4BQ5A

Structural analysis of an exo-beta-agarase
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
748
structure length
748
Chain Sequence
b'SHMLFDFENDQVPSNIHFLNARASIETYTGINGEPSKGLKLAMQSKQHSYTGLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSYYAKLSGHDLEVPDSGDVNDLNLASGLRSNPPTWTSDDRQFVWMWGVKNLDLSGIAKISLSVQSAMHDKTVIIDNIRIQPNPPQDENFLVGLVDEFGQNAKVDYKGKIHSLEELHAARDVELAELDGKPMPSRSKFGGWLAGPKLKATGYFRTEKINGKWMLVDPEGYPYFATGLDIIRLSNSSTMTGYDYDQATVAQRSADDVTPEDSKGLMAVSEKSFATRHLASPTRAAMFNWLPDYDHPLANHYNYRRSAHSGPLKRGEAYSFYSANLERKYGETYPGSYLDKWREVTVDRMLNWGFTSLGNWTDPAYYDNNRIPFFANGWVIGDFKTVSSGADFWGAMPDVFDPEFKVRAMETARVVSEEIKNSPWCVGVFIDNQKSFGRPDSDKAQYGIPIHTLGRPSEGVPTRQAFSKLLKAKYKTIAALNNAWGLKLSSWAEFDLGVDVKALPVTDTLRADYSMLLSAYADQYFKVVHGAVEHYMPNHLYLGARFPDWGMPMEVVKAAAKYADVVSYNSYKEGLPKQKWAFLAELDKPSIIGEFHIGAMDHGSYHPGLIHAASQADRGEMYKDYMQSVIDNPYFVGAHWFQYMDSPLTGRAYDGENYNVGFVDVTDTPYQEMVDAAKEVNAKIYTERLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-AGARASE
publication title Substrate Recognition and Hydrolysis by a Family 50 Exo-Beta-Agarase Aga50D from the Marine Bacterium Saccharophagus Degradans
pubmed doi rcsb
source organism Saccharophagus degradans
molecule tags Hydrolase
total genus 255
structure length 748
sequence length 748
chains with identical sequence B
ec nomenclature ec 3.2.1.81: Beta-agarase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02449 Glyco_hydro_42 Beta-galactosidase
A PF17992 Agarase_CBM Agarase CBM like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4bq5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bq5A02
1D3CA 3EDFA 1E4NA 3J7HA 1Q6EA 1J12A 4W7UA 1M04A 2DT3A 1XYZA 1GW1A 1ODUA 5BXSA 1CPUA 1OIMA 4F8XA 5D9NA 4LK7A 5BXRA 4WIWA 4RE3A 1V02E 4CVUA 4PEEA 4JAWA 5FIPA 1B3ZA 4QCEA 4IM4A 2GDUA 4EE9A 4GQQA 1WP6A 3VDCA 4JL2A 1IT0A 1KR1A 2V3GA 4GKLA 4AIUA 3L4YA 3VDBA 4HZ6A 1MW2A 5HOSA 3PTKA 2UY4A 2V3FA 2WBGA 2BY0A 2F8QA 4OUEA 3KEHA 3TOPA 1MVYA 2GK1B 5IFPA 2WHLA 4RL3A 4KGJA 1B3XA 1E6SM 1HL8A 1TVPA 5I2UA 3WMBA 3SCPA 1OH3A 1J0KA 5BYWA 1UOJA 2FHFA 2IUZA 1OKOA 1UWRA 2XVPA 2A3HA 3RM8A 3NUKA 3M7SA 1R8LA 3VUPA 1XSJA 3QHMA 3W4RA 1TVNA 1LQ0A 1W9BM 1TUXA 3GH7A 2A3AA 3S6TA 4PYSA 1Y7VA 4IPLA 4JCLA 4YW7A 1E3ZA 1JD9A 3VD4A 3NSMA 5CG0A 2XVNA 4JHOA 3BAIA 1LL7A 1AVAA 1BYCA 3WQ8A 1LG1A 1AMYA 1SMDA 1V3MA 2BFGA 3VDAA 4PMDA 1M03A 4AISA 1VRXA 2XWEA 3A47A 1B90A 3CZGA 2ZX8A 1B3WA 1Q6FA 4FLQA 1OT2A 1KXHA 5DEZA 1QW8A 1E70M 3WNLA 3OIHA 4OOZA 4TXEA 1FH8A 1A3HA 3AMKA 1ZU8A 1W8ZA 5A2AA 3WY1A 1KXQA 2PWGA 3W81A 3IK2A 1BGGA 1DEDA 2XPKA 3AXHA 3WH8A 2ZUVA 2IXUA 3CTTA 3VDHA 3ZR6A 2O9PA 1J0IA 2VCAA 5JIWA 4PMNA 5LA1A 4DM1A 4AD0A 4YW6A 4D1IA 4HOWA 3SUSA 3WD0A 2C7FA 4ACYA 2ESCA 4PSPA 2X0YA 9CGTA 1E6QM 1FFRA 3MANA 2Y4SA 4B3LA 3NIYA 3AIEA 4AZHA 1W3JA 3GNRA 1DWJM 4BQ5A 3BC9A 1GONA 2VX4A 1UKSA 4AZCA 2WKLA 4HMDA 2WXDM 2DSUA 3AS2A 4W5UA 4AD2A 1PBGA 3BAKA 3AHXA 4L4PA 4UFHA 4WJXA 3BAJA 4J27A 4IPNB 4ZEPA 5AYIA 3W25A 4AYSA 2AOSA 1H0IA 2CKSA 5DT5A 2YOCA 3GNPA 3ZOAA 3K1DA 3AIQA 4JFWA 2VNCA 4MJ2A 2JIWA 3QR3A 3RM9A 4Z2LA 1HXJA 2BY2A 4BQ4A 1QNQA 2V5CA 4TOQA 1VJSA 1JYWA 3BSHA 3FW6A 4GO9A 1IZJA 5D9MA 4HMCA 4OOUA 1PX4A 1ZS2A 2PBGA 3I3DA 3SCQA 1H4PA 3TA9A 1VFUA 2J8FA 2J77A 3ARXA 3FAXA 1CGXA 3PZUA 2X05A 3L2MA 1ZBCA 2BS9A 1GQKA 4PUEA 5JUVA 4MADA 2C8NA 3O2LA 3VIPA 2BVTA 2BY1A 1WZAA 1V03A 4HZ8A 3ZSSA 4HMEA 1NARA 2BXZA 1PIFA 3OBAA 3WDRA 3VX0A 2O92A 4UQCA 3MS8A 2XFYA 4CN4A 2GDVA 1V6YA 2E8YA 3LPPA 4HP5A 1CDGA 1GOWA 5CPSA 4UNIA 4M80A 4AMCA 2YL5A 4OKDA 1XCXA 4D72A 2J78A 4W84A 2ZXAA 3WIJA 4W8BA 3VMNA 1UA7A 1CXHA 1QVBA 2YA1A 2AAAA 5CGTA 5CQ1A 1VF8A 1V02A 5A6KA 2D24A 3KL0A 4D1JA 1EDGA 1U33A 1OM0A 5CXPA 1D2KA 4CPBA 1W32A 3WBAA 3PZGA 3SUWA 3CZEA 3SIMA 2CYGA 4IISA 3VGFA 4UOZA 1K9EA 1UD3A 2WZHA 2VO5A 4JFUA 4EKJA 2DSVA 1HVXA 2J74A 3AHYA 2VVSA 3WD2A 3QHOA 2WMKA 3SCOA 3B9AA 4J3SA 1H2JA 4GIAA 3T0DA 3VD5A 3RO8A 4PCSA 1B2YA 2WM0A 2W66A 1KCLA 1BLIA 2E9BA 3ZJ7A 2VMFA 1I1WA 1EOKA 5FL0A 3VD7A 3UT0A 4TX6A 2X09A 3TONA 4ATLA 4H2CA 2QF8A 1GQIA 2W62A 6A3HA 3K4AA 1JF5A 4YWAA 1KXVA 2GK1A 2PWHA 1ODZA 3CHFA 1UR8A 3ARPA 5KEZA 3WUFA 3VGGA 1OGGA 2ZOXA 3ZIZA 3I3BA 3W0KA 3OG2A 3THCA 3GM8A 1HF6A 1ECEA 4WKHA 2BHYA 4LYRA 4MTVA 4ZFMA 4HTYA 2VZSA 1WNOA 2PWDA 3BAXA 1OGBA 3CH9A 4LKDA 4W87A 4EAMA 3T0BA 2NSXA 1W8WA 2YBTA 1XH2A 3ZJ6A 1UYQA 3VMOA 4PTMA 5A8NA 1WZXA 3MO4A 4JIEA 4NI3A 1JYXA 3DYOA 1XH0A 3ZJKA 2DEPA 4UFJA 4CU8A 4QAWA 4NF7A 3B9EA 2WKGA 3ARYA 3MMDA 3EYPA 3OA5A 3GBEA 2JFEX 1NQ6A 5TD4A 1BF2A 1E43A 2WPGA 1G0CA 4KRTA 3MUY1 2WWCA 3VM7A 2WC7A 4CPBD 2LRPA 5EBAA 1TCMA 1UH3A 3K46A 1HKJA 1UH4A 2DGAA 5EFFA 1GHRA 2FHCA 3AS3A 5CPQA 4LKEA 4AIEA 2W67A 1JDAA 3WD1A 4W7WA 4XX6A 2UY2A 3N12A 4OZOA 1GJWA 4D6CA 3W27A 1GWKA 3MSGA 3K8MA 1W9DM 2VZTA 1H5VA 2XFFA 5M17A 1W9FA 1SFSA 1VBUA 3ARWA 2IXVA 2YL9A 4H04A 4AEFA 3SUUA 1ZBWA 4PN2A 4D6GA 4W7VA 2Y8KA 4J3UA 4KGLA 1NWRA 1GJUA 4KH2A 5A6BD 1H0GA 4MB1A 4CU7A 5EMYA 4V28A 4CN6A 1GWLA 1TG7A 1UWTA 3D3AA 3SCWA 1CWYA 4JL1A 3VGHA 4GPNA 3WF3A 1E73M 4D6EA 1KCKA 2ZX6A 4KMQA 1CENA 1UH2A 1E6PA 2XSBA 2E9MA 1E6XM 3WDPP 3CGTA 3WD3A 2VRJA 1J01A 3GDBA 2DT1A 1MW3A 3M46A 4FF5A 1E6NA 1DTUA 2WSPA 3RDKA 1KWKA 1X6LA 5IDIA 1UKTA 1M53A 4P7QA 3TP4A 2NT1A 3SEPA 7CGTA 3AHVA 3WBEA 4BA0A 4D71A 1W9VA 4AZ7A 1Q6DA 1XYFA 4U3AA 4X9YA 1FP8A 1GOMA 3VMPA 1C7TA 3PBGA 2D20A 5E70A 1C8QA 2D22A 3MSDA 5A8PA 3BMVA 1FP9A 3IAQA 5A6JA 4J3WA 1V0LA 4GZIA 1GOOA 1HN1A 2C0HA 1B3YA 1CXEA 3AIRA 1HJSA 1WMXA 2JEPA 4MAZA 3OGRA 2W63A 3VILA 2ZIDA 2VT0A 1QNRA 1MQPA 1BSIA 3AHZA 2OSXA 1W2VA 4NRRA 5A8MA 5ABHA 1EOMA 3ARQA 4PUDA 1KBKA 3OLEA 2CBJA 2WK2A 1VFMA 2VXJA 5A2BA 3CUJA 1BG4A 1C8YA 4M81A 1JFHA 1CXKA 4UFKA 3WNNA 2FH8A 4AWEA 1ISWA 3CMJA 1J0JA 2W91A 2ZUWA 1ISXA 3WNMA 2A3BA 3MMUA 1E6ZA 4GO8A 2QPSA 3WEOA 2DT0A 3THDA 4N42A 2V38A 4D6JA 2G4FA 3CHCA 4PMOA 1OCQA 3QHNA 4K68A 1B30A 3LMYA 1E71M 3FXYA 1XGZA 2W4XA 3GH5A 3U57A 4P7LA 5A69A 1JD7A 3MV01 3MV11 1E0XA 1ZBVA 2G3NA 2CEQA 1M01A 2WYSA 2VUYA 5E6ZA 1VJZA 4MNLA 2ZUNA 3AIWA 3POCA 3BMWA 1UR1A 2RGLA 4OJYA 2WZIA 4KRUA 3EMCA 4V2XA 4DWSB 3SUVA 4UOJA 3PZQA 3T09A 4JKLA 1GPFA 2CPUA 4FLSA 2YDRA 1QW9A 1NOFA 3DECA 2F61A 2FDMA 3SUTA 2W61A 2ZUUA 4X0VA 1E6RA 1FA2A 4S3KA 1AQMA 4F9JA 4M24A 5DMYA 4XV0A 1EDTA 3ORJA 1I1XA 1UZ1A 4FK9A 4R5EA 1UWQA 2WANA 1DWIM 3GXIA 2VX6A 3ARSA 4L4OA 2CBUA 1JI1A 1NM9A 1H1NA 3GNOA 1SR0A 2FGZA 1F4HA 1KB3A 3WKZA 4HPHA 1WZKA 4CP9A 1PJ9A 2ZX9A 1WDPA 3RILA 4LK6A 4P7NA 3VIFA 3VOCA 4HA1A 3GXDA 3AIUA 5M5DA 1ESWA 4U33A 3DYMA 4GZEA 1BYDA 3F95A 4PTXA 2Z1KA 4QCFA 1V3IA 1UHVA 4WLCA 1NH6A 3RIKA 2YIHA 4M8UA 4W89A 3PHAA 1JDCA 1HVQA 1WE5A 1JZ2A 1QNPA 1R85A 5I23A 1PEZA 2JF7A 3L2LA 4W8AA 3SCTA 3W38A 3ECQA 4M82A 1V08A 2J7EA 3UESA 4BQ3A 1E15A 3EDEA 1UUQA 4UQEA 1E5JA 2WHJA 1SMAA 2Y8VA 4Z2GA 2E3ZA 3WD4A 1JZ5A 1VIWA 4P8VA 1PZ2A 3VTRA 3WENA 1CXLA 5I79A 3A6OA 3GTNA 4CKQA 1KGXA 5I78A 2J7FA 3ALFA 4M1RA 3WSUA 5ECUA 4LPCA 1HJUA 3N1AA 1VENA 3ZT6A 1CTNA 2J7BA 1HJQA 4DM2A 5A95A 8A3HA 3F4VA 1CYGA 5HXMA 1JYVA 3F5LA 5CJ5A 2K46A 5D9OA 4AY1A 5BXTA 4CCEA 1JZ6A 1ITCA 5HPOA 4CD8A 2QLYA 4U2ZA 1EHAA 2XM2A 3EBVA 4AZGA 2OYLA 1PPIA 4ACZA 3UCQA 3CUHA 1R7AA 3CUGA 1E72M 2NT0A 2EPNA 2WCGA 2V3DA 2YKKA 4EANA 2EQDA 3WEZA 2WC3A 2TAAA 4U2YA 1LF1A 2V3EA 3ZYHA 3SCRA 3FHQA 2YJQA 1JZ8A 1US3A 2V5DA 4OBRA 5E0FA 1G9HA 2VX7A 4MB3A 4MNMA 5CLWA 3EDDA 4D6DA 5ABFB 1QI0A 1OWQA 1BG9A 1TR1A 4S3JA 5I24A 3NDZA 1ITXA 2OYKA 3W24A 1GNXA 1L0PA 2JWPA 4QFUA 4GZJA 1E56A 1MYRA 1GOIA 1ZJAA 1QNOA 5I77A 4GI8A 3CHEA 2EBNA 2UY5A 3VGDA 1OD0A 2J47A 2W92A 5AYBA 1HKMA 2ZX7A 3ZR5A 2G3JA 2X1IA 2XG9A 3G6LA 2XUCA 1CGVA 1MFVA 2ZXQA 5BWFA 4ZXLA 4D6FA 4Q22A 2ZUSA 2D3NA 3GZAA 2XVGA 3WDQA 4F66A 1O6IA 1GOQA 1J10A 1DWFM 5LYRA 2EPMX 2ZICA 4UQ9A 4U5KA 3VU2A 1UR9A 1TFVA 4LYQA 1E4LA 1JIBA 3AZTA 1XSIA 3U7BA 1B31A 5C8BB 2PI6A 2CESA 3AHTA 2VRKA 1QNSA 4NRSA 2WVTA 3NDYA 1H09A 2O9RA 1JF6A 2ZUMA 1HP4A 1VB9A 2BY3A 1WZMA 3BCDA 2XVKA 4UCFA 3VD9A 1ISVA 1QPKA 1QBAA 1FH7A 3N15A 2DSZA 2Z1SA 1CGYA 1Q6GA 3WL0A 3ARVA 2WVSA 5CSUA 4C7FA 3CO4A 3UEQA 3A4AA 4Z2JA 1R7OA 3T0AA 3AMDA 1ZL1A 1UD4A 3MMWA 1V3HA 2FH6A 2WNWA 2WAGA 4ZE5A 4JFSA 3VVGA 3BXWA 3L4UA 1B3VA 1CGWA 1KFWA 1RH9A 1E3XA 3AFBA 5I6SA 1J18A 3ALGA 2Y24A 4UFMA 4WSJA 2OWWA 2XSAA 2VOTA 3AIVA 1HT6A 5DO8A 1TMQA 2GJXB 2J79A 1K9TA 2UY3A 1CECA 2VI0A 3N11A 4HA3A 2WCSA 2CXGA 3RCNA 3GH4A 4TUFA 3K8LA 1QI4A 5ABGA 1UD6A 1NOUA 3HJEA 3T2OA 1W9UA 2YLLA 4PMZA 1Q6CA 1QI3A 2J7CA 3WH9A 4J3XA 3BCFA 4W93A 1W91A 4MDOA 1CIUA 1W1VA 5A6BA 1W1PA 1GOKA 3VNZA 3WH6A 5CGMA 4PMXA 2C24A 4D6IA 3CZ8A 1IZKA 6CGTA 3TTQA 2E9LA 5I3DA 1CBGA 1WAWA 2EJ1A 2WHMA 1QBBA 1J9YA 1W90A 3VIKA 1TA3B 1C91A 2MANA 2YDQA 1HKIA 4ZXOA 3SCVA 4R27A 3APGA 1I75A 1YQ2A 3HU7A 4OIFA 3VGEA 2W5FA 1HIZA 2XHYA 4CD7A 3GYCA 3WMSA 3VIOA 2BHUA 1X1NA 1ZB5A 1J0ZA 2GUYA 1V6VA 3WUBA 2WZEA 4W8LA 3AICA 1GUVA 2YBUA 4HZ7A 5BXPA 2GFTA 3ARTA 4UZUA 4CU6A 5M03A 2DT2A 3AISA 2WB5A 3A4XA 4J28A 1VAHA 4E8DA 3OGVA 1WDRA 4M56A 3ARZA 2VL4A 3AYSA 4CN1A 3LPFA 3QOKA 1W8TA 1CGUA 2WMJA 2GJRA 1DWAM 4E4PA 1QHZA 4H8VA 2CERA 3PZMA 3II1A 1MXDA 2WSKA 5E9AA 1K9DA 1G94A 3CZJA 3VNYA 2WMFA 2FHBA 1E9LA 1BFNA 5CZKA 2OSWA 4E8CA 3RM4A 4DWSD 3F5KA 4AZIA 1W1YA 1K9FA 2DDXA 2WMIB 5HNNA 3VM5A 3VD3A 4A4AA 7A3HA 1MFUA 3PZTA 4W85A 4D6HA 2QPUA 1FH9A 2O9TA 1V3LA 2BNJA 1UQYA 1E40A 1M7XA 4MB5A 5GNZA 4UQBA 2OSYA 4AD3A 2G41A 2VURA 2LROA 4CCDA 1RP9A 1W3HA 4XZBA 1E4IA 2GVYA 1JAKA 5A6LA 1GQJA 4HU0A 3PZOA 4U31A 1HX0A 1V0AA 1OB0A 5CLTA 1XCWA 4AZCB 1GHSA 1RPKA 5IHSA 1QI2A 3RJYA 3ZMRA 1MW0A 2VZUA 2QV4A 4XUYA 2DSWA 3VX1A 4QP0A 2X8RA 3K4DA 4LJHA 3FN9A 4TVUA 5IHRA 1UKQA 4GQRA 4AL9A 1H49A 2XTKA 3ZO9A 1EA9C 3HMCA 2VJXA 2YDSA 1EDQA 1JAEA 3VINA 1KR0A 1QI5A 3WDJA 2BXYA 3KZSA 1UZ4A 1JFXA 4H41A 4JFTA 5ABEA 2JEQA 3UR8A 5JBFA 3IANA 3ARUA 4F9DA 1B1YA 3GXFA 3AS1A 4QLKA 4W86A 5A1AA 1OGSA 4HU8A 8CGTA 5BROA 5I0DA 3VIMA 2J7DA 4RE2A 4UR9A 2OWCA 3OZPA 2VVNA 3QGVA 1TE1A 4Z2HA 2EXOA 4LKFA 5HBFA 3WF0A 3N18A 5FKYA 4NZCA 5AC4A 1BQCA 1WB0A 4LQ1A 2XIIA 1Z32X 2GJPA 5GQBA 4PMRA 2JF6A 1FHDA 4BF7A 3WH7A 4WK9A 4J7RA 4Y7EA 5E09A 1W9PA 1W1TA 3IJ9A 1EQCA 3WFLA 1C3FA 1MW1A 5DF0A 1WZLA 2NW0A 4HOXA 4Q7NA 3I3EA 1UKPA 4BZYA 1WDQA 2BV9A 1KWGA 3D5HA 4CUCA 4V27A 4ZE4A 3RPMA 1K6AA 2BHZA 3AROA 1N82A 3PTMA 3WF1A 2XFRA 5JIPA 1PX8A 4X0NA 5A8QA 1GQLA 1MWOA 3DHPA 3CIVA 2CCRA 1GVIA 2OYMA 3AMGA 4UZSA 1B0IA 3FNDA 1RP8A 2CITA 4PMUA 3SCNA 5A6SA 3BAYA 4FLRA 3EMQA 2PF0A 1EQPA 2E8ZA 1JZ7A 3TTSA 3MUZ1 1UWIA 3JUGA 1O7AA 2GJXA 4F79A 1IV8A 3CHDA 3BLKA 1C93A 1LWJA 2OWXA 2ZX5A 3PZ9A 4JKMA 4DWSC 4TVCA 1VBRA 3ZM8A 4IUGA 1CZ1A 3NJ3A 1OT1A 4MDPA 4W5ZA 1H11A 3VIIA 5JBDA 4M29A 4TVDA 3T08A 1HJWA 3NYDA 4PTWA 2PWFA 4AEEA 5D8ZA 3PZVA 1H41A 3AMCA 4UQDA 1L8NA 1J11A 1UR0A 5AC5A 1R86A 1J0HA 4YHGA 3MKKA 1XV8A 2E40A 2DQXA 1EH9A 3LPGA 1TA3A 2VCCA 1ZJBA 3PTQA 4DUWA 1UR2A 2A3EA 3FAWA 3VIGA 2O14A 3CZKA 1R87A 1UWSA 2OLHA 3N9KA 2YL8A 4URIA 1XC6A 3WDHA 2J8GA 1H3GA 1GORA 3ZYBA 1LG2A 1W3KA 3UR7A 4UQAA 1UD5A 4DUXA 4H8UA 3N04A 3WL1A 1JL8A 1KGWA 4TTUA 1GZJA 1QOXA 2Y5EA 1CNVA 3ARRA 2XM1A 1FOBA 2CBVA 2EPLX 3B8SA 4PBGA 1GVYA 4P7RA 3A3HA 3UG4A 3CMGA 3N17A 3O6AA 2CHOA 3PZNA 5C70A 2X2YA 1GCYA 3TTOA 3RJXA 1DP0A 4HPGA 3O9NA 2ZWYA 1A47A 3KL5A 2VR4A 4WKAA 2WCAA 5A2CA 1VFFA 3CUIA 1HJXA 1MQQA 4KWUA 4TX8A 3BAWA 2WMIA 5IFTA 1BYAA 2VCBA 4MJ4A 3WUGA 3L4ZA 5LA2A 1JGIA 1XSKA 3SCUA 3OB8A 1JXJA 4HOZA 4BQ2A 2JE8A 4AW7A 1PIGA 1UKOA 2Q8XA 4YHEA 3WF4A 1NWTA 3EMZA 1NOWA 3M6DA 4CCCA 5F7UA 3AZSA 1JZ4A 1MXGA 3VIHA 2G8ZA 1AQHA 2YLAA 2ZE0A 5D8WA 1LL6A 1U30A 4GI9A 4QDMA 2A3CA 2WVVB 2XYLA 5M3WA 3WELA 5I5RA 2WYFA 1Q4NX 1V0KA 2WBKA 3K8KA 4A3YA 4CVWA 5A8OA 3EDKA 1JYNA 4GI6A 1CXIA 1W2PA 4AZ5A 1UD2A 5E0CA 1ISZA 3CZLA 3UG3A 3W29A 7TAAA 5C71A 2J25A 1B9ZA 2WWDA 4CD5A 2QMKA 4DUVA 5D21A 6TAAA 2DIEA 2DIJA 5BRQA 4C7GA 4B15A 1BTCA 2HISA 3S2CA 1U2YA 2DH2A 4CD6A 2DPEA 5CSYA 3AS0A 1NP2A 2WLZA 1RD6A 3AYRA 3N13A 1W3LA 3W82A 5DT7A 4U5IA 3RMEA 4PMYA 3OGSA 4MNJA 1CGTA 3E1F1 5A94A 1YHTA 1LLOA 1XRVA 2G3IA 4AZBA 2CETA 1L7LA 1HKKA 2D0GA 1G01A 3NCOA 3CBWA 4WF7A 3BLPX 2JALA 2VZOA 2EO7A 4PMVA 4ZENA 3UERA 1AQ0A 5LA0A 3AOFA 3OLGA 2EEXA 4QLJA 2QHAA 3WNKA 4AC1X 3NSXA 3FY1A 2DSKA 2PC8A 1E4MM 4MB4A 4UOQA 2BVYA 1G1YA 2AMGA 3B9DA 3MUAA 4NSBA 2YA0A 4AD5A 4P8XA 3ZQ9A 4XZWA 2WVUA 5GPRA 3NSNA 1XH1A 1V3KA 4LGXA 1NP0A 3POHA 4YPJA 1WKYA 1VFOA 2VTFA 4PTVA 2RGMA 2WC4A 4JFVA 1V3JA 3W6LA 5BRPA 2XJ7A 3G6MA 4JHZA 5FOOA 1BAGA 3WQWA 4JCMA 3AXIA 4CGTA 3MUIA 1GWMA 4P7OA 3T2QA 4UFIA 2EPOA 2XGIA 2J7GA 1E1FA 1XHGA 3WNOA 1E0WA 2CBIA 3KL3A 4H7VA 3WQ5A 2O9OA 1ZBKA 5D4YA 1JNEA 2FGLA 4J3TA 4DWSA 4B16A 2WMGA 1E1EA 4ATWA 1HP5A 3BGAA 1VEMA 4PSRA 2CKRA 4AD4A 2D0FA 2J75A 1OIFA 2ZXBA 1EGZA 2XIBA 2XWDA 5AY7A 3W26A 4PRWA 1S46A 2WW5A 1LJYA 3WQ6A 1WCGA 4HA4A 4ML4A 3WDIA 2BVDA 1DWHM 1US2A 2E4TA 1BVZA 4MAVA 3WN6A 3ZT7A 4RE4A 1W9XA 3WNPA 5IXEA 3W37A 5DFAA 1JDDA 1QHPA 2WMHA 3MU7A 3UG5A 3KE0A 1ISYA 3ZJ8A 2D3LA 1FFQA 1BYBA 1HL9A 1C7SA 2VQUA 1EHNA 3AJ7A 4XB3A 1NWSA 1KQZA 3ZSTA 4CP9B 2JIEA 1F4AA 2PWEA 1OD8A 3AMLA 3DHUA 2CIPA 1EXPA 1HJVA 3AI0A 3CLWA 1BGAA 1DWGM 1EIBA 3CPUA 4WSKA 1C92A 3AIBA 5A3HA 2WHKA 2F2HA 3DYPA 2J7HA 4B9ZA 3U7VA 2YA2A 2E0PA 5HDRA 1LL4A 4C7DA 1P6WA 1QHOA 4LYPA 1UD8A 3EDJA 4OBSA 1PAMA 1WDSA 3WQVA 3DC0A 4WKFA 2D1ZA 2YL6A 4J3VA 1OBAA 4P8UA 2PB1A 2GSJA 4AZ6A 3T2PA 2J62A 1UQZA 4FLOA 3AQUA 4GXPA 5A6MA 1JG9A 5GNXA 5E6YA 1KQYA 3VGBA 1C8XA 3OZOA 1D7FA 2VQTA 2UWFA 2Q1FA 2VRQA 4BS0A 4QLLA 3WFZA 4UTFA 1UWUA 3UETA 2XVLA 1SYTA 1V0NA 2WLYA 1W8UA 2ZXDA 1C90A 4AXNA 2CNCA 5A6AA 2D23A 1E55A 1VEPA 2ZWZA 2X0HA 1XD0A 1HNYA 3BH4A 4FMVA 4PCTA 1UA3A 4PMQA 1DHKA 2G3MA 1OSEA 1BHGA 5FL1A 1OINA 1CEOA 1LWHA 4JZ5A 2WVVA 3SURA 1HN0A 4B3KA 4P8WA 1X6NA 1KXTA 3BSGA 4ACZB 1BVNP 3HN3A 4H8HA 4Z2KA 1UG6A 1PX3A 3ZYFA 1MQRA 5CPTA 3W6MA 3CUFA 3IJ7A 4CD4A 5JBEA 3GBDA 5EB8A 3A4WA 1XD1A 2ZUTA 3U5UA 1V6XA 1UOKA 3PZIA 4E2OA 4BCEA 3IJ8A 5ABFA 1EO7A 3FHAA 5KZ6A 2QMJA 3WF2A 2PBOA 4GINA 3VKKA 3LPOA 2D0HA 4W88A 2DH3A 1WO2A 3L4XA 3F5JA 3AZRA 4LXFA 1V0MA 1V6UA 3WH5A 4TTGA 4EK7A 1KGUA 4N0RA 3L4WA 4Z2IA 3W28A 3QOMA 1VEOA 3OLIA 3PN8A 1UR4A 1TZ7A 3OLDA 4UFLA 3WEMA 2KR2A 3WUEA 1JZ3A 1BPLB 1NWUA 3W53A 4JKKA 5D9PA 3GXMA 2VR5A 3TTYA 1E5NA 4MNKA 5EFDA 2VC9A 4AIOA 1E0VA 4ATDA 2D2OA 3IAPA 1KBBA 3KWXA 4U3CA 3U5YA 3WQ4A 3VPLA 1J0YA 3WMCA 4A3HA 2Y2WA 1EO5A 1V6WA 5FCZA 5FD0A 1G5AA 5HPCA 4B9YA 2EPKX 1CLXA 3ZT5A 3AXXA 4MPKA 5BCAA 4YN5A 2VZVA 4A6SA 3M07A 4AD1A 3SCSA 1PZ3A 3L4VA 2B31A 5GNYA 1WCUA 3VIJA 3VO0A 1CLVA 1JXKA 1JNDA 1JI2A 2CHNA 2J4GA 1CXFA 2HVMA 1WPCA 1FHLA 2VX5A 3L4TA 2XGBA 4LX4A
chains in the Genus database with same CATH superfamily
5AFBA 5A7OA 1D3CA 2QCGA 3EDFA 4DRRA 5EMJA 3J7NA 4GUJA 1CD3G 3QH6A 2AKMA 3DN5A 2WA4A 1CPUA 2E5DA 4BLJA 4LOTA 3AJXA 4DQWA 1CZSA 2ZGSA 3S5QA 3QV6A 4IL0A 4MFDA 3O1NA 4LK7A 3TRSB 4LY4A 4WIWA 4XQ6A 2HWF1 1ND3A 2V2CA 4RE3A 2Y7DA 4KCVA 4CXWA 3RZJA 3EEZA 3AP7A 3BJTA 1Z6KA 2CW6A 3KVLA 3VE7A 3CIHA 1Y9GA 4JAWA 5FF4A 2JGYA 4FO4A 4UNKA 1UOGA 5HJLA 4DO0A 2GDUA 4EE9A 4NZ4A 1S0EA 4QNEA 3KAOA 4L6OA 3VDCA 2WUHA 1W39A 5FZAA 4R52A 2AREA 2CZEA 3TEYA 4CDXC 2JICA 1IT0A 4LAKA 1FT9A 3B0UX 3E6DA 4FTBA 2QPXA 3B93A 1ZAJA 3ISIX 1I2OA 1LHNA 3N73A 4NIDA 1VBE2 3S5SA 1AFSA 5K4XA 2FMOA 4OUEA 3TOPA 4XZHA 3U3HA 1GG0A 1O95A 2GK1B 4RXGA 4RL3A 1L3JA 1STMA 1TVPA 5I2UA 2WN3A 2RUSA 1ULPA 1J0KA 2HWD3 5BYWA 4BEUA 1UOJA 4IQPA 4KQ7A 3XINA 4AF0B 2YXSA 2OEJA 3M7SA 1R8LA 1UX6A 1YC61 3RJRA 5LNUA 3H7VA 2PP3A 4INDA 1POV0 4ZOBA 2A75A 2R7EB 4CEWC 3R2GA 2Q02A 5BMWA 1XYBA 4SLIA 2F38A 1UZYA 2B7QA 4QX3A 1VB4A 4YVWB 4Z1AA 2W79A 2I56A 3GAYA 4DYKA 2P17A 1LENA 1HG3A 3T1LA 1LL7A 1WDDA 3JZVA 2BMBA 1AVAA 3AZWA 1C3HA 1LG1A 4D8AA 5FI8A 4IXHA 1SMDA 4UXAA 5K7PA 4GULA 4PLOA 2ISWA 1VYSX 3VDAA 4JS3A 3VOFA 3J26N 2HYKA 1M03A 2H0VA 2AEYA 4QGLA 3BTNA 1B90A 4FAGA 2VY0A 1B3WA 1Q6FA 4BK5A 4BK9A 2P3IA 5E8AA 1S1RA 1KXHA 3FXGA 5G4HC 5DEZA 3POYA 3C8FA 3S6DA 3WNLA 1E70M 3H4XA 4OOZA 4TXEA 4YARA 4E2QA 1HIXA 2TPSA 3APBA 2CZFA 4FR6A 4XOGA 3SGZA 4PEKA 5D33A 2WFF1 1OLRA 2QQJA 2IXUA 3CTTA 3VDHA 4LVGA 4CCKA 4O0KA 2VOVA 2VCAA 3G0XA 2Z28A 1S2EA 4MUZA 2QCFA 5TBOA 4BXFA 1ZBE1 1JTZX 1U5YA 2WPBA 4X61A 3I8TA 3WD0A 1KW1A 2CHRA 2OQHA 3AZXA 3ZFFC 1U22A 1WLDA 5CADA 4FALA 5JWPA 3M5ZA 1E6QM 1RBOB 1ZLPA 1G8WA 3ZYPA 4GD0A 4M3PA 1XISA 1OX4A 3AIEA 1PVC1 1OFNA 1W3JA 1XLLA 3KDOA 1IF2A 4BQ5A 4L2NA 1UKSA 3B8WA 5FZDA 2WXDM 1NF7A 3LENA 3H9AA 3MW2A 3BAKA 4L4PA 4KS0A 3GUWA 5FEXA 3FC0A 3MCNA 4JTOA 3MT1A 3A22A 5J96B 1B4KA 1W0NA 4OQ8A 2AOSA 2YOCA 1PSCA 4JFWA 5D8AC 4MJ2A 1MS5A 4UYBA 3BG5A 3NZRA 4DLMA 3IPVB 1MEIA 4Z2LA 2ZRYA 1AD1A 2JB4A 1CQ9A 1HXJA 2BY2A 1KCZA 1YYNA 1UUOA 4MSVA 4WM7C 4CXYA 2V5CA 2A3XA 5CFDB 1PVNA 5IUQA 4NIRA 1JYWA 4Y8FA 3LTPA 1WBHA 5ANNA 4HN0A 3ANVA 1QJX2 5T5LA 2P4EA 4GX9A 2EALA 1ZAIA 1H1MA 3M7AA 3EO6A 3H21A 5C9UA 4Q4MA 5F39A 5LIKX 4NNAA 4LVFA 5A5WA 1XKYA 3FAXA 5KETA 3NO8A 1O4YA 1RUC1 3ZLHA 2FZ8A 2WNUA 4MADA 3MCOA 1XXXA 2C8NA 2JG9B 1J59A 4QS5A 3BUCA 4P9XA 2F7FA 3HG3A 4X6QB 2BY1A 4JX4A 2PHFA 4FX6M 3VBFA 2VUJA 5CG8A 3B03A 2Q8ZA 2VE1A 2RS32 2CYFA 3APTA 2D69A 3R05A 3HPZA 1GYKA 5A3PA 3VX0A 1RHI1 1TE1B 1RTVA 3MS8A 2VXRA 2P10A 2WL1A 5IK8A 3W7RA 4GWEA 4YIWA 3VKDA 2ALRA 3NL2A 2FTWA 4RHV2 4JGYB 1I60A 4B5UA 4UNIA 4AGGA 1AW5A 1BVP1 3WX7A 1EWDA 1AXZA 1ENUA 1K8YA 1WCQA 4D72A 3OU8A 3LRLA 4XBSA 4LVBA 5U7SA 2ZXAA 1NFPA 1LHWA 1P0BA 2E1DA 2V68A 1UA7A 3S5ZA 1CXHA 5AVAA 5DQPA 4D8LA 3UJEA 3B01A 1PO12 2WNQA 5A6KA 4RV8A 5MF5A 1AR82 2EIEA 4S23A 4D1JA 1RL3A 4RNHA 2BBAA 1U33A 4XTIA 5CXPA 1D2KA 3WBAA 1W32A 3SUWA 1POJA 2I2SA 2ICSA 3NL3A 1JOJA 4LBQA 4IISA 1UD3A 3HFYA 4JTEA 3O0XA 1R3SA 1QEXA 1QPNA 2ZEXA 5FP4A 2A5HA 1BKZA 1DQ5A 3H22A 1FWGC 4PUNA 3LQGA 1R091 2C0AA 3RITA 2IKJA 3QHOA 5DANA 4H3WA 3SQSA 1ZZ8A 3T0DA 3RG6A 3STCA 3RO8A 3W7HA 1JDEA 2WM0A 2W66A 5D03A 3ZJ7A 3RZMA 2C6QA 1EBGA 5IRPA 3VD7A 4Q29A 3LLXA 4TX6A 1KO0A 3OPZA 4Q27A 1XLMA 4H2CA 4DJDC 2NM1A 3LA2A 3FA4A 2XH6A 3OGJA 1GQIA 1ZRRA 3N6QA 4QGCA 1BK0A 2XOMA 3TYUA 1D7KA 4BWLC 2JG8B 3APYA 5GKAC 3MQTA 1UKGA 5D1IA 1NEYA 4YCPA 1Z0HA 1W05A 1GOGA 6REQB 4LTAA 2Y0IA 5FYVA 1BXCA 4AEOA 1UZZA 4YZ5A 1H8TC 1MPXA 1ECEA 5JI9A 1P7TA 3EWXA 4GKXA 1UPMB 2YCJA 1KFEA 4LYRA 4ZB0A 4QQPA 4MTVA 4ZFMA 1BQGA 3GHRA 5A32B 4B2DD 4WY0F 1VLIA 1N8FA 3W72A 2QJNA 1W8WA 4AI9A 1XH2A 3RPDA 2X0SA 1I5PA 4OV4A 4A7ZA 3BLDA 3R11A 5G1YA 1FWEC 3MO4A 4RDWA 2D5FA 3F4WA 1GKBA 4NI3A 2IFWA 4XUTA 1P6BA 4UF0A 2BFUS 2DEPA 4LUTA 3BE7A 1G4PA 4NF7A 4A8LA 1H63A 3VFLA 1RUE3 1IR1A 1OF6A 3ABZA 3QZAA 4D94A 3GBEA 2WKKA 1NQ6A 3KW3A 1Z69A 2FCVA 1OY0A 4AY7A 1BF2A 1J3RA 2PHDA 2WPGA 2YGLA 4UAPA 1BYHA 3MI8A 1P1XA 4O1BA 3HFTA 3NKTA 2XZ9A 4MYEA 3ZSMA 4X2PA 5EBAA 1YHFA 1VMJA 2P0IA 3EHKA 1TCMA 1UH3A 1Q43A 1HKJA 1FRBA 3RI8A 1Q5MA 5JOWA 1GHRA 1ASJ2 2GZXA 3SQOA 2FHCA 2JJ6A 1PL9A 3H7YA 1MS3A 1JCXA 4DXSA 1UJPA 4O0QA 3LHZA 4AIEA 1TEIA 1OSGA 3VBHB 1CWPA 4CQBA 4ALDA 3LGRA 4IQJA 2FKPA 4XX6A 3NNGA 2L5HA 4TYSA 4BF9A 4CEYA 4O11A 4D6CA 3GW0A 3KOXA 3VNDA 3W27A 3TOJA 1W8GA 5EWSA 1MS1A 3IS4A 2HDJA 4I9TA 3SI9A 1TIWA 1H5VA 2ACSA 2XFFA 3LDKA 4ZY9A 3ZXKA 1SFSA 4COUA 3LRMA 1DIEA 4YRDA 3ARWA 2IXVA 2YL9A 4H04A 5DAPA 1HW6A 1EPXA 3KVKA 1S2BA 3MBWA 1FX5A 3R79A 2HWE3 2XIJA 4TMCA 4S3EA 1OK6A 1RUG3 1W5PA 1HB1A 4AQ2A 3TB0A 3S5OA 6XIAA 3NQMA 1GJUA 3VOGA 1VR6A 2UWCA 3GXNA 3GFZA 3CAQA 1AYM1 4I2OA 2W08A 4LBNA 2V67A 4D6EA 1GZWB 1CENA 1JW6A 4A2UA 1E6XM 3QH7A 4QPGC 1XDJA 3NAPB 1O3RA 1XGEA 1C5HA 1RMU1 4O14A 1BMV1 4XQWA 3HQNA 3M46A 1WBFA 2PAKA 4FF5A 3N4AA 4QPIA 1VBD3 4QHOA 3I6TA 4NKCA 1SEFA 3GCXA 3B00A 1PYFA 5A1FA 3KVMA 4HK5A 4COYA 4CQCA 1UKTA 1OFPA 4WJEA 7CGTA 2LS6A 1YNYA 2ATMA 3KTXA 1AVBA 3HQRA 4AZ7A 4PFHA 1FOD3 2Y6LA 1XYFA 1ZHAA 4U3AA 1Y5VA 1FP8A 3RLHA 1WW4A 1OFSA 1ZJIA 2FZNA 3POIA 1JRCA 3MSDA 1CR7A 2XJUA 5A8PA 3GYDA 3BMVA 4F4RA 2PDCA 3WHUA 1JHJA 1VFHA 3IAQA 1LR5A 3VHRA 2XFWA 5A6JA 4J3WA 4QG8A 4QBXA 3M16A 2YXGA 1XBZA 1HN1A 5J5DA 1TTPA 1TR9A 4IPIA 1CXEA 3AIRA 4FPCA 1WMXA 1WV2A 1ZQ5A 1RUI1 4IV3C 2XPJA 1LECA 1DJGA 4Q4X3 5F2WA 1WD3A 2F2KA 3RZKA 1COV1 3NJXA 1R2SA 1CESA 2OLAA 2VT0A 2PDPA 1MQPA 1BSIA 3WQ0A 2VGBA 5ABHA 3BURA 3CK5A 2C18A 1KBKA 1IQ8A 4ZODA 2JKEA 3CAWA 2QQUA 5LHEA 1UWAA 1BG4A 1ECQA 3WNNA 2ZZ4A 4EWJA 3CQIA 4FPYA 4Z08A 2FH8A 1ISWA 3HOJA 1UCXA 5C5YA 2E7TA 1ISXA 5C4WB 1NIUA 4M3CA 2VD8A 4KI5M 5KXCA 3VV1A 3R6IA 4LS0A 3CBNA 2CWXA 1EV11 3ZVHA 3UZXA 5JMOA 3PUIA 4N42A 5TIMA 3NFUA 4L9ZA 2G4FA 3L2YA 4PMOA 4N9HA 2J6XA 3QHNA 3GIPA 4FXSA 3FXYA 5KHKA 4XJAA 4IEQA 4AHOA 3OD4A 1BBT2 3BIEA 1E0XA 3WLIA 1ZBVA 2G3NA 1OD3A 3POEA 1M01A 3JQWA 1IYXA 4B3ZA 1NA1A 5E6ZA 4OZXA 1LLZA 1VBE3 4CUAA 4OJYA 2ANUA 4AE2A 3UWYA 3FA5A 4OHYA 5DPNA 1U1HA 4N02A 1ND2B 1GPFA 5BNNB 1OZQA 1EUNA 2CPUA 2YDRA 2QW5A 2CZ5A 4ZB5A 2MUCA 2ZUUA 2Z6IA 1XNKA 1DJZA 2NMOA 1FA2A 4S3KA 4F9JA 5DMYA 4XV0A 4C6JA 3UA4A 1EDTA 5I0TA 3ORJA 2XL7A 3QQ1A 5F4SA 4C1NA 2JDMA 4R5EA 2YBSA 2SLIA 2NUXA 4K8HA 1WLWA 4L4OA 2B45X 4MIMA 3U11A 2A6ZA 3PFRA 3FYYA 1SR0A 1A3XA 4GC4A 4IFKA 3R7MA 3WKZA 3UBPC 3VUSA 3BTYA 2ZX9A 1WDPA 4G9SB 4LK6A 4P7NA 1TPVA 3VOCA 1QNWA 2WNEA 4HA1A 3H54A 1AW1A 1WMEA 1RJ7A 5M5DA 4GZEA 4QEEA 4G2DA 3W7QA 4QCFA 3NQHA 2Q30A 1ZM1A 2XH7A 4ZB2A 4Q7IA 3S46A 1JDCA 4KFOA 2OX0A 1QH6A 3RMYA 1JZ2A 1R85A 1NCRA 4QDWA 1Q8AA 2JF7A 4NZ3A 1YFYA 2IXKA 1XLJA 3SCTA 2PN5A 3W7NA 4M82A 4WDUA 5FJJA 3UESA 4BQ3A 4C91A 2P1BA 5KZMA 3H12A 4UQEA 3C7OA 1TTJA 2DURA 3KS5A 3NRUA 1ZAHA 1E5JA 4NIAA 5D02A 3HT1A 2Y8VA 1JZ5A 3WD4A 3VTRA 1CXLA 5JMUA 5HMFA 1KGXA 4XD6A 5I3HA 2J7FA 2VVEA 1KJRA 1R3VA 2Z4GA 2WT2A 2WWJA 3OIXA 5JLVA 3PUHA 2P2KA 1VR3A 2Z1BA 1HFBA 3UW6A 1M7JA 5D9OA 5BXTA 1AODA 1H7PA 4G8TA 4HONA 4HZFA 1UR3M 5J04A 3T81A 1MEWA 2QLYA 5FF2A 2R1KA 1YPXA 2ES3A 4UTWC 3DC8A 3OEXA 3NR0A 4OWGA 3EBVA 2J7MA 5FFOC 2OYLA 1PPIA 4ACZA 1MDRA 2GJLA 3CUGA 4XZ9A 2VZPA 4Y3OA 4FIRA 4K40A 3MW4A 4L97A 4ARXA 1A0CA 1LQAA 1SUXA 2EPNA 2MEV1 1XFCA 2V3DA 4EANA 1LUCB 5FP8A 1VPXA 1XL9A 5REQA 4XVHA 3RVHA 2YB1A 4QX1A 3LBCA 1LTEA 4U2YA 3HQOA 3ZFHA 4MHUA 9XIMA 1NT0A 3P6LA 4DHGA 2YJQA 2ALDA 4HL0A 4HGXA 3PG9A 4CQAA 3G18A 4W9TA 2X5IC 2JIGA 4P00B 3W7DA 1JZ8A 3NQGA 2VNOA 1US3A 3LQLA 2V5DA 1AL21 1KLYA 4RJEA 3W1NA 1G9HA 4MB3A 3BPWA 3THQA 4Q6XA 4D6DA 5ABFB 1QJX3 2FMDA 2Z1XA 1OLMA 4AXOA 2DJXA 3V5CA 3WY6A 1OWQA 1TR1A 4L56A 5CBLA 2ZAHA 3GO2A 3NDZA 4XTDA 2FTYA 3U4SA 4TV5A 5G4WA 3MSYA 5CFDC 1YNAA 4N8MA 2NQJA 3C2VA 4AWDA 3W73A 3RMJA 4DQAA 4DY1A 1H61A 2D6MA 1NDWA 2HEJA 4FOUA 4GI8A 4GUHA 3ABOA 1KC7A 1JYCA 1XR2A 4WRHA 2XQRA 1KFLA 1ULCA 2FB3A 3Q8BA 1Q65A 2WKJA 2W92A 3VKFC 1DXEA 3N2BA 1HKMA 3TC7A 3ZR5A 2PZ0A 3PPHA 1OHFA 3IGHX 1ZBA1 1XBXA 2R1NA 2G0WA 3OEBA 4PF1A 1MFVA 1HRI1 2Y38A 2VOMA 3EB2A 5BWFA 3BV4A 3GZAA 2ZUSA 4P5UA 2RS33 3WDQA 2W2IA 3QV9A 3FK4A 4JXCA 3UXIA 1UR9A 1P43A 1TFVA 4LYQA 3TDFA 1E4LA 1E9YB 3L2IA 1XJAA 5JOZA 1Z7S2 5FJIA 2DWRA 1MQTA 3AZTA 3WVJA 5DXDA 3O16A 2A3YA 4RHV3 5GLZA 1W8OA 4UW4A 3T4HB 1R2TA 4M6VA 4Y90A 5D2XA 3TH6A 4FA3A 2YW4A 1RVF1 1AW2A 2HXTA 3FLTA 2YHJA 2FD8A 1R3RA 1CAUB 1QNSA 2WVTA 1H09A 3QMRA 1ICSA 3S47A 4XQ4A 1CJPA 1VB9A 2BY3A 1WZMA 4JGYC 1EJWC 1UMYA 4MXVA 3VD9A 1PO13 1ISVA 1QPKA 4RE0A 3ZXGA 4O18A 1AR83 4LE4A 4GIQA 4MHBA 3MF9A 4NAEB 1CIYA 4IEOA 4JDMA 2D6PA 4ZA0A 3W2KA 4W6XA 3WL0A 4GH1A 1A80A 4XBJA 2F6KA 4DFSA 3I2IA 2Y60A 4J35A 2EA7A 5C3OA 4LO7A 3PANA 3A4AA 4Z2JA 2Y8UA 4L1GA 1ZL1A 1V3HA 1AMKA 3ST7A 1N55A 3SH3A 2WAGA 3VVGA 5CEHA 3BXWA 3L4UA 4CNSA 4LEJA 1ND3B 2ZA3A 1KFWA 3BV7A 1E3XA 2WZTA 3GHTA 3PTRB 4PUWA 4CQ8A 4MZUA 2IC1A 4Y4YA 5FYIA 2OWWA 1UOBA 3BJSA 1R1A1 3CNYA 2GJXB 2ZRUA 1K9TA 4XAEA 2ZC8A 3N2CA 3QKEA 3LGGA 2VI0A 5GZFA 4MGSA 4QX4A 7XIMA 3BGJA 4IW3A 2CXGA 3H8AA 3ZOIA 3EWZA 1IPSA 1HQNA 3TSMA 4UTJA 1NOUA 4GUFA 3T2OA 3TAYA 4NHXA 3C5QA 3DFHA 4PMZA 4WVVA 2P5BA 3TZNA 3GZEA 2DZAA 5D2AA 5SV5A 4W93A 2E7QA 3T3YA 4MDOA 1XM3A 3MKVA 2E32A 1W1PA 1UY2A 4JTQA 1XYPA 4MGQA 1TWZA 2G3FA 4KGQA 4DZGA 4LH8A 4ADUA 4G3YC 1IXOA 3VNLA 5CH9A 4WVMA 2PURA 1L2QA 1D9EA 3TTQA 2IXJA 2E9LA 2EJ1A 4K38A 1TA3B 3FCPA 1FWRA 4FI9A 2BW8A 1GLHA 4C1WA 3SCVA 1MI3A 3P62A 3FOKA 1YQ2A 1S5WA 3TMLA 2R6QA 3WMSA 3PUAA 1J3PA 4NZJA 1ME9A 2J1VA 2DORA 1Y9MA 4BPZA 4W8LA 5I8SA 5LW9A 4HZ7A 2RMU2 3H1MA 3STEA 4G56A 5FEZA 3ARTA 2PQQA 4CU6A 2PLCA 4KBBA 4GX8A 1REEA 3A4XA 2DIKA 1L6YA 2R6OA 2Y7GA 3W75A 1VKFA 4J28A 3ILRA 5E1RA 4QE4A 1VAHA 3H4GA 3PB0A 4GQGA 1ODNA 3ARZA 3TKFA 2BRTA 2D3RA 1ASJ3 2HE5A 2GMEA 4AB4A 1MNSA 3LPFA 1E9ZB 2YYUA 4IEZA 4P9LA 3LAGA 5A6YA 3WP3A 4Z1BA 3N9LA 4L7ZA 1R082 2CERA 2ZZ3A 3KP0A 2Z00A 5GJNA 5LNSA 1M3UA 5F2GA 2WSKA 3QBQA 2JDNA 1JMUB 3UV9A 5DMLA 1EUAA 2QVNA 3S5NA 3EXRA 4LNVA 2FHBA 1OJXA 1NY72 3EJKA 1XIEA 3NQAA 4LS1A 4FCAA 3B0PA 3QM3A 1GVEA 4CNOA 5FZ8A 2ZHMA 3MZHA 4DMIA 3GHNA 2DDXA 5DAWA 2PAMA 2HMCA 1PV8A 3PZTA 4D6HA 4KIEA 2FFIA 2O9TA 4X3ZA 2FYMA 2PTDA 4IIDA 5FAJA 1KJLA 3F2BA 1WDWA 3DFTA 2OSYA 1D4VB 2VURA 2ZX2A 3I2KA 4HKLA 4EN9B 2X16A 3DFSA 4HMNA 5LWBA 3E02A 3BOWA 4HPXA 3UZWA 4YW2A 4BQXA 4A2SA 3VZYA 3FGCA 1XE0A 2WNZA 3DHDA 1J6PA 5HXVA 1QI2A 3BARA 5DLCA 5FWEA 1JYIA 4QHRA 4DO5A 1Q2SA 4S3FA 4IEUA 1DQ4A 9RUBA 5CZ0A 3NGJA 3NV3A 4YG3A 1UKQA 4AL9A 4GQRA 4ADSA 5I02A 2CZDA 3ZO9A 3UXAA 3HMCA 2A3LA 2VJXA 1H9WA 1EDQA 1KR0A 4J5NA 3R5EA 2FZDA 3BLFA 2BXYA 4A3UA 4FOVA 4CEUC 4FNQA 5JIUA 2Y0OA 3KQ4B 3GDLA 3EXUA 4M0NA 3AXKA 3H50A 1T2XA 4H41A 2EIBA 3NWRA 4KPLA 5DUVA 5K8SA 2J1AA 3NQBA 2PMWB 3MYXA 3H2CA 3WJSA 4FOWA 4ZS2A 1TMLA 1RXOB 2Y89A 3R8GA 1J1LA 1EJXC 3SFKA 2PELA 5A1AA 1B3OA 1GEHA 1OGSA 1P48A 2QZ2A 5BROA 3VIMA 2ZKMX 2J7DA 1GOHA 4F2UA 3VFCA 3L7RA 4UNLA 1GSLA 4NRQA 4AFYA 4GWNA 4PC8A 3QGVA 3W9ZA 5HV4A 4YVSA 1F15A 4N7UA 4KWLA 4LKFA 3H2OA 2CLIA 1UX7A 4IZGA 3WF0A 1ZRIA 5IK7A 5JVVA 1WBLA 3KOFA 4QSHA 3VBFB 3OVGA 4NZCA 3VBRB 1AR72 4Z92B 5LRRA 3ZMNA 2WS91 4JGDA 3A12A 2R0FA 1W6TA 5BNQA 4J7RA 5I91A 4J2MA 4TWTA 2OEMA 3RJ2X 3TSBA 3ZMOA 1IQDC 1EQCA 3WZ1A 3IACA 4LOCA 4HVXA 5DF0A 1UY0A 3TW7A 4FP3A 3R1ZA 3UNPA 5T26A 3GVVA 4Q7NA 4R8HA 1ZNPA 3LBOA 5K9YA 1Q5OA 8XIAA 4BZYA 5CB7A 1HGYA 3R8RA 2RJKA 3KCOA 1DOSA 2JKPA 1T40A 3INPA 3D5HA 4ZE4A 3DXIA 1N82A 3POFA 5C4WC 2XFRA 3AO0A 1N3OA 1YKWA 2YC0A 1GQLA 4CDQA 4AZZA 5FZHA 2QZRA 1BBT3 1SW0A 3FIGA 4WUIA 3DHPA 4GG9A 4D6QA 4HMZA 3MDPA 4P02B 4OUSA 3A9BA 2VMGA 2EF9A 3AMGA 4LAZA 3W22A 1B0IA 3FNDA 4BWOA 2D2JA 5T5JA 3MFAA 2CITA 4PMUA 3SCNA 5HINA 4WVXA 3W1RA 5FPZA 5A6SA 3F4DA 2X30A 3JBG1 3FJLA 4FLRA 1TWSA 2Z0IA 4QQUA 2GJNA 1F3WA 1JZ7A 2E8ZA 1YBQA 3JUGA 3I68A 1FWSA 4K8RB 1F7BA 4KWVA 3CHDA 4QXKA 2P3KA 1VD6A 3PZ9A 4DJEC 2CLEA 3MF6A 1VBRA 2P53A 4IFOA 5K4ZA 4ZS3A 3S0CA 1H11A 3PSWA 3SBFA 1V6NA 4RS5A 1QQP1 2PWFA 3IT8A 4XFFA 5ISLA 1DPMA 1SG3A 3AMCA 3WMLA 3TXZA 1RXFA 3TYBA 1GYLA 4LVAA 4BR1A 5AC5A 4F83A 2E40A 2VNRA 3VNKA 2BERA 2OO6A 4QPWA 2DQXA 4YFZA 4V2WA 2HTMA 1P7TB 4MOZA 1PIV2 3BODA 3T4WA 2EPHA 4XW3A 3PTQA 4PBOA 2I9UA 5HMDA 4NYUA 2NP0A 4OE7A 5G5IA 4GXWA 5CBJA 3FAWA 3W7OA 4JOMA 1PDZA 3BQ6A 4F0SA 2ZA9A 3IWPA 4HHMA 2XU2A 1KV5A 4URIA 3UZZA 3WDHA 2J8GA 2BUKA 1YTKA 2WRAA 4N9DA 1IGOA 4MWAA 5I3GA 1LG2A 4GRSA 5LEKA 4E2GA 1VPYA 5AVPA 4UF0B 1HKVA 5AC8A 4BKNA 4TTUA 4FQZA 2CGNA 1GZJA 3A0KA 2Y5EA 2XM1A 4PBGA 2EPLX 3B8SA 5CKSA 2ZZ2A 2IXHA 3U8GA 2BYVE 4YLWA 1DZRA 3OEAA 2XN0A 1OPMA 4A6OA 1D4M2 3MI3A 3O6AA 3THAA 3WK2A 1GVFA 3PZNA 4OHVA 5CPNA 2WSYA 2X2YA 3RAOA 4FOQA 4AC7C 3B8IA 1W6OA 3O9NA 4R9AA 3W88A 2D7FA 3WO8A 2JX9A 2Z27A 5FO9B 3NZPA 4C1XA 2FCUA 1F3EA 4TX8A 3M3CA 5DCDA 1YQ5A 4X8NA 1FBAA 3UCCA 4Z2AA 4XBLA 5IFTA 3L5MA 2VCBA 3WUGA 4JTGA 3SCUA 1XSKA 1RCQA 2IKGA 3OB8A 3I59B 1JXJA 1XPYA 4JTLA 1NQJA 4BI5A 1PIGA 2Q8XA 3WF4A 1V79A 1XSRA 1OCBA 1NOWA 1MXSA 3WINE 3UU0A 5F2IA 1DJQA 5LBCA 3AKPA 3QFWA 1V93A 3LIHA 1YIXA 2YLAA 4YXGA 3O0KA 2Y6FA 3VUOA 4MXWB 2ZE0A 3CJPA 1LL6A 1G6CA 3ZFGB 3QACA 2R1PA 1XRFA 2A3CA 4HD5A 3VGIA 3WELA 2WYFA 3K8KA 1JDFA 3PLQA 4CVWA 3E74A 4MV2A 2VTXJ 5EJ3A 4BU2A 2C9AA 1IKQA 1M7OA 1YADA 3EWDA 3UA3A 1JYNA 3TOYA 3RWNA 1M9HA 3EOLA 4O7XA 5L36A 2XN2A 1CIWA 3IB3A 2IVIB 3VKLA 3PBYA 2G9ZA 1G4TA 2B4KA 2J25A 1B9ZA 2A4AA 4CD5A 4NUWA 5A3UA 4ASMB 5D21A 2DU0A 2DIEA 1WGPA 2DIJA 4G9PA 2GC0A 5I0SA 3DG7A 4GQ0A 1BTCA 2DP3A 4LY8A 2ZHLA 3U4FA 2DH2A 4CD6A 1SO6A 2WLZA 3G1SA 4WZFA 1S0CA 1RD6A 1PM4A 3AYRA 3QKZA 3W82A 3WCSA 4IEXA 4PR4A 3PJQA 4TQTA 3P8IA 3MDWA 2E6AA 3H2MA 3NZ1A 5A94A 1YHTA 4A41A 4MLJA 1NE4A 3C3UA 1A4MA 3GZ3A 2D0GA 3S8HA 4B4FA 1QIQA 2EO7A 1Y9QA 4PMVA 1MS9A 1Z7S3 1KM2A 4DJFD 3T4CA 2Y88A 3GXUA 1QJWA 1W3VA 3OLGA 1YDYA 3GNEA 1J83A 4ZO8A 4IGPA 7REQA 5IWFA 2YCKX 4QU2A 4S2HA 1VYPX 1KFXL 1PNGA 1G1YA 3BN6A 1J4EA 3MUAA 4AD5A 2GOKA 4M19A 1UMZA 2WVUA 2YZ5A 3T42A 4YW3A 1J1TA 4BEQA 1XH1A 1CJDA 4U4MA 3KVBA 3BG9A 3OUIA 4YMZA 1P0EA 1K45A 4AEDA 4YPJA 1WKYA 1VFOA 1O5QA 4O54A 3TAKA 4PTVA 2RGMA 4ES8A 5GVJA 7ENLA 2YFNA 1D3HA 3M3EA 4XVDA 3ABXA 3OD0A 2IMRA 2V5JA 2AUYA 3WK1A 3ZSKA 4DF1A 4RPPA 1MEC2 2O55A 4OULA 1A8DA 1QTWA 5LB6A 3I97A 1GWMA 3P60A 3T2QA 2CDOA 1XDMA 1DTNA 3O63A 2J7GA 1PMHX 1E1FA 4GY0A 3C56A 5GJMA 3DUIA 4HCDA 3RGTA 4NOTA 3KL3A 2Q3RA 2O9OA 3MKCA 2HVNA 4ZQMA 4J3TA 1VHNA 3ZWSA 1KM1A 4XHXA 4L4MA 1C28A 1QOPA 2DFAA 2WMGA 3C8NA 1ND3C 5F4XA 1KRAC 3O6CA 5DXYA 1HL2A 2BWAA 1DJWA 2BP1A 2ZZ6A 4C6BA 1V9U1 4AD4A 1YTEA 2GLKA 2VHLA 5HUOA 4R34A 2ZXBA 2KD7A 1EGZA 2XIBA 3LK6A 2NQYA 4NMIA 1IGWA 2WW5A 1VS1A 3DFQA 3DPRA 1WCGA 4HA4A 3GE7A 1Y5WA 1DWHM 3SC7X 3N25A 3ZT7A 1SZFA 1OX6A 1BEV2 1EJRC 1R9ZA 2HNEA 2XWBB 4D8ZA 4I7WA 3NQFA 3I65A 1WW5A 1K5MA 4HSHA 1TE6A 4GB31 3OYWB 1UPPA 4KESA 1JDDA 5DFAA 5EU9A 1QJY1 2WMHA 2RDUA 4AWSA 1GVOA 4XFGA 1POQA 5XINA 3KE0A 4H00A 1XBFA 3RRDA 4C1NB 5IVFA 5T3NA 3JCIA 4LUYA 1XYCA 1S55A 3M70A 3XIMA 2G1MA 2H6CA 1QOQA 1C7SA 3DEQA 3AJ7A 1KQZA 3IGUA 3TWAA 3ZSTA 4IFKB 4NT0A 2UY9A 4FNSA 3O0FA 1VCVA 2NSOA 2RMU3 2BVVA 3RCYA 2QQNA 1AR62 1BXHA 3SM0A 4IPJA 4JD4A 3CB8A 3CLWA 2Y6KA 1VCGA 1EIBA 5I7GA 4WSKA 3GWQA 3AIBA 3ORWA 5A3HA 2F2HA 5FJOA 4B9ZA 3AMHA 2G95A 4Q8LA 1DE6A 4AH7A 4GI4A 4D7TA 2WIIB 3AP4A 1J79A 3QYSA 1WDSA 5K9CA 1R083 4ZCWA 2FVMA 3NO3A 2OA2A 4REQA 3WG1A 1OBAA 2PB1A 2DVFA 2HQAA 4L8QA 3VAVA 4A45A 3T2PA 3P3NA 4DNYA 1QAPA 4AR2A 3AQUA 2VFFA 2CLMA 1DYSA 2RE9A 1Y0EA 4LCSA 5FCCA 1X7IA 1KQYA 4LO5B 4PCNA 3ZFFA 3AFKA 5CISA 4ADTA 2VRQA 3BL3A 4HVOA 3LHYA 4BS0A 3BI3A 1NX9A 3GZTB 2AC1A 5FO7B 3UETA 1UWUA 3QV8A 3PUDA 1IEIA 3FS2A 3QLQA 2FQPA 1H1AA 3N3MA 1EUTA 2I16A 1ZP4A 5A6AA 1HLCA 2O8OA 1E55A 1VEPA 2X0HA 5E5CA 2UYBA 5CKNA 1I0BA 4PCTA 2VECA 5FP9A 4HU3A 3WQ1A 4XBQA 1DHKA 3SRHA 1N3PA 2R1MA 1BHGA 3BO9A 1OINA 4DVOA 1CEOA 2Y6HA 1M7PA 4B8EA 4ROPA 4LBJA 2HWB2 1QY4A 4B3KA 1TJRA 1IEWA 4JAAA 1FI2A 1H2MA 1O5KA 4IUOA 4ACZB 3HN3A 1DXFA 4WVZA 3ZYFA 3CUFA 4L9YA 4QB1A 3GBDA 5EB8A 1TELA 1ALDA 2E31A 4E2OA 3IJ8A 4FOYA 4LB3A 1QT1A 4WM7A 1K6WA 5KZ6A 2FGBA 3WF2A 2ABAA 3MO7A 3L23A 4BJ0A 4CQ9A 2PBOA 4GINA 4J9JA 4PA8A 4MKSA 2D0HA 2WJFA 3TV8A 3L4XA 5B7ZA 4AX7A 2ZCGA 5J7MA 3F5JA 1BJQA 1HB4A 1V6UA 3WH5A 4TTGA 1RUH1 3CL1A 2DUXA 4QIUA 3QGAC 2W47A 3UKTA 3RI9A 3WLQA 5LZLA 4E2VA 2ET7A 1RQEA 1H7RA 1TV5A 1UR4A 3OLDA 4ATFA 1NAL1 2Q0AA 3WEMA 3ZKUA 4PIZA 1JZ3A 4WBBA 1NWUA 2PP0A 4JKKA 3W53A 3VKBA 1V51A 1IT8A 1PGSA 1EJTC 4LR4A 2VR5A 4Q4V2 3TTYA 1E5NA 3CPGA 4MMWA 3M1HA 2ZX0A 1S5MA 1B5TA 1O1HA 1V6KA 4DBSA 2OT0A 2Q8LA 3I4IA 2W68A 3EKLA 4NR1A 2AL2A 4AQLA 4E9KA 2YCLA 2IQDA 3VPLA 4B1MA 1KKRA 1AR73 2YYOA 3P6BA 4QXHA 3WMCA 5A7WB 5FY1A 1GEQA 2WNUC 5C9WA 1MZRA 1V6WA 5KWRA 3RX2A 2XJSA 2PYTA 2Y26A 1Z78A 1G5AA 4R85A 4AG4A 3VBFC 3UZ5A 4Q4W2 1MQTB 1CLXA 2E5CA 1DJYA 4UMBA 4A05A 4F2BA 3AXXA 5H8UA 5JDBA 2OU4A 3NPVA 3I7QA 1W1B1 4Z1VA 1H9PA 1MSSA 1XIGA 1GTHA 3OQ8A 1W2NA 3CLPA 4QM9A 2RKXA 3VO0A 1A49A 4XAZA 2CHNA 1JI2A 2XIOA 1W1IE 2AAMA 3HGRA 3LEIA 3ITTA 3H42B 4GYKA 2XGBA 4JEQA 3VABA 1YXYA 3GG0A 1Q6EA 4S38A 1SQ4A 3C7GA 4RSUA 1J12A 4WHBA 5BXSA 1R6WA 3LDVA 3B7MA 4U36A 1DQXA 5DMMA 1SLAA 4IOTA 1LNSA 2YR1A 1Q8SA 3WG2A 4R9XA 3NQCA 3QGKC 3URAA 4RPQA 1ZA4A 3TQVA 1XBYA 1RIRA 4IF2A 1JN2P 3RNSA 4CVUA 3SEEA 3VNMA 1LBFA 2X40A 4XJUA 2INEA 4TIMA 5FIPA 1YCIA 1PZ9A 4QCEA 1Q13A 4B5NA 5EL1A 4A35A 1WP6A 4DJDA 4IT1A 3I3MA 4JL2A 2QUTA 2ADDA 3ES1A 4NUBA 1X33A 1KR1A 2D2GA 1E0UA 2I1OA 2PDFA 1GFF2 4AIUA 3L4YA 1VRH2 2UY4A 3M2MA 3Q2DA 4O1EA 1A6CA 1AR91 2ZX4A 5GLUA 2F8QA 2HWC2 2ZAAA 5HJXA 1GZ1A 3W1LA 3ACIA 4ZU4A 2WHLA 5FZ6A 4J40A 5G1TA 4GE8A 4E27A 1B3XA 4KGJA 3WMBA 1RUF1 3QN3A 2YW3A 3B06A 4LBRA 2IUZA 1PIV3 4C6DA 1OKOA 3MIBA 4F0RA 2A3HA 3RM8A 3O1SA 1DGRN 1UYPA 3T07A 1OZMA 4MG2A 2GOUA 1X97A 1TVNA 1H1ZA 5AC92 4MG4A 1ADDA 1UB3A 2HYXA 2POTA 3MHUA 3M41A 4RL7A 1SSGA 1Y7VA 4FSAA 1REQA 2QCDB 3V36A 4IPLA 1M41A 2R49A 4JCLA 4YW7A 3FJ4A 3PNUA 4Q4Y2 2HWGA 2TRSA 3VBUA 2XVNA 4JHOA 2XJRA 5DAVA 3BAIA 3QTGA 4I7VA 4Q0VA 1BYCA 3QXBA 3CU7A 3FFZA 2VTXA 1UJQA 5I06A 1V3MA 4GVIA 3GDRA 3QYQA 2PS2A 1UAIA 4HNOA 2OZJA 1CAWB 4M0HA 3U14A 3C0JA 1D4M3 5B80A 3S1XA 1SHWB 4BA6A 3ZX7A 4OFCA 2R061 4LFYA 1C9WA 1Q2RA 3WDTA 4FVVA 2EG7A 3PG8A 1A3HA 1R64A 1ZU8A 2B46X 1W8ZA 5A2AA 1K12A 2PTXA 5I3JA 3W81A 2DFBA 3UY8A 3CJIA 1ZRDA 1DEDA 1NYWA 2XPKA 4RD7A 3ZR6A 2O9PA 5XIMA 1RZMA 1AH3A 4H9XA 1RALA 3W23A 2AMXA 3VNIA 4D1IA 4HOWA 2AR6A 3SUSA 1MRQA 3NJZA 3GHUA 5FYZA 2Y63A 3KCXA 3J8F2 4M6QA 5C9ZA 3KS6A 3GB6A 1XJBA 4B3LA 4CEYC 3OTRA 4HK7A 4NU7A 2DBNA 4B3NA 5D37A 3GNRA 4Y1VA 3A5VA 1SJDA 2H3BA 4UTHA 1BLZA 1DWJM 3LA7A 4GY1A 4LHKA 2VX4A 2GP3A 1BWKA 4S1FA 2DSUA 4J25A 3AS2A 2Z26A 1EBHA 4LUIA 5DXXA 4P08A 4HVQA 5LRSA 4AD2A 1PBGA 3FJ6A 4D9PA 3ZYJB 3BAJA 4J27A 4PGLA 4PI0A 5BW6A 4C6OA 3ITQA 3K75B 1PXGA 4AYSA 3R4SA 5IYYA 4Q0SA 4L99A 1OHLA 3S1WA 1UIOA 3RCMA 4W50A 5FA5A 3QQWA 2QZ3A 3QR3A 3USUA 2VPVA 2GGHA 2VQAA 3R94A 1IWAA 4GXMA 4BQ4A 1Q7ZA 1QNQA 3HG2A 4TOQA 2YZRA 1XLGA 2VEKA 5FZOA 1VJSA 2HJPA 2I5IA 1KM0A 3BSHA 4GYFA 3W87A 1ADSA 4LLOA 4NAOA 1GZGA 1PZ0A 4Q3MA 2JECA 2DF7A 5JZGA 2FZMA 1UU6A 1PX4A 1VBGA 2QNEA 4A44A 1W28A 1ZS2A 3VBSA 3SCQA 3ACFA 3VN4A 1H4PA 3H3LA 2QIWA 2XLAA 4WCJA 5DUUA 2J8FA 2J9YA 4XURA 5EV7A 1QU0A 3W76A 3ARXA 1IQAA 1X7NA 1CGXA 2XB6C 1I2NA 2YUEA 1RLCL 3L2MA 2DV0A 1XNDA 1GQKA 4PUEA 1YXCA 1R0MA 2GNBA 3O2LA 5A7QA 3UGRA 1WZAA 3F2DA 1V03A 5LXXA 2V6AA 1IG0A 1GQHA 4NVTA 4PF5A 1UMHA 5LBFA 3IJ6A 2R30A 1GGOA 4BMBA 3G77A 3ZSSA 2Y6JA 2HWD1 4XF1A 1PIFA 3WDRA 1MNZA 2VWSA 4ZZ9A 3P5BA 4CCLA 5LSMA 4UQCA 4YVSB 1DJHA 4NASA 1W04A 4Z1CA 4V33A 4ASKA 4MKVA 2R14A 2E8YA 1VCFA 3BCJA 3JD72 1GOWA 1K1DA 4C6KA 4RN5A 2QDNA 4IIFA 2WQDA 4M80A 1H60A 1FWBC 2GH8A 3URQA 5H8MA 4CU9A 3BALA 2A5ZA 3RF9A 3TZFA 2J78A 5F2SA 1POKA 3WIJA 4W8BA 4YM2A 3CS2A 1MEC3 2CFFA 2YA1A 1GANA 2G19A 4M00A 2AAAA 5CGTA 3MZNA 5CQ1A 1VF8A 3IGXA 4YWIA 3H2AA 1LOFC 2D24A 3KL0A 4AFDA 4DUOA 2KXLA 1CX9A 4CPBA 5LIWX 4ONUA 4XYXA 2BBFA 1DLCA 4QG9A 1VRDA 1RMU2 2CYGA 3L68A 3PTDA 3VGFA 1K9EA 4C0HA 3MZ2A 2VO5A 1PMJX 4NHLA 4Q1RA 1XWYA 5C9AB 5DBUA 4BMEA 2DSVA 1HVXA 5JPMB 2J74A 3PIJA 3NG3A 3P74A 3MPBA 1QPOA 3K77A 1H2JA 4GIAA 1OG6A 3PMSA 4C5YA 3HNBM 3P1IA 4E4DX 1Q45A 3S2MA 1BLIA 5A70A 3IJQA 5IJRA 3DGBA 3E2VA 1EOKA 1M4WA 5D2VA 3UGGA 2YXOA 5FL0A 3MHZA 4OECA 5CZJA 3LXAA 3WR0A 1TMF2 2BGCA 3TONA 4ATLA 1YJLA 3MPGA 4RGKA 5FZ1A 1OURA 2ATSA 1BEV3 2W62A 4FZIA 3E97A 5FY5A 3AU2A 3K4AA 2GK1A 3COTA 1SFTA 1NA1C 5DRCA 1LT7A 1FWNA 1ODZA 2A0NA 3CHFA 2PDHA 1OGGA 3POWA 2ZOXA 3ZIZA 5BWAA 3W0KA 2FTPA 2Y33A 3Q65A 3SJ3A 2JDUA 1MO0A 4WSHA 3THCA 2FDKA 4WKHA 2XH2A 4AF0A 4RS5B 2BHYA 2VZSA 2PWDA 4AHPA 2WT0A 3CH9A 2RV9A 2QT3A 4IV1B 5EYXA 2P50A 1G9FA 2VU9A 3T0BA 2NSXA 4EAMA 4GIRA 5DDJ1 3ZJ6A 1U1UA 1W3TA 5BY5A 4PTMA 1XYLA 1AR63 1WUEA 3WDWA 4YG0A 3PBMA 4YVWA 2YV8A 4Z17A 3K2GA 3UYIA 1K7EA 2B0MA 1XH0A 3ZJKA 1VBC1 4CU8A 1F3XA 1SM9A 4GGBA 1QDOA 1VALA 2WKGA 4YM0A 3FSTA 1OADA 3EYPA 1TME2 5JI7A 5CZSA 2QDHA 3OA5A 4DRSA 2JFEX 2AGSA 2O0OA 4PULA 5LK7B 4UTKA 3ZZ1A 5TD4A 5I00A 1EV12 1E43A 3W7IA 1ULFA 2RS12 3MUY1 1GR3A 2C16A 2WWCA 2WC7A 4PLNA 3K4WA 1TWDA 1O3SA 1DE5A 1GPWA 2TMDA 4GVGA 3LHTA 4LBQD 3E96A 3FMGA 1ZX5A 1P1MA 1NCRC 1V4YA 4GGHA 3STFA 1KFJA 2O1QA 1VIWB 1RD5A 3AS3A 1CX4A 1LLWA 3KRZA 4LKEA 4BCUA 3Q45A 4PB3A 5IVBA 1GKRA 3H6OA 1GICA 2ZGKA 3DGTA 2X1UA 3N12A 3HQXA 1GJWA 2OZ3A 2A1YA 1TX0A 2XLGA 2GMMA 4YGEA 3K8MA 2LALA 4A42A 1W9DM 3EWCA 2P1FA 4AMAA 3NNJA 2X29A 5M17A 1W9FA 2OVLA 4HNVA 3T40A 3KZ4C 5C2CA 4AEMA 3R43A 3PPGA 3KHDA 2JDAA 2ZX1A 3FX3A 2W9XA 2HWB3 5HATA 2EKGA 2G4IA 2Z25A 1GW9A 4D6GA 3U07A 3PTYA 1S1AA 3PFMA 1FWHC 1NZIA 4AHZA 1NWRA 2WABA 5KHGA 4KH2A 3MC5A 3EPOA 1YUDA 1JQVA 4KWWA 1TG7A 3HGSA 4AHWA 4JL1A 3UR2A 4K7YA 5I3IA 4W65A 1S5TA 1RC6A 4GPNA 4BXSV 2ET1A 2G50A 1UH2A 3IPVA 4D7YA 3EAUA 3WD3A 3WG3A 3CWOX 4IFRA 3DOPA 1NDVA 3B0XA 4I01A 1H6YA 5FJPA 4UTTA 1MW3A 1UU4A 4ZONA 4B5TA 5CFDA 3RYKA 4J2PA 4LRTA 4OUMA 2GWNA 4O57A 5EPDA 3GNNA 2ZZQA 4A29A 1GYMA 2D6OX 1LOSA 4ZOCA 3OJBA 3MP5A 3TP4A 1JPHA 3VXGA 1XOYA 3BW2A 3T44A 3PJUA 4GUIA 3UWEA 4JTIA 2AH2A 3W1QA 3C8XA 1LJ7A 4Q4V3 4K8GA 1PMIA 4BA0A 1W9VA 1Q8JA 3FBMA 3BW3A 4N4PA 1LT8A 4TXWA 4X9YA 2XHKA 2JG9A 2Q1ZB 1C7TA 3HO8A 5FXVA 3M9YA 4LV4A 2RJ2A 1AHSA 1CB7B 5E70A 1SACA 2Q8DA 2EIDA 4WV8A 1FP9A 2MPFA 3V0SA 2I9EA 3RLGA 3POSA 3ME3A 1FMD2 4P9WA 1O8PA 1JU3A 4FPLA 5B4NA 1EYBA 3FJSA 3WT3A 1ZFJA 4O1FA 1QWKA 4S3DA 1HJSA 2GYIA 3UZYA 4IGQA 4Q4W3 3PR2A 1S0IA 3VOHA 4KWJA 2CGOA 3VDDA 4JQRA 1Q3EA 5F4WA 2CLPA 4QKNA 3G1DA 1UROA 4RW5A 3ILNA 3ZN4A 4ZTYA 1N7KA 4K36A 2BB0A 4P9IA 3AHZA 1W2VA 5FMOS 2OT1A 1EGMA 4PFMA 1EOMA 3TN6A 3ARQA 1MQTC 1RBAA 2RS52 1VFMA 2VXJA 4LT9A 3QPZA 5A2BA 3UPMA 4US5A 2BTVC 3CUJA 1JS9A 4UFKA 1JFHA 1CXKA 1NJJA 4O9EA 4CEXC 2WA3A 4YFWA 5HK4A 5HWMA 3SN1A 3U2OA 5FZ0A 4UC5A 3QJAA 3CMJA 1DQ6A 1O5RA 1RUE1 2W91A 2YFUA 3URNA 2QXWA 2GVEA 1A50A 4DINB 4L1WA 1KXGA 1E6ZA 2OXBA 3Q9OA 1EX1A 4KFNA 1GK8A 3DL3A 3K5XA 1NUKA 2W87A 2V38A 5MKGA 4HHPA 4QJ4B 2EHHA 3CHCA 2L9LA 4P9GA 1B30A 4L80A 3LMYA 1E71M 2VDHA 3V16A 2W4XA 2DJLA 2OTDA 5EP9A 4JGZA 3SRDA 4P7LA 1B4EA 2VKZG 5A69A 2BSLA 3MV01 3W85A 3MV11 4BQYA 4D6RA 3V3WA 2CEQA 4M3CF 2EAKA 3A5FA 1VRH3 2VUYA 3NNMA 4MNLA 3RRXA 3BMWA 4GXLA 4CDUB 2P88A 4O1AA 2ZRVA 4Z0SA 3PJYA 2HWC3 2E28A 1OQ1A 4Q4QA 1DJXA 2JG8A 2ZZJA 1SO4A 1QW9A 4MY8A 2F61A 3TAOA 2FDMA 4X0VA 1W2AX 4DXTA 1WCDJ 2R91A 6REQA 2GN7A 4P14A 4IX2A 4QQLA 1N8WA 4YGDA 5FUIA 2JDPA 5A32A 4AVOA 1RUG1 1UC4A 2XBO2 3NTYA 1JI1A 1NM9A 5AC93 1H1NA 3GNOA 1F4HA 1KB3A 4IJCA 3W1TA 1U5JA 1SMVA 2GNMA 3O7OA 5H9RA 3DDMA 3Q94A 4CP9A 4L9XA 4AEJA 3M47A 3UR5A 3HGJA 3IVUA 4Q4Y3 1XP3A 3V0BB 1O5UA 1T7LA 1IR2A 1VJIA 4AI8A 2QVSB 3Q8FA 4OV9A 4DXRA 1P0DA 3GXDA 2VEIA 4RZBA 5JH1A 3KLLA 1JOBA 3DYMA 2OIIA 4S2FA 5FTTC 5LGXA 4PTXA 5J37A 1DQ2A 2E7FA 4NX0A 1V3IA 3PB2A 3PPFA 4JTDA 1UHVA 4GFIA 1NH6A 3TJXA 1QASA 3SXWA 1N47A 2QJHA 4NIGA 2VMHA 2BEOA 1VBD1 1H6XA 1SO5A 3PWAA 4QWNA 3T30A 3TNPB 1C4RA 5M0TA 2HCVA 2NZ9A 2VEMA 3L2LA 3TQ0A 5A3WA 4M51A 1OX5A 1V08A 2J7EA 3UJ2A 4FAMA 2WNNA 3P0WA 1NF0A 2NQ9A 2C14A 4AK3A 2WHJA 3AX4A 1DYPA 1FOD1 4Z2GA 2E3ZA 1UXXX 5IVYA 1VBJA 4Q4OA 2NVDA 1X38A 4NX5A 4Y4RA 3GTNA 5E1QA 3SJNA 1V7AA 3RZHA 1VP6A 3M43A 4B5SA 4GQ7A 3VBHA 5M2FX 3WG6A 1YXWA 3WSUA 2VEFA 4EJRA 4LPCA 3TW6A 3WYZA 1HTIA 3N1AA 1O12A 4REQB 1VENA 3ZT6A 1CTNA 3W01A 2FZ1A 1CI1A 4DM2A 5A95A 3W2MA 2R042 2ZGNA 5HQLA 3F4VA 3DBNA 4R33A 3J8F3 1RUNA 1JYVA 5CJ5A 1WXJA 3CWHA 3C52A 4L64A 4CCEA 3LDBA 1T6BX 3LCWA 3UKNA 4MX3A 4Q4X1 2NV2A 4A3RA 5HPOA 5HCHA 1J84A 2PLV2 4YW4A 1QNVA 4G4FA 2XM2A 2BOGX 2TEPA 4FAHA 3G8RA 3VKAA 4AZGA 1R7AA 3WSOA 1UC5A 3PUOA 1YWKA 5ANQA 1WA3A 5FJHA 2YKKA 5IDZA 4Q4SA 1IXNA 1PTGA 3FUQA 2EQDA 1DHKB 2WC3A 1F61A 2TAAA 4O28A 5JMCA 4ROQA 5I0RA 2OXNA 5CZTA 4QTGA 4H9MA 3KLKA 2DBIA 3NNTA 3NAPA 1N1TA 5BNOA 1JULA 3DFOA 1S0BA 1W5OA 1G67A 1JU4A 2IZWA 3HIJA 4UW6A 2ZCWA 4OBRA 4GOAA 5FJUA 5E0FA 4HG6B 1TPWA 3AU6A 5FMDA 2OQYA 5KC6A 4XZLX 1R46A 1ZRQA 4K8EA 1ZJHA 1VP5A 1XLIA 1ITXA 1MDLA 2OYKA 4WOQA 1GNXA 2JWPA 3P8JA 4AAJA 4HU4A 2C4XA 1ITUA 3OBKA 5A3NA 1W6QA 4OI2A 4YZ4A 1VBE1 2Q5TA 2QUMA 4HJWA 1KFCA 2ZX7A 3VZNA 4PUUA 2JB8A 3QEZA 2OVUA 2Z7GA 5FPAA 3LI1A 2X1IA 4KFPA 2D6NA 2XUCA 1KBJA 1XIDA 4JZRA 4ZXLA 4XUPA 1G69A 2XVGA 3POBA 1O6IA 3SFWA 4J1OA 4DN1A 5CAHA 2I74A 4H9TA 1QPQA 4QDSA 3HM7A 4NJHA 2R32A 4UQ9A 4O17A 5T5OA 4QE1A 5JVLA 2QKDA 3BG3A 3AZYA 1JIBA 5CPMA 3E38A 4BHYA 4XIOA 2OFJA 4KEUA 1X36A 3JD73 3U7BA 1B31A 2Y61A 4AUBA 3DI1A 2YB4A 3NXFA 2P37A 5C8BB 1AL8A 2PI6A 2AEZA 4YVSC 2V2DA 2IPWA 2I5QA 1MVQA 5FYMA 1MUCA 1FX6A 4AFAA 3WP6A 2O9RA 1KGYA 1JF6A 4NNCA 2ZUMA 4WEVX 2XVKA 4GMP3 1CZTA 1QBAA 5FLHA 1QR7A 1FH7A 3RLUA 1Z8AA 3N15A 1OA4A 2DSZA 2R24A 1XF0A 1LESA 1XRUA 2O8QA 4XEZA 2Z1SA 2PU1A 1E0TA 1XCFA 2RM22 3CUZA 2WVSA 2XUMA 1RMU3 4URTA 2XHNA 4LC6A 1O59A 1HKWA 3MLLA 2XSXA 3MTWA 1RUOA 4C7FA 1VYRA 2C1FA 3LIGA 1A0EA 4NAFB 3UWWA 1VFSA 3T0AA 1D3GA 3GXPA 3AMDA 1R2RA 3W2UA 1GP6A 3L12A 5AYZA 3MIFA 4ZE5A 4JFSA 4RFT0 4PRTA 2BNOA 4I90A 1AG1O 2DZSA 1KTCA 3LLFA 1TMF3 4CDQC 4DJEA 2LLEA 3BLEA 1BZWA 1J18A 5CG7A 2XJQA 3S9ZA 1JEZA 3EB4A 1WLCA 1OPOA 2WR9A 1W3XA 1HT6A 1ND2A 1IKPA 5BNNA 3BZGA 2MHFA 2J79A 5FMBA 1CECA 1BWVA 1J96A 2OQLA 3RCNA 3B3QE 1QI4A 1CCWB 3K8LA 1UD6A 1J5SA 1ALYA 1Q6CA 1TPDA 5JH2A 2RDTA 3LMZA 3WH9A 3O1PA 4GNVA 1UY3A 4AG0A 2WFPA 4YG6A 2FPVA 4MYXA 3WP5A 2XDFA 1W1VA 1XU1A 4PI2A 1GOKA 1PNFA 4FPEA 1LYXA 3KS7A 5D09A 1OC5A 1SLBA 4PMXA 3UWZA 1OXCA 2C24A 1RQBA 1IZKA 5F9TA 3KTSA 1KRCC 4RS5C 3EBRA 3UY7A 2VUNA 3LSEA 2JE9A 1CBGA 4G6CA 2WHMA 2XG3A 3TWIA 2ZQ0A 4X22A 3VIKA 3T1GA 3SECA 2V9DA 3T7VA 2O7QA 1TSIA 2YDQA 4ZXOA 3UNDA 3JUUA 3SISA 4RA0A 2W5FA 1TME3 1SLTA 4XZUG 1K77A 2XHYA 3BK0A 4MF4A 4CD7A 2DUQA 4AFCA 2WN2A 1TPB1 3TJ4A 2BHUA 1X1NA 1XDLA 3IGSA 2YC2A 1JR1A 5FMCA 4NJKA 1EV13 2HROA 3WUBA 3OBEA 4E0CA 2YBUA 1REQB 1QJX1 2GFTA 3F2CA 2RS13 2YFOA 2QS8A 2ZYFA 3U2CA 2DT2A 1QJU2 5JXIA 2C1IA 4PZVA 3N4MA 4DEQA 2DFCA 3RGBA 1F2JA 4C6EA 4DX3A 1VGAA 4JDNA 2YPJA 2ZTKA 3FFSA 4MWAE 5I03A 3OGVA 1WDRA 4PIYA 4D3WA 4M56A 5HCFA 5CPLA 3CEUA 1RJRA 2GGEA 3GXTA 1XFBA 2HE8A 4CXXA 1FWAC 1Z3NA 1W8TA 4R9DA 1R3YA 2HJIA 5F5AA 3I7SA 4E4PA 3W1UA 3PZMA 3HPFA 5EMMA 4XD5A 4XK2A 2OKTA 2RS31 2Q71A 5JPNB 5E9AA 3M6YA 1G94A 1DV7A 4GKYA 4H4IA 3SO7A 3AWOA 2A3WA 3LHUA 4E8CA 2QGHA 4DWSD 3F5KA 4AZIA 3CJIB 5FJTA 4MZ1A 3KT4A 2Q4SA 1K9FA 5FACA 3VD3A 1SU5A 2E6FA 3IJLA 4L4LA 1TREA 4W85A 2QPUA 3P3BA 5BNKA 1V3LA 3AJYA 3E5UA 3I2OA 2CAVA 2BNJA 1JUHA 1TWIA 2FFCA 3UP8A 2B9UA 1M7XA 3MI6A 4UQBA 2VFIA 3GFYA 1QJFA 4AD3A 1TUFA 2G41A 1QXRA