VFTA 4FT8A 3ZMOA 3NNTA 1AVAA 3LHVA 2OZTA 3BQ6A 2XIBA 2YL8A 2CGPA 4P00B 1NF0A 4FAMA 1IZJA 3KBMA 1HIZA 2PU0A 4MNKA 4NXKA 3UJRA 3LRKA 5CC3A 4YGDA 1ENXA 2VQUA 1PIV1 3ZT7A 1FOD2 3RWNA 3STEA 3OY8A 1XLFA 2CHHA 2GN3A 3F2ZA 3UV9A 2OODA 4HBNA 1DEDA 2NZ9A 4OCTA 2ATMA 4RZ5A 4BLJA 3ID7A 3S2CA 2VGIA 3MLJA 4C1XA 3S6TA 2Q0AA 1E6ZA 3S6OA 1OVSA 4A8NA 3V5OA 2Y7EA 1MS9A 1X9PA 5E16A 4D71A 3NSTA 2WNWA 4QKDA 3IDEA 1WQ5A 2D43A 4QGMA 4ZTYA 5JI7A 1SBFA 4TMBA 2WLPA 1F3WA 2ASHA 1G0CA 2CERA 2DSKA 5FF4A 5C4WA 1Y0EA 3OBAA 4LMFA 5JBDA 2HWB1 4MLOA 1CLKA 3GNOA 1K3IA 5DDJ2 3HWJA 4UC5A 1G7YA 1CZTA 4MWAB 5A70A 2XOMA 1G9BA 4ISQA 1X7NA 3WF3A 2BYVE 4XQ4A 2BWGA 4EF8A 1QJX2 1QQP3 2VNOA 5HXMA 2J1TA 3N9OA 2IKIA 4MHRA 1G4TA 1IKPA 1RPXA 3GC4A 1EQCA 1IPJA 3N2XA 4X0VA 4LXLA 5JIUA 2WKJA 3LSBA 1LRNA 4GVHA 1AHSA 4YW4A 4KQ7A 2UWCA 4AEMA 5M03A 3WUDA 1NSJA 2K9ZA 2ZBTA 2B7OA 5FLHA 3NJVA 3PUOA 3GU9A 1EOMA 3WUGA 3OU8A 3ITQA 2D6MA 4RE0A 3BU0A 3G3DA 1UXXX 3OEAA 1V6TA 1VFSA 1DQ1A 3PZIA 1PK6B 3OG3A 3O0WA 3VD9A 1NA1B 4RQPC 3TDFA 1B9BA 1VE0A 5F32A 4GD0A 3MS8A 3G18A 3ZXDA 3IPVB 2ZZ5A 3W87A 1OEPA 3M0JA 4RX0A 3U1XA 2PDCA 1NX9A 3HTWA 1QJU3 4MWAA 1BLIA 1PZ7A 1UMIA 2XSBA 2GK1A 1UQYA 2VRJA 4X8PA 4R5EA 5J09A 1LEMA 4UW6A 2DZWA 1EY2A 3N9MA 1XE0A 2WO2A 1PCWA 2EGZA 1K12A 2OUHA 1LESA 5C3PA 4LPLA 4L80A 3GHTA 1RY8A 2NVDA 4AD5A 1KFCA 4Q4W1 3V35A 4YW3A 3KWVA 2ZX6A 1ZAJA 3O1TA 2PE4A 1TG7A 3WNKA 2FZBA 3EEGA 2VBPA 2CLKA 5E5CA 3IJ6A 4PL1A 1Y5XA 3LY0A 2BTMA 4HOOA 4N6FA 4B5TA 2KAUC 5D9OA 2HBXA 3W26A 1KFBA 3NWKA 4D6CA 1R091 3FVMA 3RCYA 2XBO3 3SCFA 1TV7A 2EXKA 2EPOA 2LTNA 3P0WA 4N9BA 4XVHA 3LNPA 2BRTA 4A3XA 4RD7A 3VOHA 3LCIA 2O7QA 3TTEA 5CPTA 2WMGA 2HWD1 3MIGA 2PWFA 4EAMA 1Q5OA 3EPOA 1E3XA 4CPBA 2RHGA 1NDVA 1F9CA 3E74A 3AMKA 4LAZA 2QCNA 1MNZA 2Y8VA 3OLEA 1XIIA 3VIPA 3GUWA 1UYPA 1UH3A 2BERA 1JF6A 2Y5JA 4ZENA 4DRSA 4W6XA 2VR2A 4OI4A 4MKNA 3NO3A 3TUUA 1I45A 2ZDSA 3RMJA 4HNUA 2ZX1A 1AYM2 2ISVA 3UT0A 1JODA 4PL2A 3AZZA 3WG4A 4RCXA 1OA3A 4NROA 1Q85A 5TF0A 1GYKA 2W0XA 4L97A 1MUWA 3WLPA 1RUI3 4R9AA 3BOXA 1U5YA 2DWRA 2ZGSA 5HCFA 3NPWA 5C8CB 5K2ZA 1VZWA 3RUBL 4GX9A 4TYSA 5DAWA 2VDGA 2WVSA 3GG0A 1KBLA 4M3PA 1DVJA 4EE2A 4HXCA 4CXYA 1L8NA 5FZ3A 1JCXA 4WVWA 5F2LA 3ZN6A 5CSUA 3KL0A 4B3LA 1UD6A 3U4SA 1FH8A 2WW5A 4PODA 2GSYA 1Z48A 4LA3A 4Q1RA 4RE4A 3M70A 2R041 1NP2A 3VGBA 5KZ6A 2OXBA 3OTFA 5DBUA 1XXXA 3RJRA 3HMJG 4YCPA 3SCGA 4Z2LA 3CHCA 5F4SA 2PP1A 5C9ZA 1PIFA 3WELA 3PBWA 4EPBC 1UD4A 1FCQA 4DO4A 4KWKA 4AW7A 3LHYA 1XQKA 4YSFA 2HWF1 1HQTA 3NAPC 4MJZA 4MHUA 3LDVA 3D6NA 2Z69A 3WQWA 2XWBB 3BSMA 1H2NA 4N0RA 3PPGA 1J0IA 4B5UA 2GVGA 4LE4A 5FAJA 1DJGA 4IV1C 1YDYA 3T3YA 1US3A 2CAVA 1FCVA 4DINB 4PYSA 3GIYA 1RUI1 2F38A 4L1XA 2FQPA 1SO5A 4Z8BA 3M5VA 3WQ4A 3UESA 3SGUA 3QLQA 2UWAA 1FWNA 2VD9A 4IGHA 3U3HA 1CN1A 3C2EA 2NQ5A 3H42B 3QMRA 2YCKX 4WD0A 3U2EA 3NWRA 4JNMA 1W32A 5DY3A 2VNVA 2JD4A 1UPPA 3CUIA 4XURA 4ERIA 3A3WA 2AREA 2HXTA 3RZJA 1V6LA 1QU0A 4RZ4A 2WN2A 2YPIA 3S2JA 3QFWA 3V56A 3EHKA 3ATZA 3RYKA 2CTVA 1T6GC 4EV0A 2JG8A 3PBUA 2RS12 1A3HA 4PBGA 2XBO1 3FHAA 4D94A 3G3MA 1VRBA 4NHXA 3WBEA 2WQZC 2LROA 2PRHA 3CMJA 1W56A 4WDXA 1EF2A 1HIXA 3N7KA 1IQDC 4NR1A 1EO5A 2PN5A 1QHOA 2CZ5A 4QPYA 1KCLA 3KZ4C 3WF0A 4OE7A 2OZ6A 3VDGA 2A1YA 5LHEA 1UY4A 1DIEA 4LAOA 4GFSA 4BE3A 2OGYA 2J7BA 3CJXA 5T9CE 4GI8A 3LPGA 3LIGA 4B4PA 2YJQA 6XIAA 4IV3B 5JMOA 1P8JA 4Q4W3 5LEJA 5FP7A 1YFXA 1AQMA 3OJGA 3BOPA 2Z25A 1VBHA 1EUAA 1U1UA 4HANA 3KRZA 4V2XA 4EE9A 3CZGA 3GDTA 1H8TA 4QPIA 3U57A 1QFEA 1LLWA 2ORXA 5SV5A 2DSVA 2IWGB 3N2OA 3ZSSA 5HPOA 1ENUA 2VZSA 3NL6A 4HNOA 4MOAA 4P5UA 1YE4A 1EWDA 1TPUA 4NOTA 2EAAA 2VELA 5CG9A 4I2OA 5HR6A 4X22A 5KR7A 3K8LA 3WQOA 1UD1A 2HK0A 1OT1A 4W9TA 5D04C 4NE9A 4IFKA 1LOSA 2XVPA 2R062 3PZNA 4GY0A 4ZXOA 1JUBA 5HATA 2C3ZA 5C4WB 4DJFA 1W9YA 4XAEA 3BMXA 3KBWA 1V6WA 3UJFA 3J4UH 2E9BA 3MO4A 2VX6A 4HT3A 3ZLFA 4MUPA 3RDIA 1VCGA 4K36A 2BZDA 3S5NA 2VOMA 5FCZA 3W82A 1ULEA 1QUMA 4LUKA 2BDQA 4BCEA 4G2DA 1EUNA 1E71M 2QAPA 3NZPA 3ZR6A 4ES4A 4IM4A 3QHNA 3KE0A 2G41A 4B5SA 4AWEA 3USUB 4WJ8A 1FBAA 1RXGA 1J2BA 2OX4A 2CGNA 1EQPA 2GQ3A 1VFOA 4KBXA 3JU2A 1I1EA 5L36A 4QJ1A 2VTXJ 1VALA 4C6MA 3PZ9A 4XF9A 1QW7A 2ET7A 1J5SA 2A3EA 1SFSA 1F6KA 1X8CA 1JCJA 3CUHA 4JTJA 2VL4A 2VVEA 1ZCOA 3LX9A 1QPOA 4OLLA 2HWB3 3G1AA 1JD7A 4ZB5A 4RSUA 4K6AA 2DFCA 1VP5A 4Q8VA 1YI9A 3MJYA 2QE3A 1QPKA 1C8VA 5T8GA 5FZ8A 3SY1A 5FY8A 2YYUA 4Q8NA 3NNFA 3CQIA 3L0NA 4HN8A 5CGMA 4X6QB 1ITCA 3AXDA 5E9XA 4TUFA 3AJ7A 4GB31 2E6AA 3LFMA 4FOKA 4H9VA 3ZKYA 1BHGA 3KF3A 1RUF1 1QJFA 2XDVA 1ULOA 3GRIA 4PFMA 1NQJA 3TYCA 3LG3A 3NQEA 5AN7A 1RUC1 4XD4A 3WUEA 5ABTA 2QJVA 4QQUA 4RK8A 1ITQA 4AWUA 1AL8A 3TN91 4NYUA 4GRSA 4B90A 4Y5Z0 1G6CA 3ZLHA 1BBT1 2FDGA 1EP2A 1XKJA 2P5NA 4P9XA 1NH6A 4AYGA 4PUDA 3BCJA 5IUQA 5GZGA 2CU0A 2MANA 2NLYA 3VE7A 1JU3A 2VCBA 5FZCA 1OC5A 5D32A 4HA4A 3DYMA 4AY8A 2J7EA 4E8GA 4AISA 1RGSA 5A7SA 4MLRA 2YROA 1CWPA 4UOQA 3EWWA 2WSUA 4DXVA 2W1WA 3MVIA 4NZJA 5GZDA 3G1VA 1V70A 3UP8A 4N4PA 4EX4A 5BWAA 3UNTA 3AZVA 3RR1A 3SQOA 2O9RA 4B7EA 3DHDA 3OBEA 3BLIA 1LWJA 5FL1A 2OZ8A 1AL21 2W79A 3RMYA 1J9YA 2Z79A 2BJSA 2ATFA 2YV8A 2PI6A 4U31A 1HXS1 3R43A 1QT1A 1KXHA 2P3JA 3PM6A 4QX2A 4AUBA 2YBUA 3GS6A 4M0NA 3UETA 3VDDC 2FDHA 2Q1FA 3AMGA 4MVAA 3WK2A 2J7MA 2V5CA 5CNAA 3V0AB 1VLIA 3JVAA 2AL2B 5FMCA 1RJ7A 1UA7A 3UXAA 5A3OA 2WUHA 2ORZA 3DXUA 1ZBCA 2PBGA 4ARXA 4JQ2A 3GVQA 1P7TA 3VKNA 1GNZA 2ADAA 1NOVA 3W1LA 4RYDA 5GM0A 4I9MA 4O52A 1WMEA 1OMIA 1TUXA 2ZICA 3M7SA 4JCLA 4XWUA 4UOZA 4LB3A 3OEBA 1VFLA 4DXKA 5FMBA 4GKLA 2AKMA 2JF6A 5FZDA 5BROA 1TVNA 1YQ8A 2HEWF 3RYRA 4ASMB 3EGJA 1ALYA 2XLAA 4IEOA 5IDZA 1MQPA 1D0HA 3OGGA 3KV6A 1UWRA 2DVUA 4XFCA 3W2LA 1AFSA 4AZBA 4J3SA 3WK1A 4UTFA 3BG3A 3POGA 4PLNA 1UWAA 3U7BA 4E2DA 2QF7A 4MF4A 4Q22A 4IGNA 3UZ5A 2E8YA 2JBMA 1TA3B 3PMSA 4J5NA 3I7RA 1EP0A 4ZQCA 4Q29A 5F3EA 5A2AA 2VD8A 3D5HA 4MHBA 4REQA 4NMIA 1EF3A 2D24A 2ZE0A 2HXUA 2ZGRA 3KCXA 2XGIA 1OGGA 2PWGA 1GU3A 3WH9A 4GIAA 3UYIA 4A7YA 1RP9A 4DBSA 1VFMA 3M0XA 2V63A 4EPDC 4HPKA 1SPPB 3M0ZA 3NPUA 4IMAA 3N2CA 5JXJA 4Z1AA 3KT7A 2Z6JA 3VOGA 3UQNA 2ACSA 4MGQA 2DY3A 4R85A 2PHLA 4JQRA 4QQPA 1CAUA 3LD5A 3TCEA 2BY2A 3KRBA 4UQAA 1G4PA 4JTTA 1KV5A 5C0QA 4D9PA 4W4ZA 2CESA 2PDQA 2DEPA 2HEJA 4CN1A 3AYSA 1QF3A 4ZE5A 4QXIA 1IXPA 4NN0A 4L4PA 1GVEA 1OFOA 4AAJA 3LOBA 1GZ9A 2Z29A 1S55A 2CWNA 2ZUUA 1GKRA 5ABJA 5FPAA 3QY6A 4LBKA 2ZFAA 2XUEA 3A0KA 4DPPA 1TPC1 2MEV3 4Y5TA 1PTDA 1J79A 4Q8TA 2UYAA 3LBMA 4TO8A 1UWSA 1BQPA 1UD2A 4PIYA 3LGRA 1O8SA 3MWAA 4LITA 5U4NA 2I07B 1UY1A 1HNYA 3UYCA 1T0OA 1UD8A 3FX3A 2NWRA 4E2BA 3WG1A 1OGBA 1DBTA 6TAAA 1ZLPA 3GNRA 1KDKA 3QACA 4ITCA 3KOWA 4Y22A 1LOEA 5H8PA 4OHZA 1TWSA 2JIEA 3DPRB 3AYDA 5BNPB 2HWGA 2HWE3 3MU7A 1YEWA 3BDKA 3FYOA 3QH2A 3AVSA 4S2FA 3UG4A 2R30A 5FZKA 1VC4A 5AB3A 1Q6EA 1PHWA 2A5HA 1R092 2QCDA 3OD4A 1PB0A 4D8MA 2K2SA 1AD4A 4DQWA 3S9YA 5L9RA 4RL3A 4EXAA 1ZP3A 3NZ1A 1WAWA 3VGGA 2JDKA 4CU7A 4RDZA 3DF0A 1KB3A 2VUJA 1VP6A 3ITOA 2YGLA 4AI1A 2V3EA 4F48A 1A5SA 1Q8AA 3PBMA 1JAEA 1OFAA 3WYZA 3J7LA 3B8UA 1K42A 4JEQA 1E70M 4J2MA 1UKSA 3L2IA 3CIHA 5GNYA 1EWEA 5BMWA 2QUMA 4COYA 4HMCA 1WAUA 3R0RA 3ZFEA 1J0JA 5LZ6A 3KF5A 4G6CA 2E8ZA 4TR9A 2QQIA 2G1MA 4Y24A 2VMIA 2R49A 3PBYA 3WLIA 4IMGA 1RUNA 5F39A 2QMKA 4XJZA 4UOJA 4ORFA 3QV7A 1XYMA 3RYSA 2DZVA 1CGYA 1FOD3 2VOXA 4C6DA 2ETEA 5JMUA 4IGMA 1MS8A 3LQLA 1XD1A 5L73A 2ZX7A 2E77A 1B5TA 1DTNA 3TV8A 2VM8A 4MNLA 1XM3A 2YUEA 3ZYJB 3DHUA 2HBVA 3ATYA 4PMRA 3AHZA 3JZUA 2OWCA 3UZJA 4DZ5A 1PM4A 3IIAA 4Z0SA 2FVKA 1K9FA 2XONA 1J0HA 2QUUA 1XLCA 4ASKA 5CVRA 1FXQA 4YYCA 3WQ1A 3N9KA 4INDA 3NZQA 3AP5A 4O9GA 4GVGA 1OFDA 3B4YA 3O0KA 1NWTA 2QNEA 2JB8A 3SCSA 4B7KA 1DWHM 4X63A 3OZPA 3VABA 1XIHA 2HWF2 2Z1KA 5LBFA 4CQ8A 1RUD1 4HU3A 1SYTA 3H54A 2NQ9A 4Z2JA 4I3GA 5C9UA 3WENA 4XIMA 3WZ1A 1UZWA 2V67A 5EIYB 2PGFA 1KJLA 3L4ZA 3W1TA 4F0SA 5TAOA 1H9PA 4CD4A 1O4ZA 2BVWA 4A8RA 1W8UA 4ZS3A 3NXFA 2F4LA 2WMIB 4F3JA 1GK8A 4TOQA 4Q4Y3 4KESA 1UG6A 3FSUA 4PB3A 1I2PA 2FTPA 2WA4A 3T1LA 2J7GA 5LNRA 3GIPA 2V69A 3MEPA 1EV11 1GQIA 5CXPA 2WC2A 3WD3A 1COV3 2OYLA 1KKOA 2WNUB 3B8SA 4GWMA 1S5VA 3RDKA 2RDRA 3VZOA 2ZX0A 1QXJA 1PWMA 5B2GB 2NV1A 4WOQA 1UOGA 2PF0A 4ZPIA 1CD3G 5GZFA 3ZYGA 3GH7A 4W93A 3R8GA 1VJZA 5I23A 1WA6X 1F31A 1WOAA 4GQRA 2HS6A 3WBYA 2ZMLA 2PQSA 1COV2 3AKQA 4QAWA 1ZA7A 1DWIM 4JQ1A 2P3YA 1XISA 1QXLA 2OSYA 1RUG1 2YBKA 3A4AA 4LBOA 3OA5A 1DKWA 4FEZA 5DXDA 4BOWA 3U2ZA 3MV11 1ZZMA 1WLDA 4Q32A 2J78A 4Q8MA 2H0BA 3AIQA 1UY2A 3ZPYA 3VBSB 1V3LA 3WMSA 2WT2A 5FRAA 1LJYA 3HG3A 4W4QA 1IZ3A 2DBIA 5ACA2 5I7GA 3CHFA 2G9ZA 3W24A 4AI3A 1MZ5A 4EWAA 1GOKA 3RM4A 4XFHA 4XACA 2GJXA 3WV6A 1GBGA 1B3ZA 4FPKA 3AFBA 4XD6A 3NNJA 4YFWA 4OMCA 3FSTA 2QJHA 3RLVA 3WEOA 1PZ3A 3CJIC 4WQ6A 4B9ZA 4J1XA 2PRLA 2BFUL 5AHFA 4XX6A 4TVCA 3BJSA 1UQXA 1F61A 1H1NA 2R16A 1XB9A 4LBNA 2J77A 1O91A 4WDUA 4P2VA 1S2EA 4UR8A 1KGUA 4J25A 4NIHA 3FJ6A 1E5RA 1KXGA 3AMPA 1M9HA 4CQDA 1ML1A 3UKNA 2WR9A 1ODUA 3OYWA 1BG9A 2DCJA 3I6TA 1FH7A 1QNOA 1VH7A 1ZCCA 3EX2A 3NEHA 4GALA 4FP2A 1W2OA 2VNRA 4LUYA 3RPQA 2RDSA 3GAKA 4DBUA 3CPUA 3K4ZA 4LKEA 3AS1A 3O8AA 4E5TA 4QXBA