4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
1E6PA 4JFSA 4QCFA 1US2A 1JYWA 2O9TA 3WNLA 4OUEA 4J3SA 5C70A 2BXYA 3EDJA 2BY0A 1C93A 2ZUNA 2VCCA 1AQHA 4PMXA 4W84A 1B2YA 5A6MA 3TA9A 1IZJA 1QNQA 1U30A 2PC8A 5HOSA 5A8MA 4BA0A 1H0GA 1V08A 1W1YA 3SIMA 1VFMA 4AZIA 2XWDA 1CGTA 3WFZA 2VZTA 4XUYA 5A6BA 1V6VA 2ZXDA 2VT0A 2ZX5A 3SCQA 1B3VA 4PSPA 3WMCA 3PZMA 3OB8A 4UR9A 1JDAA 2ZX8A 4DWSB 4D6DA 1HIZA 3CZEA 3WN6A 3MO4A 2UWFA 1W9BM 3WNKA 3RJYA 1XV8A 2C0HA 1H4PA 3A3HA 1QW8A 3OLDA 3QHMA 2Y8VA 1H3GA 3UERA 1J9YA 1DWGM 2VX4A 4UFMA 1R85A 2WWDA 3M07A 4CU8A 2IUZA 3DYPA 1H2JA 1CDGA 3VX1A 1C8YA 3B9AA 1PEZA 5CPSA 4J7RA 1IV8A 4W7WA 3ZR5A 3NJ3A 1UWTA 1QW9A 3EMCA 3L2LA 3WD2A 5BWFA 5E0FA 1UR0A 5LYRA 2WC3A 3UG3A 2XG9A 1GOKA 3NYDA 3CUFA 1RP9A 2RGLA 2GFTA 1GHRA 1X6NA 1FP9A 2QHAA 3FHAA 1Q6CA 1CPUA 1BYDA 1M04A 1Q6FA 4FMVA 1PAMA 2YL9A 2J79A 4Z2GA 1XCWA 4LYQA 3KL3A 1Q6DA 1JZ5A 1Q6GA 1OINA 1UWUA 2EPOA 2WHLA 1B3WA 3N13A 5BRQA 3ZYHA 2WBKA 5JIWA 3KE0A 1CLVA 2HVMA 2F8QA 2VQUA 3W82A 3ORJA 3VVGA 3GBDA 4QAWA 3SCVA 3S2CA 1QHOA 4AZBA 4Z2JA 1KQZA 1PJ9A 3LPOA 1SR0A 4QLKA 4BQ3A 4AYSA 4JFTA 4RL3A 4EK7A 4HP5A 1E5JA 1UYQA 1XH1A 3WF2A 3ZJ8A 2WSPA 1FFRA 2D2OA 4H04A 3WH7A 5HPOA 4YHGA 1JGIA 1J0KA 4R27A 2VUYA 5FL1A 3NCOA 3PTKA 3HN3A 2VCBA 2DT2A 3AMKA 2A3HA 3VDAA 1LQ0A 3AMDA 3W24A 4JFVA 3I3DA 4QDMA 3SEPA 4X0NA 2WMJA 5EBAA 5IHSA 2CHOA 1BVZA 3RPMA 3BMWA 4LXFA 3AMGA 4D6HA 4HU0A 1OBAA 4GKLA 5D8ZA 5A6SA 3VOCA 1C7TA 5A2AA 2WVTA 1XD1A 3AS2A 4UFLA 3RMEA 3SCOA 1DWJM 4E8CA 1E4MM 3AFBA 3VD4A 4H8UA 2Y8KA 1E4IA 4HZ7A 4HU8A 5EMYA 1CGVA 3VIHA 1KR1A 1LG2A 2ESCA 3F5JA 3N15A 1E0XA 1ISZA 1V6UA 1HVQA 3WEZA 2K46A 2ZIDA 3QOMA 4AZHA 1KQYA 3U5YA 2DSUA 2OSYA 1H09A 4HPHA 2E9LA 2YBUA 3B9DA 4J27A 5D9MA 2XGBA 1E6QM 5FL0A 1CGYA 4DUXA 2VO5A 2ZUVA 3ARQA 3ZSSA 3WSUA 2WMIA 5JIPA 5CLTA 4CD6A 3WUFA 4PMRA 3PZUA 1D2KA 5BYWA 1WCGA 1I1XA 2GJXB 1WNOA 3CO4A 1C91A 1KCLA 2VNCA 1WCUA 1TA3A 3AICA 1E9LA 4FK9A 1FHLA 4PMDA 3EMZA 1GQJA 4HMDA 1UZ4A 5AYBA 3EMQA 2OYKA 2VX5A 4U2YA 3RCNA 1S46A 1UKTA 3WNOA 1NWTA 1TZ7A 1BYBA 2DIJA 4JKMA 4KGJA 3ZT5A 1UA3A 3B9EA 2CBIA 7TAAA 4LYRA 1FH7A 2ZUWA 1GWKA 2KR2A 3AXHA 1W2PA 1DTUA 5CJ5A 2VVNA 1KXVA 3L2MA 4MTVA 1WZLA 4YN5A 4GO8A 1ISWA 4S3JA 4IPNB 4YW6A 1E6ZA 5DF0A 4U5IA 2WLYA 3CBWA 5A2CA 4UQ9A 1HKJA 3SCNA 3U7VA 2GDUA 1CXHA 1ZL1A 4CCDA 1BTCA 4Q7NA 1LJYA 3W37A 1KGWA 4H8HA 1OSEA 4LK6A 1WAWA 8CGTA 1V0NA 5BXSA 3CUGA 4Y7EA 3TTSA 4AIUA 1DP0A 2DSWA 2Q1FA 2GK1A 4CKQA 1HXJA 4BQ5A 1B0IA 3TTQA 1X1NA 2VZVA 1JDCA 1V6WA 2DH2A 5CGTA 3WF1A 3GXDA 2VI0A 5A2BA 2XWEA 5AC4A 1WO2A 1OT1A 3AIVA 4U3CA 3WDQA 2J7CA 3PZNA 3SUTA 4P7NA 3WUBA 1WDSA 1FH9A 3WEOA 2BXZA 4EE9A 5CLWA 1BYCA 2GJRA 5AYIA 3WD3A 2EJ1A 1UD4A 4DWSD 1RPKA 3ARRA 4IUGA 1EO7A 1TVNA 1EOMA 4TVDA 4E8DA 2O9OA 4BF7A 4HA3A 3BAWA 3WD4A 4NI3A 3SCSA 4CGTA 3FY1A 4WK9A 4DUWA 2XFRA 4EANA 3ZIZA 3VM5A 3DYOA 4UZSA 3TOPA 2VX7A 4ACZB 2JF6A 1GQLA 5D21A 1C3FA 2XVLA 1GOWA 1UWSA 2PB1A 4H8VA 4J3TA 1NM9A 1ISVA 4TXEA 4CVUA 1ZB5A 2E40A 5I3DA 2WLZA 3B8SA 2X1IA 4HOXA 2WAGA 1J0YA 4LYPA 4AY1A 1JXKA 2ZOXA 1H41A 1Z32X 4W89A 1FHDA 6CGTA 4D6JA 4D6IA 2X09A 2WHMA 1E3XA 3FHQA 2XIBA 3AIWA 3WD0A 2XSBA 1JYXA 3VGHA 4OIFA 2XFFA 4AD1A 5CQ1A 3SUVA 1V02A 2EXOA 4CN6A 3UR7A 1VEMA 1E73M 1WB0A 1NARA 3AMLA 2VXJA 4W7UA 1PX3A 1QNSA 3U5UA 3GXMA 1W9XA 4J3VA 2QV4A 8A3HA 3MMWA 2J7FA 2VZUA 3WQ5A 1W9UA 4LX4A 2J7BA 1CEOA 2G3IA 3POCA 1W9VA 4V27A 5A6KA 4MAZA 1KB3A 2LROA 2WVVA 4QLLA 4MNMA 2CBVA 2WC4A 3I3BA 1WKYA 1XSKA 3WFLA 1BGAA 2G8ZA 3NSXA 1UR8A 4DUVA 1GVIA 1TE1A 3KL5A 4UFHA 4TVCA 1J0ZA 1MFUA 1GOIA 1HNYA 1GWMA 1E0WA 3MUAA 2VL4A 5CPTA 3D3AA 1MVYA 3OBAA 1NQ6A 2PF0A 4HMEA 2BVYA 4KRTA 1ZJAA 4AD2A 2XVGA 2BY1A 3T0AA 4WKFA 3EDEA 1Y7VA 1K9FA 5FCZA 1OGSA 2VR5A 4IPLA 1FH8A 2J25A 3IANA 4AC1X 1HKIA 1CNVA 4WIWA 4GINA 1JFXA 1W1TA 4KRUA 4V28A 4LPCA 1QHPA 4BS0A 1MFVA 2AAAA 5CSYA 1TFVA 1C90A 2O9PA 3LPFA 2OWWA 1ESWA 1TUXA 1BAGA 2CBJA 1HJQA 3MKKA 3AMCA 1UQZA 2FHFA 2NT1A 4D72A 1QI3A 2EO7A 1DWFM 1W3KA 1W9DM 4WKAA 1HJWA 2WVUA 2XVPA 1YHTA 1BLIA 4PUEA 2A3CA 4YW7A 1SFSA 1JF5A 3ZO9A 2WMKA 1WDRA 2YL5A 3WBAA 2ZXAA 3ZSTA 1ZJBA 1R87A 3MU7A 1W3HA 4CD5A 2C24A 3W29A 3RO8A 5C8BB 1E6XM 2YDRA 4JAWA 1W1PA 4CVWA 3T2QA 3NSMA 1U2YA 4ZENA 3CHEA 2FGZA 2J7EA 4BCEA 1KXHA 1UH2A 3GZAA 4W93A 2VMFA 1BPLB 4AW7A 3AIQA 3I3EA 1GQKA 2GDVA 5E6YA 1B3XA 3G6LA 3WKZA 4TX6A 5IFPA 3OLEA 5CXPA 4J3XA 3E1F1 3IJ7A 1K6AA 2YIHA 3L4TA 5I0DA 1MQRA 4MB3A 1E70M 1UD8A 2VX6A 2O14A 3K4DA 5I23A 1CXKA 5M5DA 2V3DA 4H7VA 4ZE5A 5E09A 1UKSA 2BNJA 1CIUA 2DQXA 3ARVA 2UY4A 3EBVA 4MB1A 4PMQA 5I79A 4W86A 2A3AA 4V2XA 4PTMA 3AHZA 1NOFA 5ABHA 3FAWA 3FW6A 4HMCA 1G01A 1V3LA 3WQ8A 1NWUA 3WNPA 1OWQA 3SURA 2ZXQA 2ZX7A 4GI8A 1V0LA 2ZUUA 3UEQA 4QCEA 4P7QA 2QLYA 1JL8A 2GJPA 4W8BA 1RH9A 3VIJA 1WZMA 3WL0A 3W6LA 4ZXLA 1JNEA 4P8WA 2ZICA 1VFUA 3MMUA 2B31A 1HL8A 1JG9A 1WZXA 4U5KA 2V38A 2CEQA 2D20A 4OOUA 2AMGA 1JAEA 3AS3A 4MNLA 3VGDA 1UOJA 1EQPA 1CECA 2XUCA 3N17A 3VPLA 4PMUA 4U3AA 1N82A 5BXTA 3VIGA 4GQRA 4PTVA 1YQ2A 1BF2A 1KCKA 2DSZA 3CHCA 2X2YA 4AISA 4CD8A 4C7DA 2TAAA 3W27A 3VIKA 5D9PA 3VMPA 3FXYA 1NH6A 1H49A 4LKEA 2GUYA 3M46A 3IK2A 2CITA 4D1IA 3CUJA 3AI0A 1CYGA 2DEPA 3OG2A 2Y4SA 2XPKA 5TD4A 4RE3A 4XZBA 1UG6A 3RIKA 2PWDA 3KL0A 2DH3A 2VVSA 3GNRA 1QI2A 4L4PA 4HPGA 3WDIA 2BVTA 4AWEA 3L4XA 1PIFA 3VO0A 3TTOA 3W6MA 1W8WA 1VBUA 2A3BA 3ALFA 2XVKA 4JL2A 2XM1A 2ZUSA 5DEZA 1V3MA 2DT0A 4PYSA 1UH4A 4OBRA 1LWJA 3NDYA 3M6DA 3VGGA 2X05A 2IXUA 3WF4A 2Y5EA 4M56A 3WF3A 3WDRA 5M3WA 4JHZA 4NRRA 3O9NA 2EPMX 1ISXA 1HKKA 4ATDA 1JZ7A 1GOMA 1JDDA 1WDPA 3EDDA 3L4UA 4AIEA 4CPBD 4C7FA 2W91A 5KZ6A 4KGLA 2WW5A 1V6YA 2W4XA 5LA1A 3RM8A 5BCAA 3MANA 3WMBA 1B1YA 1Q6EA 1AVAA 3GH5A 1MYRA 1WDQA 3L4YA 1ODUA 2ZUTA 1FP8A 2ZX9A 2GK1B 5M17A 3UR8A 3VIOA 1JZ4A 3UG4A 3KWXA 4OJYA 3GDBA 4HZ8A 2J62A 3RJXA 1NOUA 3DYMA 2JE8A 1JF6A 1DHKA 1XRVA 3DC0A 1B3YA 3GNPA 3LPPA 1UQYA 4LGXA 4CCEA 1H1NA 4W8LA 3NDZA 3WENA 3PZ9A 2WZIA 3WH5A 2VZOA 4A4AA 3G6MA 1XH0A 1CBGA 2UY5A 3ZT6A 3CHFA 3N1AA 3ECQA 5A6BD 2Z1KA 1I1WA 2JEPA 5AC5A 5DT7A 1UOKA 3BLKA 3S6TA 2VOTA 3WH8A 4FLOA 4YWAA 2WWCA 4ACYA 1ODZA 5FIPA 2XJ7A 1E15A 3WH6A 1X6LA 1VENA 1D3CA 1CGXA 4H41A 1ECEA 3VILA 1BG4A 4MDOA 4MJ4A 2VRQA 4MB5A 5A69A 3FNDA 3GTNA 3F5KA 1E6RA 3AIUA 3N11A 3ZJ7A 4AD3A 3A47A 4CU7A 1HJVA 3QHOA 3VD9A 4DM1A 1G5AA 1UH3A 3L4ZA 3BC9A 3VM7A 1O6IA 2EPNA 3MV11 1NP2A 1JAKA 1BYAA 1M03A 4AL9A 1XCXA 5IHRA 3ZJKA 3BLPX 1C8QA 2HISA 4TTUA 3BAKA 4MNKA 4U2ZA 4B9ZA 3HMCA 4CP9A 3AS0A 1CWYA 2ZXBA 1UR4A 1EA9C 7A3HA 2WYSA 2BV9A 1XSJA 4UFIA 2OWCA 1QI5A 2CCRA 2ZE0A 4AMCA 3K8KA 2F61A 3AZTA 1HJSA 1W8TA 3A4AA 1G0CA 1KBBA 4ZXOA 4ZE4A 3WEMA 1LLOA 4JFWA 5BXPA 2E9BA 2J7DA 4JHOA 3AXXA 4JZ5A 4N0RA 2GSJA 1M7XA 3CGTA 2VZSA 4TX8A 3W81A 1PBGA 3AIRA 3OLIA 2NSXA 2D23A 4QFUA 2Q8XA 1HN1A 4M24A 4AIOA 3AZRA 3PN8A 2XIIA 2WVVB 3AOFA 1UHVA 5JBDA 1JZ6A 4TUFA 1MXDA 5BXRA 2J75A 1OT2A 4OZOA 1OIFA 4M29A 2WKGA 2VR4A 2EBNA 3VGBA 3VKKA 1VEPA 2VRKA 4FLQA 3WDPP 1UR9A 2QPSA 4HZ6A 3OA5A 4N42A 4AEEA 2J78A 2W5FA 1L7LA 3RM4A 2ZX6A 1OGGA 5I6SA 2WXDM 3CMGA 1SMDA 4AZCA 1OD0A 5EB8A 2WPGA 4JKLA 4Z2KA 3A4WA 4B3LA 2DSVA 3SCWA 5A1AA 1QOXA 1VRXA 4M80A 1H11A 1GJUA 2JFEX 1ZBWA 3OGVA 4PMNA 1C92A 4JCLA 2YBTA 1E4LA 2WMHA 3CUIA 4CD4A 5HPCA 3VDBA 1VB9A 2WCGA 1XC6A 2Y2WA 3BH4A 1J18A 3VNYA 1GHSA 4NRSA 3F4VA 3ARXA 1GOQA 3CZKA 3CIVA 4TVUA 1VF8A 3ZYFA 2BHZA 3CPUA 4P8VA 1VAHA 3VIPA 3UT0A 1V3JA 1KGUA 2WZHA 3RILA 4GI9A 1UWQA 3IJ9A 4J28A 2CESA 3ZR6A 4ZEPA 4WJXA 3KEHA 1VFOA 3BMVA 1EHNA 2JWPA 1E55A 1G9HA 4PTXA 3QOKA 3HU7A 2D0GA 4Z2IA 1RD6A 3F5LA 3OLGA 1CXEA 3ARYA 4MDPA 5FKYA 4JCMA 2E0PA 1MXGA 2Y24A 1XSIA 1UUQA 3W26A 3UETA 1KBKA 4S3KA 5ABFA 2W66A 2J74A 1HT6A 1J11A 3BGAA 3F95A 1AQMA 2E8ZA 2J8FA 3DECA 1BGGA 1J0IA 4MB4A 3WDJA 2X8RA 4BQ4A 2O9RA 2JF7A 1BG9A 1QI4A 4BZYA 5IFTA 5E0CA 4EKJA 2J47A 5D9OA 3SUWA 1SMAA 3MUZ1 1JFHA 1HKMA 1V0MA 1BVNP 5EFFA 4UQDA 6TAAA 2VCAA 2EQDA 4P8XA 4ACZA 2W92A 5CG0A 1XD0A 1GOOA 4M1RA 4LJHA 3PZTA 3BAXA 3ALGA 2WC7A 1EIBA 1ITXA 2WMGA 2D0FA 5A6LA 2QPUA 2XHYA 3CZ8A 5DO8A 3MS8A 4XV0A 4LKDA 2YA2A 4W7VA 2FGLA 1W9FA 1W8ZA 4IISA 3UESA 6A3HA 5LA0A 4LKFA 3TP4A 3K1DA 3WELA 3ARTA 1CXFA 2OLHA 1W3LA 3WH9A 3ZOAA 2FHBA 2WCAA 4WSJA 1OB0A 4UOQA 4BQ2A 4FLRA 2WKLA 3W53A 1E4NA 4AZ6A 3L4WA 4JL1A 3WUGA 1XGZA 4CUCA 1K9TA 1J0HA 4KWUA 4Q22A 2V3EA 3QHNA 1UR2A 1VJSA 2WM0A 3PZGA 2ZWZA 1ISYA 4CU6A 2YLLA 1D7FA 3GNOA 5DT5A 3D5HA 3ZT7A 1HP5A 1VBRA 4F9JA 3EDFA 2QF8A 4DWSC 1UKQA 1WZKA 3POHA 4W5UA 5CZKA 3NIYA 4MNJA 2FH6A 4UNIA 1LG1A 3K46A 2D24A 1KR0A 4D6EA 5I77A 5D4YA 1UWIA 2D0HA 2PWGA 2QMKA 4J3UA 1H5VA 1A3HA 2IXVA 1MW2A 1GORA 4WSKA 4TTGA 1WZAA 1JZ8A 3WQ4A 1V3KA 4AZ7A 4AZGA 3GXFA 1JXJA 1HF6A 5GPRA 3AIEA 2AOSA 4WF7A 2XTKA 1GVYA 4OKDA 3II1A 1V02E 3N12A 1PIGA 3KZSA 1E1EA 4LK7A 1KXQA 1W9PA 5E70A 3ZM8A 2F2HA 1UR1A 3SCPA 1ITCA 1W91A 1PPIA 3CZLA 3O6AA 3K4AA 4W87A 4EAMA 4OBSA 3VD3A 1KXTA 5GNXA 2PWHA 3ARSA 1V3IA 1VEOA 1F4AA 2DPEA 4FF5A 2WZEA 1E3ZA 2OYLA 3IAPA 2J7HA 2CXGA 1CZ1A 2RGMA 2YDSA 4FLSA 4C7GA 5I78A 1JZ3A 1OM0A 1EDQA 4CN4A 1TR1A 4AZ5A 4P7OA 4F79A 1MQPA 5D8WA 3PZVA 1XHGA 4U33A 1KFWA 5GQBA 3VDHA 4F66A 2PBOA 7CGTA 3MMDA 3BAIA 3W25A 1F4HA 1QNPA 1KGXA 1B31A 1B90A 1VJZA 1ZU8A 1PZ3A 1QNRA 2NT0A 4PMYA 5I2UA 4JFUA 3W0KA 2JIEA 1ZBVA 2G4FA 2W62A 3AZSA 3TONA 4GPNA 4GQQA 3W38A 1O7AA 2JALA 4NSBA 1QBBA 2V5DA 1B9ZA 3WNNA 3BSHA 1WP6A 1J12A 1UD2A 1HVXA 4W8AA 1CXLA 1QVBA 4XZWA 1OKOA 1HN0A 4AEFA 3WQWA 1G94A 4D1JA 3UCQA 2WMIB 4UFKA 1EDTA 3M7SA 4PMVA 3LPGA 4UTFA 5IDIA 1CENA 1EGZA 4D6CA 1MW0A 3MSGA 4DM2A 1JI1A 1V0KA 1G1YA 4X0VA 1MW1A 1TA3B 4HA1A 4ZFMA 1I75A 3AS1A 3GXIA 2J7GA 4UQEA 1NWRA 3QGVA 3K8MA 1B30A 2YDQA 3MUY1 5CGMA 3UG5A 1EH9A 3WUEA 2WK2A 1SYTA 2DGAA 1DEDA 1IZKA 5E6ZA 1E1FA 1U33A 1JD9A 1QNOA 2OWXA 1HX0A 1EOKA 3ARWA 1GJWA 4A3YA 1HL9A 4DWSA 2G41A 2WSKA 1CGWA 1DWHM 3ZYBA 1HJUA 1EO5A 1LF1A 1JZ2A 1E43A 1Q4NX 1QI0A 3N18A 4HTYA 2OYMA 2BY2A 3RM9A 1PZ2A 2W61A 1W90A 4PMOA 4F8XA 3CH9A 4R5EA 3NSNA 3CHDA 2XVNA 2YL8A 2EPKX 4PEEA 2DT1A 3OIHA 4GI6A 5BROA 2WB5A 3AHXA 5EFDA 1TVPA 3WMSA 3AYSA 1TCMA 2DIEA 2NW0A 1C8XA 4NZCA 4CP9B 4B16A 3ZQ9A 1LL6A 4W5ZA 4W88A 4GIAA 5KEZA 3WL1A 2DDXA 2WNWA 1L8NA 2CPUA 1MW3A 2J77A 3T0BA 2WCSA 2Z1SA 3T2PA 2D3NA 4PCTA 4JKKA 1OGBA 1R7OA 4UOZA 5ABGA 1UZ1A 3N9KA 3ARPA 4A3HA 3LMYA 3QR3A 4QP0A 1FA2A 1NWSA 1NOWA 1NP0A 2YA1A 5A8QA 5DFAA 5FOOA 2D1ZA 2A3EA 3ARUA 3IJ8A 3K8LA 4XX6A 5CPQA 3SCRA 1GPFA 3AROA 3W4RA 1GWLA 4GXPA 2XSAA 1CTNA 3L4VA 1V6XA 1UD3A 3AIBA 3VNZA 4UCFA 1C7SA 4JIEA 3VU2A 1KWKA 4M8UA 2O92A 4H2CA 5BRPA 3N04A 1JD7A 4CD7A 4GZJA 1BHGA 3W28A 2OSWA 2J8GA 3T08A 4E4PA 3AXIA 3PBGA 2ZUMA 1DWIM 3GH7A 3VTRA 4AZCB 1E6NA 1EQCA 4D71A 3WDHA 4UZUA 1OIMA 3U57A 4HOZA 3WQ6A 2UY2A 2D3LA 4RE4A 4MAVA 1KWGA 1QPKA 3APGA 2C7FA 4ML4A 3DHUA 4MPKA 2CKSA 2X0HA 1US3A 3RDKA 1LWHA 1EHAA 2V3GA 1GNXA 5ECUA 2WHJA 4K68A 1E0VA 1UWRA 2LRPA 2PWFA 1JNDA 3VIFA 1EDGA 4GO9A 4TOQA 5A6JA 1UA7A 1W3JA 1CXIA 1LL7A 3CZGA 1ZBCA 1E5NA 4GZIA 1XYZA 1FFQA 1L0PA 1UD5A 1RP8A 5A3HA 3DHPA 1E72M 4B9YA 4X9YA 4HOWA 1H0IA 2VJXA 2WYFA 5HDRA 1QBAA 2GJXA 4KH2A 1IT0A 2YLAA 1UKPA 4YPJA 3PZIA 1PX4A 1V3HA 4LQ1A 1ZBKA 1PX8A 1VFFA 3WNMA 2E4TA 2DT3A 2YJQA 3BSGA 3PZOA 2CETA 4URIA 3VIIA 4D6FA 3VGFA 2CNCA 5F7UA 1OD8A 1R7AA 2PI6A 2CERA 4CCCA 1OH3A 1W1VA 3SCUA 4UOJA 1JI2A 2E9MA 2G3MA 4AXNA 5ABFB 2VTFA 3AISA 1V0AA 5A8NA 5HNNA 3VX0A 3AJ7A 5HXMA 3T2OA 1LL4A 3CMJA 3CZJA 2D22A 1M01A 3ARZA 3J7HA 3HJEA 1XH2A 3MV01 3VMOA 3GBEA 3AHTA 4PCSA 1K9EA 1UKOA 3CUHA 4YHEA 4W85A 3T09A 5IXEA 2GVYA 2BHUA 2YOCA 1HJXA 1VIWA 4M81A 2X0YA 3T0DA 5A8PA 3VINA 2J4GA 3SUUA 3WD1A 2QMJA 4AD4A 3VUPA 2JIWA 1CGUA 3WQVA 3U7BA 3VIMA 2MANA 4A6SA 2BS9A 4QLJA 5HBFA 2CHNA 4B15A 1GUVA 1W32A 2BVDA 5I24A 1OCQA 3WIJA 2V5CA 2WVSA 3EDKA 4PTWA 5JUVA 2C8NA 1AMYA 1MWOA 1JYNA 4Z2HA 2WMFA 5JBFA 2YL6A 1J01A 3BAYA 4HA4A 4E2OA 5D9NA 1GW1A 1R86A 9CGTA 5CSUA 2BFGA 3CTTA 4M82A 2XM2A 1BQCA 5FD0A 2YKKA 3VDCA 3MSDA 2WANA 2XFYA 4P8UA 1BFNA 3O2LA 5I5RA 1W8UA 2G3NA 4RE2A 3BXWA 2VRJA 2PWEA 4P7RA 2CIPA 4AD0A 3GYCA 1HP4A 3FAXA 3MUIA 3EYPA 1EXPA 1GCYA 3GM8A 2YA0A 2BHYA 3A4XA 3VGEA 1XYFA 2ZWYA 1ZS2A 3THCA 1BSIA 1GONA 5GNYA 1R8LA 3SCTA 2G3JA 2W67A 1W2VA 4PN2A 2XYLA 4AD5A 2JEQA 5LA2A 4P7LA 2EEXA 1CLXA 1GZJA 5C71A 3AQUA 3PZQA 3OZPA 3PHAA 1A47A 2FH8A 2CBUA 3A6OA 1QHZA 4IM4A 3OZOA 4ATLA 5A95A 1TG7A 3BAJA 2VURA 5JBEA 4F9DA 2OSXA 4GZEA 3OGSA 3BCDA 5GNZA 3PTMA 1JYVA 2UY3A 1K9DA 3THDA 4WLCA 3IAQA 5A8OA 5A6AA 1E71M 2WBGA 2PBGA 3AHYA 2W63A 4D6GA 1WPCA 4UQBA 2VQTA 4MJ2A 3TTYA 5E9AA 2FHCA 3VD7A 3NUKA 1E40A 2EPLX 3BCFA 1B3ZA 3FN9A 4NF7A 3ZMRA 4L4OA 4PUDA 1WMXA 3WF0A 1E56A 3JUGA 4UQCA 2CYGA 1JIBA 2WHKA 1GQIA 4Z2LA 5M03A 5A94A 4PSRA 1V03A 3VD5A 3OGRA 5ABEA 1M53A 4U31A 1UD6A 4PMZA 3GH4A 4B3KA 5AY7A 1FOBA 1J10A 1MQQA 2VC9A 1AQ0A 3ZJ6A 4UQAA 3WBEA 4OOZA 1P6WA 2XGIA 3WY1A 4ATWA 5DMYA 1TMQA 3AHVA 4UFJA 2FDMA 2CKRA 1E6SM 2V3FA 3SUSA 3PTQA 4J3WA 3VMNA 1J0JA 4CN1A 3CLWA 1DWAM 2E8YA 4CPBA 1WE5A 4PBGA 4XB3A 3AYRA 2E3ZA 4KMQA 4WKHA 2BY3A 2DSKA 4MADA 4PRWA
chains in the Genus database with same CATH superfamily
5T8GA 4TLGA 1TJ1A 4QCFA 1US2A 2Z1VA 4WVXA 3WHTA 3SECA 4OUEA 5C70A 5LEKA 3PTYA 4DI8A 4KKXA 2I1OA 1V9U1 4K20A 3KBWA 5JSOA 3UU0A 2HRWA 2A0NA 3PLQA 5AB3A 3FX3A 1CPNA 2VCCA 4LO4B 5DUWA 5IW0A 1R082 3CIWA 3PBYA 4PMXA 3I97A 3U14A 2ZABA 1XLEA 2JIJA 5F4XA 1FKXA 3PUGA 3KDNA 1U30A 5T54A 4CDWC 2PC8A 5HOSA 1BRLA 1MMFA 2TMDA 3EZ4A 3LEKA 4K7YA 3WJXA 3S0CA 4BPZA 5DLCA 4DLMA 4B5SA 3DF0A 1EC9A 1AL0G 1VFMA 1FXZA 4ZL1A 3UXAA 4HMZA 4CP1A 2ORXA 1WD4A 1AJ0A 4PMJA 1KS5A 3S5QA 2VFIA 1S5VA 2VT0A 3K1GA 3NL5A 5A6XA 5C5UA 4QRNA 2HWF2 4C6PA 3QV8A 1B3VA 1SZNA 4KESA 3DV8A 3H12A 1IQ8A 3O3RA 3OUHA 3RF9A 5F1RA 2QCNA 3S46A 3CV2A 1O66A 3G5EA 3E6EA 1VIZA 2J1TA 3GTHA 1PNGA 1RCXB 1XV8A 2J9YA 2VTXJ 1LECA 4ES9A 1PSCA 3A3HA 4QX0A 2A5HA 2Y8VA 1RUD3 2P3YA 4QHOA 4COZA 1J9YA 1DWGM 2VX4A 2YXSA 4Q4X1 5FXXA 3B04A 3M07A 4B5UA 3Q8EA 1XLAA 2WS93 2WQ8A 1W1A1 1C8YA 4H83A 1VC4A 5CPSA 1IV8A 4W7WA 4YWSA 4AF9A 3A22A 3K2OA 4UF0A 3GVWA 4LAZA 1UR0A 4FNTA 4ZB5A 4HGXA 3G1VA 3VZJA 4CA9A 2WC3A 2V72A 1EIXA 2PTDA 1RP9A 1XX1A 3CB3A 3AFKA 2HNHA 3CUFA 4LVFA 1HRI1 1X6NA 4GMP3 3W7MA 5FXVA 1CPUA 2I17A 1I2NA 4AFYA 1PAMA 5DMNA 1W05A 5FY7A 4B7KA 1K1DA 4MY8A 4CDWB 3KL3A 1JZ5A 4L64A 2VNGA 3QCWA 1FBAA 2HZGA 1N3PA 2WHLA 1NCQB 5JIWA 2HVMA 3VVGA 3I59A 4YFWA 1A5LC 3E38A 3HM7A 1RUF3 2WLPA 4L65A 3BG9A 3S2CA 3ABRA 3LPOA 6ENLA 1SR0A 4BQ3A 2WT1A 4AYSA 1SPPA 3GGLA 4RL3A 4XZPA 2OG9A 4HP5A 3LHUA 5LNUA 5J98B 1HRV1 3WF2A 2PTWA 4L6OA 3ITQA 4OYUA 4UBPC 5A3WA 3CTLA 5IBXA 4LOCA 2EPHA 5GZDA 1YUDA 2BV4A 3IACA 5FL1A 4RK8A 4D8AA 3HN3A 3J9SA 3CU7A 3FFQA 5F6LB 1HKDA 2A3HA 1EUAA 1TWDA 4JIQA 1J1LA 2FZBA 4Y22A 3AMDA 3VBFB 3W24A 4M19A 4Q4SA 4JFVA 3FKRA 3EPNA 3I3DA 2O4QA 3NQDA 5GZFA 2GQAA 1I8JA 3POEA 2RHGA 3QH2A 5EBAA 1QJX2 4Y8FA 1RPXA 3HPNA 2CHOA 1NFPA 4MHBA 1AR71 3ABOA 4KCTA 5J48A 4D6HA 4XFIA 2NV1A 1OBAA 1DL3A 1RV8A 2VW1A 4BEQA 2E7AA 4ZFCA 2CLPA 1C7TA 1YX1A 3N9SA 1FYUA 1G86A 1WKEA 1OC5A 2WVTA 4D0QA 4I0WB 4XHBA 3AS2A 4LB3A 4E8CA 5CZJA 3RMEA 3Q4DA 3V56A 3WP3A 2VEIA 4MX3A 3REQB 2V73A 3VD4A 5G04L 1E4IA 4Z2WA 4ZOBA 4UW6A 4XBLA 2RS11 2JXAA 3EKZA 3PAJA 3VCCA 4YW4A 1V6UA 2J66A 2ZIDA 1RUG1 5T50A 1RHI1 3IBMA 1N7KA 4L4LA 4WOQA 2VUDA 2YBUA 3W02A 1ND2A 4Y5Z0 3OBTA 1HW5A 4XETA 1W17A 5A80A 4RNHA 3EOOA 5FL0A 2JE7A 3WCZA 2D40A 2NVCA 4KBXA 4EVZA 1XYPA 3QYQA 4E4HA 4XAEA 5FO9B 1HDKA 1TX2A 4FF7A 2WMIA 1GEHA 3KRZA 3PZUA 3FIGA 1D2KA 1ULDA 2IPWA 3LM3A 4KWSA 5IAXA 5BYWA 5A6YA 1I1XA 4Q8TA 1A34A 4WY0B 3H2OA 4LUTB 3C7GA 1DE6A 2VNCA 4X60A 4MZUA 1TA3A 4GI4A 4XUQA 1FHLA 4PMDA 4DQWA 3B0YA 4TYSA 5AVHA 3IIPA 2NX1A 2OQ6A 1ONRA 2H3DA 3BO9A 3AP9A 3JB8A 3HEIA 2OYKA 3CV6A 2PGRA 1NSJA 2WNZA 2WJZA 3WNOA 1NWTA 3NQCA 1BYBA 5EU9A 1LBFA 2Q4SA 3GUWA 5ACA3 3VLBB 3NNLA 7TIMA 1MNSA 4EWEA 1XNKA 2Y6HA 3I4IA 1SSGA 1FH7A 5FYMA 5LY1A 1QJY1 3CEPA 3M2MA 1XE0A 1ZCOA 3VBHC 3GFXA 4IG2A 3L2MA 2F9RA 5FSDC 5BXXA 2VZQA 3LTPA 4N7QA 1VIWB 2Y6KA 4IPNB 4CCOA 2E51A 5LNWA 4AK3A 4B1MA 5LXEA 3DBNA 5A2CA 3C0SA 3RHGA 3U7VA 4KNCA 1ZL1A 4TXWA 3J26N 4BH9A 1Z6KA 2NQHA 2JD9A 1IEIA 1V0NA 4CCNA 2PDUA 5CAHA 2DQWA 1JH5A 2VULA 3K3NA 4IDZA 3VN4A 5FWJA 4O19A 3CUGA 3KHCA 2XSXA 4M4RA 3IV3A 4Y7EA 3JUUA 3NKTA 4XZHA 3RYRA 2DSWA 4PB3A 1LEMA 1LGBA 4CKQA 1SO3A 5H2ZA 4K8RB 4QU2A 4WM7C 3NDOA 3ZR4A 1Y3TA 1QK0A 3H2EA 2ZADA 5BYNA 1VCGA 4YVSA 5LK7B 4LLOA 2XJTA 4XAAA 9RUBA 3MGUA 2QCLA 2BZDA 5CGTA 4D6SA 2HWE1 4O0ZA 4Q0VA 4GGHA 5D38A 1BXHA 4QT6A 3VBOB 3GXDA 4Y1VA 2VVFA 1H8TC 2XWEA 2W52A 5AC4A 1NXD1 1OT1A 3AIVA 4MG2A 3WDQA 4PCRA 1Q6QA 3H26A 3PZNA 2CLOA 1POV0 3EOEA 3WEOA 2H9AB 2V5BA 2BXZA 1FMD3 2VQ0A 1DGWX 4AWUA 3EOUA 2Z2UA 3HQ1A 1V7YA 3WD3A 1GR3A 1XBVA 3GQYA 3GBWA 5FXWA 4POCA 4NJGA 5FZKA 5EWSA 1O5KA 3VBHB 4O9EA 1EO7A 1D8WA 4E8DA 1TVNA 3AYVA 2HK0A 4FTBA 4LHKA 4HYVA 1NZCA 2O9OA 4BF7A 2W9MA 5BNOA 4GYJA 4IEQA 2HWGA 1ZBE2 2ZRZA 2OFJA 1MUCA 4NI3A 4A45A 4NHKA 2F38A 4CGTA 4DUWA 2XFRA 4YL2A 4GXLA 1VMFA 1CGPA 4EANA 4NN0A 1OFRA 1KD7A 3DYOA 1EP1A 1FWCC 1NDWA 1PKLA 5APAA 2BRTA 3TOPA 2B0MA 4Z0JA 4CLMA 2R8WA 1GVFA 1EL3A 4HHHA 1SJCA 1EKOA 3G18A 5K7JA 3B97A 4HNLA 1GOWA 4J3TA 4PF1A 1ISVA 3HPAA 2BOIA 1OY0A 4ZBCA 2VQAA 3PUOA 1LJ7A 1A50A 4S23A 1J0YA 4LYPA 3EWUA 2ZOXA 1EUNA 4W89A 4GWNA 1PZ7A 1LM1A 3KHJA 2X09A 2WHMA 3LF7A 3L0NA 3BLLA 1UPMB 4QNEA 3ZXWA 2A7PA 1R2SA 5LNSA 5AYYA 1G9BA 2YGLA 3VGHA 4OIFA 5C9ZA 5CQ1A 3VUSA 2OOFA 1DKWA 2HJPA 3SRKA 4WGXA 3PJYA 5FJPA 5KHHA 3TV8A 1NARA 1PVC3 3H54A 3LQCA 1X9PA 4HNCA 1EPZA 2VOXA 3PS7A 4W7UA 3ZN6A 3W5NA 3U5UA 2VE1A 3BE7A 5HR7A 1DV7A 3LU2A 4MMWA 4X8PA 8A3HA 3EKGA 1AR92 3V0UA 3HQXA 3MMWA 4B7EA 4GABA 3EAUA 2J7BA 1X33A 2HE5A 4AF0A 1VGAA 4V27A 3WMLA 1LKNA 1OA3A 3AU6A 1KB3A 2DF7A 1QJU1 4DJDD 3D6EA 1T6MA 4MNMA 4QLLA 1KFKA 1R5YA 4XJ8A 3FZ3A 3V1HA 1XSKA 2VFFA 1AW2A 1SJAA 5IYYA 3G24A 1TE1A 3N9NA 5LGXA 4J1XA 4MOAA 2VM9A 5LHFA 1QNWA 3KV5A 2YFOA 2P3KA 3MUAA 2Z2SB 4DIQA 3D3AA 1AD1A 3T8QA 1BXBA 3FCPA 3IARA 4PL2A 4Y9AA 4XILA 5C7GA 1VB4A 4HMEA 4BEUA 4KRTA 1YXDA 1IEXA 2XVGA 3T0AA 1DLLA 1LNSA 3A0KA 3AZVA 1K3IA 3DU0A 4JTJA 2OEJA 1XYLA 1S0FA 1H50A 5D2YA 2ARXA 5PTDA 3QLLA 1BRLB 3WLTA 5AHFA 2VR5A 4IPLA 5I3GA 4Z1DA 2J25A 4ALDA 2L5HA 1CNVA 5ABTA 4I5RA 1G7VA 3NAPB 1V77A 2VD7A 4YW3A 4KRUA 4V28A 4N2YA 4OHYA 1QHPA 4IX0A 2NLYA 3HNYM 2QJJA 4NHMA 1ACCA 3LPFA 2R071 1ESWA 3H50A 4O1DA 2ZGSA 1GBGA 2FYMA 1TUXA 2A79A 3P62A 2AREA 1HXS2 2IKGA 3AMCA 4M3CA 4Y20A 2B46X 2QNEA 3WLMA 1OPMA 2ZA3A 4UCGA 2NT1A 5J36A 1AW5A 4EPDC 1A49A 1W3KA 1OHFA 1K8YA 4RN5A 2DUXA 3GR7A 4JTTA 1YHTA 4IQDA 3RZMA 3B4UA 5C2CA 4YW7A 4EQVA 3W3OA 4E9KA 1A5SA 2F84A 3EKLA 4BI6A 1ME7A 1V9U3 4CRQA 4FIRA 1A8MA 1SUXA 5F5AA 1BBT1 2ON3A 3FYOA 4NUBA 3TW6A 3PUIA 3VZZA 2ZAHA 3TWBA 4ISQA 1R87A 3QSTA 4XC9A 2RV9A 2E77A 3UXLA 4CUGA 5F3IA 3EOLA 1E6XM 5C8BB 3NGJA 3T2QA 4K2SA 4LEJA 5E0KA 4Q4W2 4Q4Y1 1EJTC 4W93A 2DU2A 3UWEA 2QQMA 3AIQA 1KKRA 2VR2A 3E96A 1JTZX 4H55A 2CZVA 1GZ1A 4B5NA 3S5AA 3I59B 4AVAA 1W0OA 2NXGA 1IXNA 2VU9A 2OVLA 1AODA 2VOMA 4A2SA 2FDKA 2XL7A 4ROPA 3AKSA 3L4TA 1SPPB 3ZIWA 1O68A 1U12A 3OHMB 1UIJA 4LNVA 1ND2C 3NYZA 5I23A 4UXAA 1W28A 3W1LA 4WDUA 1FPN2 2Z0IA 2BNJA 4PMQA 1VQTA 3EBVA 4MB1A 2B4GA 4LANA 4TIMA 2A3AA 4V2XA 1R64A 3BJSA 3V0AB 4PTMA 4XIAA 1NOFA 1A53A 4EP8C 2MNGA 3BG5A 3FAWA 2F2KA 4N9EA 3NEVA 4IEVA 4Y2WA 4HMCA 3VGIA 5E89A 4Y22B 3WQ8A 1W37A 4XCBA 1OWQA 1HRI3 2QCFA 2B8MA 4BY3A 3QMTA 4EN7B 2ZUUA 2OJPA 4KCVA 5K2ZA 2QLYA 4E2SA 4W8BA 1FWJC 4ZXLA 4P8WA 2ZICA 2ACSA 5DCDA 4HNVA 1NFGA 4KWOA 1STMA 3AC0A 3S4TA 1WZXA 2JICA 4ZU4A 2IXJA 1MEC2 3QY7A 1ASJ2 3R6IA 4R9DA 1FWRA 2V38A 3AL5A 3B7MA 4JIHA 1NTHA 2K0GA 2OKOA 3AS3A 3R4UA 1ZRCA 3VBUB 3RGBA 1OUXA 4ZO7A 1HRV3 3VIGA 1BF2A 2RR12 4AISA 4CD8A 3KHBA 4JGYA 3G1YA 3W27A 3VIKA 4J9JA 1X7IA 2QBXA 2YB4A 4GYKA 5D9PA 2HWF1 3HT1A 5F3GA 1H60A 3VMPA 1HV0A 3UJQA 3CASA 5XINA 4FB7A 1ND2B 2XWBB 5FKBA 2RDRA 3FXGA 3OBZA 2WSVA 1N8WA 3WLLA 1XRSA 1A6CA 3TYDA 1EAH1 2X2GA 2H0VA 4R85A 4Y5TA 3G3DA 5REQA 4OCTA 9XIMA 1AR73 2PWDA 2WV8A 4XAPA 3W9ZA 2QV5A 2DWRA 1EF3A 4DB5A 2VVSA 3GNRA 4L4PA 4Q8WA 2XFWA 4PUMA 5FJJA 2V82A 4AWEA 2H90A 3OPZA 4AYGA 4YGCA 1PIFA 4PJYA 2PP3A 4GB32 4LH8A 2E9QA 2NMOA 2A3BA 3MDWA 4LY4A 3T55A 4IJCA 4HPKA 4A05A 2YSWA 4PEKA 5E6HA 2QGHA 3OBEA 3E9AA 4DELA 4PYSA 1UH4A 2R24A 3DDMA 4G8TA 4OBRA 2WT0A 1LWJA 4JQRA 3ZLIA 5CPNA 1RUG3 2GSHA 1JW6A 1C8M2 1RHI3 5GLVA 2D5HA 1S2UA 2VNRA 3LSEA 2Y5EA 3H1MA 3HQNA 4Z1YA 4JHZA 4RHV2 2OZ0A 4RSUA 2G96A 3GXUA 4FFIA 3KT4A 4IG2B 4YZ2A 4ICCX 4R3UA 2EPMX 1W2OA 4JQ2A 4ATDA 1JZ7A 1IPSA 4DHGA 2QZRA 3G1DA 1LOFC 4DZAA 5KR7A 1WDPA 5G2WA 3EDDA 3WG3A 5C5YA 1DIWA 2GNDA 1F9CA 3AMNA 3W7IA 2NYYA 1RALA 2X29A 2YCJA 1PIV3 2Q0AA 1XYNA 4RS5B 1B1YA 4BMBA 3SCGA 5IJRA 4J3ZA 4C6DA 1X39A 3GH5A 1MYRA 1WDQA 3N7JA 3L4YA 3ZXLA 1FP8A 4PBFA 3W7OA 2FBEA 2XHNA 3VIOA 4XUGA 2X1TA 2UWAA 3KWXA 4BFAA 3SEEA 2FDHA 3TEXA 2J62A 3U07A 4N8MA 1UP2A 3H8XA 4YVSB 4CCJA 3QPEA 2UBPC 2JE8A 4NHVA 1JF6A 5A3OA 1XRVA 4E4ZA 1QJX1 3FBYA 4HSJA 4QPYA 3DC0A 2V09A 1B3YA 3LPPA 1UQYA 4CCEA 4W8LA 2PC4A 3UQNA 1Z44A 4IQEA 2AL2A 5CISA 3GF6A 3W2NA 3BUVA 3G6MA 3AAMA 5T55A 4NJHA 1GU3A 4Z07A 1Q8VA 1R3WA 4A8LA 2Y7GA 1IXPA 1TPH1 1K4GA 1WV2A 2XIQA 2VZPA 4M01A 4QB2A 2JEPA 4DI9A 1MEHA 5AC5A 1CAWA 2W0UA 3BLIA 2ADEA 2DORA 3BLKA 4N43C 1IGWA 2ADDA 2IPFA 2OGJA 2JG8A 3M47A 5F2LA 5GLTA 3TLLA 1ULEA 1ODZA 3P7YA 3S6DA 1IEVA 4ASLA 3DEQA 4BIFA 2IVIB 3H8AA 1TNRA 3THTA 1CGXA 1D3CA 3PVOA 2YFUA 1R6WA 5BNOB 3ES4A 3BTYA 1LOEA 2NV9A 4MDOA 1YLVA 5L9RA 1QKQA 4MB5A 3FNDA 3QN3A 1O60A 4RQPA 2RDNA 1E6RA 1KM5A 3ZJ7A 1YBQA 5DCEA 1PCKA 1J5SA 1HQWA 1DJYA 3ACHA 3FLTA 4GNJA 3KCCA 4MGKE 4E4UA 3E0VA 2YYTA 2A6VA 2HWE3 3BC9A 1VBA2 3DUIA 4FXRA 1FNZA 1QPRA 3IVSA 1BYAA 1LBMA 1W5QA 4LUJA 4RW5A 2BOFX 4I90A 3T2TA 2E7FA 1C8QA 5AKQA 3TYUA 4MNKA 1HUVA 3V18A 1AF9A 3HD8B 1QOSA 1SU5A 2XL9A 1UR4A 2WQZC 2IMRA 3LA7A 7A3HA 1RB8G 5LXXA 2AENA 5A7QA 3EX1A 1UZYA 3UJ2A 4UTTA 4UFIA 1MZEA 3OYZA 3GYEA 4UBHA 1QI5A 3BLEA 2OX1A 2XLAA 1QMLA 3WJYA 5C2XA 1R2TA 2E7QA 5FMOS 2F61A 1W8TA 3CF6E 3A4AA 1C9DA 4IEZA 4S3GA 3R05A 3JD71 1PTAA 3GG7A 1IOAA 3AXXA 3ZN6B 1Z3NA 2ES3A 2RMU2 3NQ2A 5KXEA 4NZ5A 3POFA 2ASHA 5I0SA 2Q8XA 4AF0B 4M24A 4AIOA 3PN8A 3RNDA 3S2MA 2ZOEB 3IJLA 3TB0A 5GM0A 3S9IA 4K21A 4ZS3A 1NYWA 2KA3A 1S38A 3HIJA 6REQA 1BVP1 3VNDA 1OADA 2QQPA 1OT2A 3M5YA 4I02A 4M29A 2WKGA 3DKLA 4COUA 2C26A 3N19B 4JTUA 4K7VA 1TE1B 1L7QA 3VKKA 2VRKA 5T5OA 2RJLA 1UR9A 1U1JA 2QPSA 4BCUA 4MIMA 4Y9MA 4AGVA 2DUQA 1U5JA 1SBDA 5FZIA 3RM4A 3H7YA 2ZX6A 5DN2A 1TE6A 4XFGA 4B91A 2D43A 3NZGA 2YCKX 4QG8A 3UY8A 1OD0A 2WPGA 4O17A 4TV5A 4HYRA 5T9CE 4B3LA 3IPVB 4A2UA 3UZXA 2DSVA 3CAVA 2HSAA 3O16A 1R9ZA 5FYSA 1K4HA 3WJSA 3OGVA 4ZMGA 2VECA 4IGPA 1P8JA 4UW3A 1O1HA 1VPXA 4NAEA 4G3YC 1TCDA 4IZGA 3VDBA 4AR2A 1GOFA 4CNUA 5CGQA 1XC6A 4OUMA 1KM0A 2FPVA 1N8IA 2R91A 4M6UA 5FP3A 3TN92 1IPKA 1GOQA 1ST8A 1BEUA 3CIVA 4TVUA 1U5HA 4N53A 4M3CB 4FPJA 4Y20B 3TN5A 4P8VA 2OO6A 3E6CC 1RUNA 5KXDA 4Y26A 1KGUA 1PGL2 2WZHA 3VB9A 3QGAC 3CHXA 3EX2A 4XF9A 4J28A 4XZ9A 2C91A 3RLGA 4QKNA 2OQHA 2G4IA 4XJ9A 3BMVA 4NMIA 4Q0UA 1ADSA 2BDQA 1W2AX 1H6YA 2BGCA 3HU7A 3C5QA 1YMYA 1CXEA 4COVA 4MDPA 3WD5A 3H8RA 2EAKA 5IVBA 5DANA 5FKYA 3ES7A 3S1VA 1MXGA 3IVTA 1UUQA 1ONWA 5GLZA 4S3KA 4D69A 1J96A 1Q6RA 2WO1A 2C1GA 3FVDA 4IHCA 1TB3A 1HT6A 3C56A 4FPFA 3BGAA 3F95A 4LW7A 2R073 2Z42A 2BTVC 2ISFA 1LUCA 4BZ4A 1XIBA 2O9RA 3RRAA 1PV8A 4KBZA 1BG9A 4NYUA 1YDVA 5IFTA 3P82A 4EKJA 5CEHA 2ZMNA 3SUWA 3U9IA 5FZFA 5AVAA 4GG9A 3OODA 4EF9A 4Z17A 2YZRA 4JGYC 2Y6LA 2JG9B 2BFUS 1MDLA 3M0ZA 2OT7A 1XGDA 4CQCA 4QQUA 2DU0A 4P8XA 3EB3A 1GOOA 4FZIA 3V64A 4EXQA 4WRHA 2FZNA 3OU8A 4LJHA 4L56A 3HG5A 1RGSA 1XJAA 1JUKA 1HW6A 1JPMA 3ALGA 3P74A 5C3PA 5FY0A 2WC7A 1EEXA 3L12A 2WSQA 1O95A 2CLMA 1P5BA 4XUNA 4O1CA 3UWUA 3CZ8A 5DO8A 1K5MC 3E0LA 3V0BB 4PB4A 5I06A 1RD5A 4LKDA 3UR5A 2YA2A 4W7VA 2Y6ZA 1N8FA 4IISA 5JXQA 4GYFA 4FOVA 3WELA 3ARTA 1CXFA 1W3LA 3ZOAA 2EGZA 3TMLA 4PI0A 4Q1RA 5KXBA 2DFBA 3FYPA 3UJRA 5KHKA 4FALA 3JVAA 1OB0A 1QF3A 5FP7A 3R4SA 1DTNA 3NRUA 5KXCA 3W7NA 3W53A 1E4NA 4Q8MA 2ETEA 1K7FA 3KLLA 4FX7A 5K4XA 2QDNA 4CUCA 4LS2A 2DTYA 1J0HA 1K9TA 3NXFA 3ZVHA 3A5FA 1UUMA 4GQBA 2AEYA 3ZYPA 3K51A 1XOYA 1VYSX 2YLLA 2R1KA 1D7FA 1VBRA 3OY8B 5A3NA 2I2SA 3GSMA 3LI1A 1WZKA 1V70A 1OEPA 1O8SA 2ZKNA 4P02B 1PO9A 3NIYA 3IZOA 1RZMA 5H9RA 5D09A 2FH6A 4DZ5A 4IGNA 1XB9A 5A3TA 2D24A 1BMV2 4HPNA 4D6EA 1ECQA 2ZC8A 2R16A 4NWWA 5C4WC 1DQUA 4JGYB 1UWIA 1AMKA 3B0PA 1KTNA 2QMKA 1X98A 4JEQA 3Q94A 3TYAA 4XABA 3ZYZA 1HXS1 4K1WA 3OSDA 2WFF2 1FXQA 5KZMA 3WQ4A 3DG3A 3GXFA 3NW4A 1XQKA 2H8ZA 1ND3A 1JXJA 1L9WA 2TSYA 1HF6A 4MKNA 7REQB 2E5CA 1S0IA 5FF4A 2AACA 2AKZA 4AGGA 1BK1A 1V02E 3H0OA 1VFHA 3N12A 2PLJA 4MY1A 1QH7A 1O4ZA 1PIGA 3GB6A 1R46A 1E1EA 2Y7FA 5REQB 3W5MA 1SFLA 2QEZA 1W91A 1PPIA 5B7YA 4MLRA 3CZLA 3VV1A 1Q4WA 3TJ4A 2ACRA 4EAMA 1R083 2W0XA 2VZRA 3H3ZA 1O5UA 3HA1A 3BUCA 1KXTA 3GFYA 4AFDA 1QQP1 1V3IA 1F4AA 1DQXA 2Y88A 2I5QA 5D37A 1E3ZA 3IAPA 4HPKB 3VZNA 1XFBA 2E26A 2PP0A 2V63A 4XE9A 1CZ1A 4IV1A 3PIJA 2YBVA 4FLSA 4C7GA 4MF4A 3N6JA 2ZS6B 4MH0E 1OM0A 3HJRA 3PSVA 2R1DA 4I6VA 4JHMA 4CCMA 2HWF3 4AZ5A 4LO5B 4F79A 4E2BA 3FE5A 1MQPA 4OGZA 4B2DD 1A5OC 4IE5A 1ZYBA 3VDHA 3MP5A 2YU1A 4F66A 2JG8C 2P6HA 2PBOA 3SADA 5FZMA 4P5HA 3RDIA 3BAIA 4N02A 1Z9AA 3UZZA 4I6KA 3NV4A 3LB9A 4BWLC 4DJDC 3S9ZA 1VP6A 2NT0A 3GAKA 1M1BA 1EPWA 3PF3A 1EAH3 4ZPIA 2FCUA 2UYBA 1WXZA 3B00A 3FLRA 3PJWA 4FX8A 4GYPA 1FPN1 4CNTA 3ABZA 1GYMA 1UPSA 3UJOA 1GOHA 4L8QA 2QQJA 4MFEA 5CFDC 4HU3A 5FZ3A 1LCOA 2VHLA 1J12A 2DCYA 4ZXKA 2ET7A 4W8AA 2FDIA 2Z7KA 1H2NA 1OKOA 3QQ0A 5F2WA 1FDZA 5JAXA 3WQWA 3UCQA 1TKKA 1FWTA 4C6CA 3M7SA 4JTEA 2FDJA 3E3HA 4WXYA 3TKFA 1LOQA 1T40A 1XPYA 4DM2A 1V0KA 4KG0A 1XIHA 3LE0A 1MW1A 3CJIA 3M7AA 4A7YA 3CL8A 3QEZA 1WCDJ 1Q65A 4ZFMA 3VC6A 2CHHA 2E6FA 4XVDA 2Z27A 4UQEA 1NWRA 3QGVA 3SSZA 3VKNA 1B30A 3KS6A 1VBC1 2YDQA 1YJKA 1PYMA 1R3YA 1V8EA 2QDRA 3IGUA 3B8WA 1IKQA 1CAWB 4GLEA 5GJMA 5FP4A 4W9TA 3MYOA 1EX5A 5E6ZA 1Q63A 3KOFA 5A7SA 1QNOA 2JG8B 1U5IA 3LZ5A 4DEFA 2RR11 4Q29A 4AI0A 1HL9A 1YQ6A 2QUTA 4QKDA 2BPA2 2B7OA 4Y9PA 4JYDA 3CYVA 1TZOA 2P0IA 2WRAA 3O0KA 1M65A 1E43A 3MW7A 1R3TA 3PNUA 2D93A 4CYDA 1ALDA 1XISA 4RQPB 3EXSA 2WNOA 1G7YA 4HTYA 2BY2A 5FPBA 4PMOA 3W7PA 2QKFA 5CJMA 3QRHA 1PB0A 2JDPA 3BICA 4GX9A 4NZ4A 3R89A 1QJX3 3AFGA 1VR6A 2WN2A 2QJHA 3L7RA 4F2BA 3F4WA 2V2CA 2O7SA 5BROA 3MT1A 1IWPA 3TLQA 4KW2A 3T4CA 1VPHA 4KEZA 1XLJA 3NJVA 1KBJA 5IK5A 3LM7A 3ITVA 4GB31 1F6PA 4DXVA 1TCMA 2DIEA 1QU0A 1C8XA 3AP7A 1CWPA 4Y1UA 2QJNA 1ZPTA 4IP5A 4PUKA 2BERA 1EWEA 3WY6A 3WLQA 1BTMA 3GVGA 1W9YA 1U5YA 4FOQA 2GMPA 1Q8AA 1FWHC 1YPXA 4HHPA 4AAJA 1DGLA 2WNWA 4CEYA 1MW3A 3UWVA 3C2OA 2J77A 4K1ZA 1BF6A 3HPZA 1FUYA 5E1RA 4RHV1 4PCTA 4AHZA 3CAQA 1IEWA 2PDNA 2FMNA 4UUIA 5ABGA 1H7WA 4MGYE 4H9MA 4BLJA 3LMYA 4N53C 3OVQA 3DKWA 1EJXC 3S5YA 5FOOA 3ARUA 2JENA 5CPQA 3NQ7A 3SCRA 5HMDA 2OYZA 2R042 4GCAA 4J2MA 3USUA 3AROA 1S0BA 2B7NA 3W4RA 1HG3A 4YIWA 2XSAA 2BU9A 3LXBA 4JN7A 3BIWE 2PLMA 1U5VA 1KM2A 3LCIA 6REQB 5JWPA 2OZJA 5E1QA 1LAJA 5FMBA 1W6NA 5CBLA 1QPQA 1LDCA 2O92A 1XFCA 1WUEA 3PPHA 2ZTNA 3ICJA 3N3MA 4YYOA 2OSWA 4RXFA 3CIXA 2J8GA 4LBJA 2CGOA 3H2FA 2J13A 1RUOA 3GH7A 2NN8A 1YTDA 3ONBA 3IIAA 3SISA 2YYUA 3GG8A 4UZUA 2QQIA 2HEYF 3U57A 3JD73 4S2BA 3E2VA 3WQ6A 2UY2A 2R6QA 4XF3A 3HV8A 4GH3A 4ML4A 4MPKA 5G4HC 1Y9QA 1EHAA 3ANVA 4NAEB 2OXNA 3EA2A 1SCSA 2GGJA 4K68A 1GZWA 4IE6A 2PHUA 1E0VA 1UWRA 2LRPA 2PWFA 1FTXA 3NM1A 1JNDA 4ZOAA 3VYLA 1YCIA 5K8SA 3ANYA 3A23A 1G9FA 1R0MA 1RY8A 4FA3A 2XKPA 4QXHA 4GO9A 2EIEA 4GIRA 4N53B 1UPIA 4A29A 1ZBCA 4LJ3A 2EXHA 2DW6A 2ARBA 2C5DA 3GZUC 1XYZA 1OF4A 5EBUA 2H0BA 3DHPA 1E72M 1LROA 4B9YA 2BX7A 1IKPA 1UMYA 3C7OA 1G6CA 4X9YA 3LRMA 1T0OA 4PBEA 4YNIA 2WYFA 1I0BA 4XTDA 2GJXA 5A6ZA 2H6RA 5C9UA 5FYBA 4Q1PA 1K70A 2EIGA 5FYTA 1R2RA 1L8PA 4CEWA 3NJXA 1PX8A 1VFFA 3UBPC 4BXFA 1M7OA 4LAUA 2E4TA 2DT3A 3BSGA 3PZOA 2GOUA 4D3WA 1SQ4A 2VMGA 4H7MA 1O4TA 4AQ2A 3U3HA 4GACA 4R33A 2ZA2A 2PLV2 4K8EA 2PI6A 2YZ5A 3DHDA 2O0TA 4CCCA 2B42B 1W1VA 1H7XA 4GHRA 4L80A 3R4IA 1JI2A 2E9MA 2G3MA 3GAYA 4MWAE 3AISA 4XUOA 5A8NA 2EJAA 3KP0A 3CZJA 3CQIA 4IIHA 3ARZA 3MPBA 1GNYA 4E0CA 5FZOA 3F4DA 4Q8QA 4S39A 4FHAA 4QS6A 3VMOA 3GBEA 1LUCB 3U2OA 4RFRB 3GCWA 2DU1A 3P3PA 1RVKA 4PCSA 1UKOA 3FJSA 4YHEA 4W85A 5F4WA 3KLSA 3ZXDA 4FOYA 5IXEA 4LO6B 1HJXA 4YTRA 2X0YA 3T0DA 5A8PA 3VINA 2Y38A 4JN8A 3E0WA 3KT1A 3MSYA 5JPMB 2BLEA 3Q45A 2Y8UA 4AD4A 2JIWA 1CGUA 3U7BA 4MXWA 4MWAD 4A6SA 1R092 2QIIA 4ES4A 3PTRB 3IDAA 4QLJA 2A3XA 5CAKA 4JVAA 2CHNA 4B15A 3H2MA 3K30A 5I24A 1G4SA 1WUVA 3GD6A 3HNBM 4BISA 4RUBA 4QX2A 1XLDA 4IEYA 2EA7A 4YM2A 1PZ9A 1JYNA 3IIOA 5JBFA 1J01A 4AAPA 2GC2A 2QE3A 5A7PA 4HA4A 1GFF2 3EMRA 4JRAA 1UROA 5D9NA 3QVQA 2OX4A 1GW1A 1W8GA 1R86A 1KFLA 2Y62A 1QU4A 1IIGA 1KW1A 1VHCA 4W4QA 1QJEA 1ZJHA 2YKKA 3VDCA 1JYIA 4P8UA 3S42A 3O2LA 1LHVA 1Z7S1 5I5RA 1YNAA 3O1RA 1LHWA 4RE2A 2VRJA 2OUJA 3KOWA 3EPOA 3PFMA 4IV1C 3BW2A 3PULA 3LEIA 2ZGQA 2VMHA 3BB6A 2YA0A 5GJPA 3OYXA 3A4XA 2ZC1A 3FWEA 4IERA 2AQVA 1OF8A 1TV2A 2YCIX 5EZWA 3ZKYA 1CX9A 3ACGA 4ASKA 3THCA 2XB6C 1R8LA 1NOVA 3C3NA 5GNYA 3TN91 3AYAA 3WDUA 2R062 2XYLA 5LA2A 3UYJA 4XQWA 1H1ZA 3MIGA 3ZXKA 1SZFA 1RUJ1 1CLXA 3R58A 2J1SA 5FZ0A 4JR5A 3I7DA 2ZRVA 4GYPC 1VJIA 1PVNA 2BBAA 3LHWA 5G1YA 4DO4A 1ND3B 4ATLA 3LN3A 3WUDA 2WUHA 4K6BA 2DBNA 4BOWA 2OSXA 4GZEA 4UMAA 3BCDA 5GNZA 1JYVA 4EXBA 1MVQA 1YEYA 3IAQA 4Y5SA 5HNTA 1E71M 4JTDA 1UUOA 5C3OA 1OFBA 5I3KA 4KH9A 2ATFA 2FHCA 3HOJA 5JSRA 5KHIA 1AR62 4MYEA 1B3ZA 2DZTA 5LHEA 5F1UA 1LQAA 2RAGA 2GDQA 4NF7A 3ZMRA 4PUDA 1DGRA 3L65A 1E56A 1TWIA 4UQCA 3SSJA 2WHKA 4Y9NA 3B69A 4Z2LA 4PSRA 2DZUA 4QKBA 3PWAA 2F6BA 2J1UA 3KS7A 4UTUA 5ABEA 4PTNA 3GH4A 3I4KA 1FOBA 2BGSA 3BJTA 4FPKA 4OULA 1LLWA 1AQ0A 5FV3A 1HXS3 4QS5A 3WBEA 5BRBA 2RJ2A 3THPA 3CUXA 4L1XA 5G5IA 1IG0A 4UFJA 1LESA 4K8HA 4O8AA 2I07B 3RZLA 2PODA 1RXGA 5F6KA 1O3TA 1W6TA 3PTQA 4J3WA 3VMNA 4CDXA 5FJTA 2BW8A 4CN1A 2JDHA 5LNRA 4LXLA 1DWAM 1JPKA 1Q5MA 3MIDA 4MHUA 4LF1A 3U4SA 1DQ1A 3MEPA 1W6MA 4DJFA 4QHZA 2AL1A 1K7XA 1QQP3 2HBUA 1RUH1 4KMQA 4WKHA 2BY3A 1EWDA 2DSKA 1GPWA 3NWKA 1HO4A 2EG6A 5CEWA 4OHWA 5KZEA 3APBA 4QPGA 4U2AA 1E6PA 2QTWB 4KGGA 5AECA 3GVVA 3OVGA 3C2EA 2ISVA 1H30A 2FMYA 1VB2A 2ZZ3A 3M0JA 3EDJA 3TYBA 2ZUNA 2ZGKA 4M51A 3KF3A 2WKJA 6ALDA 3WBYA 5FAGA 3NQBA 3UJSA 4D8LA 3SGUA 3V4BA 1HB3A 2R32A 3CJIB 2Z7GA 3DUGA 4BQWA 5D04C 5IVYA 2N7GA 4ZVJA 1H0GA 4AIBA 4LS1A 1MUWA 4B3NA 1V08A 2HE8A 3MA8A 3JCIA 3MYPA 2P50A 4EIVA 2FIQA 5FP8A 4S3EA 4FXSA 2BG5A 4ERIA 3M64A 2GU9A 1RQHA 2Y6JA 2VTXA 4HK5A 3VC5A 1OFPA 2ZX5A 1O5RA 4BYYA 4AC7C 3BVCA 4OI4A 3SCQA 4NHYA 4PSPA 1FPN3 3LCHA 1OABA 3AVRA 3OB8A 4KS0A 3HIFA 4D6DA 2IKIA 4MLOA 1HIZA 3U4AA 2IXKA 3VDGA 2Q30A 5FZEA 2UWFA 4IIDA 1RUD2 2VMIA 3W1NA 3HZ3A 3WNKA 1UQXA 2JDNA 2C0HA 4A6GA 2WS92 3QHMA 5H6HA 2HYKA 1H3GA 4CQDA 4UFMA 1PDYA 3A13A 1PM7A 1AL21 1FWFC 4HK9A 1CDGA 2ZEZA 5KZDA 3IWPA 3B9AA 4WGHA 3UYCA 1PEZA 3U48A 1QW9A 4GKTA 1DXEA 1YDNA 4DF2A 1AL8A 5IOBA 1EA0A 5LYRA 3PFRA 1LOAA 2C9AA 5CVRA 1GKRA 1FOD1 2V9DA 1G69A 1KV5A 5BNPA 3SN0A 1PO21 4GMP0 5AFEA 5IT6A 1VBC3 4O7XA 4FR1A 1PIIA 2PYTA 2J1RA 2J79A 3VDDC 4Z2GA 4NIGA 1C1LA 4U10A 1XCWA 4HK7A 2CLKA 2X0SA 5I8TA 3Q67A 1Q2SA 2O56A 1Q6GA 5FPLA 2EPOA 4X2PA 4A8RA 3UA4A 2ZX2A 1RUF2 2RR13 3N13A 1OCNA 1OZMA 3MI2A 1DQ4A 2VQUA 4AVFA 1J5TA 4QAWA 4CEYB 3WLHA 1XF0A 4IXXA 4AZBA 5LSMA 2D6KA 3QBUA 4PBOA 4Q4V1 4UI9L 1N1SA 1UY0A 3PMEA 2A73B 1E5JA 1WUFA 3SM0A 2K9ZA 2GWGA 1GQPA 3MCNA 4ASTA 1YWKA 1AX0A 3ZJ8A 1W2NA 1J3RA 3KV4A 3SY8A 4H04A 3WH7A 1LHUA 1KO0A 1JCJA 2OODA 4QITA 3USUB 3K75B 1AZDA 4R27A 4AVVA 4E38A 4XO6A 3F2CA 4D94A 1QDOA 4HL0A 2VCBA 2QGYA 4S3DA 2Z29A 5U7SA 1MZRA 3VDAA 4CEWC 3M3CA 1W6NB 1PL9A 4UW5A 4ZCWA 4GB33 3S47A 2C16A 3FMGA 1FCBA 4DNHA 2Y64A 2V5KA 5G2IA 3NNMA 1EEPA 5IHSA 1PZ1A 3RPMA 4LXFA 4HVXA 4A42A 2G5WA 3AMGA 2DZWA 3QR1A 4HU0A 2VXNA 4CQBA 3M70A 3RYPA 5D8ZA 5A6SA 3VOCA 1C8M3 3XINA 1MS9A 3EB2A 5A2AA 3B8VA 1XD1A 1KRMA 2IPGA 3MP4A 3TC3A 2C15A 3FOKA 3FA5A 2QJMA 3U8GA 2G9GA 3AFBA 4RHV3 4BA6A 1AR81 2Y8KA 1S0GA 5IK4A 1OOPA 1CGVA 4AHWA 3IIVA 5F5QA 4IF2A 3F5JA 1F3WA 3ROUA 1E0XA 1TV8A 3V35A 2XISA 4QHBA 3VKMA 1XXXA 3ZXGA 1SJBA 2NV2A 1X7FA 1GZWB 1IG3A 1NLSA 3VL9A 4H7LA 2A4AA 3B06A 4AZHA 3LSDA 2DSUA 1H09A 5FLJA 2E9LA 3V65A 2VKZG 4JS3A 1YIPA 5D9MA 2XGBA 1OF6A 3WQOA 2B7YA 2LLEA 1ZZBA 3ZXFA 4XMAA 3BVJA 1ZFJA 3SITA 3PK7A 5JIPA 5CLTA 2ARAA 1WCGA 2WFPA 3OOQA 2GJXB 4SBVA 3UW6A 1C91A 2X42A 2ZBJA 4GUHA 2ZZJA 3NXLA 3AP6A 3I6TA 3AICA 1ZP3A 3I54A 3GJBA 3N7LA 3O1UA 4P61A 4HMDA 5FYZA 3LGDA 4AAXA 2BNOA 5AYBA 1R3SA 3EMQA 1AYN1 3NQ8A 3BOXA 2B45X 3NQVA 3UGFA 2GVGA 2VX5A 4U2YA 4XQ6A 5DABA 4C6BA 3RCNA 1S46A 1UKTA 3SH3A 3IDEA 1NXMA 3OZMA 4KGJA 1WKDA 4GWMA 3ZT5A 2WSUA 1UA3A 2WDBA 2UWCA 4FXKB 4BIOA 1FHUA 4A44A 2ZUWA 1GWKA 3SKJE 5JXGA 1L6SA 5A33A 3CBNA 1W3XA 2D2HA 4JTKA 4RDWA 3NGFA 5HWNA 5FZOB 1Q2RA 1PKYA 2BSLA 2E1DA 1R1A1 2RJKA 5LIWX 4QDSA 4DF1A 1QWRA 1O7FA 1LGCA 3WUCA 4YN5A 4NHLA 4S3JA 2DVDA 2VD8A 5KWRA 1D4M2 3SN1A 3SQMA 4DEVA 4YW6A 3VHNA 2WNQA 4P9GA 1DVJA 1E6ZA 1K77A 1NG0A 1UOBA 4FFFA 4MXWB 4EXAA 2GDUA 2A5ZA 4H8HA 4BF5A 4LK6A 1WAWA 2FVKA 2IZWA 3AZZA 4MJMA 1HB4A 1YQ5A 2OZ3A 3W59A 5C3QA 3TTSA 1T99A 2Q1FA 2GK1A 3KCXA 1HXJA 2A70A 3VHOA 1CCWB 4LRTA 5D05A 2VZVA 2P0OA 4Q0SA 2VVDA 1U1HA 3CT2A 3O7OA 1F8VA 3Q8BA 1TR9A 4Z0SA 2Z1XA 1XPWA 2VENA 4NIHA 2UV8G 5D2WA 3LTYA 3TSBA 5T5PA 3A12A 3PBMA 2A7RA 3WQEA 1FI2A 5D33A 1LULA 3EOSA 1FMD2 1JGMA 3OGJA 3P67A 2J7CA 4P7NA 4YVVA 1GK8A 3V5FA 4EE9A 5DY3A 3WBWA 2GJRA 3LZ3A 3G1RA 1WLTA 3MQTA 5KITA 3PJQA 5AZ0A 1ZZ8A 3I2IA 4I9TA 2NVAA 3A24A 2SLIA 1ZZ9A 2Z4FA 2Z6IA 3ZOIA 5TBOA 4CZSA 3O6CA 2UURA 3ARRA 3QZEA 5EY5A 5HMEA 3MY9A 2GQ8A 5FUPA 5L9BA 3GHSA 5DUVA 5FMDA 1QT1A 4YW2A 3WD4A 4UC5A 3S57A 3I7RA 3G1AA 3IMNA 1EJSC 3QQWA 3BDKA 1POV1 3VM5A 1F9KA 4LALA 1JPIA 4AVSA 3UFYA 4I09A 1H2KA 4UZSA 2P6CA 3O1VA 5LATA 1TSIA 2JF6A 3E49A 1TVLA 1WD3A 1WMFA 1UOGA 4H8VA 5K9YA 2JGYA 4TXEA 1Z7S3 5CSSA 1DJWA 2ALRA 3O1NA 5FYCA 1ZB5A 4ZTYA 1DGRN 5LK5A 3B8SA 4C0HA 3UV9A 4HOXA 4AY1A 3WCSA 2DZAA 2KM2A 3GVQA 1H41A 1YXYA 3M0LA 1FHDA 2HJIA 3T40A 4GC4A 3WOGA 3W1RA 2C18A 4D6JA 1H6XA 5LASA 1ZUAX 4DO6A 3AIWA 2IUWA 3WD0A 1XIGA 4JICA 1JYXA 3NO1A 1S2EA 3MB9A 4AD1A 3WR0A 2XFFA 4H9TA 4OZXA 1W54A 3SUVA 2EXOA 4CN6A 3TN93 3G0SA 2VUJA 4OE7A 1RIRA 6XIAA 3UR7A 5K0UA 5EJ1B 1O12A 3AMLA 4IIGA 1RUJ3 1UWAA 1W9XA 2Z4GA 4J3VA 3IRSA 3YPIA 4QQLA 2QV4A 4FAMA 2PU1A 1FWNA 3TN3A 4GK8A 4LBNA 3WQ5A 2E7TA 1DQ6A 5L9FA 5T91A 4EWJA 2HKXA 4LCSA 5TAOA 3NURA 4AHPA 4C1XA 4FPLA 2G3IA 5A6KA 1VRBA 3E5PA 1RJPA 5FOJB 3IJ6A 2LROA 4RXGA 4Q4MA 5JZGA 3URBA 3NKGA 1EGVA 1LORA 4HKOA 2WC4A 4CDXB 2OZ6A 3WLSA 1JUHA 1WKYA 4V1PA 3WFLA 1BGAA 3GIPA 2IVJA 3CDZB 3SGZA 2YGMA 4DUVA 1GVIA 1CB2A 2BVBA 1W6MB 3ITCA 2QUUA 3VHPA 4JTAA 2X5IC 4UFHA 1J0ZA 2GN7A 1G4EA 1NX9A 1MFUA 2RDTA 2ZZ6A 4OWGA 1GOIA 1HNYA 3KGZA 2VL4A 4QPGB 3LQLA 3I68A 3O8AA 5CPTA 3TU9A 3VZXA 4F0MA 3OBAA 1UZHA 1NQ6A 2NZ9A 2YC0A 2GN3A 4Z2AA 1ZJAA 4AD2A 3GNEA 2JDZA 5BUVA 3UGHA 2P88A 3A3WA 2IW0A 4HANA 1DJGA 3M44A 1N47A 1OGSA 2B39A 5C9RA 1AH3A 3G3MA 1PMHX 1XRFA 4IV3A 1HKIA 3GHTA 4XFCA 1W1TA 1XLBA 5I3JA 4R9AA 4TSVA 5CSYA 2OWWA 4WZHA 3WP4A 2X30A 1FCVA 2CBJA 3NQFA 2LUWA 3FHIB 1HJQA 1UQZA 1IYXA 5I03A 4AEMA 2FHFA 4D72A 3S1UA 5HJLA 4NAOA 1DWFM 1W9DM 1RUH3 1LODA 2PTXA 2YC4A 1HJWA 3RG6A 4MVAA 2BGNE 1W8OA 1WCKA 2DBIA 1JF5A 4A2RA 3ZO9A 4TMCA 2VCMA 3IS4A 1DYPA 1WW4A 4CP0A 3LI0A 5EIYB 2FMDA 4DYKA 4K3UA 5I93A 2YL5A 1MEIA 1NLRA 2HEJA 4PFMA 4V2VA 3OBKA 3TCSA 1ZJBA 1AJKA 4F7ZA 4DLFA 3TTEA 2VFEA 1W3HA 1HQNA 4IMDA 4PFHA 3VI2A 3TYZA 2C24A 3W29A 2YDRA 5BNPB 4AHXA 4QE4A 4EX4A 4Q4PA 2DZPA 4WOZA 4US5A 4KEMA 3KTCA 2OS2A 2FGZA 1W9SA 2J7EA 1NDYA 1QDSA 4C0BA 1UH2A 4B4PA 3W7DA 3WG6A 1SFJA 4S38A 2VMFA 3NVTA 1BPLB 4H9ZA 3MC5A 3I3EA 3R79A 5E6YA 1TZ9A 5CG9A 1OOPC 1B3XA 4MHRA 4O1EA 5K9XA 1PM4A 1UYYA 1R38A 3MLLA 2XN1A 4XD5A 1JR1A 4D8MA 4LA2A 3UKTA 4RZBA 4NIRA 3HPFA 4J3XA 5J96B 3E1F1 2EF9A 3IJ7A 1VHNA 4MWAC 5EMMA 3NZQA 2C14A 1OFQA 4Q4X2 1XE8A 1CJPA 4OVXA 2A1XA 2Z1WA 1UYZA 3FGCB 3QKEA 4YGDA 3K4DA 4JD4A 3UNPA 3KXQA 3UNDA 1AL23 2Y0FA 1XYMA 2WO2A 1UKSA 4ZQRA 3ARVA 5LA9A 2PRHA 5FZCA 3M0IA 4KFPA 2Y7DA 8XIMA 1AJ2A 4IUOA 4CNOA 3CL7A 2AGTA 2P10A 3AHZA 4PRTA 2OKXA 2ZZ5A 3WP6A 4YNGA 1TWSA 1LTDA 5BOEA 2CZFA 1D0GA 1V3LA 5C7HA 1NWUA 2OT0A 3WNPA 3QY8A 3MCOA 3PSWA 5FJRA 5MKGB 3L67A 4Q4QA 2ZX7A 1V6OA 3BPZA 1TV4A 1RBAA 4QCEA 4P7QA 2PXJA 1ZM1A 1TQ5A 3KSCA 1WX0A 1RH9A 3C61A 2PAEA 1G9DA 3W6LA 1P1MA 3HF3A 1VFUA 3MMUA 3PUEA 2B31A 4RZ4A 3DENA 5AHMA 1JG9A 1HL8A 2PDCA 2HLEA 4ZB2A 1UNBA 3MF6A 3PP7A 2CEQA 2RH9A 5KMYA 4OOUA 2Z2AA 4MNLA 1HRV2 3I6RA 4OQ9A 5B4NA 1CECA 3N17A 2DZVA 4YGBA 4PMUA 4F8AA 3R8HA 1N82A 3JU2A 2FZ2A 1TWZA 5C6CA 4F48A 4I9AA 3GALA 2BUKA 4S2GA 4OT7A 4YLWA 4PTVA 3CHCA 3L0GA 2TAAA 3ZFGA 3M7WA 3E2RA 3CS2A 2P3JA 3KV9A 1GYLA 4LLFA 3R12A 2XZ7A 1MPXA 4L6HA 1H49A 2GUYA 3HO8A 5EYXA 1W03A 3IK2A 3AI0A 1VFTA 2DEPA 4F4RA 2Y4SA 3ITXA 2XPKA 3SR7A 1AR72 2JX9A 3E5UA 1JOBA 1DYOA 4JY9A 4KERA 5TD4A 4XZBA 3MCMA 4NXSA 1PHWA 3RIKA 1LOCA 3KCLA 1QI2A 3UGGA 5I00A 2BVTA 1OD5A 1XUUA 4NT0A 2YB7A 1J93A 1ZZMA 2JKEA 2RS12 1AR83 2XVKA 4JL2A 4EN0A 3W7EA 3T4VA 2ZUSA 1RUG2 3SQLA 3GDKA 1RHI2 1VFLA 5FPXA 5KHGA 2XH2A 4GISA 4HNOA 3B05A 2Y5SA 4PL1A 3KZ4C 2YCLA 1HGYA 3WDRA 4IL0A 5M3WA 3KVKA 4NRRA 3TW9A 4ZHNA 4UYBA 4HNTA 1H9PA 1DJNA 1NT0A 1W0PA 3JZUA 4JC1A 3S3GA 3O9NA 4Q33A 1XICA 1UMZA 1HKKA 3HOBA 2Z5WA 4B5XA 5D2TA 3JS3A 1CQ9A 5L7OA 3D6NA 3OD0A 1P48A 3I65A 4NP7A 3L4UA 3CWHA 4AIEA 4CPBD 1FATA 4C7FA 2W91A 4KGLA 4GQ7A 2W4XA 3GKAA 1PTDA 2QR6A 4WQ6A 3H7RA 3FL7A 1VFSA 5C3SA 3TC6A 5AHIA 3WYZA 7ODCA 2ZEXA 2V81A 2YDEA 4F3HA 2NUXA 4JDYA 5CZSA 3TQKA 3KGLA 3VNKA 2PQQA 3O12A 3AUJA 2GK1B 3LMZA 1JZ4A 4OHZA 4N9CA 3GDBA 4HZ8A 3IIZA 3NO3A 3BV4A 3W2KA 4NASA 5C55A 4ZO9A 2O55A 5HMFA 1QXPA 4FPSA 1QJY2 5A32A 3A9IA 4ZZ9A 3KM8A 2ATMA 2DVUA 3LHYA 1QXLA 4C6IA 1AH4A 2FZ8A 1KA9F 4IGQA 4GFIA 2WZIA 4XCAA 2JBMA 2VZOA 1CAUA 1R1A3 3ZT6A 4OHVA 1B5TA 2DZSA 4Y3OA 5F2SA 2Q6ZA 1J3PA 3KVLA 3MTWA 4XBKA 3CL6A 2KAUC 3D46A 4QM8A 4H6QA 3WJWA 4BJHA 1IGSA 3H9AA 4P5YA 2YDAA 2VOTA 3S8HA 3WLUA 3WH8A 4FLOA 4YWAA 2WWCA 1MRQA 1R3QA 5IATA 2GZWA 2EXIA 4H41A 5HNUA 1U5XA 4GZ9A 3B0VC 4Q6JA 1WBFA 5FZ6A 3WO8A 4Y1YA 2DUOA 4MJ4A 4Q27A 3ZLGA 1F6KA 5JZGC 3GTNA 5DG2A 3F5KA 1TV5A 4AVBA 1BLZA 2HWE2 4CU7A 1WXYA 4JXCA 1HQTA 1T6GC 1QJWA 3WK2A 2YUEA 4O28A 3MV11 2FVLA 5AC7A 1JAKA 4YVPA 1XLMA 4LE4A 5AYXA 1LOGA 1XCXA 5FF7A 3ZJKA 1Z41A 4ZOEA 2WQDA 3DXIA 1KITA 2TUNA 3BAKA 3WT3A 2Y26A 4YTUA 4U2ZA 4XHXA 2DZXA 1OBNA 1B4KA 4JTHA 5AFBA 1N2VA 4JBRA 1XXNA 2PP1A 1UP0A 4JIIX 1SJDA 1DHPA 4IIFA 4IPIA 3NNTA 1SZRA 5BNNC 3AZTA 3NL1A 1HJSA 1IR2A 1KCZA 3H42B 3NZ1A 1KBBA 4L6DA 3S9YA 4ZXOA 5K0UB 3BOLA 1F15A 1LLOA 1WCSA 4TR9A 4RCXA 2E9BA 2J7DA 2R49A 1W2UA 1M7XA 5DX7A 1POV3 2W79A 2VZSA 3SRDA 1XL9A 2QQWA 3W81A 2WC2A 3AIRA 1D4M1 5XIMA 4IICA 2KZHA 4XW3A 3ILFA 4LUTA 2NSXA 1QDCA 2HBTA 4LTAA 2P8BA 4QFUA 1HN1A 4DPQA 1GZTA 3T42A 4QQOA 1P6BA 2XIIA 1REFA 3AOFA 5JBDA 1JZ6A 3NTYA 3IGSA 4MVTA 1F74A 1GQGA 4TUFA 4D7SA 2WNVC 5BXRA 1UAIA 1MVEA 2X16A 1OIFA 1LYXA 3POYA 4WX2A 1TPC1 4XAZA 2EBNA 4Y6GA 1EBHA 3AL6A 3R11A 3R4DB 4HSNA 4YZ5A 1C57A 4GVGA 4IFKA 4ZB0A 2DJLA 3WDPP 2YHJA 1ME9A 3QC3A 4HZ6A 1KFJA 2O1QA 4AEEA 1NQJA 1BQGA 1CVNA 3ZPOA 4PUJA 4E4DX 5DN1A 4R34A 3RMXA 2WXDM 2TYSA 1VBD2 1G8WA 1SMDA 2SFPA 1L6WA 4UR7A 2CLLA 2FJKA 4COWA 4GIEA 1LRNA 4RGAA 3O63A 1XLCA 1N3QA 1V93A 3T1LA 4JTIA 4EE2A 3UZJA 1GJUA 2JFEX 5HWJA 1M9HA 4JCLA 2CZ5A 1X82A 1E4LA 4IV3B 4MGGA 3CUIA 1RMU1 1W8HA 1QJU2 3C8XA 1REQB 3S7IA 3MF9A 5C9XA 1QO5A 1VKFA 1XLLA 2Y2WA 1GHSA 1NF0A 4NRSA 3F4VA 4MZ1A 4R4ZA 4XIMA 1WAUA 3VBSA 4GALA 2QVHA 1WLWA 2PDIA 4GGBA 3DERA 2W3ZA 3CM4A 1DQ5A 4LBQA 1VF8A 4LA3A 3O5SA 3RWNA 2NX9A 4LV4A 2PUZA 3USBA 1AQFA 1PGW1 2W1WA 1VAHA 1S2TA 3VIPA 5JQ9A 5EL1A 1UU4A 2CYFA 1V3JA 3LDRA 3PUHA 4J5NA 3RILA 5A8GA 4QWNA 1REEA 1ZCCA 1UWQA 2ZE3A 3BJFA 1CPMA 3IJ9A 3ZR6A 2K2SA 2PN5A 1VRDA 2PDFA 2B5HA 2VWSA 1T96A 3KEHA 2JKAA 1VFOA 3QH7A 3GW0A 1E55A 1B57A 1G9HA 4UW4A 2NLIA 4C1LA 5H8UA 2E31A 1K3UA 1L2UA 1M4WA 2YFNA 1MR5A 3F5LA 3KLKA 4JTLA 2VEKA 1SW7A 1SFTA 3ARYA 3LGEA 2PCQA 1QWKA 2BOJA 3IDCB 2VZ1A 5GZEA 3FV9A 2WL1A 4JDMA 2FTPA 3W26A 1XSIA 3UETA 4IW3A 4UBGA 2G9ZA 1F73A 2J74A 2WWJA 1E57A 3POGA 4XACA 2D6OX 1B35B 1Q3NA 1W3VA 3E74A 4DEQA 3DECA 2J8FA 2IFWA 3DPRC 4MB4A 3WDJA 4XD4A 3ZFHA 2X8RA 1TJ0A 4JN6A 2JF7A 3U2CA 4BZYA 5E0CA 2CGPA 5C9AC 2J47A 1IEQA 5D9OA 1DZTA 1H4HA 3DGTA 3QV6A 4PGLA 1V0MA 5EFFA 1CLKA 1AJOA 5FJIA 2VCAA 5CC6A 1LRTA