4BQBA

Crystal structure of the fn5 and fn6 domains of neo1, form 2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
195
Chain Sequence
PMMPPVGVQASILSHDTIRITWADNSLPTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEOGENIN
total genus 35
structure length 195
sequence length 200
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqbA02
5BRZD 1EIBA 2IQ9L 1TZGL 3OL2A 2C1PA 2BP3A 3GMPB 3SGEH 1K5NA 3TZVB 1I85C 3K3QA 1F58L 4RGNB 1OAKL 5D7LD 2B4CH 3NIDF 4I13B 1IGTB 1X5IA 3MUY1 3VE0A 3OPZH 3MCKB 4PJCF 2FO4A 3OXSA 4BFIA 5B4MD 4P2RB 3KPNB 5C0RH 4KQ4L 3UYOD 2ADGA 3LPWA 5E94B 5KTEH 5J57B 4G3YL 1QSEB 1QRNB 1CFSB 1A14L 2CGRH 2W59A 2VLME 3VXSA 1DL7H 4QHKJ 3LHPH 2CKBL 1ES0B 4J4PC 2RFXB 1DQLL 1W0VB 2EDRA 3CDCA 3V5DA 4PJGE 4PFEA 3BZEB 1CFQB 4FQXB 3MLXL 4MVBD 4GKSB 3WN5A 4ELKA 5HXMA 5EZJB 3O0RH 1DQDH 4BK4A 3RWEA 4NYLA 5I6XC 1FFPB 3C5JA 5BO1L 4HS6B 1AE6L 1AO7A 4E0RB 2A77L 2CDEB 1VFAB 1LO4H 3MRFB 1A7RL 1EUUA 1JGEB 1KJ3L 5ENWB 1HQRA 4HUVB 4MAYC 1DN0A 3AREB 1NCBL 5IMKB 3UYPA 1N8ZA 4ZO8A 4IM8A 4UOW1 5F7FA 3WHXB 3T0XA 2W1NA 1FSKB 3DO7B 4TNWK 1JFQH 2BVYA 1FCCA 2FD6H 4FQLL 3SN6N 3RI5K 3MGOB 1TDQA 3L3OA 4OT1L 3IRZA 5FYLD 5J9PA 5DVOA 5HJ3B 3BZFA 3BP4A 2AABH 1HH6A 4AL8H 4ZXBB 3HPLB 1I1YA 4NUJB 5C07E 4AJ0A 1SJVA 4HWZA 2AXJA 3O6LL 3DMMD 1I7UB 3AB0B 5D8JL 1I3RB 4NBXB 5D1XD 5F71A 1BGXL 1NGYB 4Y5XC 2XZCH 3TO4D 4U49A 3RVTD 4OLYL 1ZLWK 3NPZB 4M8VA 5ETUA 1Q9LA 2N56A 3NFPB 3G5ZA 3QZWA 3FHAA 3VDBA 5JUEL 1OAQH 3S4SB 1GGTA 4JY4B 4WV1C 3QIBD 2V2TA 4CVXA 4XAWH 3X3FL 2JLLA 4HS8H 4JGMA 2AGJL 2EIBA 4L29A 3G9VA 3B8SA 2V6HA 4P5MA 4P9HC 4F57H 1D5MB 4YDJA 1KLUB 1J11A 3O2DL 3QCTH 4OIIL 1KNOA 4M6ML 4XTRC 1FORL 3RY4A 1DQJB 4KTYA 4CKVX 2VH5L 4XPTL 5IKCA 3UTPE 4H8WL 1JMZA 5DXWA 3ZSTA 1DVFB 4KXZI 3OAUL 5T1KB 4EI6A 4H26B 4JEGB 3GIVB 1VKXB 4UMGA 2EKSB 1WISA 1ZHKA 2PYEA 1AXSA 1EEUA 5B8CC 4F9PC 5J11C 5MEOA 2FHBA 4BKLA 4NO0D 1WAAE 3MJ6A 5D7IA 1MI5E 3P4OB 3FOLB 5DD3L 3SQOL 2BOCA 4HV8B 3BDYL 5F7DB 4HWBH 3L3KB 4MAYA 1YJDC 5D7KD 1I7RA 2DQTL 1A6WL 1G7LB 5FF6A 1VEPA 4OLVL 3C60C 5EIVA 3OKEA 1QBBA 3ROOA 2FLRT 3WNMA 2P7TB 4YBLB 5IV2B 3BSZH 1CLYL 2XWTB 1U41A 5EU5B 5EC2A 2BRRL 1G7JB 1MAJA 3NFPA 4CADA 5D7KE 3O9WB 1TXKA 4GOSA 3MRRA 2V7HA 1PY9A 3CZFB 5C9JB 2I5YL 5KBNC 3NZHL 4HZAA 3HNSL 3HRZB 32C2B 4JJ5A 1N7ML 3V4PH 4QHNA 3WNOA 1MELA 2W9DH 4S1DC 4W6XB 2YD7A 4LHUG 3QEGH 4K3HA 2D7TH 4Q97A 1A7QL 1WZ1H 4KI5F 1JPGA 4OD1L 4Y1AD 4A2MA 2NY7L 4NZTL 3TNMA 1OPGH 1C16B 1U8OB 4YGAB 5CCKL 1YNLL 2HG5A 2ZG1A 3QDMB 3VGFA 5F96L 1XR8A 1TVHB 4YE4H 4OUUA 1FNEB 1IC5H 2HKHL 4M43L 12E8L 1YEGL 5T5FH 4OD2B 5KG9B 3QXAA 3QWOB 2VXSL 3REVA 3ZYIA 3C87A 4RQQB 3TEUA 1ED3A 4Y2OA 2EDXA 5HYJB 4L8SB 4YC2B 2Q6WA 1F3JA 1ZT1B 3NFSH 5E2VH 4F33B 4XGZA 1KTLB 1AQKH 1J8HE 1NFDF 1NJ9B 1GOHA 3BEWB 1MQ8A 2R1WB 3BYYA 4XX1G 3MRNB 5ADOL 5C0CB 1NEZG 1GPOH 4ODSH 5EUKA 3PF2A 2ITDA 1KG0B 3O81A 4HPYL 1O0VA 5CLTA 1S9VA 4LNVA 4TULL 1RQ5A 4QRQA 1DUZB 4L4TA 1JVKA 1EFQA 3WKNA 2DQGL 2A0LD 4JREB 4NFCA 3ZHDA 3I6KA 3D39D 5IFHH 1X5LA 2HVJA 3QI9B 4V1DD 1WCBA 3MODL 3RTQC 5JLZA 4DQOH 3WFEL 1EMTL 1MCSA 2N1KA 1J1OH 1RJYA 2VR4A 1KB5L 3QWRA 4DAGH 3RZCB 3IETA 4QTIH 4XCYB 3BISA 4Y4FC 1FAIH 5MENA 3SBWC 1CICC 4WW1A 4M3KB 4M9PA 4V1DE 3WIHA 3M8OH 1AGBB 5I1DA 2Z92A 4OFPA 4LBEA 4F3FA 4MLSA 4YWGH 4U1MA 1KN2L 5IEKA 3KJ4B 2J88H 5DEFB 2R0ZL 4PRID 3QXUA 3QDJD 5C0GA 3I2CH 1C16A 3SKNA 2PW1A 3LSOB 5F7EL 1VGEL 2DYPD 2FB4L 3EDFA 2HH0H 3G5YB 3KS0J 2Q7NA 3BD3A 5B8CA 2GYSA 4NC1C 2NY0D 2YK1L 4M6AA 2P1YA 3QR2A 2RHEA 2CRYA 4KRPD 5DMKB 2CKBH 4LSUL 1CD1A 2RCSL 4JRYE 2IF7A 4PRIE 1U92A 3QIBB 3TBWA 2Y4SA 1NLBH 4PJFF 5ITBL 1JGLL 3A6BH 1KB9K 2DF3A 3GMMB 4NKIL 5D2LF 1EV2E 1SJHA 4MNQB 5SWZE 2QQQA 4WHCA 2G5BB 4APQA 3ZTJH 4PRBA 3N50A 4D2NA 1MCBA 4JRYD 5DZNA 5IUSA 3UTSD 5MP6L 3IU3A 2BSRA 4G9FB 4UTBH 3LB6C 3VMPA 1P84J 5E8NB 1PFCA 1UFUA 4U6YB 5CJ8A 3U83A 4IRSB 4M6NH 4OLUH 5K9QG 4NKOA 2HVJB 4YDIH 3GMNA 3DXAE 5FUZL 1S9XA 4HAFA 2WV3A 3E3QC 4E42B 4MHHG 3U9PH 4DCQA 4U1SA 1E27B 4UQ2A 1GXEA 1F42A 1YPZE 4P3CH 1KBGH 3O4OB 3VWJB 4RAUB 1ES0A 3BD4A 4OM1L 3QO0A 5FGRA 2AEPH 3QI9C 3X13A 3MV01 2HN7B 5HHXH 3P11H 1ZA6A 4XVSH 3U7AA 3HB3C 4Y2DC 3UTQB 3DV6A 1BFVL 2A1WH 4R0LB 3CH8A 4P46D 3SKUD 1D5IH 3BI9X 4RMVA 3KWWB 4PYHA 4G5ZL 2XZQH 4JM2A 4HXAL 5IJVB 3BESR 5DJ0B 2CDEA 1HHHB 1CLOH 1GH7A 3EHBD 4ZUTA 2DQDL 3SGKC 4M02A 4U6HA 2P48B 4ZFOL 3MNWA 4HUNB 3QUZC 4KKNA 2C3WA 3BPOB 5GRJL 4FXGB 5EBWA 4X6DB 3FMGH 5GJTH 3K7UA 3OWEA 4HIIB 1W72H 1MLBB 3MRMB 5D1ZC 3GMMA 3QCTL 4G80A 5HHOB 4M7ZC 1CZ8L 3N9GH 4JZJC 3JV6B 5I1AB 2AEQH 4XCNB 3FT2A 4HKZB 5B38A 3UC0H 1JNLL 1G7QA 1Z9LA 2GTZA 5INCA 4DN3H 2NYYD 3U36B 3OZ9L 1I9IL 4XWGH 3DGCR 1XH3B 4Y4KB 3QB7C 5E5UB 1CICD 4OCXL 5CUSL 2F8XC 4I0KA 1QNZL 1AY1L 1NGZA 1ZS8B 2Q8BL 2K7PA 4W6WB 5MENE 2WQ8A 2Z35A 1MFEL 1HHGA 4CDHA 4I0PD 2HFFB 5CINL 1OVZA 2W0FA 3VJ6A 1TZGH 1E0OB 3AU1B 1HYRC 3MZTA 5D7SL 1E6JH 5JXEA 4PTTB 1U95B 3PQYD 2M2DA 1X5ZA 4GLRI 3MLZH 3TJEH 2EC9U 3CMOH 35C8H 3KYNA 3V6OE 2X7LB 1MCPH 4F7PB 3QHFL 3ROLA 3CX2A 3V0WH 2FBJL 3QDGD 4P5TA 4QXTA 4Z77B 3RHWF 3VD5A 4I5BA 1T83A 4JN1L 3QUYB 2BRRH 4CL7A 2EH7L 4RA0C 1JF1A 1JZ8A 1A14H 2WWMD 2CDFB 1RZ7L 3EFDH 5SWZA 3FT4A 3NBNA 4JY5L 3ARFB 3TN0D 1S9WB 3WFHB 1K6QL 2ZKHH 4F37F 2F5BL 3GJEB 3DETC 1ZTXH 4FQ1H 5IT2H 4RAVB 2OL3L 4PR5A 4D0BB 3QG6B 3T3PE 3ULVL 5DJZA 4JRXE 5M7QA 1SEBB 2QSQA 4FFYH 1BVKA 3CVHB 3QUXB 1DUYA 2FYYA 3LKRA 5JNYA 1AE6H 3BAEL 1MCQA 1DSFH 5T3ZE 1I1AD 3O3AA 1U8JA 1ZAGA 2NLJA 1H8SA 5ANMB 4OI7A 4TRPL 3K8LA 3G04A 4NUGH 3FQTB 5JW4M 1LEIA 4V2CB 5ISZD 1ZKAA 5J12B 4Y5YC 4QWWD 1A3RH 2EDNA 1GAFH 1N4XH 2GJJA 3PDDA 4LKXB 2ESVE 3MREA 4MYWB 3GRWH 4HH9A 3DX8B 4X99B 4OJFL 5F1OB 2UWEF 4NO2B 3VA2C 3RU8H 4FTVD 5I1GL 4KPHH 1XIWA 3WIIH 3O4LB 1QLRA 4RGNC 2JIXD 1WZLA 2I9LB 3EZJB 3LOWA 2QSVA 4FP8H 5E03A 3R06A 3NTCL 4X4YA 1BGXH 2BCKB 4IMKA 1XFPA 4Z8FL 3BKCH 4HBQA 4ODHL 4X98B 2R2BA 2NZIA 5FGCE 1MNUH 3CNKA 5E1AB 4QCIB 4F15C 1KIPA 2D7NA 3UTSB 1U8KA 1RZKC 3Q6FA 4YDLB 2DQGH 1KJ2L 4WU5A 4F7MA 1CR9H 1Q9OB 2F53D 5BO1H 4NIKB 5KSBB 3RVUD 1UT9A 4OGAD 4KZDH 4YQXL 3SGJC 4D0DB 3S35X 1YN6A 3VGEA 4FQJH 4LF3B 3MV7E 4DW2L 4QGTA 5HI3D 2YMXH 3FAWA 3WHE1 4YHIA 2VXQH 1IGTA 4JZJA 4YZFE 5GGRB 4DZ8A 3J8F7 1T3FB 4RQQA 5ICYA 4F2MB 4GUPA 1IFHH 2Z4QB 3BFOA 4LVOB 2F54D 4PLKD 3S9DB 3S34H 5HHQB 3M8OL 1Z0NA 3WJJC 3ULVE 1EEYB 5EFIA 3VFSB 1W72B 2FCBA 5CSZB 4UDTA 1SQ2N 1WFUA 4FNLL 3FQTA 4F8QA 3DVFA 3MA7B 4M48L 4LPXA 3PGCA 4C55A 1IGFH 4HC1H 4XVUD 3WNNA 1T1YA 3WN5B 4ELKB 4P4KB 1ZGLB 3VXTB 3QHZH 4NOBA 4DUXA 4NCC2 5C0RL 2OK0H 4NOFA 1RHFA 2P8PA 3BDYH 4NO2A 2K3TA 3RKPA 3UZQA 5FOJA 1IRAY 1J86A 2A6IA 3RX7A 1GYAA 2VDML 1TQCC 1NCWH 4MXQC 4NM8H 5DRNB 1WIOA 3VGHA 5EPMA 1BAFL 3U2SA 1F4WL 3EW3B 4RGNE 3AVEA 4PGDB 3L3JA 3MLUL 2MPAH 3RPIA 1SBBA 4CW1B 3G5XA 4MMZC 5D93B 4IRSC 4WI8A 3P73A 3B8YA 5DJCB 3PP4L 4KKCC 3TT3H 3G5VA 2NY4B 2EDOA 4RFOH 5DSCB 1OWWA 1YUHB 2H2SC 4JVPA 2EYRA 1XGRB 3LKSB 1KCUL 4LLMB 2BSSA 1PLGH 4HHAA 1LE9A 1NCBH 1YECL 2CDGB 1N0XL 3R8BB 5GS0C 3B6SA 5SWSA 3ZDZF 1NAKL 4Z0BH 2P5EB 4PJHF 4RCAA 5CGTA 4G8GD 1A02N 5DMGC 3TVMB 4K8RH 2XTJC 4J1UA 1MJ8L 3G6DH 4B53A 2X1QA 1S7XA 4M00A 4QXUL 3T1FA 4JO1H 3OXRB 2Z0BA 5TF0A 1RVFH 4HF5H 4DEPC 2W0KA 4R3SA 2J3SA 1P6AB 1JHTA 5F96H 3H42H 2YD1A 2CKBB 2BDNL 1P4LA 4Y4FA 1KPVB 1G6RH 4X7DC 1HQ4A 1ZHLA 1CXLA 1M7DB 5HVHC 1AFVH 4M7KH 1WJ3A 5I8EB 4DUWA 4DK6A 1OGAB 3HE6D 5EOCL 1AHWA 3NFSL 1AGCB 3VDAA 5B3NA 3MRGA 3BP5B 2AK4A 1FL3A 3UBXB 4EN3B 4UNUA 1FV1B 4POYA 1WTGT 1NCNA 4N0UE 2V5SA 2F58L 4A6YH 2DBLL 3BUYA 2EKSA 5AWNH 1EHLL 1EGJH 4U6XB 2P5WE 2OQJB 4QRRB 3GHEL 4ZFGH 4TOYH 3P73B 3QQ3B 4RRPA 3TIEA 5DUPH 5IF0A 4KJQC 3NZHH 5GGUA 1ZA6B 2UZYB 4GW5A 5L8JB 3CSPA 3SDDB 2DQCH 2HRPH 4M61B 2C3HA 3RWCB 2YR3A 4LDLB 5DT1L 5ISZB 4I9WD 3BZ4A 5A40E 3KYAA 5A2LH 2B20A 1JI2A 4JFPB 1BD2B 3DV4A 4YAQA 3TNNA 5M95B 3HC4L 1M71B 5TGBB 3QO1B 1FNAA 4M1CC 1T66C 1UQSA 4KK6D 5CEYA 3S97C 1RJLB 1IC5L 4PGEA 4EXKA 4YR6A 4ETQA 2PYFA 4EUPG 1NDGA 1Z6JT 1FJ1B 2XY2A 4OLYH 5D96B 5L8KB 3V0WL 4JRYA 1RY7B 3L9RA 5B22A 2VITB 3I9GL 2IWGA 3QQ9D 4WI6A 1T2JA 4JPVH 1O7SA 2KDGA 1HKLH 2C1PB 2NX5D 2ZUVA 2GFBB 1V3LA 3H7BB 4BK5A 1CLYH 1FE8L 5F7LB 1LEKA 1NLBL 2H45A 1YC8A 5D9SB 4F57L 3MV9A 4XP5H 4QLRA 5F97E 1J10A 3QH3A 1WLHA 3VW3L 4YHML 4S0SD 2VLRD 2NZ9D 3GHBL 3AM8A 2PUQT 1TPXC 1IC4L 2KKQA 5F9WC 2YD8A 4ZAKD 5EH1A 4BH8A 1J12A 25C8H 3MZGB 4R97B 5E95B 1FC2D 3REVB 2DWDA 1PG7H 5T3XE 3KLSA 1T89C 3JWDL 3BHBB 1RJZB 2LU3A 4PGJA 2Y5TB 5HGDA 1E28B 2G60H 5ICZB 5DZLA 4L9LC 3OTTA 1KLFA 1UYWL 2G2RA 1ZT4A 4D8PB 5KSUB 4PBWD 5EWIH 3TIDA 5I1EL 4X6CE 5C6WH 4HUWB 3DVGA 1TITA 5E8DH 5T3XD 2CDFA 5GZOD 5CJOH 3A0OA 1PD6A 2Q7YB 2HLAB 5EIIA 1YEIH 2HTLD 1AO7D 3MRBB 3PWVB 3OG6B 4GAJL 1YNTB 4LLVB 1ZK9A 2BK8A 1FNGB 1EVTC 1IGJB 2X40A 5E2VL 2YD6A 4L9LB 3MROA 1XCQB 3QI9A 3W82A 1AQKL 2BHUA 3U7YL 5JZ7D 4S2SB 2RCSH 3VFVA 4DWHA 4PP1D 4NKDA 4Z7WE 1BJ1H 4O2CB 1DVFC 4L4VA 4TUJA 4ZXBA 15C8L 3O3UN 4EN3C 4TSCH 3OBAA 2Z8WC 3KXFD 2AV1A 1IM3B 4XNXL 3VFPB 4F9LA 3X14B 2Y6SD 4LCCC 1BFSA 1AKJA 1L7IH 1KTDA 3AAZB 3GO1H 5IFHL 1PQZB 4M8QB 2Z93B 1I3GL 4G6FB 3UYRH 4PG9B 3SPVA 4C58B 5B39A 3GMLA 5I75B 5JW5B 3QPXH 4ZFZA 4NHUB 3DMMA 1D5BA 1FG2A 3TCLA 3VFNB 4L3CB 2NY2C 3KPSD 5TE4L 4JHWH 2JCCA 1B3JA 2I9LA 1S7VA 5DJ8A 2P43B 1KPRA 3GI8H 3EGSB 1FYTE 5MERA 1H15B 2QQLL 1IGFL 4HC1L 2Y5TA 3CJJA 5HGDB 2DICA 1UZ6E 4LASL 4U1LB 2PXYA 2ADIA 2BY1A 4U1NA 4OT1H 4JFOB 2ZSWB 2XKNB 5F7UA 1SYSB 3CLFH 4DKEL 2AXFB 3D6GA 3OG4B 5IKCB 1MAKA 4M7LH 5EORL 5CBEA 4RZCB 3V2AR 3HE7C 5E5MA 4ZNEA 5L0QC 4PLKC 1AXTL 1DN2A 4KMTH 3VXMB 2A74B 2P8MB 3FN0L 2DBJA 4MD5A 1QHOA 4G3YH 1U3HD 1ZHNA 4XPFL 5K9JL 4CNIA 3ARDA 2DM2A 3QCUH 1NSNL 4L9LA 4M1GL 4PJFB 5I66B 2E27L 1MI5A 2AJYL 3K4DA 4KJWC 2QLVB 1HSAA 3P4OA 3MNZB 1S7QA 2CRZA 5I8KL 1C5DB 3VRJA 5KAQF 3W2DH 3E2HC 1GSMA 2VZTA 3FONB 4M5ZL 3RWJB 3NZ8B 2P24B 4Y19D 4Z76A 3U0PA 1HCFX 4X6EB 1ETZB 3LQAL 1QBAA 1XR9B 1QO3A 3CDFA 5I1CL 2VWEC 3O6FA 3IDJA 3S35L 1I9IH 4XWGL 4WI3A 3BIKB 5TE7H 3C5SB 4KKCD 1H3XA 1JYXA 1XGQA 3DUSB 1I9JL 3NCYS 3AM8C 2VZOA 2EE2A 1MAML 4FXKB 5TQ0H 4YEFA 2VDKH 4QXUH 2ED7A 2HVKA 2AJVL 5KS9E 5LG1A 1VGEH 2Y6SC 1OP5K 5AUMA 1LEGA 5D7SH 1BFVH 4MJ6A 1BF8A 5BV7B 1H9VA 2J8UF 3BP6B 2ADJA 1P7QB 1WBXB 3FQXB 4LSUH 5FO8A 2ZCHH 2RB8A 1AQDB 2F53A 3DXAB 4BQ6A 2OYPA 3RU8L 4L8SC 2EYRB 3LKPB 5HYSB 4AIZA 3BDBA 2I07B 3OJMB 5FO7B 1IZKA 2WUCH 1U8OA 5I8CA 3K1KC 3BQUC 2APFA 1XR8B 1UXSA 4D9LH 3U4AA 1P9MA 4KROD 5F89A 4HFUL 3E0GA 5JUEH 5FYLE 1L6XA 1EX0A 3V6OA 2V7NB 5MP6H 2Z8RA 3HAEA 3F7YB 1JNLH 3RI5F 5IEHA 1JPTL 3VXPB 3B9AA 2R1XA 3ZKMC 3PHOA 4XGZB 3ZKND 5C07D 3MUGA 3AREC 4I2XB 4X4XA 1A4JB 2FJFA 2HFGL 5DEGB 1I85A 4H88L 3IS0X 4HKJB 5GGVY 3KPOB 1UVQA 1MFEH 1N26A 4LPUA 5I8OL 3ULSA 1BX2A 1S9VB 2F19H 4NZUL 3BE1H 1F4HA 3IJYA 1B0GA 1A7BA 3UJTH 5C6TL 2QV2A 4I5BB 5CHNB 4JZOA 1A7QH 4X8XA 1YZZA 4JFFB 5CEZH 4Z9KB 5E6IA 5D7JB 2HVKB 1BBDH 4PGZA 4TNWF 4XBEL 2M8XA 4AM0A 4OZ4B 1WIPA 3QXTA 4ENED 3Q48A 5A3IC 1AI1L 2VL5A 1MOEA 3DMMC 5IHUH 3RVUC 5AUMB 4HCRH 3V0VB 3EKCA 4JY6A 2OTWB 1R3JB 5HVGB 4ZDHA 1B4RA 1N3NB 3WD5H 3UTPD 1FVEB 1L0QA 3CFEB 4NHCH 4DK3A 2D03L 3FRUA 4LP5A 5KSAC 4Z8FH 2OI9C 3DUUA 4FN0A 4UU9A 4F9PA 1X5YA 5ISZA 1CN4A 4MDIB 4FQHB 3WIFB 4GAYA 4OCMC 4PP1C 3SE8H 3QXDB 1GPOL 4ODSL 1JGDA 1A22B 1B90A 1UXSB 4NCDA 5GJSL 4GG6B 4KVNH 3O4OC 2WQRA 1T4KA 3EAKA 4PJ7B 5F9DC 4LHUA 5JW3H 4NQSB 1YY9C 4OLWL 5DJYA 4MAYD 1CXKA 2V7NA 4FTVA 1R3LB 43C9B 5KJRH 1CE6A 1XIWD 3DX8A 1U8MA 3DROB 1KCUH 3VWKC 4BZ2L 3FQUA 1MRDH 3S36X 1IL1A 1I7ZA 3KYKH 3HPJB 4LOUC 3U9UB 1J87A 1YECH 3PJSB 1Z9OA 4IRJD 4QRTA 2V2TB 5HHMB 1OARH 1F3DJ 4OLXL 1OSPH 1TVBB 4YK4B 3DI3B 1OWRM 4BSVB 3T09A 4Z7NF 3SCMB 3HE6A 4QHMB 1A9EA 4NQEE 4NSKB 2P8LB 4JFYB 3MRLB 4GSDH 3ARWA 5E1AA 2P47B 4HLJA 3VD7A 5CHNA 4ZFOB 2Z9TA 2NTFB 3MLZL 4MQ7A 5EBLB 3T0EE 5ANME 3QHZL 3MLRH 5E6ZA 5ERWA 2CH8A 3GMNB 1U3HB 4W81A 1S9XB 1CQYA 4NCC1 5FGBC 2CO7B 3K74B 3MRJB 4MAUL 1XF2B 4L8CA 1YN6B 1UJ3A 3T2NH 2XTJE 2VSCA 3TN0C 2H8PB 5ILTH 2AK4E 4HK0A 3QAZC 4ZPTB 4KUCF 2CQVA 3P0VH 4N68A 1WBYA 5HDLA 4G7YL 3HG1D 5BXFB 1HXYA 3CK0H 2WSKA 1KJ2H 1BECA 2OL3A 1G9MC 3MV9E 2YZ1A 3GMOA 1LO2L 4ODXB 5CP7A 1YEHH 2ZSVB 4NQDB 3O4LE 5JR1H 3QNZB 3T77B 1KYOK 2JK5A 5DJ0A 1NCUA 2YMXL 2BNRA 4S1SH 3IKKA 2EXYC 4XZUB 1OHQA 1LD9A 5I1HL 3S37L 5DMGD 2ZUWA 3DGGB 5D93C 3V0AC 5L8LB 3VXSB 2EIZB 1HI6B 3I02B 1AP2B 5TFSL 2RFXA 4HFWB 4JB9L 3UDWA 1NC4A 43C9A 4OFVA 3SE4C 2AJZB 2GI7A 4OZGE 4RMRA 3O4LD 1NQBA 5L6YH 3FQUB 1T5WA 3ARED 5AZEL 3EJJX 3MO1B 2IH3A 5B38B 4K3JH 2HT3C 3O8XC 4KY1L 4M48H 5CEXA 1HDMA 4AENB 4ZUWB 5EPMB 5EZLB 2BVEA 2ENYA 2GTWB 3HS0B 1CYGA 1WBZA 5I1GH 1E4WH 2WBKA 4MB4A 3W5MA 2ZCLL 1ZGLM 2B5IB 5EBMB 4P5KA 4TVPH 2FIRT 1N8ZB 2MTPA 5F7EH 5T1DH 3PV6A 3D39E 1LDPL 1N64H 8FABB 2IAMA 3KLDA 4YHNA 3SY0A 1AKJB 1MHHA 3N1GC 1DLFH 3SJVE 3LKSA 2Z93A 1NAML 3X3GL 4PB9H 5IBUG 3SBWA 3TCXA 1CICA 1HH9A 4PYGA 1CI5A 2WNGA 3K46A 3LH2H 3TNMB 3KYMA 3GSXA 3B3IB 1NANH 3K2UL 2MCG1 4CAGA 1KELH 1FG2B 3HPLA 4XC1L 2FH8A 2VE6A 3IJHA 1CDHA 4M5ZH 4Q9BA 3H3KA 3SJVD 2DBLH 5EUOE 1A6ZA 4H0HB 4OF5A 4J1UB 3HUJB 3W9EA 4EI5C 3STZB 1AD0B 4G6JL 3V5HB 2DKMA 1KTLA 4FHBD 1YMME 3GSOA 1IEHA 5LBSH 3U4EB 2B0SL 2UWEE 1NMAH 3EO9L 5E00A 1S9WA 2AJVH 2JCCE 3WFHA 3GSWA 4FQ2H 1RI8A 4NQTA 4X7TB 5E9DE 1DBAL 5GRWA 1GC1H 3P40A 5CKAA 1KIRA 1IC7H 4ZYKA 3IDXH 1U8HA 1TFHA 4QRQB 1FYTA 4LEOB 1ZHNB 3ULVC 2R4SH 1TJIL 2FYYB 1G9MH 4JO1L 5BVJA 3ARQA 3WE6B 3MQIA 1DQJA 1VEMA 4OM1H 3GM8A 2FZ3A 2VABA 1QSVA 4XNMA 4LSTH 2NY1B 3F65A 5E9DD 4CU8A 4AMKL 2P5EE 1A5FH 3RBSA 4HJ0D 3FRPA 5A2JH 4LPWA 3G6JA 1WT5C 1Z3GH 3R4DA 1I7UA 3L95A 3R1GH 4P2OB 4Q0XL 3MNVB 1QR1B 4AQOA 2MPAL 2QBWA 4HH9B 1XAUA 3NAAL 4ZS7H 2PW1B 3LSOA 3QULA 4W68A 3HE7A 3O2VL 4G8EB 5LXGL 2VZUA 2NY0C 4HUMB 3DPBA 4RGMC 2Y07H 4TSCL 1MFAL 3L7FB 1NC2D 1UM5L 3SDXF 4QHUA 4MLIA 4NQXB 2ORBH 1S5IL 5BCAA 4B5EA 4MCYB 3NMEA 5IJKA 3OKEB 1OTTD 3OKMA 2W0LA 2EZ0D 3BAEH 1FNLA 1Q8MA 4DFIA 1JHKL 3RL2A 4LSSH 4Z7QE 1JHLH 3LZFL 4PJCA 3GSOB 3QEQA 2JIXA 5D72H 4CUCA 3ZMRA 1G7JA 3O45A 1H3UA 3GUTB 3U4EA 3U79A 4OGXH 2E8YA 1BQHG 1QSEE 4F7MB 4S1QL 5GXBB 3DX6A 4L3ED 4Q9RH 3G08A 2CXGA 5TH2A 1JL8A 4YHLL 3PDOA 2ERJB 1A2YB 2UV3A 3WFZA 1KIUA 4JHZA 4IDJH 4O4YH 4DGYL 1HINH 3H6JA 5F89B 1P4BL 4JG1L 4LASH 2DDQL 4HPOL 4PLJC 2VXUH 3BN9C 3GJFB 3SDCB 4G43B 3DUHA 2KQMA 3UDWC 3NPSC 4Q2ZA 3GSNB 1Q0XL 3RVWD 4MJID 4ELMB 3CVIH 3RWFA 3I3EA 1U2HA 2VYRE 4JHAH 1PGRB 3LEVL 3FQRB 2F58H 3O11A 3M45A 4ZOEA 3WS6A 4JO3L 5E08L 4M7JH 5DTFA 1QVOB 2SEBA 4EUPH 2E7LA 3D69B 5KG9A 4PJGA 5D7LE 1V8HA 2XG4A 5JW3L 4UT6H 4OZHA 3OX8A 3ZE2E 2P46B 4XNXH 2QL1A 4JQXC 5DHXB 1M4KA 3I6LE 4L8SA 2IH1A 3LDBB 3NIGF 1F3JB 4NDMB 1YYLL 4GO6B 2C7UA 3MJGX 2NNAB 4HG4K 1IC4H 4LGPB 4I0CC 1ZANL 2Y1VA 25C8L 3MBXL 1CXFA 3HNTH 2HT4C 2CK0H 3TBYA 1G7PB 1Q9WA 1CGVA 1YNTA 4LLVA 3I6LD 5DUML 4JJ5B 4H1LG 3RUGB 3T0WA 2OJEA 5EUOF 3W0WE 3W39A 1MIEL 4XB8A 4A6YB 1UYWH 4YGVA 3WDIA 4QTHA 4YXKH 2NYYC 2H1PL 4GXUN 1FIGH 2P42B 1TCRA 4MA3A 2MCPH 4O2CA 1BF2A 4GRWF 2IGFL 3OPZL 2C3VB 5T1LD 1U8LB 1YN7B 4N9GB 1JF6A 3B9KC 1DP0A 4X6FB 4RBPH 3SDXE 1CIDA 4PPTA 3QPQC 4WEMB 5F1IB 5HPMA 2AV1B 3WKMH 3UJJL 5EUOB 5GS2H 4NN6B 2HWZH 5FHAH 1NBZB 3N85H 3RGVB 1UADC 3HUJE 1ZSDA 3I75B 3U4BH 4MXWH 4KDVA 3QJFB 5CZXC 2QADB 5EO1B 2OZ4H 5I71C 1T1WA 4WRLA 1JUFB 2E8ZA 5C07A 5HYJA 2F5AL 2YPLB 4LBEB 1R3IH 2O5YH 1JWUB 4ISVB 2Y25A 4N90E 15C8H 2VDMH 4YNYB 2AJXH 2HFTA 3DURB 4KTDH 4N8VG 2C1OB 1C7SA 3VXUE 3ZYOA 1ORQA 1MCHA 3KVQA 3MRNA 4B7IA 4UV7H 1KOAA 1RIHL 1N6UA 4S1SL 1KXQE 3FO2B 2CIIA 3KLAA 1I3GH 1TLKA 3EOAA 4YJZL 2LU4A 1MCLA 5D5ME 3CFBA 5I1JH 3Q2CA 3REWA 1ONQA 3MRHB 5CIPA 5BS0B 3P0YH 2AEIT 4KVCH 2EDLA 3GSNH 1BZ7B 4HUUA 1F4YH 2D7QA 2ZCKH 2R15A 4I48A 2FJHA 4PRHD 3EFFA 1HNGA 1KPUB 2H2PD 2XNAA 3T1WA 1BPVA 5CMAB 3ARDD 4LCWB 4MNHA 5IMOB 2CLRA 2A6KB 5MEQB 4RSVA 2V9QA 3GIZH 4JQIL 3WFBH 4PRNB 2DI7A 4U6VL 4OCSH 5SX4H 2X89D 5J7CC 4WW1B 1K4CB 3STBA 2GY5A 4XPGH 5DVKA 5H35A 4R4FL 3OJVC 1F8TL 4FZEH 2WK2A 3IF1B 3RWCA 1RMFL 3QRFM 2X10A 3C08H 5C0GB 1JPST 1RK0B 3CCHB 2H3NB 4NQDA 4XCEA 3W11D 2M1KA 1UB5B 2XRAL 5IB3A 3FN0H 4C56B 1HSBB 3M1BB 4Y8AA 1EHNA 1FDLH 1AI1H 2X4PB 3UXFA 2O26U 4XZUA 3L6FB 2BRQA 3BIKA 2FX8L 1UACH 4UNTA 1G9EA 2A9ML 5E7BA 5IVZB 2H9GA 3O9WD 4N8PA 5FAAA 3QO0B 4HS8L 1T1WB 5J1SC 1JNJA 4EDXA 2A38A 4DFHA 4YR6B 4ETQB 2OM5A 3ES6A 3BZDA 3MLUH 1FJ1A 3WFDH 5F9JA 2JB6B 2C1OA 2GUOA 2WUBL 3L5JA 4A6YL 1FORH 4RX4A 5DA0B 2R4RL 1JIBA 5BOZG 2J5LC 4YDVB 2EDHA 5I18L 5IM7A 4PUBL 3GI9H 4HKBA 1J0ZA 3M07A 1EAPB 3BXNA 1JK8B 3U48A 4P5KB 1XF4B 2NY5C 4ZO7A 2M26A 4K9EL 3ZSSA 5FM4A 5TQ2L 3FZUD 4DVRH 4U2ZA 2IAMB 3MOAL 1F90H 1JJUA 4ZO9A 4Z0BL 2QKIA 2H26A 4JGJA 5DT1H 3PNWA 4LK4A 3RTQD 1LK2B 3QPQD 1OARL 3RUGF 3S36L 3EHBC 4AG4L 5KSVB 1GCFA 3VFMB 2R2EB 4OCWH 4OZIE 2F8VA 4JDTH 5F7HA 5I19H 3OQ3B 4GSDL 3BWAA 1A7PL 1DQML 1NCCH 3VRLF 2VLKA 4FQPA 2W60B 3ZZ1A 3WDHA 1FL6A 1G6RL 4PIRF 2FHCA 1KB5A 4GRLD 3QFJA 4WHYG 3STZA 3GFUA 3FO0L 1BLNB 3TWCH 4X4MA 3KPNA 4NRXB 1OM3H 2DRUA 3OSKA 2HTKC 2D0GA 1X44A 3PWJA 5F1SA 5KANI 3I6GA 3PGCB 2YRLA 1KJMB 4GW4B 3HA0A 2OR8A 4UINH 5CZKA 2ATPA 5FKAB 4Y88A 4WCYH 4WGWB 1UJTA 4FABH 3SDAA 1EDQA 5CGYD 1S7RB 2FR4B 1BVLB 4CVUA 4Y5YB 2X7LA 3DYMA 4MZ2A 1JGVH 4P5TB 4TNVK 3JV6A 5I1AA 3VGBA 3EO0B 4D3CL 1OT1A 1I3UA 5BZWA 1MRDL 5IQ9B 5IESL 1KB9J 5GHWH 3G5XB 3FN9A 2VXVH 1CD0A 1OSPL 4PRIB 3E1F1 5FECB 1CGXA 3OKKA 5FCUL 1HHIB 2FBOJ 1C5CH 2LTQC 2HFFA 2CRMA 1F58H 1HK6A 3QCVH 4NRYB 5CWSA 5DS8B 2PN5A 3NCJL 5HDQH 5D1XB 3ILQD 3BQUD 4AH2A 3KAAA 4XBGB 2R0LH 3S88H 5DQ9A 5DJYB 4NQXA 3WUWG 5D5MB 4XP9L 1U3JA 3ILPA 3WL9B 2X4QA 2VR5A 3J7HA 3D1MC 2A6JB 3DI2B 3O3BB 4J2XA 4I9WE 1NGYA 3NCYP 1AXIB 2MJWA 5D2NB 3KS0H 3HI6H 1KFAH 2DKUA 3BPLB 4OAWA 1FZJA 3K2UH 5E99H 1T5XB 4GRWB 3ETBF 4KVNL 5DVMA 4XCCL 3MC0A 2J12B 4HMCA 1VACA 4XP5L 3LEXB 4KROC 5FA4B 1QBLL 3DX6B 4ORZC 1IAIH 1ZHLB 3MBXH 4FFWC 2E3VA 3WFEH 1X7QB 1UENA 3F5WA 1I3VA 2VAJA 1A6UH 1P1ZA 3PGDA 4YK4C 5I8OH 1WSST 1BMGA 3QUXA 1WGOA 3LKRB 4KKAC 4MQ7B 5JNYB 3GJFA 2ATKB 2V2XA 2DLTA 3I50L 1UB6A 4BFIB 5ERWB 2YKLH 4G43A 3VH8B 2J6EL 3F58H 3RA7L 4GKNB 1EVUA 4LCCB 5B21A 2O5XH 5DR5L 1UJ3B 4OQTL 4PREA 1T7ZA 5T3ZH 4XTRD 4XB7A 1KN2H 4G6KL 2P24A 2R69H 3HG1A 3KPQA 3VGAC 4ONGL 4EJ1C 3D3VB 4H5SA 3GI8L 1EEZB 1NBVL 5I71B 1LEIB 3ULVF 3A67H 5D1ZB 2ICEB 4KDTC 1A6AA 2CMRL 4KU1A 2ZCLH 3U46A 1LO3L 3MACL 3O8XB 3EDKA 43CAB 4OIAA 3NCMA 3HE7D 5IB4B 5EDXA 2LAGB 2HTKD 3QNZA 3KJ4C 4P48A 1JYNA 3GRWA 1UC6A 3HUJF 4I3SL 1IT9L 5JOPE 1S7UB 2AJXL 4LQ1A 1A1NA 1UZ8B 4LNRB 1SM3L 5SV3A 1DQLH 1M71A 5T33L 3QO1A 4XNUL 4Z5RB 5GJSH 3RRQA 1MFCH 1RIHH 1C12A 3CLEH 1NSNH 4PJ7F 3ECBB 3DO7A 1LO2H 2E27H 4N5ED 2HMID 1J1XL 1P7KB 4NO5B 3MO1A 2FGWH 5JOPD 4OAWB 4DN4H 3BKMH 1JWSB 3T3ME 3HI1A 4KVCL 4JFEA 1MQKL 3FRPG 1F4XL 1X5FA 2VDQL 3FFDB 4XMKH 4HGMA 1K85A 5DK2B 5FO7A 1WBZB 3Q3GB 4R97C 5KS9F 3V52H 2DL9A 3VWJC 2ADFL 2IAMD 1QHPA 3JTSB 3OB0K 4MS8C 3ULUC 3R0NA 1PX3A 5HYQA 2DM3A 1EEQA 2R9HC 1LO5B 2CLVA 2DKSA 1LWRA 4KV5F 4FQLH 5HI5C 4OB5L 4CBPA 2R8SH 4L4VD 4P2QB 1ZV5A 4G9DA 3LZFH 4XMPL 3OAUH 3MV9B 4RFNC 3EYQC 3KNBB 2QQLH 5HHXL 1NCTA 3QZWB 2JJWA 3LPFA 5GGSA 4MQXD 4ODTL 3DURA 2XT1B 1IVLA 2IBZY 4JY4A 2E7HA 4U1KA 3BT2L 3CLFL 1U8QB 5SWSB 2VQ1A 3AXLA 4FG6D 2VXUL 2XZCL 4J23A 4IHOB 1QFPA 3MLWL 5JXAH 3OF6A 1W0WB 2BSTA 4OV6F 5GRJH 4PJIB 4BUHA 1OB1B 1Q94A 1NLDL 2BVQB 2Q6WB 2N4IA 3R1GL 5CJXC 3E8UL 5K93A 5FDYA 2EYSA 1KLGB 5F72S 5IB5B 2QEJA 2IALB 4PJDE 2OJZH 4X6CF 4XHJC 1JPSH 1U8PB 7CGTA 5AZ2H 2ED9A 1EA9C 1N5YH 2CXKA 3CPLB 3DETD 3ZDXF 3L5IA 5C0CA 1DR9A 3C8DA 3PP3H 3O2VH 3D39B 4CVWA 1BQUA 2A6KA 1CE1H 4JY6B 1R3HA 3NOIA 3GSUA 3L3JB 3PQYE 5KN5A 3IJSB 1FGVL 4LQFH 2MMXA 4YO0A 1AIFB 3CX5K 3S35H 3QDGE 4ZSOE 2NZ9C 2BFVH 3RVXC 3RY6C 4HV8A 4C83B 1KEMH 5F7DA 2D9CA 2D0FA 3MFGB 1JCKA 5CINH 1CDIA 3LS4H 5BV7H 1LP9A 1MPAL 1RZKL 4TTDC 2EEDA 2BXYA 4BQ8A 4K71B 3ARGB 2ICWJ 3VFPA 5EOQH 4RFEB 2VUOA 3B2VL 1QPPA 4PJAB 4R4BB 3O6MH 4PJBF 4P2YA 2K9UA 1FZKA 2ICES 1D7FA 4JR9H 4Y19A 5T1DL 1CLZL 1FIGL 1CF8L 1FFQA 4GW5B 2ESVA 3FO1A 3GNMH 1PBYA 3LEYL 1WK0A 3K4ZA 3LVEA 3TCLB 4K71C 4LHUD 1JYVA 1BM3L 4RWYL 4GXUM 3BP7B 5DURD 1JHTB 2KZ1B 1M1SA 1ADQL 3JWOH 4PJ5B 5AD0B 1A6TA 2CKBA 5EULV 3C9NB 5L9DH 3LQAC 5MERB 1Y0LB 4GG6F 4JY5H 4UINL 2CR6A 3VXUA 1BHGA 2YEZA 3JUYA 2FEDC 4JZNA 1H8NA 4RAHA 4HJJH 2ICWB 5JOEA 5C0IB 4LFHG 2R23A 4LCUA 3BP5A 4PY8I 3B9KD 2LE9A 5T1KD 3BN3B 5IFJA 2D4DA 4KJYB 3NN8B 3WHE0 3JXAA 5GS1A 5B4MC 1J0KA 2KBGA 2D0HA 4J8RA 1IGYB 1F2XK 3CH1A 4ZPTA 4NNYA 3MMEA 2BVPB 5C70A 4HIJB 4TRPH 3T0VA 4JM4L 1LE5A 3DNKA 2Z8VC 5I1KL 2VZ3A 3DRTB 5GIRA 4DAGL 5I2IB 5A3ID 2FGZA 5HDOA 2CIKB 3PIQB 2VB5A 4KK6C 4RRPG 1QRNE 4E42A 4OLXH 1YPZF 2R1WA 3QCVL 2H1PH 2ZPKH 5HYEA 4LPTA 1BJMA 5ESAB 1INDH 3I6GB 2H32A 5DJ6B 5GQBA 4XI5C 3PE9A 2V5RA 4PJGB 2WZPD 4WV1A 3QG7L 1INEH 1ND0B 2DQTH 1BIHA 1A64A 3BHBA 4L4TB 1KIQB 4XP9H 2IH1B 1S9KC 2F15A 1ZEAH 4PTUB 4U3CA 1LK3L 1TNNA 5DRZB 2DWEB 4ODHH 2RGSA 2HT4D 4JHAL 4P9HH 4XNZC 4KKLD 3MRQA 4HGKC 1U91A 4JM2B 1U3ZA 5CEXB 1FDLL 1PYWB 5D6DA 3N1QC 4UDUA 3WS3B 1ACYL 2H2PC 4O58H 2GSGB 4JKKA 1UWGH 4N5UA 4FQJL 4PJHE 1YYLH 5EBWB 2GJ6A 1CVSC 1BBJB 4QF1A 4Q6IC 3UTTA 4LCUB 1XCQA 1P4IL 2XN9B 3S3SA 1OAXL 2F74A 2XQYK 4WUKH 2WWKT 3QH3B 3ABZA 5BRZB 1H8OA 2A77H 1SEQH 1U58A 2EXWD 4WI5A 5F1IA 3GI9L 4ZUSB 3RGVA 3MMEB 5C0DA 3BMWA 4JB9H 3CFDB 5IVXA 1RZFH 2NXZD 3FT3B 4PRDA 3JV5A 1RULL 3QFJD 4Z95L 3SKOA 2HJKA 4NGHL 4X5XB 4O4YL 4PJ9A 1RZGB 2XFXA 4FQIL 3W9EB 3DRTA 4UQ3A 2MCPL 3CUPA 3SE9H 3NGBC 1FP5A 4U6VH 1I8KA 1MVUA 4XVJH 2W0FB 4HK3J 1IGMH 2IPKB 2QQKH 4JPIA 2RR3A 1KCRH 4N0YL 1NDMB 2DMCA 3D18A 1FQ9C 4HMEA 5EA0H 2H6PB 1N59A 4BZ1L 4XPAL 5FB8B 1N6QH 1G0XA 2DLEA 3DTXB 4ORGB 5EC1B 4UTAH 1F3DH 3O6LH 5ACMA 3QUYD 4I77H 2F5AH 1J5OH 3F5WB 2JTDA 3BKYL 3QDGB 4ZSOB 5IBTH 2ADIB 2R2HA 2L7JA 1DZBA 3AB0C 1SYSA 1ZXQA 4ZS6D 3EFFB 2YS4A 4X9FA 3V7AG 1S78D 4F7CA 3RZCD 1PG7X 4HSQA 4LSPH 3MRIB 5MEQA 3X3FH 1YEHL 4PRNA 4FFZL 1MVFA 1RZJC 3VXOA 4Z7VA 4I4WB 1VADB 4FXLA 4GW1A 3KG5A 4YZFF 5HY9A 2EDYA 3HNTL 2V5TA 1EHXA 1KJ3H 5L7XL 4XRCA 1NAKH 3CFEA 1ORSA 2NY4C 4YXHH 4MB5A 3N1FC 4MCZB 4R0LA 5KSAB 1FO0L 2XTJD 5IB4A 4XH2A 3KWWA 1HIMH 3O3EB 5A43C 3UTOA 4HDIB 3G6DL 3QXDA 1KCSH 1JGDB 1MY5A 2GQHA 1QRNA 2LTQB 1T80A 1T7XA 3PHSA 4L3CA 3G04B 1T0NB 4POZD 4Z76B 3MRCB 3HG1E 4QYOA 4EI5D 5EZOL 3HC0B 3BPNB 1OAYL 1Y18B 1W0VA 1U8NB 2WINA 4Z5RA 1FVDA 4Y4HB 2Y36H 4FTVB 4FZEL 4QOKB 1C12B 1JNNL 1I9RL 3NA4A 5BS0E 2FATH 1TETL 5C09B 1KF9B 1XGQB 4RISL 3BH8A 4PJCB 1EO5A 5C08D 1FBIH 4KKBC 3WBDA 3O45B 1FNSH 1YEEL 3U9UA 3RWHA 1CK0H 2APBA 1ITCA 1NLDH 5IMMA 1IAIM 3HFMH 3JV0A 3QQNA 3D2UD 1JGLH 3O4LA 5ELIA 3B5GA 5EZIH 3TBTB 2E9IA 2J8UB 3OV6A 3AREA 1QSFB 3U1SH 2R29L 1FFNB 2IMNA 4CNIB 3C2AH 2XA3A 2Z31D 2WUBH 3MGOA 1YC7A 5AAMA 5L0QB 2EC9T 4WNQA 2UY7A 4H0IA 1QNZH 1L4IA 1MF2H 2PO6B 3QAZB 3MLYL 3EYSH 4JO2L 3F7VA 3Q5OA 3U9PL 4HWZB 4JDZB 1HOCB 1QO3B 2PTUA 2ZP0T 4NQCB 4MJIA 2BC4A 3RWIB 5FYJL 4JZJB 4OZHB 4NBZB 1UWXH 4R6UA 3QIBC 5D96C 3HAEB 4XCFH 1V7NL 5GRUH 3S96A 1D9KA 4ZXBC 5ALBL 1R24A 1TJIH 1BZ9B 3HZYA 1UKSA 4RMSA 5JIIA 1KC5L 3SGJA 4UDTB 4ONGH 5J6GA 4YPGB 2EYTA 5CBAB 4LLQB 4ZD3H 4X8JB 4IDJL 3SQOH 2PKDA 4WTXA 2WLYA 4LSTL 3BEVB 1CLOL 5F7KC 1JNHA 3MLVH 1T1YB 3ULSB 3BGMA 1QFWM 5EU7C 3CMOL 3V6BR 5KN5B 3QA3A 4B41A 1DUYB 1KJVB 1EFXD 4ODBD 1N5AA 4YHYC 4LGSB 1CFVL 4L9DA 4ODUB 3NTCH 4U1GC 1NEUA 2BHYA 4N9GA 1SM3H 2VJXA 4S1RL 1S5HA 2OTUA 3BSZL 4GJTB 3UC0L 4DN3L 1OTUD 3VD3A 5GGTA 3SDYL 5I18H 2Y23A 1ZHBB 1ZSDB 1AO7E 1HE7A 3HMWL 1MFAH 2PYEB 4GMSH 4OIBA 3FQNA 4V1DB 4YPJA 3IAQA 4MDJB 3RL1A 1X5XA 4PP2A 4JO4L 3JWDH 1HH9B 3VG0H 4F58L 4HWUA 5IEHB 3FOLA 5HI4D 2R1XB 4XMKL 1IAKA 1Z9MA 5E70A 3V8CA 4KHTL 4TUOA 4R8WH 2E9WA 1A4JA 1XF5A 3IJHB 2HT3D 5EWIL 4G7VH 3MBEC 4GRLB 5DYOA 1BOYA 3S36H 3TBVA 4P5MB 1JRHL 2NW3B 4JFXB 2YEZB 3KJ6H 3CGTA 2FLBT 4N0RA 3MV8B 1E4KC 4M6OL 3DROA 2C4FT 4JG1H 4PV9B 4ETYA 2BY2A 4F7EB 3MJ7B 4XNQB 1C1EL 5DJ2A 3FO0H 2XNAB 4YPGA 5CBAA 4ZMAT 1JZ4A 5E00B 3V5KA 2X4UB 4JKWA 2OZ4A 4OLEA 4X8JA 2YA0A 4E5XB 5ID0B 3W81A 2VL5B 4I3SH 1KIRB 4ZYKB 4EN3D 3S5LA 3S6CA 2EDQA 1QKZH 4RMUA 2EDEA 1G0YR 1K5NB 4WFEE 4NFDA 5BVJB 3D85B 4MNQD 2XTLA 5FYKL 1BAFH 3TYGL 4GRWH 3VFGL 1S7WA 2VABB 1MJUH 2JELL 4L3EE 3OJDB 5GGTH 1NUDA 3A6BL 3GBML 2EDBA 4WFGE 5INDB 5JORA 4KK8D 1V05A 1QBLH 4N0FA 1SJXA 2FGWL 1S5HB 5FIEA 4HMDA 2EXYD 3LN5B 4J3UA 1CE1L 2VDQH 4OCRH 2X2YA 2VWEE 4PLOB 1A6AB 5ADPL 3C60B 4MGXA 43CAA 2DLGA 2PO6C 3LRSB 5ICXB 4BFBD 1N0XH 1CE6B 3WEXB 3BQUB 4R7DA 5EO9B 3CDGA 3U30C 4MNGA 2D7MA 1NBYB 3EYFB 2R69L 1GAFL 1N4XL 4MHHI 5JHDD 1A1NB 1MCRA 4Y19E 5D2LE 4JFQB 3MV7B 1T03H 5EUKB 4OGYH 2ITDB 2W38A 3I2CL 4X6DE 1R5IA 1XZ0B 1MJJA 5EO0B 3G5VB 2EDWA 5KS9A 4XVSL 2BX5A 1RJLA 4PBVC 3L3DB 5JHDE 4EQ2A 3GBLA 3VFTA 1JWSA 1G7HA 3UTTB 4WUUE 2NTFA 5EBLA 1I7TB 1T66D 4RGOH 5LAXB 5E24E 3CDYA 5E8OA 3ARSA 1CT8B 4HHAB 5KW9L 4ELMF 4Y2DB 4P23B 2YC1A 4ZUWA 5E99L 5L9DL 4X6BB 3VFRA 1A2YA 2VDRL 2FX8H 3S3PA 3FFCB 2YWZA 5ITBH 1C5BH 4NQCE 5F7NC 5GS3A 1X3DA 1D6EA 1K8DA 2L4OA 1YMHA 3RTQA 5HTSA 3H7BA 4I0PA 4WUUD 4E41B 3PWUB 1J0HA 4PJEE 5HI4C 2E9JA 4PJ8A 5BXFA 1EAJA 1MLCA 5F9WB 4QNPF 4Y1AA 3MR9B 4HJGB 5DEFA 1BLNA 1HEZA 1CDCA 3WXVL 5J3HD 5DMIL 4UILH 4NQCD 5DUPL 3TZVD 1L0XA 5JPMB 4WTWA 4OQTH 1A7OH 1N59B 1KPVA 5C0AE 3EYVA 3D69A 2EE3A 4NKMB 2FR4A 3MJ9A 3VDCA 1MFBL 1DUZA 2GJZA 4UOW0 1I9RH 3CSBA 4YX2L 4AT6A 3IXTA 4WVRA 3UPRB 1LP9F 3MCLL 1MUJA 3BT2H 5ESVB 2UZIL 4GBXC 1NFDE 2VOTA 5C0BB 3T65B 1G1CA 2I9TA 4LSQH 3PWNA 4LRIC 3OHXA 3VH8G 3OKDA 4IOIA 4XMLH 1QTYT 2Q7YA 1A7PH 1DQMH 4JRXB 3OKOA 5C0EB 1CXEA 2BSRB 4G9FA 4GG8A 8FABA 5ENWA 4HUVA 4U6YA 1AXSB 1RURH 4KHXL 3WE6A 5DQJB 2XA8H 4U1MB 1OM3L 4K3GA 1U8LA 1YN7A 4C4KO 1Q38A 2BOCB 2X89A 3O3EA 1R5WB 3B83A 4KMQA 4Q6IB 3FB8A 4O58L 4JFPA 4LLYA 1VFUA 4RFEA 3FFCA 2VRAA 5FYJE 4QRPB 2VAAB 3LN4B 4HQQL 4PJ9D 4IIQB 2F8OA 4G6FD 4PRPA 4JREC 2HJLB 5ACZA 1OGAE 4QRUA 5GSVA 1U92B 4PLJD 1DSFL 4NN6C 4X0KA 3DO3A 1SY6H 1IQDA 4IIQC 5E4IA 5J0BA 3QDJA 4JM4H 5GRVK 1F6AB 5IVXE 4AYFA 5BV7L 4XMPH 5FOBB 1SEQL 5IK3B 4JN2B 4LSVH 5FYJD 4N0UB 3GGWB 3PXJA 4NBYB 1SJHB 2DYPA 3QNYA 2PW2B 4EEEA 3JV4B 3MJ8A 3WNLA 1A6VL 3O6ML 3QISA 4AEIL 3CZFA 2GW5A 1KCVL 3FO2A 1II4E 3G5ZB 4F37K 5GHWL 4Z7OE 2P5WB 2GFBA 5DJ8B 5JMRA 1Z9SA 2GY7B 3B9KA 3REWB 2BOBA 4X6DA 3SE9L 3MLVL 5BS0A 3MCG1 4KKBD 4LLDB 2P4AB 2A83A 3L7EA 4JDTL 5J4MA 3T04D 2JIXB 1IGML 2QQKL 4KJYA 1DJSA 3EYOB 4M5YL 4WI4A 3TPUA 1NEZA 3ARFD 4TNVF 4X7EC 1IGYA 5E2TL 1K4DB 4NNYB 3U7YH 3C8KB 1K8IB 1QFUL 4HZLB 4P59L 2DTSA 4OUUB 1F45A 4D0CB 1QUNA 1WEJH 3AC0A 2LFGA 1P53A 2J8OA 4UV4L 2GKIA 3QWOA 2F54A 4XPHL 3U0TB 2W91A 4XXDB 1MI5B 4IMKC 3LKQA 1WC7A 5I17A 5I0DA 1FN4B 1MCEA 4Q2ZB 3LQZA 1P5UA 5D2LB 2H3NA 1VPOH 1T21A 1SYVB 1S7QB 3VRJB 4F33A 1JZ3A 1JTPA 3EYUL 4C56A 3V79C 2VL4A 3C60D 3BRGC 4XAKD 3AU1A 3HR5A 3HNVH 3LS4L 4UIKL 3U0PB 5J6GB 3QQ4A 5I1KH 1ETZA 4PTTA 5EIIB 1KG0A 5DQDL 5L7XH 1KTRL 3QP3A 3ZDYF 4R2GB 2DN7A 4NYLB 4Y16C 4JQVA 1JZ5A 4YIQA 3KHOA 3HI1B 1OP3K 1J8HD 1F00I 2ZPKL 5C9KA 3SEPA 5IV2A 3JV4A 1INDL 3MJ8B 3GNML 5EU6D 2JKXA 4RNRA 1P7QD 5LGKA 1D5ZA 1ZVSB 4FQXC 1IGIL 1AGDA 1EO8L 4IEFB 3ZLQC 4U05A 4MJ4A 1JP5A 2FATL 2BOBB 4XPAH 1GGBH 4RMTA 1RSFA 1PQZA 4M8QA 3DVIA 3FQNB 2OS7A 1A3LH 4V1DA 5BVPL 5FO8B 2IBGA 4PP2B 32C2A 3GMLB 1FE8H 5GRZA 1TCRB 5L2KD 3QWQB 5BJTA 1MFNA 2UWEB 4OFKA 2XQBL 2C3VA 2QHRH 3BZFB 3VI3F 1UWXK 4KRNA 2JCCB 2CUHA 2C5DC 4J3TA 3D0VB 4TQEL 4U1HB 4PRDB 4HC1A 3CLEL 4L1HA 3OR7B 2XPGB 1AGFB 4X5XA 3QNXB 4LSPL 3TM6A 3U82B 3UYRL 3QJFA 5L2KE 4P57A 5C07B 4DW2H 5C0FB 3L5XL 3QPXL 3MPCA 1XF3A 3O3DB 4GT7A 2VSDA 5DC4B 1KLGA 4YHYB 5GGQH 4FFVD 4Z7WB 5C0BE 3SKJL 2Q3AA 2WANA 4YUEL 2ADFH 4I2XA 4GQ9H 3FT4B 3MLYH 5C0CE 5JPNA 5JXED 2G5BA 4APQB 3GMQB 1H3VA 4TPRL 1U9KA 2HLFC 3CFJA 1QLFB 4U33A 5DR5H 5JDJA 3FTGB 2AJ3A 3PWPB 1A7NH 2OXHA 2Q20A 5F88B 5CJOL 2OJEB 4XCFL 2B1HL 3D85A 1NL0H 3QEUA 5IMLB 1WFNA 4HUUB 3QWRD 1WF5A 1JNNH 3W9DA 4BZ1H 1PEZA 3IB4A 4I48B 1HNFA 5SWZD 4L8BB 4RISH 1PKQA 3FB7A 5F93C 4PB9L 3T2QA 2DIJA 1QD0A 3TN0A 1J18A 1XGYL 2OK0L 1U3YA 4X6EA 3VFUB 1ZVSA 1U8IA 2AJUL 4KXZH 1QYGL 2QR0A 3GSQB 3ZHLA 3JVGA 3WLBB 3ARBC 2MNUA 4M1GH 4KZEH 4NM8L 1J0YA 3RPKA 1K4CA 1I1AA 4AEEA 3TGXA 1O7VA 3ET9F 4HW6A 4L8DB 3JSSA 1UKTA 3TJHC 4J3VA 2Z4QA 3MLSH 1NC2B 3G6JE 1H0DA 5HHQA 3ARBD 2V5MA 4IRJC 2UWEA 4UU9B 3RIFF 5BW7C 1EK3A 3EYFA 4M3JA 4UNVA 1A8JH 1KV3A 4K7PL 5TF1L 3C9NA 2YUXA 1U0QA 4G8GB 5C08A 1A7OL 3GHEH 1ZGLA 1FGVH 2VLLA 3FKUS 4M93B 1RZFL 3DRQB 3CFBB 4Y7MA 1HIML 1GL4B 4HG4J 1S7TB 4KAQL 2YSSA 1XF3B 3IDXL 3O3DA 4UAOC 4XNZB 1FGNH 3QEQE 1BD2D 2R4SL 3UTSA 1CGWA 3B2UC 2ZOLA 2BY3A 3FB5B 2V7HB 3LV3A 2FSEA 5EU3B 1VHPA 1HHJB 3Q5TA 2J8UA 2UZIH 3GMQA 2NX5A 2XQYG 4LEXH 3GB7A 5EIQA 4PY7A 2Z31A 4HIJA 4MNQA 1N6QL 1F6LL 4DGVH 4BQBA 3P30L 5JO5B 4U1IB 4PJAF 4DZ8B 2ATKA 2ARJA 4LDOB 4ZOCA 4ZUVB 1CD9B 2BDNH 1Z3GL 3RDTB 1HHGB 3LEYH 4FFVC 5IBTL 1XGRA 4LCCA 3VXRD 1UZ6F 5IBLD 4LLMA 1UKQA 2WBWB 3MR9A 4HJGA 5DUBA 5E8NA 4NWTH 4JQVC 3HG1B 1XGPA 5ESAA 5FM5O 4L4VE 1CTOA 2K1MA 1ULVA 4QOKE 2AKRB 5DO2C 4P4KA 1BX2B 4MQXC 5C09E 1BQHB 1GIGL 5KVEH 3VXRE 4B50A 3W11C 2QSCH 4NKMA 1CFQA 4FQXA 2I27N 2VLJB 2OTPA 2P45B 2VXTL 3SDYH 2RIKA 4BQCA 1KB5B 5K59E 1ZLVH 2VC2L 2GT9A 4MXVF 4D9QD 4Q9QH 4X80H 5F7YC 4XP1H 5DK3A 4TOYL 2EYTB 2HYMA 1A4KA 1RZ8B 5KVFL 1PSKH 1FLTX 3QEHB 4KH2A 4YDVA 2DTMH 1QSFE 2VDKL 4GRMB 4XX1E 1LD9B 4MNGE 1EAPA 2VZVA 4UBDC 4AEIH 4JGUA 3ECBA 3ZKXC 1TQBB 4IOIB 1NMBL 4PR5B 4APQC 5F1NB 1FVEA 3HN3A 2YPLE 2OSLB 3RNKA 3JTTA 5HHOE 4ONOA 3CZJA 4KRPC 3DUUB 3FB5A 2DOCA 1EHAA 4LLUB 1J8KA 1YEEH 4WWKB 2WP3O 3KXFA 4Z7UF 5IQ7H 4WUUA 2VUYA 1S7SA 3GZKA 3IAPA 3QIWD 3TH2T 5A16A 3O41A 1J05B 3FQWB 3P77A 5FUOL 1AKJD 4OZHE 1MRFH 5JO5A 3RL1B 3L5HA 1G9NL 2DQUL 3SDXA 2VLKB 5JW4N 5GGUB 5ALCH 5ITFA 2QHLA 1FVCB 2UYLB 4R90H 3DARA 2ICCA 2WAHA 3TZVA 1H5BA 2X05A 1P2CB 3O2WL 3MREB 3QUXC 5JTWA 3QRGL 4TUOB 1KJ2B 3KLHD 2HJFB 2JJTC 4PJEA 4KK5C 4ZAKB 1GGCH 2PW2A 1TVBA 1QOKA 2IAND 4DGIL 3D48R 1HWHB 5FUCE 5B38G 5DJAA 1UWGL 3BJ91 1GHFH 1ZLSL 3UPCA 5E94A 2FJGB 3R06B 2DQEH 1LO4L 2ZG2A 1EBAA 1G9NC 2H2SD 3EBAA 5DQDH 1OAXH 1NDGB 4YDJB 3TT1H 4KKAD 1BQLH 3KPMA 4X5LA 2F19L 4NZUH 4RMWA 4OZFB 5DMIH 3QIUD 4DTGL 3KPRB 2IANE 3VXUD 2B39A 5JIPA 3IAGC 2RBLA 4Y4FD 4MA1C 3MRIA 3S8WA 4DUVA 4I3RL 5KSBA 3TFKC 3RWDB 1QACA 3GSWB 4MXQD 3ZKSD 1RUMH 4MQTB 1IQWL 4X7TA 2BNUB 4I18A 3MXVL 4RDQF 2BJML 4GKOA 1HQRB 4OGYL 2CD0A 1G1YA 1X6LA 1NGPL 1RFDL 1T3FA 1UB6B 3PABA 5BQ7A 3BD5A 5DJZB 4GUPB 4PRHE 4UT7L 1KCRL 1FN4A 2F53E 5D8JH 1BVKB 3CVHA 2JK5B 2E9BA 5T1MB 3BVNB 1RZJH 2BNRB 4LSQL 2YPVH 1NGWB 4U6TA 5A16B 4OM0H 2XXCB 2NW2A 3VWJA 1Y18A 4ZS6C 1FVDB 5CEYB 3OAYK 1KELL 1MWAH 1Q1JH 4XC1H 5GGTL 3EJYD 2ESVB 2F54E 5HHMD 5GZOC 2VN7A 3K4AA 2P7TA 3BIBX 1RK1B 4WGVB 4BZYA 3ULVD 5JA8B 1B2WH 3QFDA 4ODWA 3GSNL 5HGHB 3BN9D 4PJ5A 3S37H 4PV8B 4G42B 3H9SD 3SKJH 3MV8D 3A6CH 4WUKL 3F6LA 4Z78A 4XPBL 1GJIA 1BFOA 4H8WH 4GRLC 1QLRB 3L3DA 3TFKD 1FNGA 4WW2C 4CJ1A 2CKNA 1SY6L 3LMJL 2R23B 4MQSB 1IM9B 3CSGA 2VR9A 5I30H 4OCSL 2KZWA 3OKNA 3QDMD 5I16A 4G80B 5HHOA 3H9SE 4NQDE 1FLRH 4OKDA 5E2UL 4Y0GA 3VXMD 2IMMA 2E5EA 4X9IA 3MLRL 1XH3A 4Y4KA 4RGND 4JG0H 2CDGA 5JQ6L 4JANA 1B9ZA 1HOCA 1RPQA 1LO5A 2CLVB 4JPWL 5ILTL 1MLCB 3A6OA 4P2RD 1DL7L 1D5XB 5C7XL 1AXTH 1MCKA 3L3GB 5H94B 4OCNC 4OCYH 3VGAB 5KSUA 1MJUL 2JELH 5ICYB 3IDGA 4MWFA 2H32B 2YUVA 1EEYA 3VG9B 4P2RE 5EFIB 3VFSA 4WFFD 5I8KH 1FFRA 2IFFH 1T2QH 1V7ML 3C2AL 4MA8H 1CDBA 5JHDB 1MWAA 1I7RB 4N0CC 2X4OB 3FOMA 4HWBA 4M6MH 5I75C 5MHSD 5ADPH 3C8HA 1RUKH 2OX5A 3FZUC 3QEUB 4S2SA 4UB0H 4OFYD 3ROOB 4FS0A 4ODWB 3NFNB 3QUYA 1F90L 4PV8A 5C0BA 3T65A 3ZTJG 2FD6L 4WFFE 5H2BB 2D9QB 2OTUB 4S11A 5I0ZA 4F7TB 2X1WL 2A6IB 1Z2KA 3MGTA 1IM3A 1I9EA 1PEWA 3H3PH 5D2NC 3OGCA 2JJSC 2X41A 2DLFH 3S98A 4XCYA 3MBEA 1CXIA 3PL6D 2W9EH 5GRUL 1OAYH 4PGDA 1PZ5A 4X4ME 1HSAB 1T22B 1P4BH 3B2UD 5I73C 4C83A 2KL6A 1QPXA 3T0EA 3OR6A 4OSUH 3S5LG 2WP3T 1A5FL 1YUHA 2NY0B 2ZCHL 2QSTA 1FNSL 4HUKB 2EE9A 2FWOA 1MREH 5HPMB 1U8QA 3CVIL 4OLVH 4PRPB 2Y5EA 4YFDB 1E4XH 5TGBA 4CN4A 4KGJA 5MI0B 1WAAF 3JWDC 3TA3B 4FABL 4P59H 1ZVHA 2IANB 1HCVA 5E5RB 4M7JL 4N0UA 4XC3H 3K8MA 2QHRL 4NNPL 3OAZH 5IB5A 5I1LB 4Q9QL 3IDGB 5CBEB 1L7TH 3WS6C 2X4UA 4TQEH 2A74A 5SX5K 3ZT6A 4NQEB 3P9MA 1NCAL 4MD5B 5GSRA 5B3JE 5C08E 1CTNA 1EXUA 1NMAL 1FCGA 3P4MA 3KLAB 4CVZB 1JHLL 4YHPB 4WY7L 4FQ2L 3SHSA 2WMPA 4YO0B 5IW1B 2D7TL 5HYIA 5FYKU 3RDTA 4LSRH 1PX4A 4ELMA 4F7CB 1A6VH 2AAVA 3SCMD 5IFJB 2H41A 4XVTH 4Q9RL 4Z6AT 1V7NH 2WIMA 5FGCB 1QA9B 5GS1B 2NX5E 2IQ9H 3B43A 4QRRE 5JLZB 3ULUL 2HMIC 4YHIB 4WU7B 3R8QA 1UH3A 4K7FA 4Y5XA 4M6OH 2HWZL 1WQVT 1D3CA 5GISL 1T21B 3FO1B 4HDIA 4O5LH 3QQ3A 2VLRE 1EZVX 1KFAL 4HT1H 3SGKA 5IB1A 4K94L 4OKVB 1L9MA 3SKMB 4ACPA 3DVGB 3QEHA 4XCCH 5DD0L 3WFCL 3SDDD 3EDDA 4UUJB 1TJGH 1BD2A 3TA3A 3MRBA 5C0IA 1QFWI 4TYUA 3ESVF 3FHQA 3QHTC 1GGIL 1CT8A 4IBLT 4AIZB 2YPKA 4JFEE 5GGVH 5I1JL 4P23A 2E6QA 1RZIA 2DJ4A 3K2MC 1G7QB 1ZLUH 4JO4H 1NFIB 3VG0L 3QXVA 4IJ3B 5I1HH 4UAOB 2O5XL 5H37G 2ZCKL 3VD9A 1SMOA 2NY4D 4JAMA 1U42A 1J05A 5FUZH 5L2KA 1A1OB 4YHLH 3X14A 5CP3H 5CILL 3EDEA 3H7LA 1A7NL 3FRUB 1FVCA 1CDGA 2QKIB 2UYLA 4Z7UE 4PJDB 4ZXBD 4BYHA 4X7SL 2X4RA 4K3JL 1H5BB 2MQ3A 5K59F 4JFDB 2AABL 3DMMB 3MJ9H 3KXFE 5DLMH 1K2DA 5LWYH 3SJVA 5L2JA 5C0DB 1IT9H 5FO9A 3TO4B 2BVOA 4TVPL 1T89A 1PJ9A 5GGRY 2OZ4L 4MAUH 2FJGA 4P57B 1EERB 1U95A 1VA9A 4UQ3B 2FIKA 1F6FB 2JF1A 2B8OT 5DDHA 2MHAB 4Q9CA 4JZOB 4RAUA 3UPRA 4JFFA 4U4BA 1Z5LA 3KPSA 3NABL 2ZZUT 4JCLA 5K9KB 5FYKH 5HHVL 5IB1B 4KRPB 2A9NH 4TUKL 3O0RL 4UDUB 1J1PH 5GS2D 2PF6A 1U93B 1KJMA 2J7LA 5IHBA 5IIEA 4UT9H 1FYTD 2GSGA 1E6OH 2DLIA 5FA3A 1J8HB 1DLHA 1ADQA 4ZDHB 2Q86A 1BVLA 3B9VA 1BBJA 1AGCA 4ZFOA 2XN9A 4OIIH 7FABH 3NPSB 1FAIL 4WDIB 1AY1H 2FDBP 4QEGA 1UEYA 4HWEH 1PSKL 1RZIB 3CCHA 1LO0L 1U8IB 3MXWL 4OD3L 1KULA 3VFVB 2V5YA 2AQ1A 5DD1L 4JAMB 2ITCB 4KY1H 2CJUL 3FT3A 5L2KB 4H25A 4L8DA 4WFGD 3V5DB 3BZEA 1IGIH 1RZGA 2XFXB 4QRUB 5GSVB 4I3GA 4X0KB 2DQFB 1D5IL 1OF2B 1SVZA 5F3HA 2ZSVA 1WIUA 3ARRA 4ZNEE 2IPKA 1X5HA 4KGLA 2GAZA 1OOAA 1KUMA 1MY7A 1DLFL 5J06A 5FB8A 1UACL 5L2JB 2MKLC 2FBJH 5HI3C 5D7IE 3TWCL 4Z78B 2DQUH 1DBKL 1T6VN 4LKCA 3T8XB 1CFNA 3H9YA 1H5BC 3T2PA 2MWCA 2PCPB 2A83B 4MA8L 2XA8L 3NCFB 2R2BB 3NAAH 1EO7A 1D6VH 5K9KA 5DC9B 3L5XH 4JRYB 3LKNA 4R26L 4M6NL 4GQPH 4F7PA 4S10A 3ARYA 4E5XA 2Z31B 5ID0A 1I1YB 1ZLSH 1K8IA 2PTTB 2I5YH 1G6RB 2IG2H 2DQEL 2L7UA 5KVFH 4U1IA 5FGBA 3VXRA 3PV6B 5JDSA 5SWZB 4KTEH 1UJ3C 3U0WH 4YHNB 3B2VH 3ARFA 1FL6B 4XRCB 4Y4HC 2P8MA 3TH3T 3RNQB 1DEEA 2OL3B 4OTXL 4EQ3A 4JRWA 3W0WA 5D72L 5KOMC 3V4VH 3RIFK 2VXVL 1I4FB 3QEGL 4LGRB 3DVNB 3VXPA 1B0RA 1IEAB 1ITBB 4P4KD 3LRHA 3T3MF 2NXYC 5F3BB 3CSYA 2A1WL 4PJ8D 3S4SA 1XT5A 1T0NA 5DEGA 4LCIH 4P3DA 2NXZC 2D31A 2YA2A 2HAZA 1T0PB 2XRAH 4KRLB 5JMOC 1FZMB 4PJHB 4BFGA 3DJ9A 4NQCA 4GKZB 1JI1A 2BC4B 5E2WH 2GT9B 2HP4A 3IJYB 4LPYA 3GJFK 1K3IA 1YDPA 4GKSA 2YN5A 4J4PA 2Q76A 1BQSA 4ZNCD 4ZOBA 3SE4A 2XICA 2R39A 1I1FA 3C5JB 5BMFL 4HUWA 4KK9C 3DX9B 4IMLA 1P84K 1CZ8H 3HB3D 5GPRA 2QSCL 2R4RH 2YN3A 4H26A 3BPCA 1MHCB 3QUKA 1OD9A 2VC2H 1R3JA 1SMAA 4KZDL 1SJEB 3V4UL 3EUUA 4J6RL 4NO5A 4ODVH 4D3CH 1PZ5B 1KEGH 4J3SA 4Y89A 2X5PA 3C09C 3DX7B 2MSPA 1WBXA 3FQXA 5T3XH 2BY0A 4MAYB 1S7SB 4GAYB 4L1DA 3ZDYE 3FQWA 2J6EH 3F58L 3P77B 5HJ3A 4P2QD 2XPGA 4UBDD 1ZHBA 3TBSA 3UPAA 2X4QB 1FAKT 5IW6B 5HYJD 1YNLH 3RVTC 5I19L 3NACH 1P2CA 4WI9A 5C0FA 1GZQB 2GIYA 4HH8A 2PR4L 4WWID 4V2BA 4CADB 4HPOH 3MA9H 1E4JA 5IGXL 4I2XE 4PJXA 4URTB 5HHPB 5C0JA 4U1GB 1B6DA 1MCPL 4Y16B 4U1KB 1UA6H 3PHOB 3UJJH 1DDHA 1EO8H 2X42A 4JPWH 3EOBB 3MUGB 4NN7B 1ZA3A 4QT5B 2HKFH 5DRWB 3VWKD 2ZJSL 2EIDA 5LGJA 3EOYG 5GSRB 4R90L 3OKMB 1HQ4B 3UZVB 3QIUA 5E8PB 2WWKO 3IXTB 1MNUL 4IRJA 4J3XA 3UX9B 5E6YA 1T0MA 4EZMA 1FL3B 4FFYL 3UBXA 3EJZD 1M6OB 1P4IH 3AS0A 4PJ8C 5FKPA 4WHTA 4CU6A 4TULH 1LQSR 4CGTA 3IFNL 2KPNA 2P8PB 3WO3B 3MBED 4Q7DA 4HK0B 1XCTB 3FB6B 3HNSH 4NQUA 5KSAD 1A0QL 4GG8B 3GSUB 4MA1B 4Z7OF 1NANI 4DQOL 4G8IB 4LRNL 5J56B 3E3QE 4QY8B 1EH9A 1IKFL 1RULH 4Z7VE 3T0ED 1TENA 4IOFC 3QIWB 1ZT7B 5T3ZL 3P9LA 1NGXB 3P9WB 2AXGA 3AFLA 3FONA 4LNRA 2BVTA 2B2XH 3GK8L 5HGBB 1FLRL 1DBML 2WIIA 3SKMA 4ZUUA 1CXHA 3MJ9L 1R3KB 1CCZA 2EIZA 1IC1A 4JQIH 4KPHL 1QVOA 2SEBB 3I02A 1ACZA 2HJLA 2V17H 5ACZB 5A2IH 1RFDH 2VIRB 1J88A 3BUTA 2DM4A 3C60A 3CC5A 3KYOB 3DRQA 1VERA 2WW8A 3V6FA 1MRFL 1CU4H 3DUSA 3WEXA 4PGEB 3VD4A 4LCYB 2ENSA 1RMFH 1C08B 4PJXB 2ARWA 5LKNA 3ZKQD 3I85A 3U7WH 1AFVL 4UI2A 4Y16A 3CVHH 3C6LB 2X4NA 5I15L 2DQDH 4Q58C 3MV7A 1HXMA 3HZVA 3B9KB 3EYQD 3H9HA 2XKUA 4WI2A 4XT1C 3IDYC 5IOPB 1SVCP 5DD6A 4DGIH 4PJBA 5EU7E 2X6MA 3W39B 2Y72A 1PDKA 3TF7C 3V6ZA 1EJOL 3EJYC 3SCMA 2VXQL 4QHLB 4HKXB 1A6UL 5CIPH 3TPUB 2CK2A 1RHHB 1BOGA 4WW2B 3CU1A 2CR3A 3FQRA 2AK4B 3OXSB 1XCTA 3EO1B 1VFMA 5IWLC 4GQ9L 4X4ZA 5DD1H 1D5XA 4RA3A 4K9EH 3PWUA 2FO1A 4WHYH 3MXVH 3GMRA 4MSWA 4NZRL 4NDMA 3BRDA 1AR1D 1N6VA 2GSIA 3QUMH 2PNDA 2VDLH 3BGFC 3LQMA 1TETH 4PJXF 2FEEL 3HMXA 3CXHK 1XIWC 2FJFB 1HYSD 5KZCB 3SDDA 4FQXD 4Z0XA 4DVBA 3KPOA 1REIA 4OSUL 5EOCJ 3T77A 3IDIA 2X4TB 3EOAB 3AS1A 4HIHB 4NC0B 4WV1B 2ED8A 1ONQB 1QYGH 5GISH 3I9GH 3C5ZC 4YIQB 2DMKA 1C7TA 3AS2A 5D6CA 4AT6B 3F7PC 4DEPB 4NWTL 5H2BA 3ILQC 1N5YL 3NGBB 5D7JA 5KVDH 4F7TA 2PYFB 4R7NA 3BKML 3FMGL 5GJTL 4NKDB 1MH5B 2FL5A 4DCQB 3ARGA 3MGTB 4XC3L 4WIQA 4TUJB 3PL6A 1MQKH 5SWSE 3MOQA 4LVNC 3OGCB 5C1MB 4JFZH 2NY3B 4X6DF 3V0VA 1QQDA 1HDMB 3L9RB 3OKOB 4ZPVA 3C5ZB 4ESKA 1RJYB 3ULVH 3LCYA 1F11A 4NUJA 4WO4D 3QUZB 3SDAC 2UUDK 4X9GA 2DQCL 3AROA 3DV6B 4P23C 2F74B 5T1LA 3ESUF 4WY7H 5FCSH 1SY6A 1OF2A 1RUQH 3QSKB 3V4VL 3BP7A 4KAQH 3H2WA 2OR7A 5HGGS 2P5ED 3H3PL 3D0VA 2E7MA 4G8EA 1PKQE 1OCWL 1RAMA 1KGCD 1HWGB 1X5GA 4U7SA 1AGEB 1CL7I 2CIIB 3KYMB 2H9GB 5DGQA 5I6XB 1QFWH 2VE6B 1GZPA 5D2NE 5DD5H 4GG6E 4ONFL 2O5ZL 1YMMB 2R2CA 5CS7A 5AAWA 3QDJB 2DWDB 3GRWL 1YYMH 3HPJA 5DFWH 3KPRA 5MI0C 1KGCE 2NY2D 3O2DA 4DKAA 3R0MA 3FCTB 1LK3H 3CH1B 4H20L 3CU7A 4HLZH 4RZCA 4OV5A 1BIIB 2G2RB 2Z8SA 3PDOB 4BSWA 2BNUA 5F88A 4JRXA 5FHBL 3QUXD 4IRZL 4DJMA 5J89A 1R5VB 3BPNC 4PJBE 4HEME 2XOTA 5FYLH 2R2HB 3IGAB 4PRHA 5DQJA 4L3EA 3IVKB 1QSED 3PIQA 1GGCL 4HUXB 2G75B 1MH5A 2FL5B 2R56H 2X4PA 2H8PA 1KEML 2R2EA 2GITB 5F3BA 4QRPA 5IW3A 5I9QC 2DQJL 1PG7L 4OQTA 1XR9A 4YEEA 4Y5XB 5D1QD 1T1ZA 2ERJC 4FQQB 2NY6C 4M4PA 3SOBL 3GKZA 3C5SA 1HXYB 2O61A 1ORSB 5I17B 1JGUH 3V7MA 4PBXA 3O6FC 4O2EA 3GGWA 2LVEA 5C0NC 3F8UB 5I9QB 4AQ1B 5EU5A 3VG9C 5FV1L 5C08B 4RIRA 3H0TB 4L5FL 1DQQB 1INEL 2VLLB 4ZQKB 3KPLB 3I3BA 2VZ1A 2AV7B 3VFNA 1Q9WB 4Y4HA 5CSGA 5EORH 5C9JA 4HIEA 4QF1B 3X11A 5C09A 4BH7B 4LLDA 2I25N 2Z91B 3PHQB 3L7EB 4XNYL 1CS6A 3BP6A 4N8VA 2YPKB 3UROR 5EN2B 4DKFL 1I1AC 1J9CT 4OQ1A 2NR6C 2NX5B 5JW4Q 4JFOA 3BKJL 2QADC 3DOSA 1XMWA 4B0MM 2F5BH 1MHEB 3CFDA 2GTZB 2AXFA 2YPLD 1IEBB 2DAVA 1CD8A 4JDVB 5HHOD 1TNMA 3RGHA 1Q1JL 4KV5E 3W0WD 5E5MB 1F02I 5JHLH 1OAZL 3G08B 3WO4B 4CMMA 2VDOH 3D9AL 1F13A 3L3HA 3VXMA 1MCDA 5EO1A 2EDTA 5ABDE 4NM4H 2VLMD 3AY4A 3B9EA 2C3GA 1NFDB 5CWSB 1SYVA 5DS8A 3O6KL 3HMXH 4TSAL 3SDCA 5JOFA 4XBPB 3ZYJA 3MCKA 3NIFE 2GITA 2FO4B 1TQBC 2AKRA 1QBMH 1OLZA 1UCBH 1CFTB 1BQHA 3TVMD 3OF6D 3QNXA 3RWJA 2R8SL 1IKNC 4G6KH 1YY9D 4J4PD 4XVJL 2O61B 1TVDA 5CD3B 5D2NA 2XN9E 1RUML 5E8PA 3VMNA 2D4FA 1B0GB 3VI3E 3B4NA 5FXCH 2B1AH 3IDMB 3PWPD 4N0YH 2YBRA 4P5TC 5DEZA 4ODTH 2CMRH 4TN9A 5C0AD 3H0TA 4OF6A 3U7WL 4D0DA 3I84A 5FA3B 3GSVA 3RX8A 2XN9D 1RZJL 1X7QA 3BEVA 1J0JA 5FUCC 5K9JH 4XHQA 2Q3ZA 2ZUYA 1U8HB 5DD0H 3DIFB 4HEPG 3RY5A 2BSED 4U1JB 2C26A 2R29H 3PDGA 3S4SG 2AVGA 3VRIB 3E8UH 4W4NA 3EJZC 1QLEH 3RUGA 2DD8L 4Z7WF 1L7IL 1JPSL 3L1OL 4K3EL 4YGVB 2AXGB 1GGIH 1AGBA 1D6VL 4YBQC 3UBXI 4RFOL 1JPFA 4DN4L 5IB3B 3QUZD 2G9HA 4UILL 5HYSA 5HHNA 1A3QA 1NGQH 4C57C 3SO3B 3WL9A 4ZFGL 7FABL 4E9LA 3AMLA 4NQSA 3V52L 3ORJA 3VXTA 5E8EB 3K8KA 2DQHL 1K3ZA 1R6VA 2BFVL 1JV5B 1HILB 5J12C 4IDLA 2QQNL 4ZFFB 5CZVL 4JVUA 1B88A 3KHQA 4XHJD 3UO1L 5DRNA 3PJSA 5DJXA 5C6TH 3UJTL 4ZTOL 1E4XI 1SBSL 1QLFA 1G84A 3HZVB 1YNKL 2VQTA 3KPPA 1JK8A 3FN3A 3NACL 4LCIL 1S9YA 4KMTL 3MRPA 5DK0B 3RL2B 1CK0L 4F80A 2VKWA 3MA9L 2EIEA 4ONHB 2NY6D 5K9OA 1TZIA 4XPFH 3CD4A 1KLUA 4LVOC 3RVXD 1U6AL 1X4ZA 3DBXB 4KUCD 3KDMA 3U30B 2J2ZA 1KNOB 2CPCA 5LCVL 1CGYA 1GGYA 1U8KB 1XF2A 4L8CB 5TH2B 2W9LA 2XXMB 1CGUA 2J8HA 4WU5B 1Q9OA 3W2DL 4MMXC 4O51A 2OJZL 3NCCB 3P2TA 4U1SB 4S1RH 3PGFL 1E27A 4UQ2B 3RNQA 1E6OL 3VXME 2IFFL 4DOHB 3UTZA 4NNPH 1HN1A 1ZT1A 1BZ9A 3BVNA 3JBG7 3IFNH 5AYUH 4YHMH 2D3VA 4X6CB 2Q1EA 3MFFA 4LLQA 3IF1A 3BEWA 3ALWA 1FNFA 1SHMA 4PJIF 1P4LB 4Z0XB 3N1MC 5TDOB 4GKZA 5FYJH 3DSFL 1UM4H 1A21A 4R8WL 1UXWA 1BP3B 3BJLA 3UBXG 5J13B 1L9NA 2VLJA 5DVLA 1BVZA 3K81A 1G7LA 5FF6B 1HILA 3NH7L 1P7HL 4O02L 2BNQD 1X4XA 4NN5B 1KC5H 5CJQH 1HZHL 4XBEH 3AS3A 3BW9A 5EZJA 1FC1A 3ZL4L 5EC2B 1AD9A 3F7RA 3KLHC 3JTSA 5E8DL 5A2KH 1PVHA 1I8IA 3VCLB 5MHSE 2MKWA 5INCB 3IXAB 3MRFA 3UTTD 5MENB 1FSKC 4M7KL 1F3RB 4GAGL 1MJJB 1AIFA 1I8LC 3MOBH 4HFUH 2GK0A 4KJPD 2N7AA