4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
molecule keywords B-AGARASE
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
1B31A 1JZ5A 2Z1KA 1DWIM 1JZ4A 4NRRA 3AYRA 5ABEA 3WDRA 1UOJA 3B9AA 2CERA 1LG2A 2WVTA 1W3KA 2VOTA 2ESCA 4AXNA 4B9ZA 4QLJA 4JKKA 1VB9A 3AIUA 2BS9A 4JIEA 3FXYA 2CHOA 2GJPA 4ZEPA 2G3IA 1JFXA 3WF3A 1XSIA 4LQ1A 1MW3A 1HN1A 2GVYA 5I2UA 4U2ZA 5M17A 5A69A 2YL8A 1WZMA 3U5YA 4WIWA 3W24A 4ZE5A 3K4AA 1JAKA 3VM5A 3RPMA 2WWDA 4AIOA 1DP0A 1UKOA 4CD7A 1C8XA 1BYCA 5CLTA 1JZ7A 4BQ4A 3FN9A 2WW5A 2EJ1A 4PTWA 3JUGA 3WH5A 5A2BA 1XH0A 2D0HA 4H8VA 1GHSA 3PZNA 1E0VA 2PC8A 1CEOA 1UQZA 2C8NA 1GCYA 2WMFA 2E9BA 4ZENA 5HBFA 3NSXA 1GNXA 1Y7VA 3WDIA 3MV11 4H8UA 1K6AA 1M03A 2EEXA 1GOIA 2HISA 5CSYA 1J18A 3ZJKA 4PEEA 4Z2JA 4NI3A 3RM9A 2WLYA 1WP6A 2WCAA 2EQDA 4BZYA 1PAMA 3AI0A 2WCSA 5CSUA 2WMIB 4HU8A 3VIPA 1TE1A 3AIBA 4P7RA 1CGUA 1US3A 1SYTA 3II1A 2GJXB 4HP5A 4PMVA 4HMCA 4D1JA 3MUY1 5E70A 3EYPA 3QOKA 3VDAA 3A3HA 4FK9A 3AICA 4WF7A 3G6MA 1BG4A 3SCTA 1ODUA 1M7XA 4UOZA 1UWTA 1EOKA 1JGIA 3VD9A 1J0IA 3HN3A 4PMXA 2EPKX 4AZBA 1E9LA 1E3XA 3GXDA 3SCPA 2IXVA 2XFYA 2A3BA 3L4ZA 4JZ5A 2UY3A 3MMUA 3LMYA 1LL6A 1W9UA 4AZ5A 2LRPA 4BA0A 2AAAA 1FH7A 3WD2A 3MSDA 4QLKA 1PEZA 3WEOA 1ZJBA 3MANA 4CD4A 4AIUA 1GJUA 4AD5A 4CU7A 1E6RA 1L0PA 5A1AA 3I3BA 4RE2A 1CYGA 3W6MA 4WJXA 2NSXA 3PN8A 4CN6A 3AS0A 1UKSA 1BLIA 1V3LA 2WSPA 3VM7A 3WDPP 4AIEA 4PRWA 4MNKA 4F66A 4PMDA 1TCMA 3MV01 5AY7A 4AD3A 2FH8A 1J11A 3VTRA 1E4LA 1MW1A 2EO7A 2YA1A 1IZJA 4IISA 1I75A 2JE8A 3UT0A 3O6AA 3AISA 4D6GA 1HJUA 2ZOXA 3VDHA 2DSUA 1MFVA 1BYBA 4HPGA 1MYRA 1V0LA 3VGFA 5FCZA 3AIRA 4PBGA 2ZX8A 5BXRA 1KR1A 1JZ2A 4LK6A 5JBDA 5E6ZA 3OA5A 1GW1A 1LQ0A 1LL4A 1HF6A 4XX6A 1GOKA 1K9TA 2FDMA 2ZXDA 4M82A 2YDSA 2VX5A 2W92A 2VCCA 2YL9A 1HJWA 4M8UA 3DHPA 2WC3A 2QLYA 2NW0A 5FKYA 3ZJ7A 5CPTA 1E4MM 2VI0A 4H8HA 4NZCA 1U33A 1OD8A 3VMNA 1LJYA 3IJ7A 5A2CA 2E9MA 3MKKA 3W81A 1UD5A 1V08A 5CPSA 5DF0A 3AXIA 4J3UA 2CBVA 1NWUA 1IT0A 1E6XM 1UWQA 1FP8A 2XPKA 2V38A 3WSUA 3L2MA 2BVYA 3F5JA 1EIBA 1UHVA 3WD3A 4TX6A 3WKZA 5E09A 4W87A 3KZSA 4U31A 2FGZA 1UH4A 3ZMRA 2WCGA 3OLEA 4E4PA 3WEZA 3OG2A 3W53A 1WKYA 4H2CA 4Z2IA 3WIJA 4P8WA 1KR0A 1XV8A 4PMQA 1CXFA 4WKFA 4W85A 1DWHM 3ALGA 3TTYA 5CJ5A 1US2A 2D3LA 1XYZA 5I6SA 1F4AA 5EFFA 1EDQA 4A6SA 2G3NA 1TVNA 2RGMA 1Q6FA 4LKDA 1VFOA 4CP9A 5JIPA 2WHMA 4PYSA 2G8ZA 3PZQA 1V3KA 4DM1A 2ZE0A 1DWGM 4Z2LA 4TUFA 4CKQA 2JIWA 4E2OA 1W9VA 4AW7A 2VUYA 1OIFA 2WVVA 1AMYA 4JFSA 3WFLA 1BYDA 1EGZA 5CGTA 2VL4A 5LA1A 1BTCA 3N1AA 1ITCA 3EDEA 3L4UA 2PBGA 3ZYBA 3OZOA 1CXLA 1DWJM 4AD1A 1LWJA 1WE5A 1HNYA 3RDKA 2PWHA 3WF4A 1OWQA 3QGVA 4CPBD 2EPLX 3EDJA 1VRXA 4CPBA 1WZLA 4X0VA 3I3EA 1B9ZA 5IDIA 4ACZB 1ESWA 1OB0A 4MB3A 1WDPA 3QOMA 1JNDA 3E1F1 4KGLA 4F8XA 1IV8A 2EXOA 3BMVA 1NOUA 4J7RA 4WKAA 2BXYA 2BV9A 4XZWA 5HXMA 2CITA 2CEQA 2WYSA 2EPNA 3W29A 1BAGA 1W9XA 3CTTA 4D6IA 5M3WA 5I0DA 3AMGA 4W84A 4TTUA 2GDVA 1OCQA 3CHCA 3M07A 1W2VA 1VFFA 2OYMA 3WF2A 1CPUA 2QF8A 1QHZA 3BAWA 1CLVA 1Q4NX 1NP0A 2DSKA 4JFTA 1ZB5A 1JDCA 5KZ6A 4HA1A 2V5CA 4JFVA 4HMDA 4X0NA 3SCWA 1W91A 3CUGA 5CLWA 2PWEA 3RIKA 5A6KA 1EH9A 3AXXA 3CUHA 4UNIA 1H2JA 1QW9A 1SFSA 1RD6A 2UY5A 3ARRA 2F8QA 4HTYA 1GPFA 4LYPA 3WL1A 3ZT6A 3GNPA 4QCEA 4LKEA 2ZWYA 4UQDA 2VZSA 1CGWA 4GKLA 1BHGA 1JXKA 1TG7A 4UFJA 4YN5A 1ZU8A 3MUZ1 3CZKA 2YDQA 2ZUWA 1GVYA 4AZCB 4OIFA 1JXJA 4KRUA 3WD4A 1FOBA 3VGEA 2WK2A 5KEZA 1C8YA 2DT1A 1QNPA 3SUUA 1GWMA 4TVDA 3N04A 2D23A 4OKDA 5M5DA 1U30A 3AIEA 5D9PA 3LPFA 3CLWA 2VRKA 3W37A 1ZJAA 3A4WA 1OINA 3GZAA 3GH7A 2E40A 1KFWA 1MQQA 1B3WA 4WK9A 3T0BA 1DEDA 5D8WA 2FH6A 3VX0A 2VR5A 4S3JA 4P8XA 3VNZA 1HN0A 2ZX9A 1V6VA 4QAWA 1JDDA 3DC0A 3THCA 4CD5A 2J7GA 3UG3A 2WKLA 3AQUA 1TUXA 3GXMA 3WNLA 1E3ZA 3SCRA 4JL1A 3UG5A 1BSIA 2D1ZA 1XSJA 3VD7A 3K8MA 4D6EA 1EHAA 4MB5A 4RL3A 2EPMX 4L4OA 1F4HA 3VIJA 8A3HA 1V3JA 1XCWA 5A6BA 1HJXA 5A6JA 1XGZA 1JDAA 1SMDA 2JEQA 3AHTA 4UZUA 1G01A 1EQPA 3VIMA 1WNOA 1ISWA 4D6CA 3ZT7A 3AS1A 1WCGA 1CNVA 3SCUA 1QW8A 4UFMA 2GDUA 2J7EA 1HJQA 1R7AA 2XM1A 4GZEA 4HPHA 3S2CA 1X1NA 3SCOA 2AOSA 2VNCA 2XVPA 1W8WA 2DGAA 5CQ1A 1JYVA 4TVCA 2WB5A 2VJXA 3CMJA 3VIIA 4RE4A 1MFUA 2Y8VA 4ATLA 3SURA 1R85A 1BFNA 4P7NA 2XFRA 4W7WA 4W89A 3L2LA 3L4YA 4UZSA 2CBJA 4MB1A 3UR8A 3VX1A 2PF0A 4PSRA 4CVWA 1E43A 3S6TA 3AZSA 1QI3A 1W1VA 1QPKA 3QHMA 3K46A 5IFPA 3AMCA 4FLRA 4C7FA 4LPCA 3ZSSA 2WLZA 1S46A 4PTXA 1UA7A 1JZ6A 4H41A 4ATWA 4AMCA 1HJVA 1DWAM 1KXVA 4UR9A 1RH9A 2V3EA 1UWIA 1QI2A 3OIHA 1PIFA 3OBAA 3AMKA 1E71M 5CPQA 3VPLA 1U2YA 3RMEA 5DEZA 1UH3A 1UZ1A 5I79A 4LJHA 1GQLA 3BSGA 2DSZA 1VEPA 5D8ZA 2CHNA 3IANA 2C24A 2WSKA 1C91A 5CG0A 3N18A 1UD4A 2D24A 3A47A 3ARQA 4GQRA 1RP8A 4BQ2A 1W2PA 4V2XA 2J62A 3VGDA 4CU8A 3TA9A 3T2PA 3W4RA 1LLOA 3WL0A 4U33A 2W66A 1VJZA 3VIGA 5A8PA 1UD2A 4AISA 1CGTA 3ARTA 1FP9A 3IJ8A 3AMDA 3AHVA 3VILA 1EXPA 3GYCA 3UG4A 5LA0A 2PBOA 5A8MA 5A8OA 3WUFA 2D22A 2XGBA 3KEHA 1R87A 3MS8A 4YHEA 4U3AA 2CESA 1EQCA 2YDRA 3VGGA 2LROA 1YHTA 3D3AA 4GO8A 3WQWA 4IUGA 1MQRA 4ZFMA 5I77A 2ZXBA 3ARYA 1AQ0A 5JBFA 3VMOA 2QMKA 3OGRA 1UD8A 3OGSA 1WO2A 2NT0A 3BLPX 4J28A 1QNRA 3CZEA 4KRTA 1GWKA 1MXGA 3WNOA 5D9OA 1KQYA 4A3HA 2VCBA 3WNMA 3QHNA 2ZXAA 4A3YA 3ZR6A 1CXEA 5I23A 3IJ9A 1HP5A 5IXEA 2G3JA 3A6OA 3AIWA 1CXIA 2FHBA 3RJYA 1CENA 5BXSA 4AZHA 1HX0A 1W32A 1ECEA 1JD9A 3IAPA 4XUYA 1QVBA 4CP9B 3SUVA 5E0FA 3ALFA 1E4NA 1QI0A 3ZOAA 4OUEA 1V02A 5C71A 1OKOA 1Q6GA 3CPUA 3DHUA 4N42A 3CHFA 1V6XA 3GBDA 3WH8A 3T08A 3ZM8A 1V0NA 2WPGA 4WLCA 5EBAA 3VDCA 1JD7A 5C70A 3GXFA 5D21A 2E4TA 1PX3A 4M56A 1HKJA 1GOQA 4JKLA 3VVGA 3ORJA 4AL9A 4LXFA 3L4TA 2QV4A 2XSAA 3CUFA 1JFHA 1VAHA 3RM8A 3ZIZA 4AD4A 3FHAA 1GOOA 4OOUA 4C7GA 3TONA 2VQTA 5BXPA 1HL9A 1E1EA 2XSBA 2Z1SA 5FD0A 1E6NA 1UQYA 4GZJA 3AJ7A 3WUBA 2RGLA 4CGTA 1H4PA 4UFLA 3WEMA 1G1YA 5ABHA 3HU7A 3CHEA 4W5UA 4PMOA 1FH9A 4M1RA 1B3XA 1UR9A 5BROA 4W5ZA 4B16A 2PWGA 3N11A 4MTVA 4GIAA 4EE9A 2PI6A 3N13A 4L4PA 4AEEA 3LPGA 2YL5A 1B3ZA 2DIJA 3RM4A 1C8QA 3KWXA 3RCNA 2A3CA 2X0HA 2UWFA 1KCLA 1BYAA 3T0DA 2BHYA 1OD0A 3ZJ6A 3SCSA 4GO9A 4KWUA 2CKRA 2VMFA 3W27A 1WDQA 4OZOA 3FHQA 2C0HA 3AHXA 1UR2A 5BWFA 1E6QM 1CXKA 4FLQA 4W8LA 2VCAA 3NCOA 3ARUA 2VZOA 3MSGA 1JZ3A 3U57A 3ZSTA 4BQ5A 5E6YA 1CGVA 2C7FA 2GUYA 3SEPA 4LK7A 2WHKA 1MVYA 1NP2A 1LL7A 1QNOA 2J8GA 1UA3A 2Y4SA 4UTFA 4OJYA 1XH1A 3PZTA 2NT1A 3ZQ9A 2O9PA 1ZBCA 2WVVB 3CZGA 4B15A 2ZX5A 2OSYA 2XVLA 1L7LA 3VIKA 2QPSA 4MJ2A 3TTOA 1JIBA 2EPOA 2QPUA 3VIHA 1RPKA 1GWLA 5A6BD 4GPNA 1W8TA 2WZEA 2X0YA 1XHGA 1D2KA 1JYNA 1ZL1A 5D9NA 4PSPA 2WYFA 4CD8A 1A3HA 2BY1A 3K8KA 4JFUA 2CXGA 4QFUA 3GBEA 1H3GA 3CIVA 4CCDA 5C8BB 4TXEA 3OLDA 7TAAA 5A94A 4XB3A 2IXUA 3T09A 3CHDA 4AZIA 2J77A 2XWEA 1V6UA 2V3FA 1JAEA 2VURA 3GTNA 1UR0A 4LYRA 4P8VA 2AMGA 3GDBA 6TAAA 2VQUA 4YW7A 1KGWA 2WM0A 5A6LA 1E55A 2G4FA 3VD4A 1UD6A 1LG1A 3VD3A 4EKJA 2BHZA 4M29A 1CZ1A 1PZ3A 3GH4A 1BG9A 4PMRA 5DMYA 3BAYA 5GNXA 1E56A 1HKIA 2D3NA 5F7UA 4HZ8A 1DTUA 3MUAA 5HPCA 4NRSA 1UKQA 4F9JA 1R8LA 4EK7A 1V03A 3SCQA 1BGGA 2CKSA 5GPRA 4B3LA 5ABFB 1LF1A 2OYLA 5ECUA 1H0GA 4JFWA 4B9YA 4QCFA 3WQ4A 1O6IA 4IM4A 2O9RA 3SCNA 4AEFA 3MMDA 2CBUA 1NM9A 3W6LA 4J3WA 1J10A 6A3HA 2ZUUA 3WUGA 1ZBWA 1GQJA 4PMUA 1OM0A 3WENA 2BNJA 2ZUNA 4MDPA 5CXPA 3UESA 3SUSA 5D9MA 2XYLA 2K46A 4U2YA 3WNKA 1EO7A 1VFUA 3NSNA 1TA3B 2E0PA 4NSBA 1PIGA 1TZ7A 4DWSD 3EMQA 1E73M 1AQMA 3ZR5A 1D7FA 4AD2A 3MMWA 3W82A 4MB4A 1M53A 2OSXA 3PZVA 3IAQA 3WY1A 2J74A 2UY2A 5A2AA 2GJRA 4EANA 1GONA 3BSHA 3MO4A 3B9EA 2BY0A 4FF5A 1FFRA 3BMWA 1CBGA 4U5IA 4PTVA 3VD5A 2XVNA 2DT2A 2PB1A 1CGYA 2VX4A 3T0AA 1V6WA 2ZUVA 3D5HA 5JUVA 3POHA 4AZ7A 5AYIA 4CVUA 3M46A 3K1DA 3OLGA 4M80A 1ZS2A 4DM2A 4MDOA 1NARA 3NYDA 4ACZA 3ZYHA 2B31A 2OWWA 2TAAA 3VINA 3BAIA 4D72A 1WZKA 4WSKA 3OGVA 4DWSB 2W4XA 1YQ2A 1W9DM 4ZXOA 5EFDA 4IPLA 2CCRA 2XWDA 2CIPA 1B90A 2BXZA 4KH2A 1L8NA 1WDSA 3B9DA 4U5KA 1XC6A 3BCFA 3WMCA 5M03A 3AFBA 1J0JA 1V3HA 2KR2A 3KL5A 2VTFA 2V3DA 3EMCA 1UOKA 2DH3A 3GNOA 2D0FA 4UQEA 2BY3A 4S3KA 2J47A 4UQAA 1FHLA 3WDJA 3DYOA 2WANA 1TFVA 3CBWA 3WNNA 4MNLA 4ML4A 2OWCA 4YWAA 1PX4A 4XV0A 1QBAA 4ZXLA 2YL6A 3T2OA 3PZUA 1P6WA 3PZ9A 1B3VA 1MQPA 1I1XA 1V02E 1NWRA 1E6ZA 3LPOA 1UR8A 2YBUA 4CN4A 2XGIA 1GQKA 1ZBKA 3A4AA 5DFAA 5AC4A 2GFTA 3BCDA 4DUVA 1VIWA 2WBGA 3L4VA 4H04A 3CZ8A 2JFEX 1UWUA 1VBRA 3U5UA 4ACYA 2DH2A 4GXPA 4UOQA 5A95A 4P7LA 3RJXA 3W28A 2MANA 3WBAA 2DEPA 5EMYA 1QI4A 1ITXA 3CGTA 2QMJA 4HZ6A 4QDMA 3OB8A 3QHOA 2W61A 4LGXA 1H1NA 2EBNA 4CCCA 1J9YA 1X6LA 4PMNA 4V28A 4GI6A 4E8DA 4R27A 2WWCA 3W0KA 1XCXA 2W67A 1ISYA 3ARSA 2G3MA 1JYWA 4DWSC 2CPUA 2GJXA 3IK2A 1TR1A 2JIEA 4UFIA 1R7OA 3FAWA 4CCEA 2BVDA 2XG9A 4CUCA 2D2OA 3APGA 4KMQA 2Y2WA 4J3TA 1JYXA 2J7DA 1XRVA 1OGGA 1W1PA 5AC5A 1GOWA 5E0CA 4PUEA 2ZIDA 3PHAA 5BRQA 4PN2A 1CLXA 1SR0A 3UR7A 2WMGA 3AZTA 1BF2A 3WMSA 3OLIA 3VO0A 3DYPA 3PZMA 4TX8A 3ARWA 3FNDA 1KCKA 2WZHA 2D20A 2YIHA 3A4XA 1WAWA 3HJEA 4F9DA 3F4VA 3FY1A 3WD1A 1CWYA 1NOFA 5FL0A 5BXTA 1E40A 1QBBA 4D6FA 3PTKA 3N15A 4WSJA 3VGHA 1B3YA 4TOQA 1IZKA 4JHZA 5JIWA 3M6DA 3PBGA 4AWEA 4BQ3A 2XIIA 1JF5A 1OBAA 1W9BM 1JI2A 1JZ8A 3NDYA 5ABGA 5HNNA 4GI9A 4LX4A 2A3EA 1MW2A 3EMZA 1ZBVA 5D4YA 3WQ8A 1A47A 3M7SA 4V27A 4CU6A 3AMLA 2YKKA 1WPCA 2J7BA 1D3CA 4W7VA 4R5EA 2VVSA 3CUJA 2GSJA 1K9EA 1WB0A 4W93A 2DIEA 1G9HA 1V3IA 2XVGA 1E72M 5BYWA 1H49A 2Y5EA 2YOCA 3F95A 3EDFA 1VEMA 3W38A 3NUKA 3VIFA 3O9NA 4J3XA 3VKKA 3K4DA 5A3HA 2WBKA 4LYQA 1EOMA 3KE0A 1WCUA 1C3FA 2CETA 5DO8A 4ATDA 5A6MA 2ZX6A 3LPPA 4M81A 5HDRA 7CGTA 4D6JA 1PZ2A 2OSWA 2W63A 4W8BA 1NH6A 2PWFA 4OBSA 5GNZA 5EB8A 3VUPA 2DQXA 2WMJA 4P8UA 1W3LA 2V3GA 2VC9A 2YBTA 3F5LA 4DUWA 2ZWZA 2WKGA 1JNEA 2XTKA 2YA0A 2JF6A 4IPNB 3UERA 2WC4A 1K9FA 5I78A 1MWOA 3K8LA 1J0HA 1J12A 2VRQA 4U3CA 4D6DA 1CECA 5AYBA 3ARPA 1QHPA 3ARVA 4W7UA 2BVTA 3ZYFA 5IFTA 1TMQA 3TP4A 2VT0A 1V3MA 3GH5A 4P7OA 2YLAA 1B2YA 3I3DA 3PTQA 3F5KA 1PBGA 1UH2A 2JEPA 3BAJA 3HMCA 1E6SM 3VNYA 5CZKA 4HZ7A 4GI8A 3ZO9A 3MUIA 1RP9A 1W90A 3WF1A 1Q6DA 9CGTA 3ZT5A 4GQQA 3DECA 1H5VA 3VDBA 2CYGA 3WN6A 3UCQA 4JHOA 1I1WA 4P7QA 2CNCA 2XUCA 3EDDA 5HPOA 2DT0A 3VOCA 4UFHA 3QR3A 3THDA 5E9AA 2VX6A 2J4GA 2D0GA 4BF7A 5ABFA 1C7TA 1Q6CA 2E8ZA 1HVXA 4M24A 2F2HA 4MNMA 2XIBA 1R86A 2HVMA 3W26A 2Y24A 3PZIA 1J0YA 4D6HA 1UWRA 3GNRA 2ZUMA 3WBEA 3WQ5A 2WMKA 1C7SA 1DWFM 1H0IA 2DSWA 3G6LA 5JBEA 4J27A 4RE3A 1HT6A 1FHDA 2YJQA 3CUIA 4FMVA 3WQVA 4F79A 4CN1A 5GNYA 2WMIA 3PZOA 3POCA 3RILA 1HP4A 1UWSA 1E0WA 2ZXQA 2XVKA 1KWKA 1W9PA 4PMYA 1CIUA 1NOWA 1G0CA 1GOMA 3BGAA 2XHYA 2J7HA 3O2LA 2OWXA 2DPEA 1H09A 1PPIA 3KL3A 5DT7A 2VR4A 4Q22A 6CGTA 1MW0A 2QHAA 1GJWA 1BGAA 4DWSA 1VBUA 1GUVA 2JWPA 3PZGA 1MXDA 4OBRA 3AHYA 1QI5A 1E6PA 1GORA 3U7VA 4AY1A 1GZJA 2E9LA 3CMGA 4UFKA 5BCAA 4K68A 2X09A 1CXHA 4XZBA 1E70M 1HJSA 1E15A 2J78A 1UUQA 2VZVA 1HL8A 2J75A 1XSKA 1W8ZA 1GVIA 2WVSA 4URIA 1BPLB 4AC1X 1SMAA 4EAMA 4PCTA 1B0IA 4PUDA 4N0RA 1OT1A 1OT2A 2J25A 1FFQA 2WAGA 1GQIA 4GINA 3N12A 3UEQA 4UQBA 4Z2HA 1V6YA 1NWTA 1GHRA 4TVUA 1CDGA 2E3ZA 1UR1A 1UKTA 2VRJA 3AZRA 3VIOA 3U7BA 4FLSA 4A4AA 4ZE4A 3AS2A 4Z2KA 2W91A 2V5DA 2O9OA 1CTNA 4GZIA 1OGSA 3NSMA 4HOZA 4YPJA 3RO8A 4HOWA 2O92A 1H11A 2BY2A 1KBKA 1UKPA 3N9KA 4MNJA 1E1FA 1EA9C 1N82A 2ZUTA 4MPKA 3WH6A 5CGMA 5I3DA 3ECQA 5DT5A 5GQBA 3SUTA 3VMPA 2ZICA 4QP0A 1EHNA 3SIMA 1X6NA 3WQ6A 2GK1A 5TD4A 4HOXA 3WH7A 4BCEA 2E8YA 2G41A 2VZTA 2XFFA 1JL8A 1ISZA 1OIMA 3EBVA 3GM8A 4YW6A 2Y8KA 1LWHA 3L4XA 4H7VA 1PJ9A 2W62A 1V0MA 2A3AA 2OLHA 4W8AA 5A6AA 4MAVA 2W5FA 1KGXA 2XJ7A 1VJSA 1C92A 2J8FA 2ZX7A 1HKKA 4MADA 4PTMA 1XD0A 4JAWA 1JI1A 1WMXA 2VZUA 1VEOA 4C7DA 3NDZA 3AOFA 1KGUA 2WXDM 4AZ6A 1AVAA 1G5AA 2O14A 2WMHA 3AIVA 2J7CA 1W8UA 5FIPA 1HIZA 3W25A 3EDKA 1FA2A 2JF7A 4KGJA 4D1IA 3WMBA 2Q1FA 1HXJA 3SCVA 2A3HA 1WZAA 3GXIA 1UR4A 1FH8A 1W3JA 1XH2A 4JKMA 1Q6EA 4DUXA 3SUWA 2YLLA 2Q8XA 1PX8A 3N17A 4MAZA 3AIQA 4BS0A 2OYKA 1DHKA 2WC7A 2WNWA 1W1TA 4UOJA 4HA3A 2VX7A 1J0ZA 1QHOA 4TTGA 5I24A 4D71A 1ISXA 1J01A 3NJ3A 1TA3A 1KBBA 3UETA 3TOPA 1B30A 1W9FA 3TTQA 1KWGA 1WDRA 4YHGA 4UQ9A 2DSVA 3KL0A 4Q7NA 1KB3A 1W1YA 3J7HA 5FL1A 3AXHA 1BVNP 2VXJA 4NF7A 2F61A 3PTMA 3NIYA 2XM2A 4UQCA 3VGBA 4E8CA 1NQ6A 2UY4A 3CZJA 3WDHA 1QNQA 1OSEA 3OZPA 4AZCA 1V0AA 3L4WA 2VVNA 2YA2A 5A8QA 2ZUSA 3ARXA 4JL2A 4OOZA 1KXHA 4HMEA 3WUEA 4PCSA 2FHFA 2CBIA 1BVZA 1C93A 3AROA 1ISVA 1KXTA 2GK1B 3BLKA 3WH9A 4CD6A 2O9TA 1O7AA 4QLLA 3WFZA 4B3KA 4Z2GA 4PMZA 3WD0A 1KQZA 1JF6A 3AS3A 1UZ4A 1OGBA 4UCFA 1B1YA 1JG9A 1E4IA 2J7FA 4MJ4A 2WZIA 1WZXA 4J3VA 1XYFA 4WKHA 2PWDA 3AHZA 3BAXA 1HKMA 1G94A 5FOOA 4AYSA 1XD1A 3T2QA 1OH3A 5LYRA 4LKFA 4JCLA 1ODZA 3BH4A 4W86A 3BXWA 3WF0A 8CGTA 1K9DA 4J3SA 4W88A 3VU2A 5IHRA 1NWSA 3TTSA 2FGLA 5BRPA 4AD0A 1QOXA 1VFMA 1AQHA 3CH9A 1VF8A 2BFGA 3FW6A 2JALA 2J79A 1UG6A 2X8RA 1Z32X 1EO5A 1W3HA 5LA2A 3ARZA 4HA4A 1CGXA 4AZGA 3BAKA 3DYMA 3B8SA 1H41A 2WVUA 3CO4A 5IHSA 4HU0A 2DDXA 4Y7EA 5A6SA 3ZJ8A 7A3HA 1J0KA 5A8NA 5I5RA 2WHLA 3WELA 3MU7A 1UD3A 1VENA 2VO5A 2DT3A 1E0XA 5HOSA 3AYSA 1M04A 2X2YA 3WDQA 2IUZA 1C90A 4FLOA 3WNPA 2X05A 1QNSA 1TVPA 4JCMA 1V0KA 1M01A 1EDGA 3BC9A 3CZLA 1EDTA 1HVQA 1BQCA 2FHCA 2WHJA 1KXQA 2BHUA 1UYQA 2X1IA 1E5JA 3FAXA 4X9YA 1E5NA
chains in the Genus database with same CATH superfamily
1B31A 1JZ4A 2Z1KA 1DWIM 3AYRA 3ZFGA 5ABEA 1HFBA 5CKSA 2AL2A 1OYBA 3B9AA 2X7VA 4ZMGA 1H60A 1NTHA 1WYIA 2Z2SB 3KCYA 4AGRA 2FZ2A 1M7JA 3E38A 4AXNA 4B9ZA 4QLJA 1G6CA 3RMYA 2E6AA 3GZTB 1AG1O 3GHTA 4IIEA 3APTA 4K6AA 2HWE2 4UW4A 1RC6A 2CHOA 2DUOA 3G77A 2D6MA 1QOTA 1HB4A 1U83A 1UZDA 5HJLA 2FCTA 3LA3A 3R79A 4JNYA 5A69A 1S5VA 3SSZA 1WZMA 4WIWA 5E9XA 3ACIA 4ZE5A 3K4AA 1NZIA 2AZ5A 4CCLA 4UBGA 2ACQA 2XIQA 3CL6A 3GD6A 3ITTA 1DP0A 4MUZA 1C8XA 3KVJA 4OGZA 4HN1A 3T4HB 1JZ7A 4PDWC 3FN9A 4Q4V2 2EJ1A 5A2BA 1PGL1 3CDZB 2P3YA 3PZNA 2BW8A 4KT2A 1L2UA 2E9BA 4ZENA 3NSXA 3WK0A 5IT6A 1NX9A 3C8FA 1SPPB 1GNXA 5F3GA 1PTDA 1Y7VA 3AMPA 4RX0A 2GSEA 3INPA 4WZFA 3RRDA 3OYWB 3IACA 1M03A 1MDLA 1XBZA 4A3UA 2Z2UA 4PEEA 4Z2JA 4IV1A 7REQA 3MDWA 2PGWA 3KTXA 5T9BG 1ME9A 2EQDA 3MIFA 3UU0A 5FV3A 3GWQA 3TTEA 4HK7A 3AI0A 2WCSA 5CC5A 2YB7A 3CIWA 3NJZA 1BLZA 1PIV1 3LCWA 3VIPA 3I2DA 1AMKA 2QUVA 1BBT1 1P48A 2QNEA 4NL1A 3JRKA 4EXAA 3S6OA 3KT1A 3AAMA 3LB9A 3LLDA 4QRNA 4HMCA 1UJPA 1W0OA 1PXGA 5G2HA 3ITYA 4QPWA 5E70A 4AEJA 1RUC3 2HK1A 3A3HA 3CWHA 4Q5OA 4FK9A 2NLRA 1ODUA 1M7XA 4FR6A 2J1TA 4HLTA 2G37A 3VD9A 4JZRA 2EPKX 3XISA 2DUQA 3DPRB 3NZGA 4O0KA 5JXHA 2CU0A 4TMCA 4KIRA 2GJLA 5AYXA 2VENA 1RHI2 1NFGA 3P14A 1GV9A 3AKSA 4GB32 2ZZ2A 5REQA 2ARAA 3G8RA 4QLKA 2R0HA 3J7NA 3LEKA 4CD4A 4LR4A 4JGYB 4AWDA 2DQWA 4DB5A 1V6JA 1R3WA 4OZXA 1CAUA 4CU7A 1MS9A 3I3BA 4PFHA 4XIAA 2IXHA 1E9IA 4O18A 5C8CC 4AQSA 4WJXA 3SB0A 3PN8A 3WHUA 2PTXA 3AS0A 3C52A 2OQYA 3GAKA 3CAWA 1TPB1 3VCCA 2MNRA 1R091 2WSPA 1GU3A 3TWBA 3GHNA 4RFT0 1SQ7A 4YTSA 5HUOA 1TCMA 3CEWA 3I97A 1UXXX 4J9JA 1XGDA 3MV01 3FE5A 4QISA 4NRPA 4KWVA 1PDYA 5ECVA 4X8NA 3VTRA 2C0ZA 1LTDA 1Q7MA 1WCQA 2BUKA 1ZRCA 4P14A 3LOIA 3STFA 1HJUA 1YPFA 1GYKA 1MFVA 4MPQA 5L9VA 1CPMA 1MYRA 9XIAA 1EL3A 3VGFA 5FCZA 1YXYA 3N29A 4M3CA 1J3QA 1HRV3 1QPOA 4QD2A 5CH9A 4AWSA 1KR1A 4C6DA 1UXZA 4XBJA 1M5WA 2O55A 4DZ5A 1RHI3 2JENA 4BHPA 3HNBM 3R11A 3C7HA 1GOKA 5F5IA 1UP0A 2UBPC 1IS6A 4DS0A 1QTWA 2FJKA 1GZ9A 2W1QA 1PM7A 1PCWA 3I2IA 4FPYA 3LG3A 1BEV1 1WUVA 4M8UA 1EYEA 3JD73 1G4TA 3W2MA 3BTZA 3M8LA 5CPTA 4DN1A 2VI0A 3OY8A 4H8HA 5J1XA 4CTEA 5KXBA 5LHEA 1OD8A 3ABRA 1FOD3 5DZFA 1XPGA 3R2GA 5DANA 3CJXA 2FFIA 4ASTA 3GRIA 4UWDA 3TN92 4FOVA 2GNBA 4Y4RA 1PB0A 1R0MA 3IEBA 2QJIA 3W81A 1JS9A 1V08A 3UJQA 2CWSA 1A5SA 3M0IA 4WVMA 1IEWA 4IGHA 5BU9A 5LNSA 1IT0A 3VE9A 1OFQA 4AF0B 5FZ1A 1W2UA 1AW2A 5C9ZA 4AFDA 5FUNA 5C8WA 5BU6A 4LBUA 4TX6A 4PULA 4NHYA 4W87A 1GVRA 3G0UA 2YX0A 5FK8A 4LCQA 1NE4A 2FGZA 4QXCA 4FXRA 3SHRA 3OBRA 1RVF3 3R12A 4L9ZA 4HKWA 3JS3A 4KWOA 2WL1A 3WFAA 4QTGA 1RUG2 1SLIA 1KR0A 1XV8A 3W7NA 1LHWA 4WKFA 3NTYA 3GALA 3ALGA 2E9QA 1OMIA 1OY0A 5JI9A 1US2A 1COV1 5CFDC 3C2FA 1SO5A 3D0JA 1HRI1 3MDUA 5C8CA 5FSEC 4KEMA 4XILA 3GXPA 1Q6FA 3M3CA 1UMYA 3HPSA 1ZCOA 5ACA3 1LOSA 5JIPA 4POCA 4L97A 5F2WA 2G8ZA 3VCNA 1YYNA 1DWGM 2WINB 4FPEA 1GOXA 2VUYA 3QBQA 4ES8A 1IEVA 1BYDA 3MKVA 2GP3A 1JPIA 4C1LA 4XUQA 1BTCA 2OOGA 3N1AA 5EBUA 2RHGA 3PPFA 1JCXA 3ZYBA 4CZSA 1CXLA 1LWIA 1R47A 1KS4A 1ACCA 3OJBA 3U2OA 1HNYA 3W1UA 2ZACA 4JIQA 3VOFA 1XB9A 1OWQA 5I02A 4EN0A 4CPBD 1VRXA 4CPBA 3BG3A 4X0VA 5T8GA 3RRXA 5IDIA 1ESWA 1OB0A 3V65A 4ZL1A 2OQ6A 2QV5A 3UXKA 1X9TA 1X1OA 3L5LA 1EWEA 3BMVA 1NOUA 4BH9A 2TNFA 2PDCA 2BXYA 1TJ0A 1W0PA 3W72A 1KM6A 3USZA 2WYSA 4YVPA 1W9XA 3W85A 3CL1A 2ZTKA 4GJ1A 3N2BA 2MHFA 2A21A 4K7JA 5FY7A 3UGVA 1KFLA 1SQ4A 4LWWA 3W1LA 3M07A 3T44A 3HQUA 2I1OA 1QOOA 4QROA 5ABJA 5ENLA 3AZZA 5BPXA 3HQNA 5LIUX 3I4EA 1MUCA 2WQDA 1H5YA 1A5BA 2QF8A 4QKDA 4JFTA 1JDCA 4G7EB 3GDMA 3ZSEA 4JFVA 3UXIA 4X0NA 5CLWA 2VZ1A 4KBZA 4XHXA 3C3VA 2JJ6A 4FA3A 2NLIA 3ES8A 2Q4SA 1XLKA 3M0HA 3W1XA 1J5TA 2RS51 1SFSA 2UY8A 1MQTC 4HTYA 2NV1A 3WL1A 3GC4A 2VZSA 3JR2A 4MYXA 2PDFA 3V5CA 2A7NA 3B9NA 4H00A 4QJ3B 3UFYA 4YN5A 4NILA 3MUZ1 5DZEA 3IK4A 4NWWA 1BRLB 4QHRA 4KFNA 3QKEA 1MS8A 3PTYA 4Q8TA 5HCAA 4N6EA 2J88A 1QXLA 4YCOA 3QF0A 5FKCA 3ZS4A 3SJNA 2RDWA 3G22A 4BR1A 2IWGB 1F74A 2ABAA 4GH1A 1JCJA 4JDBA 4O65A 4CDQB 5FK7A 2INEA 3QN3A 1GWMA 3AXEA 2JDYA 2I57A 1Z69A 1T96A 1S1PA 1HGWA 2YFOA 1BEUA 1BEV3 1QK0A 2RDXA 1STMA 3UPBA 3VFLA 2VRKA 3JVAA 3SGZA 5TIMA 1JODA 2JDZA 2GMEA 4EPKA 1DEDA 4UTWC 4CEYC 4DNYA 4DUOA 3QH6A 5CC7A 2V5KA 1OCBA 2PAEA 5JZGB 3PG8A 2ZADA 4P8XA 1HRV1 3LHWA 1RA5A 1V6VA 1PGSA 7ODCA 3MZHA 1RTVA 1R46A 2XN1A 2BSLA 4CD5A 1CPNA 1WV2A 3HN1A 2VEKA 1WOAA 3RAOA 1U5HA 2WKLA 1TUXA 3GXMA 1URXA 4JL1A 5FEZA 2ZBJA 3N19B 4Q1PA 4AE2A 1XSJA 3E12A 4D6EA 4BK4A 1KFEA 1UIJA 4QR6A 4EWDA 1TWZA 2EPMX 3VC5A 1UROA 4NHLA 1XCWA 4D9PA 1HKVA 4DBDA 5A6BA 1HJXA 1KS5A 2UU8A 1LOCA 2X1TA 2XN2A 1SMDA 4N6FA 1V9U1 2XB6C 2HEYF 1FHVA 3VIMA 1X39A 5LNWA 2XH7A 4K8GA 1C8NA 3ZVHB 4YVWA 2QQUA 3S7IA 2B7NA 1UO9A 1AH3A 3SCUA 2WT2A 3LBCA 4IUOA 3WR0A 3O63A 4IP5A 1W9TA 1Z7AA 2PHLA 3MP5A 2P2KA 2PGFA 4JXCA 3B06A 3BUCA 3HOBA 2QDHA 2ZYFA 3MF6A 2XVPA 4UR7A 4HU3A 4A2SA 5CQ1A 1JYVA 4RNJA 4MWAB 3O0KA 5DCDA 1BKHA 3IN9A 3HGOA 4KETA 3CMJA 3VIIA 2E25A 4F2UA 3NPWA 3WJXA 1O12A 4AHXA 2OZTA 3SITA 1IIGA 4YYOA 4JIIX 4HKPA 1R85A 3VBHB 3BOPA 1QHDA 1F6KA 4W7WA 2R073 1RXFA 2YW3A 3TNBA 4COZA 1AR82 4A42A 2ACUA 3P3NA 3QV7A 2PF0A 1OA4A 2IS7A 2Q0AA 1E43A 1ZALA 3OPZA 3CV1A 1QPKA 1XNDA 3K46A 3QSRA 3AMCA 4FLRA 6ENLA 2E26A 2Y7DA 2YSWA 3PVEA 1WMEA 1A5AA 3LHVA 2MEV3 2YXXA 4ATWA 3Q94A 5I3FA 3VBOB 2ZHNA 5EYWA 4PGLA 1OOPA 2BOJA 5MKGB 3LNMA 4UR9A 4CNSA 3RLUA 2V3EA 2IVJA 2VGBA 3AMKA 4KU7A 1F3WA 4YW5A 3PIJA 1QJX1 1TWDA 1VAKA 5I79A 5K2ZA 4IERA 1XLCA 2PTZA 3IANA 3JZUA 2D24A 4RZBA 1PO11 4JTLA 4BQ2A 1W2PA 2UURA 1MR5A 2VTXA 1U1JA 4V2XA 3URQA 3A3XA 4FTBA 4Z8BA 4XF0A 2GUUA 1Q5OA 2ODOA 1P6BA 3P2VA 2HXTA 3W4RA 3WL0A 3BLOA 4U33A 3NQMA 3KZ4C 2C26A 4NHVA 2P5BA 2VBBA 1IQ8A 2W66A 4H9YA 4E2VA 5A8PA 1UD2A 5AHNA 4AISA 4KCUA 1UNBA 5LA0A 4K8RB 4LV9A 2PBOA 5B4NA 1AL0G 3H42B 2DZBA 3EZ4A 3KEHA 2B9VA 4CXYA 3KBMA 4FXGB 1TZZA 2CESA 3TDFA 4FAHA 5PTDA 3VGGA 2Z26A 4D6SA 1K77A 4IUGA 2EIEA 1EZ2A 3U8GA 1D8CA 1DBTA 4EPEC 4MUPA 1OK4A 5C9AA 1LTEA 1UPMB 4XETA 2WDBA 1WLTA 3EQEA 3LKJA 2Y0FA 2D3RA 5JBFA 1RUD2 4LY4A 3OGRA 3OGSA 3ME3A 5AVPA 1LHVA 4KRTA 4Z08A 5F1RA 2PODA 2JG9C 1RA0A 1DBNA 5XINA 4JICA 3QHNA 1RUNA 3VV1A 3KS5A 1EAH1 4E5TA 3GZ3A 3LGRA 4MM1A 1OLMA 1TTPA 5IXEA 4LF2A 3A6OA 3DESA 4F0MA 3OA3A 2PD9A 3PHMA 1CXIA 3LZ3A 2YY1A 3NVTA 4BEQA 5ACA1 2ZVRA 1CENA 5BXSA 4AZHA 1ADDA 4Q2FA 1HX0A 1W32A 4FXSA 1ECEA 3ZLFA 1TJRA 5C8CB 1MXSA 1XPYA 3G1YA 2FBEA 3IAPA 4XUYA 3VBRA 2DUZA 1AXYA 1NDWA 4XAPA 5E0FA 2L9LA 3ZOAA 3EKZA 4FX6M 2NSOA 1OOPB 1WQ5A 5HUPA 4HSJA 1YEYA 3KP1A 3SJ3A 1E51A 1ZTVA 4X3ZA 4A29A 1EEXA 4X6QB 3W20A 3K30A 1M41A 4Y90A 4C6BA 3POSA 4N42A 2ONEA 3TX9A 3DX5A 3WH8A 2DU0A 1U22A 1V0NA 2PXJA 4WLCA 4Z1BA 5C70A 3GXFA 1F5FA 4M56A 4Y8FA 5JQ9A 1HKJA 2BP6A 3RS6A 1O91A 4DPQA 1G9FA 1Y5XA 3LTSA 5I8YA 4IV3A 4Z07A 4XUGA 2BRTA 2LM3A 3P5BA 1DHKB 3QPEA 1RJRA 1TPWA 3WLMA 1JFHA 3RI8A 3UR2A 5C3OA 1H6XA 5CGQA 3FHAA 4OOUA 4GBDA 2I14A 3LYEA 3K51A 3H2MA 2IPWA 4S3CA 4BU2A 4MO3M 5AHIA 3HQPA 5FYTA 2WKJA 1TQ5A 4Z1CA 2WNVA 3E2QA 1AYM1 4FSAA 2XSBA 2Z1SA 1P7TB 1UQYA 3SMHA 1ICQA 4GZJA 1B4EA 2C19A 2X30A 4JBRA 3UWQA 4AI0A 2RGLA 4WDTA 3URAA 3K2OA 1QDCA 4SLIA 4UFLA 3WEMA 5ABHA 1W3XA 1MZFA 4PMOA 3W7HA 4SBVA 4M1RA 2CWMA 4FTSA 1QH6A 5FZ7A 4XK2A 1B3XA 4W5ZA 4B16A 2WJZA 2PWGA 1ZRIA 2JBMA 4MTVA 2J9XA 2RKXA 4Q4RA 2YHJA 3ZVHA 1N3PA 1ZA7A 2I5QA 3C7OA 3ZVXA 3QVQA 1S2CA 4PEKA 3WDWA 3TLLA 3M44A 2K0GA 1ZZMA 3HGRA 2UWFA 2EG8A 1IEQA 1YIFA 3G1HA 2RHPA 2VMFA 1ZZ8A 2VUNA 5DUXA 1LGCA 1HKDA 3B9IA 3DHFA 1ZFJA 2WZR1 2Z6IA 4K1GA 2YZ5A 2MEV1 2V6AA 5D03A 5J3UA 1SPPA 3RX4A 1EFZA 1W56A 1TUFA 3NCOA 4MVTA 3RCYA 4QX5A 3MSGA 1POV1 3D0SA 3K1GA 4BQ5A 2VGGA 4GYKA 1DJHA 2GUYA 4AB4A 3C3NA 3NQGA 2CHHA 3WD5A 1ZRQA 1QNOA 2YG0A 2RMU1 1W8OA 1PVNA 3UVIA 3KDOA 5FPBA 2LTNA 3WG2A 2W39A 1RQHA 4G8TA 5DG1A 3W71A 3AO0A 3WLKX 3IUHA 3ZN6A 4FPSA 3LN3A 4M0XA 5AKQA 1DQ5A 2DZUA 5KETA 1TYGA 3DKJA 2XVLA 1L7LA 2P50A 3H1YA 3IRDA 2EPOA 5BNKA 1S0JA 1OFRA 2XFWA 4RK8A 1XINA 2F7FA 3E74A 3WQFA 4Q4SA 1JYNA 3PBMA 1KTNA 5D9NA 2SBAA 1O1HA 3HGJA 4ZBCA 4JFUA 5FJIA 4QQ3A 4CSWA 1ENQA 1OFAA 1NG0A 4GGHA 3PBWA 4RQPC 1VP5A 3GR8A 5A94A 1ASJ1 1UPSA 4OHWA 2C1FA 1MZ5A 3CYVA 1TTJA 1GBGA 1RMU2 2ZRXA 4OUSA 4REQB 1DCSA 3FA3A 2J77A 1D3GA 4D6QA 3GU9A 3IIVA 3GTNA 5DN2A 2V63A 4GH3A 3GB6A 4LYRA 3OTFA 4IE4A 2AMGA 3ABZA 1GP6A 2HQAA 1E55A 1DIDA 2E6DA 2BHZA 5EWSA 4M29A 4QWNA 3HG3A 5K0UB 3MZNA 5DMYA 1B35C 3WLQA 5GNXA 5JXJA 3FDKA 3WDUA 1HKIA 1OVDA 3O06A 2JKBA 3B4YA 2O7QA 1JYTA 4K8EA 4X60A 1OKQA 1GYLA 2VEIA 2ACRA 4MGTA 4GWEA 1HRV2 2CKSA 1I4NA 4PLNA 4B3LA 4YG3A 1LF1A 2FCVA 2NZ9A 5LEKA 4B90A 3HPZA 3DV8A 4ENLA 5FRAA 4KFOA 5LASA 4E4HA 1I1EA 2AQVA 4IM4A 1M4WA 3CPGA 1VBJA 2Y33A 1BXNA 3SCNA 4NVTA 2WFF3 2F9RA 2VUCA 4RGGA 3JQWA 4GIYA 3GGLA 3W6LA 2JDMA 2ZUUA 3GBWA 2EIDA 2XHKA 2YC0A 1OVPA 3WENA 2ZUNA 2FDJA 1RMU3 5FP3A 1V51A 3DUGA 4A3ZA 5LRSA 2K46A 4EF8A 4NUWA 3UGGA 1EO7A 4NIRA 1BTMA 3QZ6A 1VFUA 4I9TA 4N9EA 5FO7B 4YRDA 3LF7A 3NPXA 3U0HA 1GLHA 3R05A 1Q4WA 4WD0A 1Q56A 1S3HA 2QQLA 4EN9B 1H7OA 5KXDA 1XBXA 4DWSD 3CTLA 1AR63 4RS5B 1LLZA 5HINA 3W82A 3TWAA 1M53A 2OSXA 3UZ5A 3IAQA 1R082 2WM1A 4GBUA 3FOKA 5F4WA 5DBUA 2UY2A 2W46A 4YTUA 3RK8A 1R38A 3S2NA 2BY0A 3BMWA 4YZ4A 4OUMA 4QQLA 1RUSA 4U5IA 4PTVA 3DG3A 5BNNA 2DT2A 3CT7A 3MVIA 4GAZA 1OABA 2E7AA 3DH7A 1E1CB 3E6BA 4Q8NA 4LNCA 2CDPA 2OZ6A 1Q8AA 3GYEA 1VBD2 3M46A 5JDBA 3WOGA 4QHBA 5I7GA 2P34A 2ZGKA 3RFRA 4ARYA 3ACLA 1JCNA 2Y6LA 4QQ2A 3U78A 2G0WA 3THQA 3TEXA 2YPJA 3WBYA 5CIRA 1YKWA 2QDDA 4ACZA 2B31A 5F2SA 2OWWA 3HMJG 3VINA 4G2DA 4O19A 5FPLA 2GPTA 3BAIA 3W00A 4AI2A 1MZEA 4IP7A 2PCQA 1TWIA 3OQ8A 1EB3A 5JSPA 4IPLA 5T52A 4O7XA 3L9JT 2BXZA 4CCMA 2QUMA 4C6IA 1L8NA 5SV5A 1DPMA 5DXXA 1WDSA 5C5TA 3RZKA 4MZYA 3MI2A 1U1HA 5GJMA 5B7YA 1J0JA 2DCZA 4RR3A 2AYHA 5BOOA 2PDIA 2V3DA 2NN8A 1TX2A 3BZJA 4AI8A 3ZFFB 4MKSA 1LOAA 1D4VB 5F9TA 3CV6A 1DV7A 4GD0A 4G1KA 2OTDA 4B5VA 1FHLA 3DYOA 2BX7A 4LBSA 3ES4A 3CBWA 3WNNA 2GNDA 3MI3A 4YWAA 5JSRA 3GW0A 2E7FA 1I5PA 1P6WA 2CHRA 2V9DA 3PZ9A 3MFAA 1MQPA 3MYOA 1I1XA 4LHKA 1HKWA 5FSDC 4F48A 1SO4A 1NWRA 3VB9A 3GR7A 3LPOA 4O15A 2PDWA 2YBUA 3S47A 4BQWA 1GQKA 1ZBKA 3HFYA 1GTHA 1ICSA 4HHPA 1H6YA 2BGNE 4IMCA 3WJZA 3WY6A 4B8EA 3EXRA 3L4VA 4NJJA 2HE5A 3WLTA 3L66A 4ML9A 1UWUA 1G4SA 3TFCA 1V6OA 3BW3A 5ANQA 4UOQA 5A95A 1VYRA 3QGAC 3V36A 3AUJA 4MG2A 3TK7A 1I3HA 1IZCA 3WBAA 5EMYA 2F6BA 3K4ZA 1QI4A 1ITXA 3CGTA 2CLKA 2QMJA 3S5NA 3S46A 2WSQA 4RCXA 3MW2A 3L0NA 4QG8A 4AX7A 5KSWA 4AOCA 2B7QA 2JK2A 2ZGPA 4D6RA 4LVDA 4CCCA 3BW4A 1F5JA 2EXHA 5EJ3A 1J9YA 4PMNA 1OUSA 3MI8A 4YCPA 4V28A 3EA3A 3GFZA 1PWMA 3I3QA 4E8DA 2VD8A 4GI6A 1IPSA 3MGUA 2WWCA 2G50A 4UR8A 1B35A 3W59A 3VCRA 1S5TA 4GWJA 1LBLA 5J48A 4HJFA 2YGMA 4NZ4A 3SADA 1ZNNA 5D33A 2ZGQA 1WW7A 2VC7A 4NIIA 2FZ9A 3MMTA 4UMBA 2W68A 2G1MA 5T5LA 4J3TA 4Q7BA 1JYXA 3AL5A 2J7DA 3HBKA 2QUUA 3LCPA 1GOWA 3M0YA 5FF2A 3QC3A 1W8HA 3NZPA 3FLUA 2C5DA 1CLXA 3M3QA 2AUYA 4Y6GA 2JE7A 1JOPA 3DYPA 3PZMA 2D6OX 4KU8A 2D5HA 1Q6OA 3R43A 3VK5A 2IKGA 3A4XA 4F9DA 4LUJA 2OA2A 1BEV2 2YYOA 2VFGA 3ZSJA 4O54A 2E63A 2ICSA 2OVUA 3T8LA 3CLPA 3CM4A 1OFNA 3SBFA 1W06A 4WSJA 4Z1AA 3MW4A 4PIZA 4JHZA 3PF3A 2ZGTA 5JR2A 1RUI1 5JR7B 3VBFA 5HV4A 3PBGA 4AWEA 2R14A 1VMJA 1OBAA 2QJHA 3TAKA 4ISRA 1OJXA 3PSWA 3KCXA 2WSYA 3TYBA 5ABGA 5FPZA 2FZ1A 2BOFX 5CAKA 3EOOA 2QULA 4EWND 1UOGA 4N02A 4ZSUA 2A0NA 5D4YA 5ABJB 5KHJA 3P81A 5G5IA 1O95A 4Q26A 3AMLA 5BMWA 1XUUA 1WPCA 4ZOBA 4IEVA 3WX5A 3NYZA 4O4VA 4J1XA 2JX9A 3BOXA 2YU1A 4EAYA 3B0VC 1FXPA 1HB3A 3QQ0A 4K7YA 4XFGA 1MI3A 1FWJC 2WNQA 3MA8A 1ZLPA 4FOUA 2VVSA 1E57A 2DIEA 2VNOA 3U4FA 1E72M 1H49A 4NU7A 2YOCA 3VDDA 1RHCA 3EDFA 1PGL2 2BWAA 3VKJA 1VEMA 4DO4A 3XINA 3VIFA 2QUOA 3PB0A 3G7DA 1JHNA 2WBKA 4LBQB 4J40A 4LYQA 1EOMA 1RUJ2 2WUHA 1WCUA 5A6MA 5DCBA 4Z0JA 3W7MA 1PM4A 1XJBA 4Y22A 2YW4A 1R3TA 2ZGMA 4DXXA 5FUPA 2I56A 4LO7A 3A5VA 5JLVA 4AVTA 1ZP3A 1AW1A 2R072 4OBSA 4REQA 3PB2A 3VKBA 3WQGA 2DQXA 2WMJA 4L56A 1AR83 4P8UA 3F5LA 2ZWZA 1AYN3 2XTKA 4F83A 4XZLX 4AUBA 2VPVA 1YO8A 4JYDA 3HQRA 4PBPA 3VE7A 3KV9A 2OX0A 1F9KA 4JQTA 3JU2A 2ZPXA 2AREA 5E1QA 2H8XA 1O7FA 2VRQA 2F6KA 1TB3A 3IKWA 1FWSA 1ONWA 4DO6A 3N7JA 5F8PA 4FB7A 3ARVA 4W7UA 3FGCB 1JBCA 3UGHA 3ZYFA 1TMQA 1YJKA 3QLDA 4GG9A 1UMIA 3GTFA 4INDA 4P7OA 2V8ZA 4B5TA 4TXWA 4GVFA 4I6KA 1B2YA 3BAJA 4OQVA 3VNYA 5CZKA 3ZVIA 1EPXA 3ZN4A 4WBBA 3MUIA 2PYTA 3WF1A 3GIYA 2PMWB 1IWAA 2WFF1 1RUJ3 4S3GA 1NXD1 5FYBA 3RWKX 1NA1C 2PDUA 1XSQA 4P7QA 2EICA 2VBPA 4BISA 3EDDA 3OW1A 5DAPA 4XKYB 2QCMA 3L7RA 1OHFA 3VL9A 4NQ1A 4EE2A 1X8FA 4BF7A 1PO23 2HWGA 2HEVF 3KD4A 5C3QA 2E8ZA 1HVXA 1KM1A 3T07A 2F2HA 3VBRC 2J27A 2REQA 3UPMA 2HVMA 3W26A 5I00A 3GG1A 3A23A 3TC3A 2AKMA 3NQVA 4O17A 2ZUMA 1SLLA 4AWUA 4AFYA 1JPMA 2NVCA 1GZWA 3WQ5A 3THAA 1PMHX 4AI1A 5JZGC 2J1UA 1HT6A 4Y9NA 5LIYX 5GNYA 2FTWA 3GTIA 2J9YA 1UWSA 4LBQA 2VZQA 1F31A 5FJUA 2OS2A 2NXGA 4DXRA 4Z2AA 2ZXQA 3QKZA 4ZY9A 2ZVIA 4IHCA 2QYGA 2VHLA 4JX0A 3QV8A 4RNIA 4AEOA 1RUD3 5IVCA 3N36A 1CIUA 4PMYA 5IVBA 1VHNA 3C56A 4LEJA 1OQEA 3Q4DA 4JY9A 3BK0A 3VOIA 5A3NA 3HOJA 1TPH1 4UMAA 4M3CB 3QM3A 4KPLA 4KH9A 3A64A 2HWB1 4MV2A 2XZ9A 4W65A 5FREA 2QHAA 1IT8A 6CGTA 3E2SA 5DELA 3THPA 1W5OA 4DWSA 3MIDA 7REQB 2YYUA 3W70A 2JWPA 1AR71 3PUAA 3PZGA 4CNOA 3FBYA 3WLPA 1HV1A 2PDPA 1B3OA 4DJEC 1QI5A 2FPVA 3H4XA 1E6PA 1IYXA 4Y1XA 1RSCA 1IF2A 2ZOEB 1H8VA 3UKVA 2WJEA 2WWUA 3BYWA 2NQZA 5BRBA 5H9PA 3QQWA 2X09A 4Y9MA 1W05A 1OI6A 3GNDA 3FMGA 1TV7A 3KOYA 4A05A 1TNRA 1UUQA 3PTRB 4XD6A 4RDWA 1ZA4A 2ZEXA 4URIA 1WBFA 5EFUA 3GKFA 4KKXA 1O4ZA 5B7ZA 4AC1X 1SMAA 2Q01A 2D43A 3DC8A 4PUDA 2IPFA 4N0RA 4DZIA 1VAVA 4LTSA 2CFFA 1MUWA 1DDLA 1RY0A 1R093 3EEGA 1NWTA 3FC0A 1MS4A 1TZ9A 4QBXA 5BOFA 1D4M3 3KLKA 1W8NA 1H0BA 2NUWA 1U5ZA 2E3ZA 4TQTA 4OVEA 4IIGA 5FJJA 1UKTA 3SGUA 4IZGA 4CU9A 2E5CA 4C6EA 1LT7A 2XH6A 4ZE4A 1W6OA 1O4YA 4HU4A 3IDEA 4AHZA 5HMDA 2HDJA 1YPIA 3D5OA 2DVUA 3JW7A 4HOZA 1W2AX 1KFJA 3PU3A 3U2EA 2BY2A 3U2CA 2VZRA 4MNJA 4NE9A 1OADA 1QJY2 1RUH2 1WBLA 1EA9C 5LEJA 4QX1A 3IUDA 4E4FA 1LROA 5I3DA 5EPAA 2QW5A 5DT5A 4F2BA 1APNA 5C9AB 4QP0A 1IEIA 5CC6A 4XHBA 5JAXA 3AMMA 3CHXA 2WJDA 3WQ6A 2GK1A 1SVDA 4PB5A 1M9HA 3DBPA 1W04A 2P37A 2G41A 5HJXA 1X1ZA 3UZZA 1ST8A 2XONA 2OYZA 1ISZA 1BSLA 3SSJA 1OIMA 2X10A 3O05A 3WCSA 4H7VA 1Q6RA 1TPDA 5TNVA 5EQUA 1PGW1 4OHZA 1R092 3W21A 3I7DA 4GX8A 1D4M2 1VIWB 2VZ3A 3HWJA 3I4IA 5A3UA 4LS0A 4MADA 5L73A 4PTMA 4RZ6A 2ZFAA 1QASA 3M1HA 1JI1A 1UWAA 1QY4A 4QIUA 2VZUA 3WSOA 5IJRA 3EX4A 1PZ7A 2P10A 2WXDM 1W2NA 4HNLA 5XIMA 1EAH3 1AVAA 4L1GA 1HIZA 1XBYA 4R85A 1FA2A 3W7OA 3R94A 4QB6A 4LJ3A 2P76A 2VWSA 3B0UX 4B1LA 2Q1FA 3C6CA 2HWC1 2Y0IA 1NAEA 2XHNA 3NQHA 2ZAHA 3HM7A 4OU1A 3WQOA 3BV4A 4BDVB 1UR4A 5CBLA 1HG3A 4DEFA 1V6IA 4WQ6A 1WW4A 3W2NA 1DIEA 3ZYRA 4DJED 1XH2A 1RQBA 1AX1A 1YQ8A 3H4WA 3AIQA 4DBEA 3NDOA 4BS0A 3X29B 1DHKA 1EP1A 2G5WA 1N1TA 1HDKA 3P82A 4TTGA 1J0ZA 1QHOA 2ZE3A 3MIGA 2WA4A 1ND3C 3QOPA 2QS8A 1PZ1A 3W2KA 3HD8B 3UXAA 3VKMA 2HPMA 2IVIB 1KWGA 3VKFC 1KTBA 2VW0A 4NMIA 2DZWA 4UQ9A 4KEUA 2NMNA 2DSVA 3B04A 2UY9A 5E1RA 2A3XA 4BXFA 3KL0A 3EXSA 1KLYA 1RUJ1 1Z6KA 1BVNP 3HA1A 5HATA 4NF7A 2J22A 3KHDA 2XM2A 2OT1A 3C7EA 1ZRFA 5I3GA 1FWIC 3S2LA 3USSA 3C86A 5HWJA 4GUIA 4V33A 1OSEA 1L2QA 1R1A2 1QJU3 2WRAA 1V0AA 4QX3A 1V5XA 3PJXA 3LA4A 1W1ZA 4MXVA 1TR9A 2VVNA 4RJEA 1OC7A 4WVVA 4K38A 1S2VA 3H7VA 1J84A 5IBXC 3ZPOA 3UNPA 5CADA 3FLTA 2WLQA 2Y7EA 4QGMA 4IJCA 4XISA 2FJUB 1OQFA 1RUC1 2FHFA 5LATA 3AMHA 1WUEA 2BDRA 1H2MA 2BMBA 3RYSA 5IUQA 3FJNA 2DFCA 4PH6A 4AFAA 4CD6A 1TSIA 1K8CA 1W6MB 1XYMA 1D7PM 4E38A 5C9WA 2QKDA 3SQMA 4GVHA 1YDVA 4IWWA 5FZGA 1HQNA 1JF6A 3CIHA 3KCLA 3T0CA 1XQKA 1S1RA 3AS3A 4GUGA 3AZXA 3PR2A 1FPN1 5T55A 1FY6A 1VJIA 4BIFA 1ITQA 1ND3A 1ZENA 1ZJHA 5DQPA 2IXLA 1TWSA 2JG9B 1HKMA 4DBSA 1G94A 1XD1A 3EWYA 2JE9A 5G1YA 2B46X 1OH3A 1YMYA 1XLBA 1UL9A 5LYRA 4LKFA 4JCLA 5FJTA 4W86A 3MICA 2RS53 4AAXA 1NCQA 3WF0A 1D4M1 5FLHA 5DRIA 4ORIA 4DEVA 5HQEA 3OJGA 1EC9A 4R7OA 3N3HA 3LZZA 2HWF3 2ASHA 4AXOA 1QOXA 1VF8A 3ZO0B 3PIGA 3WP5A 3ILNA 2JALA 4Q4QA 3V0UA 3ZIXA 3WBWA 3M0ZA 2PTYA 3DF0A 1UMHA 4HSLA 4QKNA 3U1XA 1D7KA 4JV4A 3AALA 3OU8A 4Q4MA 4AZGA 2JICA 1VH7A 3S1VA 2C3ZA 4C1WA 4HVRA 4KS0A 2Q5TA 5AN7A 1LULA 3KLLA 3ILRA 4B3NA 4D7TA 4XACA 1QDOA 3MU7A 2LS6A 1UD3A 4XF9A 3CB3A 3S83A 3WHTA 4LLFA 3V0BA 1LBFA 5TSWA 1MNZA 1E0XA 5HOSA 2OO6A 1LU2A 2HBTA 3WNPA 2XIOA 2CLOA 3PJQA 4LIUA 4OLLA 1V0KA 3CZLA 2R8WA 4LAKA 1UYQA 1TME2 4MJZA 1E5JA 1YFYA 3ZMNA 3FAXA 1GHSA 3NAPA 1YYAA 4NRRA 4WHBA 1ENXA 4DRVA 3WDRA 3HBLA 3J8F3 1LG2A 2HWF2 5IVYA 1W3KA 1W6NB 2UV8G 5FZIA 2DCJA 2ESCA 3R0DA 4FOKA 1LU1A 3AIUA 5K8SA 5CSSA 4QDQA 2R1BA 2OZ3A 4DO0A 3M5ZA 3WP4A 5FZAA 3S30A 3B9OA 3SLIA 3PTDA 2GJPA 4N4QA 2EG7A 3C2UA 1J3RA 2AL2B 4GH4A 3IGUA 1ZCCA 1XSIA 3CQHA 4LQ1A 1HN1A 1YDNA 4IMFA 4FF7A 2B0MA 3LHUA 1E5RA 2VUJA 1OOPC 4DWDA 5IK5A 1JULA 4MGGA 1XLEA 2PRLA 4XAZA 3VM5A 1QQP3 3PJYA 1ITUA 3ZFHA 4RZ4A 1XFCA 4CD7A 4B4PA 4L4MA 1DGWX 5CYYA 5MF5A 4QQOA 3JUGA 1SHWB 4NZ1A 1IPJA 1L7QA 4R52A 1JUEA 1E0VA 1YI9A 3WZ0E 1CEOA 5D2AA 4XQWA 3S2MA 4RGAA 2EG6A 2E77A 5FXVA 1E0UA 3PAOA 5F1UA 4MFEA 5A7WA 1W39A 1Y43B 4QEEA 4LO6B 1BRLA 2VDGA 2D98A 3PUHA 1GOIA 2HISA 3T0TA 4OHQA 5CSYA 1J18A 3MUCA 3TN6A 4DYJA 5G4HC 2WCAA 4BF9A 4LC6A 5GKAC 3S9IA 1NY72 4C91A 1FBAA 2Q1MA 2E1DA 1W3NA 4Y2WA 4WX2A 1SFJA 2BEOA 3HPFA 4JN6A 1OFDA 3AIBA 5FYCA 3IIZA 1ULDA 2A7AA 4XFAA 1CGUA 4ASMB 3MHUA 3CLMA 1US3A 1IXOA 4K7VA 2VNVA 1NFBA 4JGZA 3PSVA 1O68A 3MUY1 4C6KA 1R9XA 5BZAA 1WDWA 4UI9L 4R7JA 4R34A 3EYPA 4LE4A 3VDAA 1O4UA 1OF8A 4Z42C 5JIAA 3AFKA 3NFUA 5FZCA 4UOZA 3UWEA 3AWNA 1EOKA 1J0IA 4PMXA 4XIKA 3CPRA 1YIPA 2E5DA 4AZBA 4YJ5A 1AL21 1T41A 1JCTA 2VEMA 1SZNA 4ATEA 3MMUA 4HPNA 4IP4A 2UYAA 4FXJA 4GZ7A 4AZ5A 4BA0A 2AAAA 2QQKA 5KTLA 3WD2A 1U12A 1C8VA 1ZJBA 4LNYA 3O1PA 3T4VA 2Z7GA 2PF8A 7PTDA 5FBZA 5A1AA 1L0PA 4JTOA 3DGTA 4RE2A 2OT0A 2P3EA 2VC5A 3W6MA 2NSXA 4PMJA 4CN6A 4AG0A 5CPMA 3NW4A 1TKKA 5KHKA 2G96A 5T50A 3RSJA 1ULGA 1BLIA 1V3LA 2XDFA 1VIZA 4AIEA 4PRWA 4Y9OA 3ZFEA 1A5UA 1LRNA 3PBYA 4YWIA 5AY7A 3W87A 2DU2A 5DQ0A 1EV13 1ND3B 1E4LA 2EXIA 2YA1A 1IZJA 5A5WA 3VZMA 3GIQA 4LBQD 4NHKA 3TJ4A 2A2IA 3N9SA 4D6GA 3MCOA 4QU2A 4QX8A 2EXJA 4HPGA 1AZ2A 1K3IA 1S0FA 2E7QA 4YYFA 4I0WB 5A32B 1UC4A 3L0KA 1VB2A 4PBGA 5BXRA 1L7RA 2PN5A 3M5VA 2FMOA 2C9AA 4LK6A 4JCKA 5E6ZA 3H24A 3OA5A 1LQ0A 1LL4A 2YCJA 4XX6A 2BVVA 1DQ0A 2FDMA 3K2GA 3MWAA 3PAJA 4HCDA 3S1XA 3PG9A 4QJ4B 2WQZC 4ZO7A 2H6RA 1OX6A 2PHWA 4A7YA 5BOEA 5F2IA 1Q8OA 3S5OA 1TV8A 2PLKA 3H7UA 5FFOC 3S5ZA 4ZHNA 1PVC1 5FKYA 3TBDA 3ZJ7A 4BY3A 3AP7A 1E4MM 4AGGA 2FDHA 2MPFA 5FZ4A 4B5XA 4NZCA 1U33A 2DZSA 1P0EA 4P00B 1DLCA 7TIMA 4F7ZA 2BZDA 4P5HA 1YNYA 3IJ6A 2E33A 5JWPA 3MKKA 2DBNA 2ZEZA 4IX2A 1CAWB 3V75A 5BNOB 4J3UA 3LRKA 3T1LA 3EX1A 1H4HA 2DZPA 4DZHA 3A24A 3I2HA 1UWQA 1FP8A 1J1LA 1PYMA 2W94A 2XIJA 3L2MA 4V15A 2GGEA 1UHVA 4AEDA 1NELA 1HUVA 1HJGA 4WVZA 3UF9A 4Q8VA 4U31A 1ONRA 2WCGA 4RS5C 3OLEA 4GK8A 1PTGA 4LC8A 3I2FA 4E4PA 3WEZA 2FVMA 4GKYA 4RYDA 1WKYA 2ZGOA 1H61A 4NAMA 1OXCA 2C1GA 3MBDA 4Z2IA 4N7UA 1EPZA 1VFHA 1PVC2 3NJXA 1PMIA 5GM0A 4P8WA 1CXFA 1DWHM 2VMDA 2ZA1A 2OPJA 1XS2A 2D3LA 1WBHA 2BGPA 1AVBA 1QIQA 1QEXA 1UY2A 2DV0A 2K2SA 3T81A 5EFFA 1BVP1 3M0JA 4GKTA 4QX0A 2G3NA 2Z25A 5FAXA 1TVNA 2RGMA 3ZXDA 1VFOA 4CP9A 1DGRA 3GZUC 3DBNA 4GQ0A 4AEKA 2WHMA 5F6LB 4XURA 5CFCA 1YFUA 1VGAA 1V3KA 4UTHA 3W84A 4UNLA 4Z2LA 4CKQA 3B0YA 1W9VA 4AW7A 2I16A 4A3XA 1I9CB 1JYIA 1NE6A 2VL4A 1S2WA 4OV4A 5I91A 4F0LA 3DKLA 5C3SA 3GHSA 3H2EA 1AJZA 3L4UA 4CXXA 2E7TA 3RX2A 3NO8A 2PBGA 3BLIA 1DWJM 4AD1A 3BANA 2PWHA 3WF4A 2X7WA 5M2FX 1BK0A 2EPLX 3TJXA 1H9PA 4GWMA 3A0NA 1BMV2 2FQPA 2PQSA 1FXQA 1TPC1 1I0BA 1WDPA 3E1F1 4KGLA 4F8XA 3E2RA 2ARBA 4AHPA 1RLCL 4BI7A 2EXOA 2ON3A 3BSMA 4HMZA 4R9XA 4WKAA 6REQA 2BV9A 3TLQA 1GOHA 1Q5MA 2YDAA 3LEIA 2A6YA 1PNGA 3KM5A 2GDQA 4XAYA 4B3ZA 2JQXA 4D6IA 2RS12 3ZXGA 4PJYA 1E1CA 2FFCA 5I0DA 3AMGA 1LRTA 3BTNA 4AWTA 3URNA 2C9KA 5A7PA 1LOFA 2VOXA 4ZU5A 2PDKA 1W2VA 2DWRA 4M4RA 1PK6A 3WF2A 4A41A 3GDTA 1J79A 4JPGA 1XDMA 3LOBA 3BAWA 1Q4NX 1RUF1 4XDPA 2OFJA 2I45A 1V7YA 1ZB5A 1DYKA 3BGJA 2BODX 4HA1A 1P1MA 1SJDA 4HHMA 4HMDA 5AHLA 1W91A 4HK8A 3V5FA 5FPUA 5A6KA 4JTFA 5CG7A 1I9RA 1DJXA 2R1MA 1S1AA 1QW9A 4XVHA 4H9VA 1H50A 2EALA 1OF6A 3LV5A 4FNUA 2RVAA 3WJYA 4DNMA 3GNPA 1GFF2 1CGWA 1RB8G 5B4XA 2FZMA 1BHGA 3VOJA 1JXKA 3UA3A 4HPKA 4H7LA 3FCPA 4UFJA 1PIIA 1ZU8A 2WZPP 4RSUA 2ZUWA 3BALA 2WNOA 2XGXA 2C18A 3ENRA 4AZCB 3KBNA 4XKYA 4LE3A 1TRDA 3XIMA 3VGEA 1RLDA 2RS13 3FJ6A 2CZFA 2VD7A 2IXKA 1TV4A 4Y3OA 4PLMA 3H26A 2ORZA 3C8NA 4BCUA 3QBUA 2NVDA 3HT1A 1HTIA 1D0HA 2GWGA 4FOJA 3GTHA 3VBUC 5FR3A 4AYGA 1ZY9A 3BCWA 5FEWA 1MACA 3B3DA 1LGNA 4L65A 1S0DA 3AIEA 1ZBA2 4DY5A 2WFPA 3UCDA 2PRMA 4YM0A 1ZJAA 1HRI2 1OINA 1ME7A 3S8HA 2AH2A 4ZTYA 2OG9A 3KBWA 1KFWA 3C5QA 3T0BA 1KJLA 3SECA 1HXS1 1PVXA 5D8WA 3W02A 2FH6A 3VX0A 3TYDA 1V6TA 2VR5A 1UCXA 4LEFA 3NAPB 2A6XA 3BKZA 3DDMA 4L92A 4YVVA 1X8EA 1RHI1 2Z00A 1XJAA 3UG3A 4RE0A 3LOTA 3WNLA 2E1WA 1EP0A 2P3KA 1E3ZA 2VNGA 3SCRA 2PDLA 5AC93 3UG5A 2BFUL 3VD7A 1QK2A 2VYOA 3EOEA 1VPYA 5LB6A 4MX3A 1UZWA 4MVAA 2RJLA 4O9EA 4IX0A 4L4OA 4EWJA 1SLTA 1Z7S2 5GZEA 5F3CA 3W2UA 1WA4A 5A6JA 5LIWX 2JEQA 2BBAA 1G01A 3H2FA 2X1UA 3PWGA 4B7KA 3SW6A 1WNOA 3H8XA 4D6CA 3GVGA 2YDEA 3SRDA 3ZT7A 3UY8A 3H22A 3AS1A 3M47A 3B8UA 1QW8A 2QIIA 1O3SA 3TYAA 4MKVA 3LCXA 2OGYA 2GNTA 1R7AA 3Q45A 2DORA 3NURA 2J1EA 1Y3TA 4NP7A 2GQ9A 2V30A 2FVKA 4QQUA 1TPFA 4HPHA 1H2NA 1X1NA 2OELA 2VNCA 1L3JA 3J26N 4PF1A 4TVCA 3E0VA 1FCVA 4QPIB 4UW6A 1GVQA 5EJZB 1N3QA 1MEHA 3GU1A 2G19A 2Y8VA 1J2WA 3TEZA 3UY7A 4JNMA 3ITOA 4XZUG 2PDBA 5FP4A 4U4MA 3FX3A 5A6QA 2ZHKA 3IJLA 3GXUA 4ATLA 2GQ3A 4RDZA 3I4KA 4QKBA 4H6RA 2CZDA 4PCRA 4W89A 3N4FA 5FZEA 4WDWA 2TYSA 4MWAA 2ZRZA 1ZRDA 4UZSA 1P5BA 2GMMA 2CBJA 4RHV2 4GQBA 2POZA 3VABA 3VX1A 5FXXA 1GKQA 4PSRA 4L64A 1QWKA 4Z1DA 3WQ7A 1XRUA 4TX9A 1OCJA 3WCZA 3ZR4A 1W1VA 2FZBA 2BNOA 3FLRA 4IEWA 1XIMA 3BV7A 1PMJX 3RZHA 1KC7A 1VRH3 3MLLA 1QPQA 3APYA 2DIKA 2WLZA 3ZSSA 4UW5A 1S46A 4MWAC 4PTXA 1UA7A 5F2LA 2ZS6B 4M3CE 1TJPA 1HJVA 5I3IA 3RGTA 1GVOA 1H62A 1RH9A 4NHMA 5AYYA 3O6CA 2XJPA 1QI2A 3OIHA 3POGA 3MSYA 3VPLA 4Q4W3 1K5MC 4HT1T 5AHMA 3RLHA 1SBFA 3RMEA 4IQJA 3P8JA 4ERAA 3KRZA 1B54A 1LB2A 2Y38A 5CBBA 2VW1A 3WW2A 3BICA 1OA2A 2IQDA 2CHNA 1LLWA 2WSKA 4JQ4A 1WA6X 2E6FA 3URFA 4HNCA 3EKLA 1POQA 3ARQA 1EJ7L 2XBO3 1RP8A 4GQRA 2Z79A 4CU8A 1OG0A 3UZXA 6PTDA 5IRPA 5KC5A 3GK0A 1LLOA 4C5ZA 2DCKA 3POWA 3ORWA 4M1BA 1WLDA 2QGYA 3VIGA 1KD0A 1RR2A 4UTJA 3IJ8A 3AMDA 4WV8A 2O7SA 1UIPA 3G5EA 3WUFA 5A8OA 3E5XA 2XGBA 4YW1A 4DJDD 2QQVA 1DQ2A 4YHEA 1S0GA 1VLWA 2YDRA 1UMZA 3HF3A 4RW5A 1OZQA 1YHTA 3N9OA 3S5AA 3PFRA 3WQWA 3DN5A 1TO3A 3LGDA 2VAUA 2JDAA 2XR4A 5C5UA 1MQRA 4ZFMA 5I77A 1GEHA 4XWUA 3A5FA 4TV5A 2MUCA 1AQ0A 1GG1A 3OUIA 3T4CA 1FTXA 3FV9A 1SZBA 4LVBA 4XVEA 4F3JA 2NT0A 3BLPX 1O5RA 1GWKA 4OV9A 3TQPA 1MXGA 3WNOA 3C2OA 4IMEA 5D9OA 3WNMA 5C2CA 2ZXAA 1NA1A 3ZR6A 1IKPA 4HCHA 3N9LA 1CXEA 3IJ9A 1IXQA 2Y0OA 2G3JA 5DAXA 2RAGA 1DU3D 4H7CA 3RJYA 3BTYA 2PDQA 4GCXA 1QO5A 5D38A 3O1SA 2CZEA 1JD9A 5C4WC 2IPGA 3URBA 3VZKA 3TFXA 1VAMA 4CP9B 1VFTA 4P02B 3W6YA 4ES4A 1XLGA 3FDGA 1Y4WA 1WD4A 4CEUC 1V02A 5C71A 6XIAA 2GN3A 2VMEA 1XGEA 3CPUA 3VYLA 1QKQA 2Z4FA 1QOQA 4QX2A 3CHFA 3NRUA 3MUXA 4M6QA 3HG4A 3SAZA 1V6XA 3GBDA 5DPNA 3T08A 4RFRB 4GMEA 4YU1A 2OZ8A 1LJ7A 4ARXA 2WPGA 5F3IA 1CIYA 5EBAA 4MMWA 1CAWA 2QUTA 1CVNA 5D21A 3C3UA 1Q3EA 1X82A 4DFSA 3O6YX 1IS5A 2JDUA 1IQAA 4AL9A 4ZGYA 5A3PA 1CJPA 3GFXA 1VRDA 4JN7A 3MPGA 1W6QB 4XTPA 3L4TA 3J8F2 4AEDB 2QV4A 3AP5A 1J8VA 1XXXA 1Y8BA 1FT9A 4AD4A 1GOOA 3TONA 4HETA 1S4CA 3N6QA 5G04L 3BOFA 4I09A 3UJOA 3AJ7A 4AQ2A 1VJ2A 3DERA 3N25A 5H8UA 2JIGA 2W3JA 3KP0A 3HU7A 1RCQA 1W6OB 5CBIA 3CAQA 4GVIA 3EB2A 3IDBB 3N11A 1EJSC 4GIAA 1FDYA 1GJPA 2ZJCA 2IXJA 1K8YA 4J1WA 3LPGA 1FPN3 3HPAA 4US6A 4Y5TA 2D5FA 4Y4YA 1V9U3 4CEYB 2BOGX 4H83A 3RM4A 2RJ2A 1ZQ5A 1RUF2 4AMAA 3M6YA 3M0MA 3RCNA 3EPOA 3QH2A 4DIQA 4HN4A 3UCCA 5I0UA 2D73A 2BHYA 3DIPA 3DFPA 3P80A 3SCSA 4GO9A 2CKRA 3W27A 5E89A 2BBFA 1WDQA 4OZOA 1Q8SA 1GZTA 1KFBA 2ETEA 3SO7A 1TQXA 2C0HA 3AVSA 2CNAA 3PS7A 3KOWA 3FYPA 1E6QM 2RS32 4GALA 2PTDA 4FLQA 2Y61A 3WLLA 3VDDB 4QXBA 1AYN1 4QM1A 4NPRA 1ZAJA 3H23A 3U57A 1PSCA 2ZTNA 2CV6A 3TW6A 4ASLA 1Y5WA 4GYPA 4LK7A 1CX9A 2BDQA 3LCLA 2EAAA 5A7NA 2J8GA 1UA3A 5F4SA 2HVOA 3TEWA 5M1TA 1DF0A 4UTFA 4WM8C 2DDUA 3PZTA 4Q6JA 3ZQ9A 1T40A 2QUNA 2DZVA 4PTNA 5LW9A 1QF3A 2O9PA 2WQPA 3GJBA 2Y64A 4I5UA 5D04C 4GNKB 2IXIA 1MVQA 3NAVA 1ZBCA 3DXTA 3PMSA 3KRSA 3KV5A 4QPGA 2ZX5A 1CONA 3VIKA 2XMLA 3TTOA 3H3ZA 3VIHA 2ZEYA 1GWLA 4LUSA 1LT8A 1D2KA 1ZL1A 2FMNA 4XBLA 4PSPA 4CD8A 2NX3A 1A3HA 3WLIA 2IC1A 4QFUA 1H3GA 2Z69A 3KS6A 1FDJA 3H53A 4XB3A 2IXUA 4N9HA 3CHDA 2ACSA 2ISSA 4AZIA 3GLCA 3ATZA 4ZO6A 1H8TA 4OHXA 3TRSB 4QXKA 4K1ZA 4XKMA 1SUXA 4MGSA 3GG8A 3WLUA 1QAPA 1R9ZA 4XO7A 4YW7A 4RGKA 3VD4A 1K03A 3EOLA 3VD3A 3ZXJA 1ZZBA 1YDYA 3LY0A 3DFSA 1CZ1A 1PZ3A 4R88A 4DF1A 1PZ8A 4IESA 4PMRA 4XQ6A 1Q65A 1DL3A 2CLPA 1E56A 5F7UA 2D3NA 4HQVA 3STCA 1DTUA 3T6CA 2O8OA 4HL0A 5HPCA 4NRSA 2QQNA 4FIRA 1POJA 1UKQA 1RVGA 2QQWA 4QG9A 1V03A 3SCQA 3TSBA 5GPRA 2A85A 4MGZE 2EJAA 4D2JA 5ABFB 1UKGA 5ECUA 4JFWA 4B9YA 3W7RA 3WCRA 1DYSA 3QRHA 1YHFA 3UGRA 5A3TA 2QVNA 4YFWA 5FDBA 2R49A 3R4SA 1O8PA 1POV3 2JKEA 1G67A 4AEFA 2C13A 5BUVA 2SLIA 4AAPA 2CBUA 3PBUA 4I9MA 4B5SA 3KVBA 3WUGA 4CE8A 5AVNA 4LHNA 1H1IA 5JMOA 3KRBA 3B69A 1OM0A 5FIXA 1Z7S1 5A6XA 2XOMA 4MDPA 2Q30A 3UESA 1F9CA 2ADEA 3RWNA 3TNQA 5AFDA 5D9MA 2BP1A 3WNKA 2OU4A 3OYZA 5FACA 3GBFA 2ZABA 3ETQA 3POYA 2E0PA 3RCMA 1NAL1 4TO8A 4A8IA 2HCVA 1UN1A 4NO4A 5EP9A 1AQMA 2R042 3EMQA 4A2RA 5FZHA 4Q4KA 3ZXKA 1D7FA 4AD2A 4H19A 4MB4A 4S2DA 2BVWA 2YGYA 2C14A 1UJQA 3PZVA 2PDYA 4IFRA 1LUCB 1H2LA 4DQAA 2Y7GA 5DAWA 2I5GA 3USUA 4XZIA 2GJRA 1GONA 1K8ZA 3U11A 4P9GA 3JB8A 4FF5A 1XC4A 1SGJA 4J5NA 4HK9A 1IS3A 5E16A 2VFDA 2VEFA 1ZSXA 1DLLA 4FFFA 5FYMA 2R24A 2YGLA 3W07A 3VD5A 2WNNA 4GJYA 1LENA 3U4AA 2VX4A 4ZR8A 3VZLA 1EX5A 1KGYA 1V6WA 1F76A 5EKYA 1SFYA 1PVC3 3AWOA 4K39A 3MPPG 5JUVA 3POHA 4AZ7A 4XSLA 5AYIA 3ELFA 1GKBA 4JTSA 4MY1A 5K4ZA 2X29A 2VELA 4I3GA 3OBZA 4GC3A 4M80A 3NL2A 4FNQA 1X96A 1NARA 3NR0A 1SSGA 2VVDA 1S0BA 1HW6A 1WZKA 4WSKA 4QXIA 1FX5A 1YQ2A 2FDGA 1YTDA 5EFDA 1OHLA 4NASA 2DY3A 3IM0A 2R9RA 3W1PA 3HEIA 1EC8A 3VL8A 2QNKA 1US0A 3QC0A 1B90A 2R043 3AXDA 3O07A 1SZGA 1I6XA 3B9DA 2JKPA 4IE0A 5M03A 3GF6A 1V3HA 5F2GA 4S1FA 4IEQA 3LHTA 5ABJC 1CX1A 2D0FA 1VMFA 2A1XA 5GLUA 4UQEA 3VBSB 4E2SA 3E96A 3N7KA 4UWMA 2XG3A 1VS1A 2J47A 3SY5A 4Y1ZA 1DJZA 4P2VA 4QGCA 4UQAA 3PLQA 3BLDA 3WDXA 3WDJA 2HSAA 4QAIA 1VB4A 4Q8OA 3RNDA 3HR9A 1W3VA 3HBZA 1JPDX 1DFQA 1GVEA 4MNLA 3ES7A 3GC2A 1PX4A 3LCGA 2YL6A 3POJA 4Q4V3 2FZ8A 3R8GA 2JDKA 5FCCA 2I5IA 1B3VA 4RDVA 2YBVA 1GVFA 4D94A 2DVTA 1YI7A 2HWC3 3UBPC 2C1IA 1UR8A 4FBFA 3IJDA 3WQ1A 1QPRA 4QNEA 5DFAA 5AC4A 3KOZA 1VIWA 4H04A 2JFEX 5I0TA 5AFEA 1VBRA 2YBSA 1V93A 3VBSC 3U5UA 3QCWA 4ACYA 4NZJA 4LBNA 4P7LA 3RJXA 6REQB 4N43C 1A5MC 3BQ5A 3W28A 5DXYA 2DEPA 4LPLA 4IGNA 4D7SA 4HZ6A 3CWOX 1Z48A 3QHOA 2HYKA 3DPRC 4NJHA 5HXVA 1THFD 4P5UA 2VM9A 2WNVB 5LGXA 3H3LA 3GXTA 1N8FA 5AZ1A 4ET7A 1R3QA 3ITVA 4LUSB 4R27A 4BWLC 4BWOA 3W0KA 4YIWA 1XBVA 5RUBA 1XCXA 2W67A 3QXBA 4XUTA 5F32A 1ISYA 5TBOA 5G05L 5GLZA 4TN7A 2J1RA 1TR1A 3PBVA 5D05A 3KDNA 3ZYZA 1EYBA 1LOBA 3HQOA 1IIHA 1DXFA 1P43A 1RUI2 2BVDA 3ACGA 3IGHX 1JUHA 5FPVA 3E2VA 4IIDA 1RQEA 3ABSA 4KMQA 3APGA 1XNCA 1BXBA 3WK2A 2TPSA 2W1WA 3BUVA 1OGGA 2HWC2 3KCCA 3WQBA 4DI8A 2I17A 1UPIA 4XQ4A