4BQBA

Crystal structure of the fn5 and fn6 domains of neo1, form 2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
195
Chain Sequence
PMMPPVGVQASILSHDTIRITWADNSLPTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 195
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqbA02
3HC4L 1H3PL 4R2GB 5E6IA 3GHBH 1S78C 2BSSA 2VWEC 4Q58C 3BIKA 3DVFA 4U4BA 5EOCJ 3GIVA 1MF2H 1G0XA 4OGXH 4UTAL 2FX9H 1JYXA 1DP0A 5IK3A 1RUML 3VDAA 2X4PA 4FQJL 4Z0BL 2HFEB 5GRVK 2VZVA 4WEBH 5J89A 1IILE 3GFUA 1RQ5A 5JIKA 4ZAKB 1OPGH 4J1UB 3AREA 1JWUA 3BQUA 3T4YB 4XGZB 1UG9A 4MB5A 3EIFA 5DEFB 4BKLB 4XWGH 2GAZB 3QJFB 3WFCL 1TVBA 1KPVB 2D7NA 4RCAA 1E28A 3RUGB 3SN6N 3QIWC 4JLRB 2E7BA 2QHLA 5D7LE 4MS8D 4XXCA 5I1HL 2JB5H 3BKCH 1A6TA 5T1MB 1VPOH 1DBKH 1T5XB 1EMTL 2NQCA 2EDEA 1P7QA 4F8QA 3VWKC 4NC0B 4LLWB 5GJTL 1I1YA 4MNQB 3OR7B 1KTDB 5FUZL 5I16A 1UH4A 4GSDL 1DUZB 3RPIB 3FN9A 4N9GB 3WXVL 4Q9QH 4GRLB 4Y4HB 5BV7L 1UJ3B 1LD9A 4KKAC 1CE6A 2LABA 4MQSB 2CK0L 3LS4L 3WHE0 4O2CA 1CGWA 1BVLA 3EO1A 3Q1SL 3QWQB 4Y2OA 2ZCKL 3QXAA 2DL2A 4Q6IA 3NTCL 5MEQB 4PJHF 1RMFH 1NQBA 2R0KL 1N8ZB 3GSWA 3PHOA 4U7SA 5H2BB 5JIHA 1YN7A 3JTSA 4IOFD 2IANE 4HCRL 3IDGA 4YC2B 4FFWC 4FXLA 4FZ8H 2LFGA 1OAZH 3QQ4B 5SWSE 2R39A 3DUSA 4Z77B 4R26L 3LKOB 3D9AL 4ELMB 1GJIA 1X5HA 2NLJA 5JXAL 2YSSA 1D9KD 2P43B 5IESH 3TBYA 3O2WH 4LAQL 5ANMA 3T8XA 3DTXA 5DD1L 3SKUD 4YQXH 4QRRE 5MI0B 5I2IB 5HGAA 4JZJA 2AJYL 3UZEA 1FSKC 2BOBA 4HZLA 5EC2A 3ULVF 1TNMA 5LGKA 4R97B 5T3ZE 4OLYH 2DLFH 3DO7B 1XH3A 1Y18A 3U6RA 3CFJA 4JRYB 3TBWB 2EDWA 1VERA 3QRFM 3QEUA 4A6YB 2GY7B 3D85B 3QDGD 3MV9E 3GGWA 2F5BH 3RWIA 3QHFH 4L8DB 1E4WH 5IB4B 3X3FH 4D9QD 3MOAH 3F12A 5FK9B 1GOHA 2VDKL 5K9JH 2YPLA 5ID0A 2MQ3A 4P2OC 3SGDH 3HPLB 1CR9L 4F9LC 1FO0L 2AXJA 3QWOA 5EULV 1BJ8A 3GSOB 3KG5A 4JY6B 2X4RB 4HXBL 5HD8C 4DKFH 5I30L 4WI3A 2ZPKL 4K55A 3IU3B 2XWBB 4O51B 3VXMD 1MCWW 3GDBA 4NZTL 5BS0E 3TYGL 5DLMH 1YUHB 1FNSH 4DOHB 3O6KL 3EOBB 3OPZH 3PDOB 5L8JB 3L3HB 4E41B 3OAUH 2FHBA 4ZSOB 5CSZA 1NGYB 1U8IB 3MA7A 4JM2D 5B4MC 1X4YA 3N9GH 2EDTA 4TNVF 1UENA 3TNNB 1UQSA 2EH7H 1EHXA 3DGGA 1FNGA 3G6AB 4KPHL 1FAIL 4ZS7H 2MMXA 1T80A 5EN2A 4AY0A 4MCYB 1RHHA 3RWJA 1NEZG 3OKDA 5BO1H 1I3VA 2X4NA 2CDGB 4JB9H 4KKLC 2G60H 4HH8A 4I3SL 3VFUB 4XCFL 4Z7UF 2H26A 1B4JH 2R2BA 2NY3B 3OX8A 3DMMA 3SE3C 4PRHA 3G5XB 3K46A 3ES6B 3UTQB 4XHQA 3PQYA 4RBPK 5IFAH 2NYYC 5ESAB 5KVGL 4EDXB 3RDTD 3CFEA 2YUXA 3D39A 3TWCL 1G9MC 2H8PB 4F7CB 3EFFB 4QTIH 5D5MF 1LP9E 4ONOA 3IJHA 1WBYB 3JVGC 1FNFA 1FL5B 4XNMA 3B9KA 4P4RA 1W72L 4PTUB 2BHUA 2R15A 5MEPB 2J5LC 1OP3K 3CSYA 3DV6A 3U0TA 3P40A 1XIWD 3LKSB 4M9PA 5GS0H 3TJHC 3SPVA 4OFIA 4NO5A 1FVEA 5D1XC 1KCVH 1PG7X 2AJSL 3ZKND 1ETZA 4CNIB 2NW2A 2PYFB 4ZXBA 2DS4A 4FABH 1TXKA 4XNUL 2AJZB 1JFQH 5BZDB 5C0BA 3O3UN 1F4WL 2ZCLL 2FYYB 1RIUH 1FH5L 2X89A 3MLXH 3X13B 5IUSA 3HE7A 3L3GB 3U4EA 5T3ZH 2XQYG 2HFFB 5JQHC 3CUPA 1QP1A 3O9WD 2BVOB 2DLGA 4LSQL 3ALXA 4LIQL 5J0BA 2DQTH 1D5MA 2HT3D 4UOJA 1T83C 4QOKE 4NHUB 1PX3A 2HFTA 4JG1L 1UM6L 4TN9A 5F7DA 4H88H 4K2UH 1S5HA 1U3YA 1I1FA 5TDNA 5JZ7D 3VGAC 3LKNA 4LSVH 3K74B 5TQ2H 2JJUA 4JO2L 2P7TA 3KPPA 1LO2L 4LCWD 2RQ8A 3SKMA 5DJ6B 2Y7QB 3F7RA 5BVJA 4XBEH 3EO0B 3FT4A 3MGTA 2VDQL 3OF6A 2J88H 3GSNH 1SJEB 1N0XH 3LN4A 2B1AL 3KPTA 5FGCE 4YXHH 1X5ZA 1KNOA 3DYOA 2XKUA 3VA2C 4PJCE 1XGTA 4KZDL 4W4OA 5JHDA 1I8IB 4YGVB 3WIFA 3CVHB 4JHAL 1Q38A 2DKMA 4TVPE 1BVKA 4YDKH 4NPYA 4IS6B 2Z35B 3NCMA 4MWFA 2C1PB 1TVHA 3AM8C 4HG4J 4Y8AA 3WNNA 1E4KC 5I1IL 5GSRB 1ES0B 1G7QB 2BJML 2EDYA 4WW2B 3LQZB 4G6FD 3VXSE 4JFDD 5GGQH 5I8CA 4OFYA 4HWEH 3VH8B 4WI4A 3I6LD 1C7SA 5BJTB 4PRID 5IB1A 4KROC 1IGYA 4ODXB 3ZL4L 3MRPA 4IEFB 4ZFGL 1MAMH 3R1GL 1FZOA 4PJBA 1INEL 2OS7A 5IV2A 2VAJA 4JKWA 3QDJB 5INDB 4TPRH 2NY7L 1JF1B 4UTBL 3VFTA 2EC9U 1GIGH 3SDAD 2B39A 4EI6A 2YWZA 1CD9B 4P59L 2Z4QB 3WNMA 4YHIA 1IC7L 2GYSA 2H3NB 2P8PB 5IMOB 4OCLC 4LCYA 4NCC2 3TN0D 3NH7L 5D96B 3RGVB 4P46A 3BPOC 2BHYA 1WZMA 4M1DH 4NSKA 3RWHA 4HKXB 5E5MA 5IVXF 5IJVB 1CL7L 2P44B 3L95B 1FL3A 4D9RE 1G7MA 4NJ9H 5DQ9B 4C59B 2KH2B 3R0MA 5CAYB 1ITCA 3ILPA 5E2WL 3F7PC 5FIEA 2Y36H 3VXUA 2OP4H 1S8DA 4LDOB 1RZJC 3SDXE 5I8EA 2FD6H 3KLHD 3HUJF 1BWMA 4Q9CA 1EAPB 3GMOB 5TDPA 3L3IA 5FUOL 2FJGB 2F8XC 1GGUA 1I1AD 2W07A 4OGYH 2B2XH 1T7XA 1FPTL 5EZLB 1KEGL 3WIHA 1RZ8A 5DJCA 1GYAA 3ARDC 4XCCL 1DUYA 3I6KA 2D03L 4AMKH 4GKZB 5C08E 2NR6D 4U2YA 4PRBB 3T2NL 3BUYB 4D2NA 4E0RB 1K8DB 1U8NA 2VLJE 3QUXB 4YBHA 2R4RL 1R3KA 4PJ9A 1UXSA 3DSFH 1DQLL 3QUZB 4RAVB 2PXYB 3WSQL 4F15B 2YUWA 4LSTH 2ESVD 4QHKJ 1EERB 3FFCD 4GXVH 2R2HB 2VXSH 3C5ZD 4K3JH 4WJ5B 2XTLA 4L3EB 4N0YL 3MGOB 1YEIH 4LASL 4J3SA 4JHWH 1JN6A 2NY4B 4B7LA 4YHNB 5HHQA 3HG1E 4PJAA 2DQHL 43CAB 4Z18A 5CD3A 2VZSA 1E4XL 4LSUH 3R8BB 3T2QA 3WO4C 4NN7C 4WFEE 5C0NC 4NKMB 4J4PD 3MV7B 3SKNA 3VFGH 3FAWA 1MLCB 3PXHA 3EYVB 3VXNB 1IAIM 4YDJA 1BD2E 3QG6B 4WWKD 3TBVA 4TVPH 2NY6D 1YQVH 3V6FB 3NZHH 2X4OB 1KG0B 4NC1E 5ETUA 2ORBL 5FB8B 1MCHA 5DURD 1WWBX 1YQ2A 3PP3K 3BHBB 3QI9B 4QHKI 3KYOB 4OT1L 1PBYA 1XGQA 1OW0A 4M61A 3G5ZA 1JK8B 4RISH 2FATH 2GT9B 4R7DA 4U31A 3PGCB 4ZFFA 4CDGC 1U58B 3MXWH 1II4E 5EO1B 2NXZD 1K6QH 2GW5A 3MTRA 4KI5F 1WIPA 1EFXD 5C09A 3WS6A 3O2DL 4Y7MA 3V6OC 1JZ2A 3VD4A 2VLME 3B6SB 2I07A 3GSVB 4PRAA 3IDIA 4ENEC 5BRZB 3WLWC 4XCEB 3PHQA 2F54E 3IDJB 4X6DA 1B0RA 4TSAL 2FX8H 3F7VA 4WW1A 1QQDA 4MJ4A 4QNPE 4I0PB 1G9MH 3B2UD 1IGTB 5F7EL 4EXPX 4C56A 2V2TB 3VW3L 1Z5LA 3QXTA 5T5NF 3DXAE 1OTSD 4QRQB 1J0JA 2BSRA 3SDCD 2R9HD 2VAAA 3D2UA 4WGWB 4EI5A 4PRNB 3U4BL 4KDTA 4QF1A 1I3GL 3UPAA 4I2XA 5GGVL 1HXMA 2NTSP 5HSFA 3RU8L 1YMMD 4I8DA 1EDQA 3BMWA 3LRHA 3AXLB 1IAII 4NYLB 2X4TB 2G2RA 3O3EA 2A73B 1DQJA 4NKQB 4TNVK 3CIQA 3VFOA 3WKNA 5I1DA 5KTEH 2BNQB 3HC3L 4ONGL 1BWWA 1HH9B 1PAMA 3VXOA 4LGRB 2IBBA 3IAPA 2QSTA 3BX7C 4KJYB 2JLLA 4PJ5A 1NFIB 3CDFA 1CVRA 2HVJA 3MO1A 3WXWL 3UTTB 2JK5B 4L8SA 3QEQA 3O8XB 3B9EA 1FVCA 3N1PC 3RBGA 1XGYL 3QUMB 4PLJC 2ITCA 4LLYA 4EQ2A 1UCBL 1K4CA 3KYNA 1NGPH 3LRGA 3O4LA 5T1LB 3MOBH 2FL5A 5CGYC 3MRNA 2P42B 3QO1A 4CVXB 5DQDL 1JZ7A 6FABH 1CBVH 4YHPB 1NBYB 2I5YH 4MJID 4H0GA 2OL3H 4NRYB 1U8HB 3RAJL 1S7UB 3GMNA 2CLZA 1DN2A 4D9LL 5DMKB 3U9UA 9CGTA 1U8PB 1U8JA 1T2XA 1K3IA 3GJFK 2CIIA 4OZIE 3ZSTA 2HJLA 2AKRA 3T0EA 3WFDL 1JP5A 2XKNA 3BPLC 3F65A 1X7QA 5JXEA 3O6MH 5CZXD 3P4MA 2WUBL 3TZVB 1NGQH 3PJSB 1N6UA 2DJSA 2VDLH 3TA3D 3LEVH 2FGZA 3H2WA 2WBKA 4YBLC 3H42L 3ROOB 1QLEL 2R56H 4DQOL 1CQKA 4XTRD 1G7PB 4KQ4L 3H0TB 2FB4H 5TE4L 3KPNB 3B9VA 5T3XL 2CKNA 2X4SB 1UVQB 4ZUWB 3ZE1E 5I18L 4HJ0D 4Y5VA 1AXTH 3GMMA 2VITA 1MFEL 3UYRL 4GFTB 5HGBB 5HHMB 1G7JA 4KGJA 1AO7D 4FFZL 3RA7H 1X6NA 1IAKB 3V9FA 3MRBB 2HWZL 4EN3C 2IPTL 2Q6WA 2A6JB 4Z7NF 4R96B 1EA9C 3I2CH 3V6OE 3NN8B 4PYGA 3FZUD 4GW1A 3CFBB 2HLAB 3JUZA 3IB4A 3QEHB 1MH5B 1BGXH 1S3KL 5ACZA 5J3HD 1ZTXH 2APFA 3VFNB 5C07D 4RIRB 4KUCD 5GJSL 5GS1C 4HK0B 2X4QA 3KR3H 4JQVA 3W0WB 4HS3B 2ZKHH 1PGRB 5FF6A 1J7VR 4ISVA 3GB7A 1AKJD 4GH7B 2VLRE 3C09B 4Q0XH 4Z8FL 5C0GA 1XCQA 1YEKL 4HV8A 1OM3L 3TH3T 3W2DL 4NT6B 1JRHH 3FQXB 1BAFH 3EYSL 5MENB 4X6CE 3VWJA 1UM5L 3QNYA 5JORA 4KK9D 3V6BR 3MLTA 1DLFL 2FHCA 3FB7B 1N5YL 2C9AA 4L4TE 4HPYH 5I6XC 3JV4A 3QUYC 3RWGB 4QY8A 4V1DE 5EUOA 4QCIA 1VACA 2PO6C 3ORJA 1F2QA 1G0YR 1ZVSA 2V5SA 5CMAB 2MPAL 5LCVH 2PUQT 3VXRE 1YJDL 5HHPA 4QXTB 5C0RL 3T0DA 1KLUB 1F6AB 4G9FA 1U8LB 3E8UH 1QLFA 3A6OA 3REWA 2CSPA 4GAYB 1RPQA 2EIZB 2Q76A 4ONHA 5H94A 2LV4A 3GHBL 3HPJB 1OSPH 2PNDA 1A7RH 2OR7A 1XCTA 5C70A 3HHRB 5JDJA 3CK0H 4JGUA 1T66C 5DMYA 3FB8B 2FX9L 3V8CA 2X2YA 3HFMH 4WY7H 1ZHNB 3PUCA 3BRDA 1J0KA 4WEBL 3VH8G 1NCCL 1ND0A 4UBDC 1Z6JT 5GGRY 4BSVB 1FN4B 5GGSY 3TEUA 3KYKH 4ZAKA 3VFWA 4J1UA 4XVTH 1KXQE 4G6MH 4IRJD 4XWGL 3T4YA 4ZUVA 2HKFH 3MSPA 1U8OB 4BKLA 5SWZD 4HIHB 4ODHL 1KPVA 3QXDB 1U9KA 3BJLA 4GUPA 3EOAB 3HAEB 1CXHA 3RUGA 1MWAB 2JB5L 3BKCL 3NZ8A 1FYTB 1LK2B 1DBKL 5T1MA 2QBWA 3SKOA 4A2MA 4I9WD 4ZTOL 5IROA 5C92A 3BIAX 4L4VB 4MNQA 5SV4A 3TT1L 4AENB 4LFHD 4NQEE 1DUZA 5E6IC 4Q9QL 2OCFD 3ARXA 4FXKB 4N9GA 1XT5A 5DD5H 3WO3B 1UJ3A 1V05A 2ICWA 2AP2A 1S9VB 1N0LA 4XMPH 5INCB 2HTLD 4ONFH 4WCYH 1RMFL 3PABB 1FZJB 4JFHD 1PKQA 4Z7VB 3ULUE 1ADQA 1WGOA 3VFVA 5GZOC 4PJ7B 1NKOA 1T0PB 3OR6B 5EBWB 5HY9A 4KFZC 4LLDB 5IB3A 4AIZA 1N6QH 1OAZL 1SYVB 1D5ZB 3QIBB 2IBZX 3C8KA 3REVB 1S9XB 5D7IB 2AABH 4Z77A 4JZOB 4QRSA 5ID1A 1MAJA 3LKOA 4L8BB 4POZC 1S7XB 4OIIH 3WHXB 4XXCC 3SE9H 3QIUD 1B90A 3MV8E 4PG9B 3MRFB 5HJ3B 2XN9B 5GSVA 3C60C 4YQXL 4Y1AA 1C1EH 5JOEA 4ODSL 3QCUH 4WFFD 1PVHA 4IOIA 5E00A 4X98B 5HHOD 1MRDH 3VXPB 5B3JF 2DLFL 2OJZH 4HGKC 2VIRB 1CF8H 4Z9KB 4AJ0A 4ZFOB 4D0DB 5CZVH 3VE0B 1M7DA 4Q6IC 4A6YA 3D85A 3L5HA 1E4WL 1OAUH 1D6VL 3MZTA 1Q9LA 4APQC 5ENWB 1RU9H 3HN3A 3BZEB 3QCTH 4FQHA 4N8CL 1LE9B 4X6FA 4BH7A 3AC0A 1AH1A 4M3JA 4M1GL 4MNHB 4Z7WB 2UWEF 1D5IH 3K8LA 4HBCL 3IU3A 4FQ2H 4G6KL 4H26B 1L6XA 1WCBA 2MQCA 2PW2A 1HK6A 1T0MB 2G9HB 4PJIB 1FNSL 4FN0A 4W6WB 1JI1A 5IHUH 1YUHA 3OPZL 1WISA 1HSBA 3TFKD 4Y89A 1F4HA 3OAUL 4JZJC 3DX8A 4U0RB 3NFNA 3V4PH 3WJLA 4UDUB 1V7ML 1YNLH 1PZUB 2BNUB 3BEWB 5DMGC 5C0FB 4ZSOA 1F90H 5F1IB 5LXGH 3NAAL 1NPUA 1NGYA 5IJKA 1NCBH 25C8L 2ZG1A 3P77B 3QNXB 4IMKA 4NQCB 1E27A 2EH7L 1PQZB 3TNNA 3BKJL 5DK2B 5AWNL 4MJ5A 4XX1G 4ZS7L 2H32H 1F6FB 1KCRL 1G7HA 4P23B 4YHZH 5BO1L 5DXWA 3U83A 4JB9L 2DJ4A 1NUFA 2XQBH 4XPBH 1JBJA 3ARBD 3L5JA 4ALAH 4UI2A 1B4JL 1HDMB 3LZFH 1C5BH 4PJXF 5J6HB 4LBEA 4NO0B 4MD5B 4KK5C 1Q9OB 2V9RA 1BLNB 5IFAL 5JHLL 2DDQH 4NFCA 5DC9B 3WD5H 3KYMB 5D70L 4DKAA 5B22A 4RMVA 4Y0GA 3X11A 1MPAH 5I71B 2CMRH 2H8PA 4QTIL 2OTWA 4FP8L 1JPFB 1OSZB 4F7CA 1U3HD 4NO2A 3SE8H 2QQLH 4Y5XA 3RL1A 4PJGB 1IEBB 2ED7A 3E6FB 4HFWA 3PWNA 2CDFB 2QADC 3KPQA 3EGSA 5MEPA 2P8LB 1AQKL 1G9NC 3LS5L 5DJAB 3KPLB 4O02H 5ESQB 1U8KB 1KCVL 3S36H 4X6EA 3IU4H 3W5MA 1F45A 4CNIA 5D7LD 5IFJB 1JWSB 3QWRD 2O26U 2R0ZH 2PYFA 3I75B 1V3LA 1JFQL 4P48A 3SKJL 3R8QA 5CUSL 2C3VB 1RIUL 5FV1L 4J7RA 3MLXL 2CUHA 2C7UA 4Z6AT 3ETBF 2Z8SA 3KLDA 5I8OH 1ZOXA 5T3ZL 5F9WB 3LN5A 2QTEA 5KAQF 1QFOA 4HCRA 1BECA 2DQFA 3PF2A 5TFSH 2A77H 5DR5H 2DQTL 1T21B 5ERWB 2DAVA 2ZSVB 3ZKXB 3VXMA 3X14B 1HH6B 4U05A 1J8HD 1ZGLB 1ED3B 1N64H 3TYFB 2NNAA 4U1NA 3FQUB 4R90H 4DN3H 5BXFB 3RVUD 5HTSA 1KIPA 4MQTB 1DBAH 2YD4A 3WL9A 5HPOA 1UB6B 1A14L 2QKIA 5K59E 4XT1C 2IAND 5KZCD 1LDPH 5D7JB 3B9KC 2J8UE 3GMLA 1B6UA 5TQ2L 1A64A 1UZ8B 4XBEL 2Y7QA 3RIAF 2AI0H 3BP5A 2J88L 4JM2A 3GSNL 3U7AA 2PW1B 2SEBB 5GS0D 3PNWB 1SJEA 4QRPA 3FT3B 3FT2B 2V7HB 5C0IA 5IIEB 4ZXBC 4YXHL 3HMXH 1DQML 5J12C 1YEJH 4MA7L 4FQXB 1FIGH 2DICA 3BGFB 3ARGB 4QRRD 4HKJA 1JYVA 3H3BC 4GRWH 4HKZA 1MI5B 4YGVA 4YDKL 1AFVH 2B5IC 4ZOCA 1ONQB 3KPMB 2ED8A 1GHFH 1XF2B 5IR1A 2Z35A 4LP5A 5T3ZD 2V9TA 1FO0A 2D2OA 1XZ0B 2P45B 3JWOC 3PWJA 3DGCR 3O6FD 1ES0A 5GSRA 3RDTA 4HWEL 1H5BB 4ODUB 5EZJB 3MV9D 5IT2H 1KB5H 5F96H 1PD6A 3P0VL 2FEDD 1I7ZB 3OZ9H 4JN2B 3MMEA 5SV3A 1BVZA 5DFWH 1G6RH 3AS2A 5DS8B 4K7PH 4RQQB 4TPRL 4WU7B 4M6AA 4KU1A 1XIWA 1KENH 1IC1A 4Y16B 1GIGL 1JF1A 4HC1H 4ZO9A 5ESVB 2AEWA 4XB7A 1MHCA 1S78D 4GXUN 2KQMA 3EHBC 5ICXB 5ISZB 2GITB 2P49B 2Z4QA 1EHLH 1IMHC 3RKPA 1WC7A 2A6KB 5E8OB 1D6EA 3RGVA 1QPPA 4I3RH 4W4OC 4Z7OF 1FBIH 2JCCF 2DB8A 3QA3B 1RD6A 2ZZUT 4PFEA 4BFEA 2CRMA 5FGSA 4NJ9L 3L95A 1OGAD 4HAGA 1SBSL 5DFVC 3O9WA 5DQ9A 5T1DH 1NSNL 3DX7A 2OP4L 3TPUB 2Z91A 4GKOA 4JDZB 5EU4B 1FL6B 5EZIL 1TZHB 3SO3C 5HGGS 1ZVYA 1X6LA 1AR1D 2DM2A 3S35X 5J56B 3O45A 3DARA 1UWEL 2WIMA 1EAPA 5JPNA 4G5ZH 4MX7A 2KKQA 3ZKMC 4FFVD 4DGYH 2FJGA 2B2XL 3JXAA 5IM7B 4P3WA 2OX5A 5DHYB 3SDDD 4M8QA 2W0PA 1WICA 3L3JA 4PGCB 5K9OB 4LLQB 2AS5M 3D3VD 5SWSB 1FHGA 3EUUA 4M4RA 5FO9B 1W72A 3BUYA 5EU6A 3DSFL 1CZ8H 1HHGB 2Y1VA 4XNXL 4LSTL 1AD0B 5I66B 4RGNB 5CEZE 3QUZA 1JUFA 1TENA 1DDHA 4P46C 4K3JL 2R2HA 5DRXA 3LKRB 4RAHA 3WFEH 3L5WB 4WV1B 2XYCA 4FFWD 1VESA 1GH7A 3TJEL 1I8MB 5LG1A 3CLEH 2HLFC 4OFKA 4J2XA 1MFCH 5D2NB 4LEXL 2MHAB 4JZNB 4OJFL 4YNYB 1MHHB 1F3DJ 4JFDA 4Z78A 5L0QB 5E70A 2VNCA 2EDHA 3TM6A 1B3JA 3LY6A 4MLSA 4QKXB 5C0AD 5KS9B 3EYVA 2FR4B 4HJGA 5C0BE 3VXNA 1M71A 5I19H 4TVPL 1JTOA 3GI9H 3NZHL 3QG6A 4BQ8A 2AQ1A 3LH2L 1OAYH 4UUJB 2X4OA 4LSPH 5E4EC 5HHVL 5E8PA 3QEGH 1L6ZA 3DUHA 2C26A 4FNLL 3QI9A 5L2KB 3STBA 3ZLQC 2X05A 4RRPG 4FQCH 3BP7A 4YDLC 3DROB 1Q9KB 3ZKQD 1FDLL 2IADB 3UTZB 5BS0B 1A02N 3MXWL 2VDNH 1YECL 1K6QL 3QO0B 4J3WA 1HHKA 1EUTA 4QOKD 1U58A 3TN0A 2PTVA 2VZ3A 4XPGH 1ZANH 4BYHA 2W91A 1SMOA 3QFJE 1TZIA 2MCPH 3SHSA 2BC4B 3RKDD 4OKVA 4P2OD 5LJYH 2GKIA 5I1GH 1AGEB 1FRGH 3SEPA 3B6SA 3OKEB 3GSVA 5EA0L 3AMLA 2YA1A 2W0FB 3FONA 4XCEA 1V3JA 2EDDA 3CVIH 3IDJA 2HN7A 5DJ8B 3RY6A 4DVBA 4I4WB 5HD8D 2NY1C 2EIDA 4P5TB 2F19H 3GKWH 3LEXB 1NGXB 4U7KA 5LBSL 1DVFB 1F8TH 4H8WL 3S3SA 4RGMB 3W11D 1I1AA 5AD0B 3LV3B 4PRNA 2VOTA 3HI1A 3FOLB 3VCLB 1RIHH 1RZKC 4UMGA 3B5TA 3M8OH 2HT2D 5HPMA 5BMFL 4I0CC 1KB9K 4TVPD 1G9NH 4OCYL 2ADFH 2K7QA 1OW0C 1YDPB 3QG7H 4PRPD 4NN6B 5B4MD 2ZUYA 2BMKB 4MJ6B 3MRGA 2JJSA 3ARUA 4MD0B 2BNQA 1MVUA 4P5KB 1YEDB 2VDPH 3KPSE 1T1ZA 5DHVB 3MLYH 3G6JE 3FFCA 1MCSA 3C5ZA 4QHUB 4N0UB 3RL2A 2XKSA 3HI6H 4K3HA 5D93C 4AM0A 1J1XH 1Z0NA 4JFFB 3GO1L 3MRLA 5DO2C 3UTTA 3V4UH 1WAAA 5GRXG 4YPGB 1IL1B 2W38A 2Q3AA 1NGPL 3OJDA 1GGBH 3GJEA 2MSPA 1A1NA 1J88A 3MOBL 4X80H 1CFQB 2EDJA 4XMLL 5CWSA 1RY7B 5CEZH 3GM8A 6FABL 4YXLH 2I5YL 4NZRH 4ZO6A 4J4PA 1NBYA 2OL3L 3X12B 4EI5C 5FUCC 5IF0B 4OM0L 4KDTC 4FXGA 4NRYA 3KXFD 4WWKA 3EDEA 2XTJE 1MEXH 2ZJSH 2MWCA 4EUPA 4J3OC 5DMKA 4D9RD 5D2LB 4CW1B 5HYEA 3IXAB 2FH8A 5KSUA 1A7OH 3TJHD 2BNRB 4XPAH 3O6ML 5D1XD 1P7KB 5TDOB 4FHBD 5HGDB 4K9EH 3D18B 2WBWB 4X7SH 1YPZF 1DQQB 2ERJB 2ICCA 1NGQL 4FTVE 2EEDA 2VDLL 3LEVL 3TZVA 3QULB 4GG6A 1WFNA 3PJSA 4M7LT 5L8KB 1X9QA 1EFXA 4O4YL 2R1WA 2R56L 1AD9B 1S5IH 2OR9L 4L8SC 1A5FH 2GTWA 1RFDL 2FB4L 3AU1A 3H0TA 3U7WL 1F4XH 5FM4A 5C08D 3MJ9H 3JWOH 3IKCA 2MKWA 3OAYH 1AXTL 2VLJD 2IH1B 1EIBA 2VKXA 5DRWB 1NGWA 1IGFH 2OK0H 1OARL 4LSSL 3RA7L 5HGBA 1AHWB 1RUKH 2W0KA 3BN3B 3GI8H 5CILL 1MY7A 3C6LB 2VXUL 2ADIA 2B8OT 4CKVX 4OM1H 4HT1H 3WLBB 5EPMB 3F8UB 2OBGA 5DSCA 1YMMA 4XWOD 2XWTB 2GJZB 2IALB 4PB0H 3VA6A 3HG1D 4PJAE 1S7SA 1ZTXL 3T0EC 1MH5A 3ME0A 4X8JA 3RIAK 3BRFA 5ICYA 1OT2A 4X6BB 3VFNA 1ORSB 1CD1A 3AAZB 4WFED 3KR3L 4OCXH 2Z9TA 3N1GC 2NCMA 3FRUB 1A6PA 3VFRA 1HN1A 3WN5C 2R23B 4PJHB 1UZ6E 1C5DA 1GXEA 3O41A 4Q0XL 3N50A 4P0DA 1BD2D 1K9TA 2Y25A 4F7TB 4X5XB 1NC4D 2GK0A 4OF3A 3FQTA 1JRHL 3UBXA 1BAFL 3K7UA 4HUNB 1IKNA 4JHZA 3G08B 1VCAA 1MJJB 2VC2L 3L6FB 3P73B 4DVRH 4DN4L 4R8WH 4Y5VC 2BCKB 2Q7NA 2B0SH 4LCUA 2MJWA 4X99B 1NC2D 3CC5A 1NFDA 3CSPA 5LCVL 1WBZB 1KYOJ 3GMPA 4MJIA 3MNWB 3PGFH 1XF4A 5ACLA 4KROD 4WI5A 5FOBA 3E8UL 1C08B 1WTGT 5EB9A 5CBAB 3RRQA 3JWDC 1NJ9B 3M07A 3H9SB 3TIEB 3IYLW 2VLMD 3DRQB 4OQ1A 1EK3A 2ZSWB 5F89A 1OSPL 3LSOA 1A7RL 4GKSB 2F54D 4KMQA 3HPJA 1NMAH 4XBGB 5CIPA 1IAIL 1PX4A 5D6DA 3PIQB 2F53B 2BRRH 2DWEA 1JNHA 4G7YH 4GRMA 4JQVC 5H8DA 5CSGA 5CJ5A 1Z3GL 3DXAD 3FB8A 4MB3A 3HFML 1FGNH 3S37X 2QHRH 5BZWB 3WIIH 2R8SH 3TA3A 1ZHNA 5C0CB 2O5ZH 4RZCA 5CJQH 1P9MA 4LGPB 4RFOH 3HR5A 1QHPA 4U0QB 3B5HA 4HGWB 2P8MA 2XZQH 3KYKL 1TETL 4YFDB 2E6PA 2HKFL 2X1QA 1I7RA 4L5FL 4F57H 3OHXA 4NFBA 4XZUB 2DD8H 1ZV5A 1CT8A 1U8OA 3DIFB 4HIHA 2W9LA 3PE9A 2ZCHH 2R1XB 1Q1JH 2P1YA 3QXDA 1HSAB 1UADC 4BFBD 3LOWA 4FQIH 3BPNB 1PZ5B 2EIEA 2CDEA 3OXSA 4HFUL 2HVKB 3IT8D 4G8GB 3O4OB 3EW3B 1A7PL 1FG9C 1HXYA 3ROLA 3ARDD 2BVQA 1TJHH 4XPTH 4LRIC 4YK4B 3C5JA 1T20B 3OTTA 1A4KB 2P46B 4R2GC 2FEEL 4AENA 1T6WA 3T77B 2JB6B 4YDIH 2Y06L 4MNGB 5C07A 5LQBL 2ZUQB 4FXKA 2UZYB 2JTDA 4XMPL 4ONFL 4WCYL 1LNUB 2FSEB 4OZFB 1AQDA 4MYWB 2G5BB 2V2XB 3PABA 2YD1A 1AKJA 4Z7UB 2IPKB 3OKNB 4R7NA 2WBJD 1MOEA 4ZAKC 1N6QL 4PRIB 4ZDHB 4BUGA 3TBSB 4OLEA 5SX5H 3OR6A 3CLFH 2ADGB 4LLDA 4PTTB 1MJ7H 5E24E 1SYVA 5F6IB 3REVA 1MHEB 5C0ND 2E8YA 4M4PA 1A6VL 3NBNA 4I48B 1XF3B 4OAWB 5D5MB 1JGVL 1RZKH 3ARVA 4M6ML 2RFXB 3QCUL 5IROC 4OZHE 2W60B 4XXDA 1L0YA 1NUGA 1MRDL 4GS7B 1T1WB 2X4UB 5K93A 3RVVC 3BESR 4X98A 3ARFB 1CF8L 2AV1A 4GRLC 4Y4HC 1UJ3C 2E27L 2O5XL 2VIRA 2VQTA 4UB0L 5CZVL 1M7IB 1QR4A 3P4NB 3VE0A 3UP1A 2I9LA 1GVIA 4R3SB 4P2QB 1N3NA 4JFEB 1J8KA 4BUHA 1PSKL 4TSBH 1FLRL 2F8OA 1CGSH 4M02A 2PYEE 2G75B 4YC2C 4BSWB 3BZEA 5J1SC 3HC0A 3HMWH 3LQAC 3BE1L 4HHAA 4NIKB 3ARRA 3HZMA 5JW4N 2R29H 1RZIA 4IRJA 4ENED 3KPRB 3RNQA 3WLWD 1D5IL 4HUVA 1UWGH 1JYNA 4HPOH 4Q7DA 5TF0A 3KLSA 4PJ8B 3Q3GB 5I73C 4E9LA 2EZ0D 3NPSB 2VQ1B 1KYOK 4N5ED 2C4FT 5SWQB 5DZNA 1T0MA 5HDQH 4M00A 1A2YB 5FA3A 2VLRD 3V4PL 3I3BA 5MI0C 1KT2B 1YNLL 4UDUA 3CCHB 1F90L 4DZ8A 5LXGL 5TE7H 4KMLB 5C0FA 1NCBL 3NFPB 3NABL 4GQ9H 2UYLA 2IQAB 4L4TD 5I9QC 4RFEB 4V1DD 1YMHB 4WEUD 5DQJB 4XAWL 5F1OB 4AT6B 2NY0D 2XQBL 4EIGB 3IAGC 3VXRD 1BBDH 4ALAL 2Y72A 4LVEA 4G9FE 5DD6A 3LZFL 1C5BL 4S0TD 4YEEA 1U92B 4NQDB 4YZFF 5DGRA 3ZE0E 3G5VB 4NO0A 3MXVH 2VZ1A 1Q9OA 1KIQB 4C58B 4ZPVB 5DURB 3ECBB 1MPAL 3KYMA 5CGYD 5DDHB 3MGAA 5KSBA 1WWAX 3ULUL 4G8FA 4M48H 3TVMA 3HRZB 5A2IH 1JPFA 2QQLL 4IOSD 1AXSA 1OAQL 5CGMA 1KPRB 2VSCA 3WJLC 1IEBA 5J06A 1P4BH 4M6OL 5EBGA 5HHOA 1WIOA 1NMCB 4O02L 3S36L 1ZA6A 2ZOKB 5IJKC 2P8LA 5DJAA 5IB5B 2WINA 4IMKC 5ESQA 1U8KA 3IU4L 3KGRA 5J57B 3FB5A 4OZGA 3RUGE 1FG2B 2R0ZL 4GRWF 2DI9A 5IFJA 3CX5J 4M62H 3I75A 2Y07H 3DRTA 4WDIB 5CHNB 2C3VA 4IOFC 5IVXB 3T3PF 5DUMH 1JZ6A 2LU7A 4Y4KD 1R3HA 1A1MB 4GBXB 3UJIH 5TFSL 1NLDL 4NQED 1LO4H 2YN5A 3ZDXF 3A0OA 3HUJB 3KPOB 5JDSB 1HH6A 2XFXB 4CADA 1HHJA 2HG5A 4HWBL 5CCKH 3TYFA 2J3SA 3NOIA 3JV6A 4PJEA 3FQUA 5TJWK 1BBJB 5DMJB 4Y5XC 3ULUD 1LDPL 3JWDH 4EN3D 2BY3A 1UB6A 3BYYA 3GMQA 4RMRA 5KN5B 3ESVF 1OAXH 2DI7A 5CBEB 2CKBL 4B0MM 3C2AH 4HXAH 2AI0L 4KKCC 2CIKB 1QBLH 2DQGL 4HKBB 2PW1A 1QFUH 4ELME 3HMXL 5B39B 1EJOL 2YXMA 5FA4B 7FABL 5E5UB 4NCDA 3MV8D 4PRDB 1INQB 3ARBA 5L9DL 3P9MB 5IB2A 4OI9A 4LKCA 2A6DB 1GHFL 1T4KA 4YFLI 3VU2A 1ONQA 1PFCA 3KPMA 4ZG1A 2EYTB 1XF2A 4UT6L 3SCMB 2QSQA 1EO5A 1KB5L 4JRYE 5F96L 2I26N 3QUYD 2BVPB 4YO0A 5EZJA 5T1KB 1U3HA 3OZ9L 4JJHA 1UT9A 2JIXD 4MJ2A 3GHEH 1D5XB 4NWUL 4X9BA 3RWCB 3EO9H 4OCWL 4JN2A 2LTQB 1G6RL 1CTOA 1OT1A 2V6HA 1VGKB 4PV9B 5EORL 4LCCB 1KENL 3I6GB 2L7JA 4HC1L 3ZYZA 4AQOA 4JM2C 3S35L 4Y16A 1BREA 2D0HA 3WS3B 1S7QA 3FAXA 2BXYA 1D7FA 2GITA 1T66D 5D7LA 4GMTL 4I3RL 1KC5H 2J7LA 1FBIL 4MZ3A 4DOHE 3W9DB 3MBEB 4UBDD 4KKNA 4LQFH 4N1EA 4E41E 4KKBC 2VLKD 1WVZA 2FBJH 5T1DL 1VB9A 5J13B 4ZSOE 4LNVA 2P5EB 5ACMA 2BY2A 3BGMA 4WW2C 5EWIH 3RDTC 1Z9LA 3THML 1JHTB 2G5RA 4O00A 5D4QA 1PEWA 4G5ZL 4CN4A 3LPGA 4GJTB 1BPVA 4F7EA 1R24B 4N8VB 4GLRI 1IGJB 2IANA 4NNXA 4E5XB 5IM7A 5F1NA 5DHYA 5DJZA 3GZKA 2ATKA 4PGCA 2IC2A 1XIWC 3KNBA 5FECA 3AB0B 2OYPA 5E6ID 5SWSA 4RA3A 5GZNC 2LAGB 2L7UA 1K4DA 4NZUL 2J8HA 1R0AL 1CZ8L 2R2EB 3MJ8B 4H1LB 3TO2A 1LE5B 4OF6A 2AK4E 4MDJA 3CX5K 2X1PA 5BVPH 1GL4B 5D96C 3RGVC 1T7WA 4QXUH 2C1OA 2CLRA 4MXWH 3LQAH 3WFEL 1MCWM 3F62A 4UDTB 1WZ1H 4OLWH 4EBQH 5GZOD 1J5OL 1H15A 4K8RH 3CLEL 5CINH 1ZHKB 5TE6H 5CP3A 5DEZA 4YUEH 3H9ZA 4Q97A 1U91B 3MNVB 4NOFA 5DK0A 3O6FA 4YAQB 2MHAA 4JZNA 4POZD 5ALBL 3HZKB 4Y19B 4CU8A 1MHHA 4HH9A 4W68A 4NCC1 2WM0A 1EEYB 2ZOLB 1UM4H 5I19L 4RWYH 1U8MA 3GI9L 1P7QD 2I9TA 3C60D 4OZFG 1OAYL 4XRCA 2AJVL 3MA9H 4FRWA 5GRWA 2VXVH 5KVDH 5FO8A 4J6RH 1HQRB 2CKBB 4FQCL 4WU5B 2OTPA 1FFNB 4I0KA 4PLKC 4A6YH 3QUXC 3NCJH 2VDNL 4U1MB 2GTZA 3DROA 5C6TH 1HI6A 4NQVB 5JW5B 5BS0A 3QUZC 1T03H 4XPGL 1ZANL 3QO0A 1KN4H 4QT5A 4U1SB 1TZGH 4WTWA 3G6DH 2DLEA 4PGDB 4APQD 2X9YA 2P5WB 2UY7A 2YBRB 4UV4H 1J9CT 1X5XA 5I1GL 1FRGL 5DVLA 1ZKAA 2NY4C 3ZTJG 4GKNA 2ATPB 5DI8A 5IKCB 3OKEA 2YMXH 5DUPL 3W39B 1XF1A 4LVNC 3CVIL 2CJUL 4AEEA 4AEIH 3PHSA 1DE4B 3MUHL 4YJZL 5DD3H 5DJ8A 1ZLSL 3GKWL 4OKDA 4I4WA 1EXUB 1RZFH 3FFDA 1F8TL 4OTXL 3LEXA 1NGXA 2VZOA 5FO7A 5DUBA 1DVFA 2B20A 1T7YA 1NMBH 3K8KA 1H8NA 5E03A 1ZLUH 3SDDA 4O9HH 4H0HB 4Z76B 2Y9RT 5MEOB 2ADFL 3VFSB 2D9QB 3QG7L 5DMGD 2APVA 3QI9C 1A1OB 2QQQA 1RK1B 2BMKA 2VDPL 2VXTH 2RCSL 3EYOB 3TN0C 2ZNWA 4UTAH 3HI6L 1LP9A 4FQJH 1J1XL 4Z0BH 4DKEH 1AR2A 3K0WA 3V4UL 1KN2H 3BZ4B 3ZDYE 3MODH 3RWEB 3QDJE 4KK5D 3MRRB 2XI9A 4YHOH 3RY6C 2XRAL 3WFCH 3BT2H 5CEZL 4JFYA 2BY1A 1NDMB 2GJ6B 4RMUA 4YXLL 5HYFA 4NZRL 1H3UA 1N7MH 4G43B 3DX9A 1AP2B 4HIIA 3X12A 4XVUC 1I1AC 1T1YB 1EMTH 1F3JB 4S1SL 2WQRA 5E7BA 2AAVA 5GJTH 2EYRB 4POYA 3VD5A 2QADD 5D2LA 3HZYB 1K85A 5F7KC 2J6EL 1DJSA 3IXAA 4GSDH 1DANT 4WHYG 4XPAL 4Y5YB 3JBG7 3WXVH 2EEAA 2BNRA 4K9EL 5GRYA 2JJSC 1A9EB 1QFWM 1QRKA 4X7SL 1OL0A 1P7KA 5TDOA 5HGDA 1KJVB 2Q1EA 4WHTA 2ZCKH 4ZPTA 4QOKA 1TNNA 1IEHA 1VDGA 3NTCH 2NY2D 2DQUH 2E7CA 2R0KH 1S5IL 2HT4C 1A5FL 1AD9A 4N1HB 4HCRH 4P2OA 5AUMB 3T2OA 4JFQB 3LIZL 4L9LB 1F4YL 1F4XL 4PRHD 2GFBB 3D25A 3MJ9L 1VSCA 3PQYD 4WIQA 4HS6B 4R26H 4PJBF 4ELKB 2IH1A 2OK0L 5DRWA 4P57B 3DI2B 4IRSB 4J4PC 4GW5A 5CEZD 4I5BB 1NAKH 1NCTA 1TCMA 2Y5TB 1DQDH 5JXAH 3GI8L 3V6ZA 4PJCA 4Y2DB 1AHWA 4WWKC 5D9SB 4OM1L 4HT1L 3EAKA 1TQBB 4L3EE 1MQ8A 2W9EH 5IVZB 1AI1H 4PB0L 2AJYH 4LVOB 3QJHB 4XC3H 2N7AA 3QFDB 2XWTA 4I77L 3L3OB 4G8IB 1MJUH 3ARWA 2XZAH 32C2B 1ORSA 3VXSA 1QBBA 4ZXBD 5C9JA 4ODTL 3MV7E 3TZVC 1CLZL 1I8LA 3WE6A 5HI3D 5A3IC 5FHBL 5C0BD 3N1FC 3DYMA 5KG9A 2X89D 2VDOL 2VZTA 2VDKH 1ZLWK 3DETC 4KRPB 4F7TA 4X5XA 3ZE2F 5DRNB 5DJXB 3E6HB 1CR9H 4U6XB 1FO0H 4Y4FB 4DVRL 1LDSA 4DCQA 3NIFE 1QYGL 2BSTB 3B8SA 3FO9B 4ZOEA 2VLLB 3P73A 3B2UC 2B0SL 4HXBH 1P69B 1UXWB 2ZPKH 1FYHB 1M4KA 2BCKA 1A9BB 1I75A 1CFNB 4X99A 2R9HC 4HIXL 3S96B 3TYGH 5FDYA 1BQHB 1ACYH 1E6OL 4R4BA 1QFHA 1ZT7B 5B39G 3B5GA 2W65B 5EO9A 5CBAA 1RJLB 1EPFA 3H9SA 1X4XA 5M94B 2XY1A 5BRZE 1BFVL 1MCEA 3MRMB 1NMAL 3OF6D 2BRRL 5CS7A 4G7YL 5D1XA 4OD1H 3SDXA 5ICZA 4XBGA 43C9B 2F53A 1FGNL 2QHRL 3WIIL 4K23H 2R8SL 4PJAF 1EEZA 4RFOL 1KLGA 2F5AL 3C5SA 1GGIL 3S4SB 3C09C 3V7AG 2XZQL 4OI7A 4I3SH 3HLAA 4XCFH 3CMOL 4HGWA 1HQ4B 3PWLB 4F57L 1IKNC 5HYQB 3PV6B 4N9OB 5C08A 1JTPA 1M05B 2UWEB 3T65B 5KVMC 5T33L 3DIFA 1Q1JL 2VLJA 4LMQE 4WO4B 2VR4A 5AYQA 1MCPL 2R1XA 5B38B 5KVGH 1VEMA 3O0RH 4OFYD 3L5IA 4FQIL 3KPSD 3TWCH 1CFTB 1HSAA 3E2HC 4LPYA 2PR4H 1WFOA 3ZKMD 3U0PA 2IAMD 1F3RB 2YEZB 1UWXH 4XCYA 3T3MF 5HVFB 2OL3A 3WFHB 1M6OA 4NBZB 2HVKA 1TJHL 4XPTL 4XNQA 3UTTE 4WTZG 3F6IA 1W72H 2IWGA 1G84A 1BOGB 4Q9BA 5L2JA 4P4KB 4P49A 1FV1B 3D5OF 3HG1A 2A83A 1T20A 3JTTB 4YDIL 5SX4H 5FFLA 1ZT4B 4B53A 3L7FA 5D6DC 2V5RA 3FQRA 3D0VA 5FYKU 2AJSH 1RZ7L 2Z31D 3ZYOA 3TA3C 4X6DF 5T5NG 3VGDA 4P46D 3VGBA 3MYZA 4POUB 1B2WH 1F4WH 2XTJD 2ZCLH 1NC4A 5ITBH 4AEFA 2NXYB 4PJXB 1V3MA 4N8VG 3QDHA 2XG5A 3NCEB 3MNZA 3H3KA 4LSQH 3AM8A 4LIQH 1WWWX 4LHUB 5DVNA 5E9DB 3LAFA 1NL0L 2EXWC 1NC2A 4FTVD 1GZPB 4E42B 4H1LG 4OAWA 4OI8A 3Q5TA 1UM6H 3BDBA 4Q6YA 5CEYA 2EYSB 3OQ3B 3DVNA 4QRTA 3LDBB 5FKAA 1IAOB 3RWDB 4JO2H 1IQDB 3BH9B 1NKRA 4DKDC 5JA9A 1NGZA 4NDMB 3UX9B 2VDQH 3T08A 6CGTA 3HS0B 4J12A 3DXAA 1AGFA 2B1AH 3OBAA 4TSBL 1EUUA 2EIBA 1CGSL 3FHAA 5HHME 1N59B 1DEEB 4NUGH 4B41A 1JIBA 3QIWB 3HMWL 1XR8B 2G75A 5CSBA 2DTSA 2Q87A 4BSWA 3HZVA 2R29L 1KJMA 1N4XH 3VGEA 1IM9B 4KRLB 1VGEH 4ZUUB 1WZLA 3TH2T 4LEOB 1QFWH 3KPRA 3QIBC 1OP9A 1UWGL 1MCJA 4HMDA 4HPOL 1J11A 3VWKB 1SJHA 2Y6SC 2ZUSA 3CZFB 5I1IH 5JPMA 4YHKL 1MSPA 3D3VB 5CEXB 3OXRB 5DEGA 4MVBC 2AXHA 5HDQL 2VQ1A 1TJIL 4ODWA 3W0WE 2GY5A 3QQ3A 3MLVH 4ZFGH 1Z9MA 3R1GH 3D0LB 4OBSA 4PY7B 3B8YA 1I1RA 4FQQA 1INEH 4Z7QE 3ARDA 4BFIA 5TE7L 4H5SA 3SQOH 1B88A 1JGDB 5GRJH 4MA3B 5MENE 4GQ9L 4NQUA 2NX5B 3EDKA 4D0CB 5EU5B 2IQAA 2E8ZA 2HA1A 4FFYL 4QTHB 4M5YH 1T3FA 4M43H 1YMHA 2CK2A 1MREH 3MFFB 1BBDL 3Q5YA 2DIAA 2VE6A 2A74B 3VGHA 1JE6A 2WBJA 2AJ3B 1RZGB 4OZIA 1CL7H 3QUMH 5DO2D 4ZOBA 3BEVA 4NQDA 3WNKA 4NFDA 5E2WH 1KIQA 1P84K 1OOAA 1T89A 2GSGB 3U46B 1R5VB 4M48L 5C71A 1AGCB 4ZQKA 4LGSB 1OHQA 1P5VA 1XGRA 4HZAA 4Z0XA 4EI5D 1NCAH 1YEGH 3LRSB 2OJEB 1J0YA 4NRZB 4U0RC 3A67L 1FPTH 3UPRB 2CR6A 2GSIB 3IS1X 2QQNH 2D03H 4GT7A 4PREB 1L7IL 3J8F7 2EE2A 3FQNB 4OLXH 4G6JH 3NCFB 2R4RH 2WLZA 1DQLH 1JPTH 2Y07L 3MLUL 1FYTE 3WSQH 1F6LL 3BRGC 2AGJH 5DUML 1D5BB 2JCCB 3VG0H 1NANI 3L3DA 1WF5A 4LASH 5EUOF 5LVEA 1ZVHA 3ARQA 3UJIL 3V6OA 4O2EA 1EZVY 4L4VE 1RJZA 3FQWA 1A1MA 3MCLH 1LO4L 3JWNC 5I1AB 4M8VA 2Z92B 2DQHH 1KCSH 2COQA 4D8PB 2FHFA 5D1ZD 3TVMC 4AIOA 1CU4H 5I71C 4KJPC 5TF1H 3JWDL 4U3HA 2VLRA 2BXZA 4Z7VE 1OAXL 5E08H 1ZHBA 5F70A 3SGJC 5KN5A 5F3BB 2H41A 1NUDA 3C2AL 4HXAL 2D7MA 4TTGA 1JGLH 4PJ7E 4ORGB 3WUWG 4X6CA 3ALWA 4C83B 1QBLL 5EIVA 1MQKL 4IDJH 4MXVE 3C6SA 1E4JA 5D7IE 1X5LA 4L4TA 3V5HA 3CZJA 5T3XE 4JDVA 1QLRA 2Q86B 5B39A 1IKFL 5GHWL 1MRFL 1QVOA 3VXRA 2HJFB 2XN9E 1A6UL 4X7TB 3TBTB 1QSFB 3AMKA 3OKKB 3P9MA 3MBXL 5F9WC 5IQ7L 1WFUA 4S2SA 5DJ2A 5TGBB 2V7NA 2FWOA 1OD7A 3RP1A 3KXFB 5CJXA 5IW1A 3GBLA 3DX6A 4MD4B 2AXFB 3PWVA 5FGBA 3MRIB 4ZD3H 3ZKXC 1Q94B 1T2QL 1MLBB 2J5LB 3VW3H 4ODBD 1JGEB 5JW3L 4YXKH 3FOMA 4JY4B 5LKNA 1ZWIB 5E5RB 3ARZA 1F13A 3A6CL 2PYED 3WFBH 1QG3A 3U4BH 3TIDB 5D7JC 1OF2B 1T0NA 3G04A 3IJYB 3RU8H 1U93B 2BHZA 2AV7A 1GGCH 5CIPH 3HNSH 3JZ7A 1I4FB 4OF0A 4Z7WE 5I74C 1LMKA 2I60L 2XIDA 4J8RB 1WBXB 3TO4D 1ZK9A 4HJJL 4YDVA 1IARB 4OV5A 2MNUA 1CDIA 1OTUC 3I50H 1ZGLM 4PJIE 1KC5L 5SX5K 4FQXC 4NNYB 4UILL 4WTZA 3BGFC 4JJ5B 5E94A 4LQFL 3ARGC 1BQHG 5ILTH 2FBJL 4Y4KA 5I17B 4PB9L 1YYLH 3TESA 4W81A 1LEKB 4QGTA 3GSQB 3OGOE 2P5EA 4K3DL 4KXZI 3VGAB 3UO1H 1TTGA 1MWAH 4NQCE 4CRPA 5I1LB 5IEHB 3VRLF 1H5BC 3NIDE 4G80B 4U6YB 4YBQC 1P5UA 4XHJC 2DBJA 5J1AA 1R24A 2DKSA 4EN3A 5TH2B 5FAAA 4G9FD 4HLZG 4BELD 5J9PA 4JRXB 4D9LH 4PUBH 4E5XA 4KV5E 4HUWA 3S4SG 1IFHH 1G0DA 4U1GC 1FVDA 5C8JA 3D69B 4Y16C 5LGJB 4F80A 4R2GD 2R2CA 3EOYG 4U1JA 5DFTA 1NLBL 5HDBF 4LQ1A 5IMMB 3S5LB 5BVPL 1DLHB 2NTFB 3MV8A 1GRWA 4QXUL 1CICB 1QNZH 5B38G 2VB5A 3LQAL 3C08H 4OZHB 5DT1H 4NRXB 1H3XA 5E4IA 3SOBL 1WZ1L 1T04B 4OLWL 4PJGE 5F97E 4EBQL 4RAUB 3V0VB 3T1FB 4UDTA 4ZAKD 1QBMH 4K8RL 3IGAA 3U36B 5DJ0B 2O5YH 1KJ2B 4TSCL 5T3XH 3QQ9D 1H0DB 1CDBA 4MXQC 1MFEH 1IVLA 3QUYA 1UM4L 5D1QB 1MELA 3VI3F 3ZDZF 4RWYL 4MLIA 4JPIA 2JIXA 1EEYA 2ZOLA 2LVCA 3KJ6L 4HWBA 4YIQB 3K2MC 3MA9L 2HWZH 2C5DC 4MSWB 3O11B 5AG8A 1HEZB 4X4XB 4MNQD 1REIA 3M45A 3O3DA 2FIKB 4J6RL 2XPGA 4HUUB 1S3KH 1SM3H 4P2RB 3WNPA 2Q8AL 4A6YL 5FHAH 2CKBA 1NCNA 3NCJL 4GRLD 4Y4HD 1FFNA 5F6HJ 4Z5RB 5HYIA 2F74B 5C6TL 4RNRA 5E8EB 2IBZY 1YPZB 5CP7B 5GJSH 4U1MA 1T03L 4F2MB 4NQVA 4F7PB 4D3CH 3VG9B 3TNMB 3QZWA 4LHUG 3G6DL 4QWWC 3HMXA 2R1YB 4UV4L 3L9RB 3I02B 3FO1A 4QXGH 3X17A 3T0XA 3KHOA 1OM3H 5KVFL 4MQ7B 3L3KB 2YMXL 3MRDA 3V5DB 2ATPA 4FQ1L 4HIEA 3EYSH 2XQYK 1I3RA 2X7LA 2ARWA 4K8RD 5F93C 3O3BB 1RZFL 3U2SB 5FM5O 4BZYA 1N2RB 1EXUA 3WNOA 2PETA 2WNGA 4H25B 4JDTH 2HP4A 2R4SL 4WNQB 3VRIB 2QSCH 1KB5A 3W9EB 1NMBL 4OD2B 3PDGA 2ICWJ 5C0RH 1LO5B 5BQ7B 2N7BA 1LEGA 4HMEA 1MI5E 3IS0X 1G6RA 1HILA 3GMRA 4YE4L 3VFSA 1ITBB 1A1OA 2EDXA 5DMIL 5KAQG 4P3CH 3TCLB 2VXTL 3OKMB 4HC1A 4KDWA 4JRYD 2FJHA 2FBOJ 4QHNB 4QYOA 3D85D 2FO4A 1KULA 3MCG1 3RNKB 3FTGA 2EICA 4IDLA 4S0SD 3WO4B 4NN7B 4G9DB 4DKEL 1A7NL 3IVKB 1NCCH 1KN2L 4DEPB 5EBMB 3MODL 5EBLA 4LPXA 3UAJC 2WK2A 4WENB 1G7LB 4YHOL 1OLZA 1RIVH 3RWEA 4WHDA 5IG7A 3MRRA 1YA5A 4EVNB 3BT2L 4LHJB 3Q6FB 5EC1B 1TITA 1EHNA 4ODHH 2IPUK 1N7ML 2ICWI 1AR1C 4P5TC 5ISZE 2YUVA 1S9WB 3V8OA 4ZFZA 1DVFC 3SJVB 2OZ4H 1W0VB 4FFVC 3RPKA 4JM2F 1PDKA 4X8XA 3VFMB 5F88B 3C60A 3IDMB 4MB4A 3SDDC 1T22B 1EO7A 4ZTOH 1BQLL 1ZS8B 4E41D 4JAMA 2C4FU 4OZ4A 3HZYA 2D31A 4OLZH 3TT1H 5IMKB 2WW8A 4RSVA 4NN6C 3GSXA 3CAFA 3SGEH 5D7SH 1YY8A 1HOCB 1A9EA 4OGAC 3TC9A 4G7VH 1FZMB 2DQUL 1U6AL 3OKYA 4WUUE 5FCUH 4APQA 2HAZA 1I8KA 1VFBB 4NQXA 5IMLA 2DMBA 3B3IA 2J8UA 4N0FB 3WUWA 4HK3J 1HINH 2NY3D 3GEWB 4L9LA 2R0WL 4UQ2B 2GFBA 1HKFA 1RSFA 4X9GA 4DGIL 1VHPA 4JFPA 4H0IA 4LPWA 3CD4A 2DL9A 3OGCB 1XF5B 3MRJA 4ELKA 4LNRA 1NAKL 4P57A 1QSZA 1DQDL 1S7WA 4RGNE 3VJ6A 3V79C 4PBWD 3BAEL 4KK8D 1R3JB 1K8IA 2W9EL 3G5YA 1AI1L 4GAJH 4ODSH 4FMFA 4XC3L 4K3EL 5GXBB 5MERB 2PTTB 3QJHA 2DYPB 3SY0A 4KKCD 1MJUL 3DSNA 2XZAL 3EJYC 4G8IA 3U82B 3BZFB 5D2NE 4F7MA 32C2A 2P24A 2ERJC 5M7QA 1D6VH 1I7TB 2FCBA 3CVHL 5KS9E 2OSLA 3QUKB 3RKDC 1OQOA 1WFTA 2Z93B 4K07A 3FB6B 3CDCA 4QHMA 4TUOB 3RIFF 3VXTA 2BVEA 5DRNA 4N8CH 4FMKA 5KANG 1GZQA 3QCVL 5DJXA 3L5XL 2RJMA 2XA8L 4M1GH 5ALCH 3MLWH 3H7BB 1J86A 4PD4K 1P4LA 2BSTA 5L2KE 1AGDB 4HBCH 4XCNA 4QHLB 4QRUA 3BKMH 1Q8MA 3NIGE 4PLNC 3KS0H 1SYSB 4G6KH 1KTRL 2VISA 1ACYL 2NW3B 5KSVA 3W11C 1AHWC 1BQHA 3BPLB 3KVQA 4WTXA 1QRNB 4U1LB 2HT2C 5J6GA 2W65A 1MCKA 1RJLA 1V7MH 2GK2A 4OV6F 1QFPA 2H32B 5IW3A 4W6XB 4K7FA 3NAAH 1KXVC 4OD1L 25C8H 4IIQA 1JI2A 1W0WA 3DWTA 5DRZB 4QRPD 1TPXB 4ETYA 1HZHH 4K23L 4KC3B 43C9A 3BKJH 5E6ZA 2BRQA 3OJVC 5AWNH 1I8LC 2C4XA 1KCRH 3LMJL 4G8EB 4MAYB 4DWHA 4LPUA 1P1ZA 3MLRL 5JNYB 4M3KB 5DYOB 4KKBD 5JOFB 3RI5K 1AGBB 3PWLA 4PGBB 4NN5C 3CMGA 3WDJA 1PG7H 3STLB 4NKOA 5JHLH 4PV8B 3O0RL 1CDHA 2ZP0T 5D70H 1CI5A 2AK4B 2PR4L 3FN3A 5E8NA 3WUZA 5J1TC 1CFTA 4FP8H 4ZYKB 4L1HA 4H8WC 4LLVB 2WIIA 4N0UE 2YEZA 4JANB 4BA8A 3WV0A 3A6BH 4JFFE 1BOGA 5EOCH 4P4KA 4S11A 3LPWA 1AQKH 3LS5H 1FORH 2J6EA 4M03A 5GZND 4LSDA 1ZT4A 1CLOL 4TNWF 5L88H 4K94L 3ULSB 3S8WA 4LOUD 2XZCH 5B8CA 4CAGA 3SKJH 4M7ZB 4X4ZA 3RGVD 2A9NH 1B2WL 5CUSH 5ITBL 5FM5M 3NACH 4BFGA 2CO6B 3RHWF 1YN6B 3Q6GL 1KUMA 4PJXA 2A6IB 2PO6B 5D2LE 5K9KA 1KCUL 5CP3H 4D9QE 2BK8A 2EC9T 3OKLA 5T5FH 4UIMB 3T0AA 3U79A 3TT3L 1OLLA 2NZ9C 1AJ7H 1ULVA 2UVFA 4P3DB 4HWZB 2BNRE 3MJ9A 1INDH 4WEMB 5EUKA 1CCZA 1SBBA 1J1OH 1ZLUK 1IT9H 5CFHA 3FMGH 2NY5L 3QFJA 3BPNC 2AJXH 3BW9B 5FYJE 5JUEL 2CUIA 1A14H 3PWPB 1ZAGA 3O4OC 4XWOC 4JPVL 3QPXH 1GOFA 3JV0A 3ZZ1A 2BVYA 1IAOA 1KPUB 1IZJA 5JOPD 2DF3A 3GUTB 4V2CB 5C0DB 2ZUQC 2VLKB 4PLKD 5EU6D 3QUXD 1WAAF 3CFIC 3HS0A 4GRWB 1QEWB 3RTQB 1JF6A 1J12A 5F7NC 3EJZC 2LE9A 4MZ2A 3QUZD 5HYJB 2DWDA 2EKSB 2PXYD 4MCZA 5DZOA 4NUGL 1DQMH 1B0WA 3RX7A 1DEEA 4MA7H 4Y88A 4TUKL 2YD2A 5FYLE 4NC1C 4L3ED 5HI4D 1XR8A 1N4XL 4GG8A 2UUDH 1VGEL 2NY4D 1QFWL 3BI9X 1SEQL 5HGHA 4U1HA 5F3HB 5F6IC 4X4YB 1K2DB 1FFOB 3CNKA 5JIIA 1TQCC 1QA9B 4BJLA 3D6GA 3KPSA 3RZCB 3MV7D 3G6JA 3IJSA 4PJHE 1K5NA 2BSSB 3BIKB 1OVZA 3P0VH 1J10A 1ACZA 1WQVT 3MLVL 2IAMA 4UQ3A 3GIVB 4HQQL 5IK3B 3SQOL 3EDFA 12E8H 4GG6F 5GRJL 2D7TH 4ZUSA 1OD9A 4U2ZA 1JGDA 1WZKA 3QI9D 4MA3A 2EC8A 4M1CD 3AREB 1JTTA 3BQUB 1B0GB 4M5YL 2AEIT 4M43L 1HCVA 5I8KH 2Z31A 3MCKA 5E2VL 1MREL 3UROR 3ARTA 4LF3A 1E28B 2EECA 1RK0A 3RVXD 1JWMB 5EIIB 4RMWA 5GS3A 3QUML 1A6TB 3H9SE 2OMNA 4BQBA 3F7YB 1RURH 3ULVE 3CFDA 5BRZD 1SBSH 2YZ1A 3O3AA 2XNAB 1XAUA 1NSNH 3FO2A 1ZA3A 1I1YB 3M1BA 5I16B 3P9LA 4CMHB 4I0PD 4PJ8C 2F53E 3U46A 5EZIH 4HS8H 1G6VK 1QSEB 3H9HA 4FTVA 1OAKL 5E1AA 1R5VA 4PPTA 1UWEH 2P47B 2X9XA 1NCAL 1AGCA 1YEGL 4X0KA 1CE6B 1C12A 2KPNA 4XVUD 3LRSA 1CTNA 5C0CE 1BVLB 3EO1B 2OJEA 5KSAB 3QXAB 4NRZA 3D1MC 4XNZC 2QQNL 4XVJH 1OWRM 3P2TA 1YN7B 4S1RL 3IDGB 3KAAA 2VSDA 4FQLL 5CLTA 4PREA 4LLMA 4NO3A 4G6JL 4OLXL 4L3AA 1KIUA 2BNQD 3OJMB 2ED9A 1YNTB 1JPTL 4XNXH 2VRAA 1YYMH 3DUSB 3PGDB 1HYSC 2H2PC 5F7WC 2AGJL 2Z8WC 3VG0L 2WBJC 2HT4D 2NLJB 2H1PH 1NFDF 3UTTD 4G8GE 5E1HB 3TBYB 1S7TA 5ANMB 3MCLL 3O8XD 3VDBA 4C57C 3T8XB 1IEAA 1AC6A 3TJEH 1KCSL 1T89C 5HGAB 3FCTB 5T1LD 4LEXH 4MNGE 4D8PA 2YC1A 4OJFH 2BOBB 1RUPH 1CU4L 2AJUH 2FGWH 5TF1L 3QPQC 3QYCA 5FYLH 1XH3B 1Y18B 3RZWA 3U6RB 1BZ7A 3CFJB 5E08L 4NUJB 3QEUB 1A3RH 4Z7UE 4UAOC 2DQCH 3RWIB 3LH2H 1JGLL 4GXUM 3T0VA 5F3BA 5I15L 5LAXA 4PRIE 3F12B 5HHVH 4OLUH 1YC7A 1NMCC 4IDJL 2YPLB 4CMMA 5ID0B 2EH8H 4FNLH 2D7OA 4X9HA 3MJ6A 3QWOB 1JV5B 5HXMA 3C9NA 1FDLH 3BWUC 4PR5A 1YECH 2KZ1B 5GGRA 3TZVD 5I1KL 1DANU 5D5ME 5GGSA 5A3ID 4X7TA 2RBLA 3DETD 4LSRL 3STZA 5KW9L 5FKPB 3RIFK 1IAMA 5TGBA 3ELAT 3DBXA 4BH8A 1JYWA 1P4IL 5EA0H 2PN5A 4ZD3L 4YEFA 2E5EA 4HX1B 5AG9A 3IFNH 3OJ2C 2EZ0C 2YHGA 3CFKA 1JPGA 4N5EC 1NEZA 5CSZB 4YXKL 5LBSH 5F44A 5HHMD 3MA7B 4P2QE 4JFEE 1JGEA 1AXIB 4H8WH 4UNVA 4JY4A 3WFBL 4KUCF 4KVNH 1UQSB 3DGGB 3TIDA 1FNGB 4ZS6D 1OF2A 1HWGB 5EO0A 1GGCL 5BMFH 1RHHB 4KTDH 3RWJB 3OKDB 1QO3A 3HNSL 4OCYH 4D0BB 3KPRE 4JO3H 2H26B 3IXTA 2R2BB 3BP6A 3MR9A 3OX8B 3DMMB 1WBXA 3I50L 3FRPG 3ZYJA 1DN0A 2K9UA 3PQYB 2NY0C 3U30B 3W0WD 4WVRA 4MXVF 5IHBA 5DGQA 3P30L 3WKMH 2IBGA 3CFEB 4IHOA 4AEHH 3D39B 5ILTL 1R5WB 4JR9H 4PJFF 5HVGB 2VABB 1XGUB 4P9HC 3GO1H 1YYLL 4JGJA 5CJXC 4NHCH 1S7RA 3IJHB 1CVSC 5MEND 1U8QB 4XB8A 3UO1L 1LEKA 5FGBC 1MWAL 5IEKA 4XNMB 3B9KB 4P4RB 4XMLH 4OBRA 4KTYA 5D1ZA 5IEHA 1AY1L 5GGTL 3B2VL 4HWUA 4G80A 3SPVB 4U3CA 4UINH 3PXJA 1FVEB 1ZT1A 3CXHJ 4PGEB 4TUJB 5E99L 2CPCA 3T4AA 1ETZB 1LHZA 4OM0H 4NBYB 3BD4A 2LTQC 1DBBH 2NW2B 1CDYA 1EZVX 4PUBL 4YR6B 5TH2A 3NGBB 3BXNA 4JRXA 1IFHL 4KHTH 4YHYB 4YX2H 4NQDE 1HHIA 1ROWA 1CK0H 4C4KO 3HE7B 1KIRA 4TNWK 2B5IB 3NFSL 3CUPB 4OZFH 4RMQA 3CDGA 4HDIA 3KDMB 5IMMA 1E4XI 1Y6NR 3WN5A 1QNZL 4HLJA 3D48R 4OLVH 3HB3D 2NTFA 4KI5C 1UACL 3C08L 1CICA 5DTFA 5DT1L 1D5MB 1FFPB 3DYPA 3BPCB 4OZHA 4O4YH 3RHWK 4L3CA 1QBML 2OR9H 4X7CC 4Y4KC 2E7LA 3GBMH 1RFDH 2O5YL 5F7DB 1NAML 3W82A 1HHHB 1S5HB 1I1FB 4TULH 3U7WH 5KBNC 4CVZA 1KJ2A 1Q9WB 2P7TB 3KPPB 1UJTA 1FZKB 3JUYA 5BVJB 2EXWD 3MGTB 3FT4B 3KWWA 1SEBA 1OARH 4LSSH 1FYTD 3ZTJH 5JTWA 3ULUC 2E7HA 4AG4H 3LN4B 2PYEA 5JW4R 5CILH 5DD0H 5IVXE 2VXUH 4YIQA 4MSWA 3O11A 3VI4F 1FGVH 4OFPA 3UBXI 5I75B 5DVMA 1C7TA 1KCLA 1PYWA 3RWFA 3ZYIA 1MIEH 5DJDB 5AAMA 4ZFOL 1SM3L 3AB0C 1P7HL 5FHAL 5JHDB 2X1XR 4HK3N 15C8L 4P2RA 3TO4A 5GGUA 1CFVL 1BVKB 4PP2A 3L1OH 2F74A 4NPYB 3HUJE 4MWFB 4D3CL 1JMZA 2YD3A 4F2MA 1TVHB 4F7PA 1NEUA 4QXGL 2D0FA 5EIQA 5I8CB 5KSBF 3NA9H 5IB1B 4ZUTB 3R06A 4MQ7A 3MRPB 1DBJL 1WUNT 4O2FA 2AEPL 3IF1A 35C8L 3IRPX 8FABA 3QIBD 1HKLH 4PJBB 2VC2H 1TTFA 1FJ1A 4DN4H 5IV2B 2Y6SD 3ZHLA 1MHPL 1U3ZA 4XP1H 5T3XD 1CG9A 4JDTL 2QL1A 1XGPA 3VFTB 2QSCL 4MVBD 1BFSA 4EI6B 2GHWB 3QH3B 4XBPA 3VRIA 5BOPA 2XN9D 1IGML 4YHIB 3W9EA 3QISA 4OZGF 1OGTA 1GOGA 1GGTA 4LCYB 1KFAH 1LO5A 3AS0A 3U7YH 5FV2A 3RWHB 4LRIA 4DUXA 3PP4H 4U33A 4P3CL 5E5MB 4KRMB 4CN6A 2VR9A 4J3XA 3LCYA 4N5UA 1FL3B 3TCLA 1G7MB 1IAIH 3OKMA 3N1QC 2W9DH 1Z3GH 2DIBA 3HE6B 3ILPB 3RY4A 3VXUB 3NCYP 4KJQC 2CQVA 3V7AE 1V8HA 1DQTA 1S8DB 3MC0A 1MCIA 2HFEA 4WHYH 5EG6C 3IVKA 2DTMH 2RHEA 1TETH 1RIVL 4PJEF 4LKXB 4JY5H 4XGZA 5DEFA 4L5FH 3EDDA 2FH6A 2GAZA 3QJFA 4EVNA 1BQSA 3S34H 1RZ8B 3Q6FA 4AH2B 3I6KB 5E4EB 3TP4A 5GS2D 4JLRA 5GISL 2OZ4L 1S9WA 4YLQT 4M9OA 3CXHK 1U8NB 1W0VA 4KI5E 1T5XA 5F88A 1R3KB 4OSUL 4PJ9B 1UXSB 1ZHLB 1OTTC 3E0GA 4HFUH 4LLWA 3GRWH 4EKXA 3WDIA 1AO7E 3ISWA 3OR7A 1A7PH 1KTDA 3UJTL 4OLZL 5D8JL 3RPIA 3W5NA 2P5EE 2EO1A 4X5LA 1J05B 5IMKA 5D7SL 1JN6B 4GRLA 4Y4HA 1Q0YH 4JVUA 4CN1A 2Y06H 5LQBH 4NQCD 1JNNL 3FJTA 3QDMB 3GM0A 4G7VL 5GRVL 3Q0HA 5HHQB 1HOCA 5CD3B 5I1JL 3RVWC 2Y5EA 5FCUL 5MEQA 1FZMA 5C0JB 1N8ZA 1X5YA 2NY1B 5H2BA 1VFBA 1HINL 4N0FA 1Y6KR 4NO0D 4YDJB 2HYMA 4UQ2A 3MPCA 3TBVB 1QKZH 2IFFL 3QQ4A 2JJTA 1NAMB 4QEGA 4JREC 5ETUB 2XT1B 2VJXA 4ELMA 3TVMD 1H8SA 1A6VH 4M61B 2APXA 3G5ZB 5GPRA 3PL6B 4R7DB 4K71C 5CD5C 1JGVH 4KJPD 1NFKA 4KZEH 4R6UA 4M6MH 4GAJL 5KOVC 1CIDA 1NBQA 3BH8B 4EQ3A 3ILQC 1CD8A 5I2IA 1L4IA 2V17H 1GC1C 4NM4L 5C09B 2PTTA 4MQXC 3HKFA 5D93B 3MOQA 3K3QA 3ABZA 3DO7A 2E27H 2O5XH 4UB0H 3P11H 3IDIB 4JRYA 3TBWA 4Y19E 3F7QA 3PHQB 4X6DB 3F7VB 4WW1B 1PSKH 4L8DA 1MFNA 5IB4A 1FLRH 3SGKC 4C56B 4HIJB 5FK9A 5F7FA 4KY1L 5I1EH 4P9HH 1EBAA 1HNFA 2E3VA 3HPLA 2VAAB 3BE1H 3D2UB 2F8VA 4L9LC 5ALCL 3MLWL 3GSOA 4QF1B 1JGUH 4UIKH 4I2XB 3TPKA 5I1CH 3H7BA 4UU9B 1HXMB 3FRPA 2X4RA 4JY6A 4LCIH 5KVEH 3BKML 2XWBA 4O51A 2HH0H 4IRSC 5CKAA 1X5AA 2BX5A 4UT7H 1VADB 4Y2DC 3O3EB 5I1DB 1DQJB 1RV6X 3EOBA 2ZWLT 2P5WE 2CRIA 3NCYS 1GCFA 3AFLA 3BD5A 3PDOA 4U1LA 5IWLA 1PLGL 3L3HA 5D7JD 4E41A 3O2VH 1ERNA 4LVOC 4PJ5B 5FYKE 2YN3A 2HVJB 1WJ3A 3MO1B 1U8IA 2DM4A 2NMSA 4MDIB 4L8SB 3QEQB 3NABH 1HZHL 1P6FA 5DRZA 4LLYB 1K4CB 1OTUD 3O4LB 3G6AA 1TVDA 2FL5B 4XAWH 3MRNB 4MAYA 3QO1B 4MCYA 4DTGH 4FQXD 2CDGA 4Z7NE 3VFUA 2FX7H 3ARGD 2WSKA 2LAAA 1MI5D 1PG7L 4Y4FC 5JOFA 3G5XA 1AGBA 3ES6A 3GMNB 3UTQA 1DSFL 1G1CA 1JVKA 1I85C 3CDYA 4WRLA 3U9UB 4LL9A 1U8JB 4X4MA 2UV3A 4KQ3H 5ESAA 4EDXA 2AK4A 1J87A 3ULUH 2AKRB 4YBQD 3T0EB 3UTSB 2XKNB 4XHJD 1RULH 3EFFA 5FOJA 1OAQH 1WBYA 2B7DT 3A6BL 3P4MB 2QV2A 4JANA 1FL5A 3KJ4C 4PTUA 4TTDC 4M6OH 5EOCL 4M93B 2YXFA 1JZ4A 1TCRB 2M26A 4Q9RL 1AC0A 3LKSA 4Y16D 2EDOA 1FORL 2DQIH 5L88L 3P0GB 4IIQC 4PIRF 4WFFE 2GJ6E 2DQJL 5ISZD 2JF1A 2XZCL 5CZKA 2ZUWA 2NY2C 1BFOB 2A9NL 2V5TA 2AJZA 4Y5VB 2WP3T 3GMMB 3NACL 2DKUA 5BZDA 1LK3H 4NWTH 2FYYA 2KDGA 5E2JA 3X13A 1G7JB 1A6ZB 3L3GA 2A6IA 2HFFA 3BJ91 5T5FL 3KS0J 4JPWH 1AJ7L 1NLDH 4OQTL 2BVOA 3EYFB 1INDL 4WO4C 4O58H 4HWZA 5AZEL 1J1OL 1IT9L 4MXQD 4TQEL 3FMGL 5ACZB 4HWBH 2AJXL 4NHUA 1U36A 5DVOA 3BW9A 2X4QB 2YD9A 4JG0L 5CGTA 3E3QC 4U6HB 3QPXL 1MVFA 5FF6B 2DQEH 4ISVB 4P4KC 2CKBH 5DJ6A 5C6WH 4KUZL 1LP9F 5C0GB 5SWSD 3EO0A 2L0DA 5E2UH 3BDXA 4HV8B 2OI9C 2B4CC 5IBTL 2DQGH 1B9ZA 1Z0MA 3EYUH 1QEWA 3VWJB 4K9EC 1EJOH 5HI3C 5B8CC 3QNYB 4RGND 7FABH 2EKSA 4EDWH 3MLTB 4KTEH 4QWWD 4G6AC 5I0ZA 3JV4B 5GRUH 4QY8B 3U0WH 5L9DH 5EUOB 4QCIB 3F5WB 2NXYC 1VACB 1I8IA 4MA1C 3CVHA 5FYKH 2RGSA 1R3LB 1KBGH 4C54A 2WZPD 1SY6A 4IS6A 5HHPB 4ODVH 2R0LL 2C1PA 2OTUB 4JVPA 3HNTL 3REWB 4UT6H 1G7QA 4FZEH 2Q76B 4ONHB 2GCYB 4WW2A 2I24N 3LQZA 2IMMA 5D2LF 1QA9A 4JGMA 2PF6A 3VH8A 4S1DD 3RZCA 1XCTB 5BJTA 4AYFA 4ODXA 2IJ0C 4NWUH 4OCWH 5EOTB 3ARYA 1FNLA 3LDBC 12E8L 1KB9J 4P99A 2D7TL 4XP4L 3QDJA 5INDA 5EORH 1ND0B 2XACC 2ILLA 3S35H 5L2KD 1O7VA 3C2SA 2DBLL 3VFWB 5I8KL 1X5GA 4GMSL 1IE5A 2CLVB 1B0GA 4ZUVB 4RMTA 5BS0D 5DVKA 2H3NA 4XPHH 2P8PA 4GMTH 5IMOA 4HSQA 1EO8L 3ZHKA 4GUPB 2ICEB 4AZ8A 4YHLH 4HKXA 4XMKH 1HIMH 1JWMA 3NZ8B 5IJVA 5EIIA 1SVCP 2DRUA 1RURL 3SKOB 3UAJD 4PJCF 5B3JE 3F7YA 4JKLA 1IC4H 2XNAA 5D6CB 1WIUA 2A1WL 4PBXA 5IVOA 4ZNEE 4HS8L 4JKKA 4P5TD 3THMH 1QSEA 2FLBT 2LU3A 1DVFD 4WUUB 1A21A 3GMOA 2IAMC 2ICWB 4DZBB 5CJBA 5DHXB 4OUOA 1NCUA 1J8HE 1GC1H 1BIIB 5KSAA 5EZLA 4XVJL 3NMEA 4NGHL 2FZ3B 1PKQB 1S7VB 4GKZA 2UWEE 4PJDB 3VFVB 4PRBA 4CUCA 3DHJA 4E0RA 1K8DA 4NZUH 1J1PH 3QUXA 5HY9B 5IB3B 1CD0A 2Z31C 3DO3A 1R0AH 4AIZB 5FYJL 1YYML 4OGAD 4RAVA 1YNTA 2PXYA 3C8KB 2WWKO 3HAEG 4M5ZH 3PGDA 2CR3A 4QRSB 4G3YL 5ID1B 2XTJC 2H1PL 3MRQB 4WJ5A 1N6VA 4L3EA 5I73B 3MGOA 3E3QE 2EDNA 3OG6B 4JFFD 3ALPA 4XI5C 5GSVB 1IC5H 4YHNA 5AYUL 1J5OH 3CU1A 4Y1AB 43CAA 3Q48A 1C5CL 4IOIB 5E00B 1RUPL 3FCTA 1DL7H 2AJUL 4NP4L 4R9HA 2FGWL 5ALBH 4NKMA 3MV7A 5FYLL 2OMBA 3TV3L 3NPZB 1MLCA 1MFDL 4NKDB 1A3RL 2YPVH 3SDXF 2DQCL 5E6YA 1M7DB 4NUJA 2Q20A 3V6FA 2AJVH 4PJXE 1KG0A 1F58L 1Q9LB 4OLUL 3RY5A 5FB8A 4IRZH 5TQ0L 3BHBA 2EH8L 1CDGA 3KYOA 4FQHB 1TDQA 3HCVB 2EXYC 1CXIA 1JK8A 2BNRD 4X6FB 3EJYD 4BH7B 2GT9A 3PGCA 1JV5A 4OB5H 5E9DE 2FECI 1CS6A 5EO1A 1EHAA 5FYJD 1UYWH 2VWEE 3ZT7A 1WCBB 2PW2B 1T5WB 1T7VA 4I13B 2DI8A 5FKPA 5I76B 3EFDH 2V5MA 5BRZA 1HSBB 5DUPH 2CJUH 3DX8B 3GNML 3NFNB 1H8OA 2PCPB 3IFNL 1FCCA 8CGTA 1ZLSH 4I0PA 4HX1A 1IGTA 2V2TA 3S3PA 3IDXH 1OGAE 2VH5L 1ZEAH 4PLOB 4OTXH 4QRQA 2HRPH 3ZMRA 1MCQA 1E27B 4KVNL 1C16B 4LPCA 2FJFB 1GAFH 3C6LD 5FYLD 3ULVL 4MJ5B 2EEBA 3BDYH 2YUZA 3B83A 4KTDL 1G7HB 3I3EA 1VA9A 3DLQR 4JO3L 2BOCB 3AXLA 4D0BA 1MCNA 4NYLA 5F9OH 1YEFH 2X4TA 4LBEB 3VXSD 2A73A 4HLZH 2RCSH 3D3VE 1HH9A 1IGCH 2UZIH 3WKML 4QO1A 1BJ1H 4N0CD 4AEHL 4KJYA 4U3XA 3X11B 4JQIL 4JR9L 1U42A 1NFIA 3JSSA 1R5WA 2OTWB 1D9KB 2JK5A 4NO2B 4NHCL 3O8XA 2VABA 3AGVA 1XGUA 3D87B 4WFHE 4Y5XB 1SJVA 3QUMA 3RL1B 2MQ0A 3F58L 2F15A 1U8QA 3UCRA 3N85L 4HFWB 2XRAH 3PWNB 5T1LA 2O61B 3KPQB 2NX5E 3MACH 4I18B 1I9IL 5IW6B 3EGSB 4CVXA 4UINL 4YHPA 2VN4A 3CXDL 4X6EB 4TUJA 4PGEA 4M7LH 1DBBL 4QNPF 1U8HA 4K7PY 3IAQA 1S7UA 3QDGB 5E0QA 5BV7B 4KHTL 4S1SH 4YX2L 4YR6A 5F7MC 2IG2L 1U8PA 3QHTC 3H9SD 5J11C 5LWYL 3ULVD 1LQSR 5C0AE 4XVSH 2J6EH 2C7UB 1CK0L 5ECJE 2FO1A 2B4CH 1T6VN 3LN5B 3MX0A 2F53D 3RVTC 4DK6A 1IJ9A 2DQFB 4OLVL 3KDMA 2UUDK 4A2LA 2CUMA 4KHXL 3VXMB 5C0CD 1E0OB 1I9JH 4HWNA 1FFPA 3BPCA 2NNAB 4U1NB 3UDWA 3GBML 3ROOA 1G7PA 1KIPB 3MLSH 3WL9B 1N26A 4TULL 3LIZH 1F4YH 2QKIB 3R4DA 3TLRA 1BQUA 3KPNA 1HHHA 3GMLB 2X4SA 2NZ9D 1UVQA 4ZUWA 4TRPH 4F33B 5KANI 1LO0L 5E56A 1Q9WA 5D1ZC 3MREB 1FZKA 4RFNB 3BP5B 4JM2B 2V2WB 4AG4L 4U6TA 1IAKA 2OQJB 5DD0L 3MRBA 4QRPB 5C0IB 4Z7OE 2A6JA 1FGVL 2JCCE 1BM3L 1P53A 3LVEA 4G8GD 4R96A 1MIEL 1KOAA 3NN8A 3CFBA 2HLAA 3QEHA 5DJDA 1A6WH 4HKJB 4I77H 4R0LB 4HKZB 1ZLVH 4DUVA 2XWJB 3L1OL 4RIRA 2GQHA 4OZIF 3UXFA 4HK0A 5IR1B 2IPUG 3EJZD 1PY4A 3CSGA 1FO0B 4ERSL 3W0WA 4HS3A 4ODTH 1CICC 4PRPE 1CLZH 3PWJB 4C55A 1D3CA 3RDTB 5FHBH 2J4WL 4R4ND 1VFOA 1JNJA 1EX0A 3NA9L 4YHML 2VDOH 2E7LC 2BP3A 4NT6A 4ZUTA 2DM7A 3MMEB 1A8JH 3FQXA 5MENA 1HKLL 2RR3A 1F3DH 3LD8B 1QYGH 3S37H 2H2SD 4XP1L 2IFGA 3FB7A 3TH4T 4DK3A 1XIWB 3RWGA 1KLFA 1TFHA 4HIXH 5CMAA 5D1QC 1MHCB 3ZE1F 1E6OH 3QH3A 1KSRA 5F7LB 4QXTA 5HHXH 1KLUA 1BEYH 1F6AA 1MFAL 1QZ1A 1KFAL 1WC7B 1U8LA 1QSFE 3U7YL 3OG4B 4R4FH 3SBWA 4GAYA 4D94A 2EIZA 3PP4L 1D6EB 4XH2B 2JJVA 5D71L 1YNKL 2FRGP 4JKMA 3KXFE 3ARFD 1BFVH 3TO4C 3K2UH 4BZ2L 2W9DL 3O9WB 3LB6C 3QAZB 4LVHB 3DX7B 4FS0A 4JO1H 3HE6A 3VG9C 4P2QD 4JFED 2Z91B 4KMTL 3QHZH 5C6PB 1R5IB 2YRLA 2F5AH 1GGIH 2DTML 3O45B 4BSVA 2EDLA 1FN4A 5JPNB 2APBA 3CMOH 4MX7B 3BO8B 4JY5L 4RDQG 4LKXA 3UPCA 3KPRD 5A40E 3S34L 4NQSB 2W59A 1EAJA 4M8QB 3UTOA