4BQCA

Crystal structure of the fn5 and fn6 domains of neo1 bound to sos
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
203
structure length
197
Chain Sequence
TGTPMMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEOGENIN
total genus 34
structure length 197
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA02
3QI9B 2BSRB 2QHLA 4LLWB 1K4CA 3RVVD 2FX7L 3WIFA 2JB6B 2YA2A 3PWNB 3NCYP 5GJTH 4DEPB 4ZXBA 4LSDA 1WAAF 4U2ZA 3RWGA 1P7QA 4JFYA 3MXWH 4MJID 5GPRA 4X6CF 1S7TB 3DBXA 4LGPB 1YEJL 3CVIH 2X6MA 2CSPA 1I1YA 4OZFA 1JYVA 4ZFZA 1J05A 1DTUA 1A4KA 1QO3A 4XVSH 5MERA 3ZHLA 2ADFL 5C8JA 4UDTA 1NH6A 3ULUL 4JO2L 5KSBE 3T8XA 1OVZA 4OAWA 4FXGB 4M8QA 2QKIA 3WL9B 5CIPH 3ZYOA 1AGCA 1I7ZB 4MQTB 4J7RA 4NWTH 3MRPA 4HAFA 4YXLH 1T04A 4CGTA 4APQD 1F4WL 1G9MH 3I6KB 3ROLB 3STZA 1HYSC 2IBZX 1NBYA 4KK5C 2ARJA 3HPJA 3Q5YA 2GI7A 5ID0B 5B39G 4LCCB 1TJIL 1E28A 1S7SB 5E8OB 4P4RB 4JFDB 2BRQA 5I0DA 3CC5A 2MOVA 2R1WA 1QLRA 2GKIA 2RIKA 5IGXH 3JWOC 4GAYB 1WWBX 2BRRH 1WFUA 4PS4H 2Z4QB 1QSFA 2NY6D 4LCIL 5T3ZL 3O4OC 1YEEH 1NANH 1MJ8H 4G9FB 2W38A 5IF0B 4DZ8A 1RUAL 3QG6B 1RSFA 2FJGB 5E00A 3SKOA 5HYJB 4UILL 3TPUB 3N50A 5JXEA 3PNWA 3SDXF 3GJFA 3LS4L 1H0DB 3VI3E 3KYMB 3L3JA 3UJJH 3W9DA 1HEZA 4U6HB 5DHYB 1EBAA 3D25A 5HYIA 2EEAA 3U2SB 2EH7L 5T1MB 1H8OA 2MHAB 2HTLC 3VWJB 3WFHA 5JMRA 2AXGB 1FYTD 2IBZY 4DAGL 1MI5A 2BY3A 4PJBA 3KPSD 3TCXA 3ZZ1A 2ZCLL 1RJCA 1GSMA 1GCFA 5FA3A 3EYOA 1IC7L 2ATKB 4H88H 3LKNA 3MRQA 3ALXA 1LO0H 3ARBB 2VXSL 4UNVA 4D0BA 5ABDE 2P8MB 2RAMA 1FFOB 3RVTD 1IC7H 2MWCA 4EKXA 3MA9H 5IEKB 5JXEC 2Z91B 4OFDA 2N1KA 1A1MB 4MQSB 4A6YB 4DN4L 3HMWH 1W8NA 3UBXB 3UTOA 1GL4B 4KZEL 1OQXA 3QIUC 1MCBA 1KT2B 4OLWL 3NN8B 1Q0YH 4P3WA 2D03H 3TBVA 2DI9A 3L3DB 3GNML 1EHAA 2FL5B 4M9OA 3V6OA 5CZKA 1ZLVH 3UYPA 3VXSB 5J1SC 3QXUA 1QHOA 5CWSB 1VCAA 2CKBH 4PRPB 1L9NA 1KCVL 3MRPB 4OTXL 1NEZA 5I8EA 3D1MC 1FE8L 3N85L 2W92A 1HI6A 2CGRL 4GRLB 4LQFL 4APQB 3NTCL 3MCLH 5HI5D 3SQOH 3VXTB 1RMFH 4HW6A 4E42B 4BYHA 2DBJA 4U2YA 2HJLB 4MXQC 4ENED 5ALCH 5EBLA 1G1CA 5BRZD 3RU8H 1X5FA 3KLHD 4PG2A 1WFOA 1EXUB 1YJDL 3CZFA 5D7IB 3E1F1 3LDBB 3BH8A 1QFOA 5IB4B 1F3JA 4ZNEE 3BP5A 1JHKL 3GIZL 4EQ3A 3F7RA 5JIKA 2X9XA 3MV7D 3QHTC 1QRKA 4GRMA 4HGWB 3F62A 4JEGB 1F11B 3I2CL 4P2RB 3TH3T 1QKZH 1T83C 4JM2F 4HZAA 1MCSA 4JR9L 4ZAKD 4L3AA 4LLWA 4PJCB 1IAKB 4MJ5A 2EEBA 4JVWA 1OL0A 5GS0L 2WINA 3ZE2F 4IIQA 3ZKQD 4BQCA 4UDTB 2PO6A 1PKQE 4ELMF 4PJGE 5TF0A 4F7EA 3JV4A 4DOHB 1AXTL 5F1IB 3RGHA 3B9EA 5B38B 5GRJL 3BEVA 2L0DA 4WU5B 4PY7A 2NW3B 4I3RH 1OSZB 1D6VL 2MKWA 3BOVA 1Z9OA 5EOTA 2C1PB 1QA9A 1RPQA 5EG6C 2YBRA 2VYRE 4LSPH 4O02H 5IVOA 2EO9A 1CL7I 1MJUL 1YEEL 3E2HC 1A6TB 4MD5A 4HIXH 5I73B 4F9LA 2I9TA 5HYQA 5IHBA 2PYFB 4FFWC 1EO8H 4BZ1H 2VLRE 4YDIH 3QUKB 4LDEB 2OL3A 1IT9L 2VDMH 5FM8A 3GSVB 5GRZA 3H9HB 5IBTH 1MIEL 3VFTB 5E1AB 1AKJB 4X7TB 2WSKA 2DJUA 2VTFA 1TCMA 4RMRA 2CQVA 3DV4B 5EUKB 4X9GA 3R8QA 1UQSA 3DJ9A 4L8SA 5FO8A 4JVUA 4X5LA 3VXUD 4M7LH 4U1GB 1R0AL 4KRNA 3ZDXF 1E4XI 5FA4B 4LASH 3BZEA 3QIUD 4JG0L 4QGYA 5JHDE 3TA3D 4CVZB 3IFPA 3TH2T 2R29H 3CXDL 3PGFH 3O81A 2NY0D 3KPLB 4XMPL 4ZNCD 2FATH 1N64H 3H9YA 2FL5A 2XV6B 5ITFA 5IMLB 2HFFB 3LVEA 2DKUA 3FO1A 4PJDE 2BC4A 3TNMA 4KROB 3EYQD 2VDNL 3BKYH 3SE3C 4Z7OF 5JA8B 1KIUA 1T89C 2FX9H 1EEZB 4UTBL 5DD1H 4XNUL 1LK2B 4I77H 1N8ZA 1T21B 5HJ3A 5I1IH 3OL2A 1T5WB 5HHXL 3D87B 5DJZA 1E0OB 4H25B 1JN6B 4TSBL 4PJ8B 4FQXD 3MSPA 4U1LA 3TN0D 3RL1B 2NTSP 1WCBA 4LK4A 4MQXC 1RIUH 3MODH 5L9DH 5GGUA 1JFQL 1ZK9A 5GGSY 2W0KA 3MJ7A 2ZCKH 4KROC 4RCAA 3RNQA 5I71B 1IEAA 2F53D 5IB2A 3P0GB 1IGCL 1GAFL 1KTLB 1ZA6B 2AERT 4WCYL 3LEVL 1ZWIA 4D0CB 3DURB 4G7VL 1CFTA 3AGVA 3IYLW 5I1DB 1IEBA 1QLFB 4FA8A 1RUML 2EH7H 2EIZB 3OGCB 4DJMA 4QTIH 4U6YB 3RWJA 5IFAL 4E5XB 5ERWA 4AIZA 2J8UA 3MACH 1I3GH 4JHWL 3FB6A 4YGAB 4XMLL 3L5XL 2ZG1A 5T5FH 4OCYH 4DKDC 4Z6AT 3BE1L 3DARA 3HR5A 4X6DF 5TDNA 3IGAA 4UTAH 3H9HA 4NNYB 4JPIA 1A4KB 1QO3B 4YHZL 1PD6A 4N0UA 4O58L 3RWEA 4EDXA 2QQKL 4WV1A 2YRLA 1IM9D 1DQML 1X5JA 1X5GA 5HVHC 4FFYH 5DSCB 3MLZH 1NANI 2X44D 1HHJA 1CE6A 2QQKH 2ICCA 3AREC 5C0BB 5KJRL 3GIVA 2KZ1B 4JRXB 4AMKH 2R4RL 3OF6D 4IOFD 3G5XB 5D7SL 4PRIA 2YC1B 5DLML 1OSPL 2ZNWA 4X9IA 5DHXB 4HS8L 4MJ6A 3DX9A 2AK1L 2J8UF 4MAUH 3VD4A 3SOBH 5F1OB 1G1YA 3EYUH 4PGEA 5B38G 2C3WA 3ARDA 3EOTH 4LCWE 3D69A 3L7EB 3QHFL 2X4OA 5J13C 4V1DE 3C5JA 5H2BA 3O6FC 1V8HA 2BC4B 2UY7A 3UDWC 3V8OA 3O9WB 3GI9H 2XWJA 1WC7A 1JZ2A 1XF4A 3QFJE 4KI5D 4D9LL 2Q8AH 4F7PB 1I7TB 1AD0B 4QLRA 3VFSB 1H3PL 4NZJA 3BZ4B 4LKCB 1XGYH 5C9JA 1MRCL 1F42A 3RWFA 2DQFA 4NQEE 3ZMRA 3EZ8A 1WWAX 1IC4H 3B9VA 1A3RL 2ICWB 3B43A 3JWDL 1U8KA 3VI4F 4PB0H 5FDYA 2KKQA 1QP1A 3S5LA 4CMHB 5I18H 5BQ7A 4K2UL 1GGYA 1FV1B 2PW2B 2I60L 3BAEH 4BFEA 3NA9L 2BDNH 4EVNA 4ISVB 4LARH 5DQJA 4YAQA 4WUKH 5GRVL 4PJ5A 2BOCA 1SEBB 1UVQA 3WFDH 4BUHA 1IZKA 1YNKH 4QY8B 1TPXC 4JHAL 1MFCL 3PP4H 2WZPD 4W70A 2JELL 1RFDL 4XNXL 2UZYB 2XZCH 4LF3A 2EDLA 2WP3O 3OJDB 2AJVL 5DJ2B 2EDBA 1WBYA 4YFLF 4LSUH 4JRYE 4GRLC 1FO0L 4XNXH 5D1ZC 1PBYA 2GUOA 1CDGA 4Y4HA 5D7JC 2VZSA 1IAII 2GCYA 3HUJB 1JF6A 3GSNB 4PJAA 1RQ5A 3CD4A 4N8VA 4PJIE 4X6BA 4Z76B 3HC0B 1EHLL 3K4AA 2VZ1A 4LVOB 4PJ5D 1I85A 3WV0A 2RFXB 3I50H 2R2EB 1OF2B 1RK1A 2Y6SD 4KC3B 1FN4B 4G8GD 1MJJA 1MHCB 3DHJA 1N3NA 3MO1B 5J12C 2ZSVA 4KKNA 1Z2KA 1KFAH 4Z7VB 3G6JA 3O6LH 2VDQL 1ZHNA 1GOHA 3HNVL 3HA0A 3U48A 3R06B 4OCWL 1T4KB 3EDJA 4HPYH 3OAYH 3P0YH 3H6JA 3RDTD 4F3FB 4KMQA 3V6BR 5T5FL 4O2CB 4LMQI 4DAGH 2W65B 4FZEH 4JZJC 5J6HB 4ZS6C 1L4IA 3VD7A 3T4AB 2XQBL 4R4FH 1BVKB 1MPAH 4H1LB 4XNMA 4NDMA 2OQJA 4KKBD 5IJKA 5HHMD 3MJ9L 2F58H 1YZZA 4OZGF 2R8SH 2YUXA 3VWJC 5IF0A 3QZWG 2IWGA 4IRZH 1L6XA 3GBML 2R56H 3EO0B 1DL7L 1ES0A 1NGWA 3T0BA 3D85B 3L5IA 3KPNA 4PS4L 1EUUA 4UUJA 3CFCL 5GGTA 5CCKH 3CFIC 3OR6A 3AS1A 1RU9H 2H3NB 1OSPH 3NCCB 3HS0B 3QO0B 2V2WB 5FKPB 3QCVL 3RL2A 4P2OD 1UZ8B 4N9OB 4GQPH 3VXSA 4G6FD 1T66D 3HR5B 3NH7L 1KN2H 2CLRA 2GJ6E 5KSAB 1E4XH 4MNGE 1WVZA 3P4NB 2RCSL 4LNRB 3LQAC 4PJFF 1WISA 3DYMA 4X6EA 1WLHA 4U33A 4XVTH 2F54B 3DROB 1FRGH 3VWJA 1PQZB 1LDPH 2DQDH 3V5DB 1CFTB 2OMNA 5I1DA 3P0VL 2HRLA 4PJDF 1ZLSL 5E5MA 2L7JA 5C0GB 1HDMA 1BWMA 2C3VB 3ZKXB 4EI5B 1BX2A 4JY5L 5I1GL 1MH5A 5GS0D 3BWAB 4OFYA 4RFEA 1RULL 5I19L 2E8ZA 2W60A 1GGCH 1T7ZA 4DGYL 1UXSB 1NBQA 3S4SA 2KDGA 4L1HA 4NNPH 3HZKA 4KKAC 4L4JA 4XGZB 3ZKMD 5I15L 3WL9A 3ULUC 3F7YB 1JIBA 3GSQA 2FX7H 1BECA 4G6AD 3HMXL 1I4FA 3VD5A 3QG7L 1A3LH 3GJEA 3VWKB 1OAZL 1F6AA 1OAQL 4NUJB 5GGVY 5GS3A 5I2IB 1ITBB 4H20L 4L8DB 5HGGS 3WFEL 2NY7H 5L2KD 2AV7A 5E94A 5LQBH 4KI5E 2J6EL 5I6XB 4L5FL 2A0LD 5SWZA 2O61A 1AIFA 3CX5K 1ZSDA 1Z9MA 4TNWK 2VDLH 1K3IA 3GDBA 5KSVB 1G6RB 4PGDB 1NCAH 5CD5C 4L4TB 3MRMA 4P5MA 4UT6L 2IPKB 5JLZA 1L9MA 1GGBL 5D2NC 4NDMB 3SPVB 4DGVL 3CAFA 2AV1A 2ZSWB 5C0EB 3WXVH 1N6UA 1JPTL 3IDNB 4R9HA 3RHWK 5L0QB 1LVEA 3MRKA 3VGGA 1Q8MA 3BQUA 3DV4A 4XT1C 2PF6A 2J6EA 1BVLB 3BYYA 4KMLB 1QKZL 4PJAB 5I9QB 4A2MA 1S8DA 3CK0L 3MJ7B 1CICD 4OF0A 1HKFA 2N56A 3HZMA 2B20A 4X4YA 3IFPB 1J7VR 1PYWB 4GQ9L 3FQRB 2YD8A 5T1LB 1OWRM 3OAZK 2OJZL 3T4YA 1KEGL 2C1PA 4J3TA 5D1XA 4OGXH 2NW2A 4JO1L 4Y5VC 5A16A 1OGAB 4OLVL 3OAYK 3CXHK 4PY7B 3QDGB 4ZFFB 2PYEB 4FHBD 1PG7L 2BSTB 3UBXG 2ITCA 4ZTOL 5ITBL 3QXAB 1I9RL 3V9FA 2DI7A 2JCCB 3PGDA 3VG9B 4F7CB 2APBA 1CQKA 3RWCA 3HHRB 4OCSH 5DK0B 3HNVH 5FIEA 5MHSE 5T3ZD 3NCMA 2E27H 3MFFB 3P0YL 5FFLA 5D5ME 4UQ3B 1GOFA 4BSWB 3PL6A 5AEAA 3TIEB 4HCRL 1OAXL 1TDQA 2NYYC 3O4LB 1HXMB 1QQDB 2FATL 4BH8A 2A6KA 4ZUWA 1QVOA 3QI9C 3KPQA 3BP7B 5GRXG 4P9HC 1F6AB 4L8BB 5IHUH 1JV5B 4L4VD 1T1WB 3K46A 3U7AA 2AEQH 2R1XA 2O93L 1JRHH 1EEQA 4DGYH 4OLWH 3O4LD 1MCJA 1NLBH 1G6RA 1DLHA 4MDJB 1ZHLA 3H7BA 1TNMA 1QR1A 5L7XH 1DJSA 3V5KA 1WTGT 1ZGLM 4I5BA 3WUZA 4M5ZH 4PLJC 4WV1B 4WY7H 5C0DA 1ZVSA 2CRIA 4OLZL 3OKDA 4R96B 5TPWL 3QPXH 2AW2A 1OAZH 2BSSB 2DF3A 2Z8SA 3ULUD 5HPMA 4K23H 4AK1A 3AM8C 5F7MC 1CYGA 4OLZH 1IAKA 3SGJA 5JW4M 2NZ9C 5HHPB 3BDBA 3RGVA 1TFHA 4OIAA 1Y0LA 5DMIH 4XCCL 1QTYT 1IGCH 4AIZB 2XPGB 5FGBA 1E4XL 1KN4L 1FORL 3D6GA 4A6YH 3F7VB 1FL3B 5C6TL 2PYED 1JVKA 2NX5E 4RMSA 1OW0C 4KQ4L 1ZHBA 3IGAB 1P4BL 4PJHB 5BW7C 1A4JA 2YD3A 1MCQA 4YO0B 1R24B 2DTSA 3GMOB 4ONGH 1KXTB 3FOMB 3Q0HA 5DC0A 5IB5A 1NFKA 4RISH 4LSRH 1YPZF 2EO1A 3UBXI 4QHKI 5FA4A 3B5TA 3QT2A 4HKXA 2ZUTA 4P5KA 1A21A 3FKUS 4XCNA 4ZO8A 1PKQA 3DUUB 3TJEH 4AMKL 3J8F7 2Z9TA 5IQ9A 3VXME 1ZVYA 1GPOH 4WENB 5FB8A 2R9HC 4S1RH 4QTHA 2ITDA 1IAIL 2FECL 1RIHL 5D2LB 3QIUB 4YBHA 4EN3A 1NL0L 1QSFE 3UPCA 4JO3L 3ZO0A 2VAJA 3TVMD 3NGBB 1NSNH 2EKSB 1T1WA 1U3HB 5LKNA 4EBQH 2HTLD 3LSOB 5ESQA 3H9SA 3AM8A 1LK2A 5E6YA 3RNKB 3TNNB 1IKNC 4NN6C 3BVNA 5CSZB 3KPQB 1DVFB 2XI9A 4XB8A 4QHUA 1YDPB 1CBVL 4KK6C 1J1PH 4DGVH 1TCRA 2RFXA 1WBXB 2PXYA 1W0VA 3WFBH 5DA4A 1HCFX 5FV1L 1UKQA 4XMKL 4W81A 1WIOA 4ZO9A 3MZGB 2E7CA 1MIMH 4HJJL 1AGEA 1OAXH 2YSSA 3MRRB 3FO2A 2ATPB 1L0XA 1RD6A 3MRHA 3FONA 1QNZH 1KB5A 2VH5H 1Q9LB 2FX9L 3BH8B 3IDJA 1UB5A 3BEWB 5C0ND 2BVQA 1G6RH 2P1YA 3FQWA 4MA7H 1NGQH 4HQQL 1F6FB 1S9VA 3TCLB 2C1OA 1CFQB 4OLVH 1AGFA 4HIJA 4RA0C 4OD1H 5GGSA 3FTGA 4PJIB 5GSRB 4YBLC 2VDPH 1KJVB 4H5SB 3OKOA 3V4VH 2FGWH 4NJAH 2GUOB 1W72H 4Y4HB 3IF1B 4LSSL 3RIAK 5AWNH 1W0YT 4BFGA 4WTZG 1RUAH 3NCBB 5BQ7B 2W0PA 4WTZA 2R9HD 1GC1H 4TUOB 3Q5OA 4ZTOH 1U8PA 2UV3A 2R39A 5F21B 4JJHA 2BSTA 3WKML 1TJGH 2EDWA 3BIAX 2BMKA 2BX5A 4IIQC 2Y6SC 3T77B 5DJCA 4KTEH 5HY9B 1I3VA 1PSKL 1R3LB 4TPRH 3BN3B 4CDGC 5C08A 2BY2A 3CH1A 4OD2B 4F33A 4OCYL 1DDHB 3EDFA 5LXGL 4OT1H 1CFSB 2X4QA 4GRLA 4W6YB 1AGDA 4O5LH 2X4OB 4GRMB 4XAWH 3BIBX 1IZJA 1K3ZA 1LO4L 3OXRA 4RWYH 5I8OH 5HGHB 1X4ZA 5IB3A 3HAEB 2MCPH 3HPLA 4K8RH 4YPGA 4XRCA 1EXUA 2CIIA 1U6AH 4YE4H 5BO1H 3WIHL 4JAMB 2IFFH 2PW2A 3KLAA 4HWBH 1MLCB 5TPWH 4OLXH 1OB1A 3GRWH 2ZSWA 1D5ZB 3AREA 4LL9A 2VSDA 3DNKA 3VGEA 1L0YA 4K23L 4R7NB 2BY0A 2OP4L 3ULVL 4GAFB 1IGIL 5C6PB 4M6OL 1KN4H 3MRNB 3UZVB 4A6YL 3E8UL 5C0BE 2CKNA 4P5KB 5DEFB 5DUPH 4ZDHB 4YNYA 3N1MC 4S1SH 4XCCH 3ARVA 2XN9E 1TENA 2MTPA 5D1QC 5F9OH 2K9UA 4X6DE 1S7RB 5KSAC 3QULA 3TH4T 1SJEB 4ODWA 1FO0A 3GI9L 4GKOA 5IEHA 5C0CD 4N1HB 1BHGA 1NMCC 3P11L 5JXAH 1Z0NA 1MHEB 3BZFB 1K85A 3MMEA 3NIDF 1MAML 4YDLC 4LCIH 1CDIA 4K2UH 5BVJB 3IAGC 2YA0A 3G5YB 4U1IA 3AB0B 1A6UH 3DIFA 3HE6D 4RAHA 4WDIA 3EDDA 2DQUL 3O6KL 2GY7B 1KJ2B 1H15A 3JUYA 2J8UB 5SX4H 3VXUE 2BVUA 1ZTXL 4G7YH 2ZNXA 3QUML 4G9DA 1QLFA 3W5MA 1EAJA 2VQ1B 2WUBL 2XZAL 2B1AL 3TN0B 4G7YL 4L3CB 4ONHA 5IESL 2JKXA 1QFWL 5DI8A 3DECA 5L0QC 3ZLQC 2F5AL 1UWEL 2QQQA 5EBWB 1J0KA 5FDWB 5IESH 3MLVL 4Y5YC 3W39A 5C0NC 3HKFA 4GRWF 3MXVL 1F3RB 2GJ6A 2HKFL 1NL0H 2X4NB 1DBKH 4Y8DC 3RVUD 2EXWC 4EUPH 2YC1A 1TLKA 3S37L 4JN1L 2XZCL 2VXSH 3OKYA 5KW9H 5KS9A 5F9WB 1M05A 2ZOKA 1TZGL 1K4CB 2DQHH 4OBRA 5EZOL 1JN6A 1N6VA 4C4KO 4P2RE 4P59H 4WHTA 3S34H 1RZKC 5EU3B 1LMKA 5F96L 1J0YA 2QHRL 4OGZA 3OZ9L 1LHZA 1S9YB 2Q87A 1G84A 5GISL 5J8OA 3O11A 3D18A 5HDBE 2A77L 3QQ9D 4UUJB 4PV8A 3ESUF 4V1DD 1MCDA 2JJSA 4NWTL 1HSBA 5MEPA 5E8EB 5LXGH 4L9LA 3T2OA 3X14B 4H8WC 3LRHA 1I8IB 2C26A 2WNGA 1DBML 2NY3C 4MX7A 2WWMD 1N8ZB 1AGCB 1LO4H 4XXDB 3EFDL 1ZMYA 4YNYB 3WN5B 1M6OA 1G0DA 1S3KH 4NZUL 2ADIA 4PJFE 1U6AL 4WUUD 2IAMC 4PJ9B 2FZ3B 2BNRA 5GRWA 5E2JA 1B0RB 2NY3D 2P5EE 4OI7A 1S3KL 4KHXH 4NGHH 1RZJL 4ZAKB 1QEWB 3SDCC 4QRRB 5DF0A 4PV9A 3VFPB 2G60L 5FYKD 4Y4FD 4Z7UF 4LIQL 4NGHL 1OT1A 4LVNB 2M2DA 1GJIA 2LU4A 3PWUB 2DJ4A 3S97C 3ARDD 3PGDB 1NFIA 1ETZA 5L7XL 1W0WB 3FT4B 5H94B 2SEBB 3PWNA 3LMJL 5K9QI 5J3HD 3T3PF 2FR4B 3QXAA 4JFFE 5IROC 5I74C 3IAPA 1S9WA 4NOBA 4S1DD 1KXQE 2P43B 5HI3C 3T1FB 4D8PA 4ODVL 1KCUH 5K59E 5DZNA 4M6NL 3O2DH 3U79A 3OXRB 4CMHC 4DN3H 3QIBC 3G6DH 2IADB 4ODSH 1Z9SA 2WIIA 2Z92B 4FNLH 3O4LA 1UACH 5IMMA 3JTSB 4GW1A 5CS7A 4UV4H 4WO4D 1ZANH 5D1XC 5F8QC 1NGYB 3CVHH 4FFWD 4MWFA 2OL3L 3O3AA 2IPUG 4JAMA 3IDUA 3QB7C 4RNRA 2AS5M 4RZCA 4NSKA 1FVEA 5D9SA 43CAB 4XVTL 1D5MA 2DQFB 2EC8A 5FOBB 5T33L 5LGKA 4TYUA 1JP5A 4KKCC 1LILA 3ARSA 2UWEA 2YR3A 5JOPE 2VDKH 3VXUB 3MRLB 4GG8B 1FIGH 4JFZH 1KYOK 5JZ7D 1EGJL 4C58B 3O0RH 4PRAA 1DUZB 2BVTA 4OLUH 3RKDD 2F8XC 5JO5B 3MLXH 4K8RC 5KG9A 4M1GL 3C9NA 3UDWA 5CP7B 2B1AH 5D93C 4Q9RL 2CDGB 2B0SH 3O4LE 4OLUL 2B7DT 3VFWA 2VLJD 4X6CE 1AY1H 1FNSH 1UWEH 1NKRA 2X4UA 1MFNA 1VERA 1WFTA 3WS3A 4EUPA 1C5CH 35C8L 3MOQA 3RRQA 4G5ZL 4OZHA 3KPSA 1I8IA 1CGTA 2WBJC 2YPKA 5DJXA 4KJQD 1WT5C 2HT3C 4HFUH 1CU4L 1RHHA 5EU4A 1WK0A 3RKPA 3G6JE 4JN1H 2JCCE 3EGSA 1JI2A 4FG6C 4QTHB 3W81A 2QBWA 5IMKA 1X5ZA 3MOBL 5F96H 5DD1L 4MJIE 1RMFL 1CVSC 5T1MA 5GGRA 1DQLH 3X11B 2VR9A 5EBWA 3NVQA 2EIBA 4APQA 4YEEA 4NZRL 5GIRA 3EYOB 1DUYA 5GZNC 3KLHC 2K7PA 2OMBA 3ALPA 5F7NC 5FK9B 1YUHB 2DICA 4WI6A 2AJSH 3PDOA 4OB5H 3OXSA 1HH9A 2NY6C 3RI5F 4U05A 3RIAF 4BZ2H 5CSGA 4XP1H 3VWJD 4NO0D 1KJ2A 1PLGH 4EN3D 1VFAB 3K7UA 3MBEC 5FUOL 2DQIL 3RJDA 4BKLB 2QR0A 3ZKXC 1DP0A 1ONQA 4B7LA 4PJAE 4K9EL 3ARFB 3GSXB 4UV7H 3RA7L 4HGMA 2VQ1A 2I5YH 5FCUH 1K8DA 2DQIH 5F88A 4PBWD 5FYKH 2R1YB 3GMQB 1MVUB 2IH1A 4WFGD 2OXGA 1VENA 3RA7H 3G6AB 2FJGA 1EZVX 3PGCA 4H26A 3SKOB 5D1QA 1J10A 4FFVD 7CGTA 5HD8D 4RAUB 1A47A 4U0RB 2EYTA 3DUSB 4U3XA 1CICC 3NGBC 3B2VH 2QSCL 4LPXA 1JYNA 4J4PC 3TF7C 1VPOH 15C8L 5D7LB 1NCWH 4NN6B 4U6HA 1VA9A 3DSFH 4WIQA 5GISH 1A0QH 1I3RB 2QSCH 3QUYB 4MJ4A 4EBQL 1V05A 1YC7A 4QOKE 2Q20A 1AC0A 1CIUA 1MWAL 1DLHB 3MA9L 4K7FA 2F19L 4K94L 3MRFA 3IT8D 1MLBB 3WUWG 1B90A 2HFEB 1CK0L 4ZOCA 4D0DA 1E4JA 4CJ0A 4JDVA 3S3PA 3TBSB 3C9NB 2BNRD 4Q7DA 5DS8A 3E6HA 3VXPA 5KBNC 2Q86B 5EO0B 2HFGH 4OJFH 1Q72H 3U4EA 3TEUA 1OGTA 3ZDZE 2XIDA 3VW3H 5FO8B 4HUNB 1FHGA 5IVXE 3MV7A 3BWUC 3SDAC 5CINL 4YDVB 1VKXA 3N1FC 4XHJD 2CKBL 5KAQG 1S7UB 3P77A 4BZYA 5GXBB 2FEDD 1PX4A 4MCZA 5TE6L 4U1JA 1REIA 1JPGB 4WFED 1DQJA 1CFVL 1UXWB 4JO4H 5GGRB 3JTSA 2FYYB 2B0SL 3ARPA 5EC1B 3MQIA 4ELMB 3BZEB 2RQ8A 1KCSL 4KI5C 3C09B 4WEBH 5SX4I 1I1YB 4OZFB 4JFOB 5DXWA 4ONFH 2VXQL 1K2DB 3IKCA 4XPAH 1JYXA 4DUVA 1P7KB 3LKPA 3G5YA 3IDYC 5E56A 3UJTL 3MR9B 1AQDB 4MB3A 5F3BB 5L9DL 3AROA 4H25A 4GBXA 4DFIA 5CKAA 5KS9E 3FQNA 1FZKB 4RRPA 1N0XH 1Q94A 1JGEA 4PJBF 5K33A 3CVHB 2FB4H 3PE9A 4JHZA 2WAHA 4L9LC 1HXYA 2ZP0T 5A1AA 4PJ5E 1N0XL 4C56E 1SBBA 2ICWI 5GRUH 3G6DL 3RJQB 1CD0A 1R5WB 3BIKB 4TUJA 5IT2H 4OZGB 1U8PB 4F37F 5CFHA 1S9VB 2LTQB 5CZVL 5EO9A 5KG9B 2VABA 3TT3H 1AR1D 5SWSA 2OTWB 1P6FA 4LKXA 2K7QA 4HFWA 3H3BC 3BHBB 4PJGF 2IPTL 3SDXA 5CZVH 4NQCD 5C3TA 2E9JA 4Y5VA 3U0WL 2E9IA 1AO7E 2X4UB 1U8JB 2R4SH 2LFGA 1D9KA 3L3IB 3QEHB 2PO6B 2GTZA 2Y5TA 2V5SA 1CD1B 3BPNB 1CFSA 1NCCL 5EBGA 1FIGL 4JFZL 1HXMA 1QQDA 4WWID 4UBDC 2IAMA 3GMRB 3O41B 4PJXE 4E41D 4LVEA 1RULH 1F45A 4EQ2A 3CLFL 2FJFB 4LSVH 5BO1L 4NO0A 1IGYB 4YXLL 2H2PD 1G9NH 1TCRB 3KWWB 5C0JA 1SVCP 4JKPL 4WTWA 2QLVB 1RJYA 2ZUWA 3QJFB 1CL7H 3D39E 4HJ0D 3JWDC 4YLQT 2FCBA 5T1DL 1A3LL 4PGDA 1BMGA 1DBBL 4JO3H 1BAFL 5C0BA 5HGBB 2EZ0D 3MLTA 3VCLB 4L5FH 3IETB 4S0SD 2CLVB 5HYSG 3O3DA 1V7NH 5HD8C 3PWVA 4H1LH 1KUMA 4HJGB 4PRHB 1JGUH 1N7ML 3IDXL 1BD2B 3H8NA 3ARDB 3DXAD 2Q7YB 5I1KL 4UNTA 1VEPA 4GBXC 1CFQA 4YJZL 3WNNA 3W0WE 5ISZA 3RWIA 5FECB 4DKEH 1MRDH 1JHLL 1QPPA 1MCWM 3ELAT 3U4BH 3JTTB 4ZODA 5DD6A 1XZ0B 1N6QL 1F11A 1IC4L 3U46B 1QRND 1PYWA 2GITB 2ARWA 1MFAH 4W4OC 1SQ2N 5I18L 5CJ5A 5JHLL 4TN9A 3RTQC 1H3UA 1PAMA 1FFOA 4BK5A 2IBGA 4ZUVB 2APVA 3TJHC 4PJ8C 1SMOA 3UPRA 5KSUA 4HJJH 2UZIL 4KUCD 1W8OA 2H45A 3D25B 4MJ2A 4L3CA 2C3HA 2R0WL 3QDJA 3UTSE 3KPPA 1CGVA 5J06A 4ZQKA 1CFVH 1SJHA 4JO4L 1NUGA 2IPUK 2PO6D 4M62L 1UA6H 1BFVH 1HKLL 3QUMB 5DRXA 1LP9F 3ULVF 2Y1VA 4NCC2 3U30B 5DMKA 4IDLA 3RX7A 4N5UA 3V95A 2R1WB 3Q1SH 4PJHE 4HULB 5HVHB 2YN5A 3OQ3B 5IB2B 1NUFA 3OMZA 3PNWB 4DQOH 3D69B 3L7EA 5DVNA 1KCRL 5BS0B 5GS0H 3P40A 5C08E 4P4KB 1KB5L 4WI5A 3GSWA 5ELIA 3BH9B 3LMJH 4MVBC 4NRXB 4LSQL 4O2FB 3KLAB 4EN3C 2NY4C 1M05B 4M8VA 3GUTB 1Q72L 5FO9A 5F6IB 3TESA 3QNXB 1EAPB 1V5JA 1RUQL 5HHPA 4GW4B 5L2JB 2CMRL 4CVZA 3HFMH 3M17B 4LSPL 4O02L 1JV5A 4NO3B 5CD5D 2X70B 2EDRA 1ZEAH 5GZND 2A73B 4HIXL 5E6ZA 2MHAA 3FO1B 2CLVA 3P9LB 4NKQB 2VKWA 2BNRE 1YMMA 1IAMA 1YEFH 2ICWJ 3MBEA 4K71B 1FVEB 1ZHLB 3H7BB 4NQED 4RQQA 5D71L 1MCOL 1XGPA 5J56B 3V52L 3FB5B 4XAWL 4KZDL 2BXYA 1A4JB 1IFHH 4F58L 4KHTL 4S10A 1AXSA 4GAGL 4MJIB 5F72S 5E8PA 1ZT4A 3QQ9C 1CDCA 3D0LB 5IKCB 5HXMA 4D8PB 3RUGF 3ULVC 4F7TA 2GTWA 1DUYB 4JY4A 3SDAB 1A9BB 1PY9A 3SKNB 1JPFB 5CILL 5ILTH 5AUMA 3LV3A 3A6OA 1U3HC 1BBDH 4S1SL 3GSVA 4EUPB 2I27N 4OZIF 4P5TA 1KIQB 1I1RA 4F7EB 3CFEB 5C0IB 2AJXH 4EOWL 1U8JA 1BBJA 2PXYC 4PREB 1FZKA 1I85C 5GJSL 4Y4FB 1HHIA 4IHOB 4MD4A 2KUTA 4XNUH 3D39A 3C60B 3O45B 1WT5A 2BVPA 3TYGH 5FV2A 3GBLA 2YBRB 3IDYB 4HUMB 3VFNA 3WIIH 3WBDA 4G8GA 1NAMB 4NT6A 5DJ8B 1OTSC 4TVPE 5FYLL 1NJ9B 4AL8L 4IOSD 5HYJD 2J8HA 2BXZA 3NFPA 5D2LF 5DRWA 4KI1A 4QHMB 1AQKH 4BA8A 2GHWB 4LSVL 4RNRB 1YYLH 4P2CG 4MJ5B 2WM0A 2AEPL 2PXYB 3C09C 3V4PH 1D7FA 3LPWA 2O5XH 1RUPL 3INUH 3L6FA 3CCHB 5C70A 4Q9QL 4X9HA 3ARZA 3IDJB 4GG8A 2AK4A 1XGUA 2XY2A 3IDNA 4HIIB 5IW6A 5JHDB 5LGHH 1A7NL 1YA5A 5FUCC 1XFPA 4RFOL 4YZFE 5TFSL 1M7IB 4JFFB 4UOJA 4F7MB 4G42A 3WHXA 1JMZA 4HCRH 4MB4A 3DXAB 4Z0BH 1PG7W 2ZKHH 4EDWH 1NEZG 4KI5F 3D2UA 2JJUA 5J12B 3ULUE 1P5VA 4PPTA 4XI5D 3GRWA 4JY6B 5JDSA 1A6ZB 5DJDA 1ZXQA 3P4OA 4O58H 1CD8A 4L8DA 3EOYG 3DV6B 4MSWA 1AE6L 3KHQA 1AI1L 2VKXA 5EUOA 1CLYL 4JQXA 3PHOB 1X5LA 5IKCA 1WFNA 3BN9D 4JFQB 1K2DA 4C83A 4J3SA 4Y19E 2PYEA 4GLRI 3GM8A 4X5WA 1HZHL 4MJIA 1I8KB 3G04A 5DC4B 4GOSA 2HA1A 4P3DA 4TVPH 2AJSL 1BJ1H 5KSBA 2EDHA 4I0PB 4KDTA 1XGTA 2UUDK 3FB7B 2G2RA 1QNZL 4JQIH 3QIBD 2JIXA 3EUUA 3HZKB 1QFHA 3SDCD 2IJ0C 3DSNA 3HG1A 3EFDH 3TZVB 3KPRD 1NGQL 2DLEA 4LVHB 4P2OC 4YGVA 5EORH 4XBGB 4HIHA 2YXMA 1B2WH 3T3PE 5CBEA 2VISB 4M3KB 3M17A 4ORZC 2FD6H 5EORL 4UQ2B 3TBVB 3V5HA 3ARFA 2XZQL 3RUGB 1CDYA 4FTVE 4HKJB 1VADA 2DQDL 4AENB 1GRWA 1UZ8A 3L3JB 1J1XH 2X4NA 1MLBA 4N0RA 4PRDB 4N0UB 3RWEB 2AV7B 2ICEB 3OXSB 4XP4L 2DQCL 2LVEA 3D48R 3GMMA 4I2XA 4GUPA 4MNQE 1T1XA 5EN2A 4MB5A 3QZWA 4K3HA 4TQEL 4YHPB 3P3YA 2QTEA 3DOSA 3PV6A 2UZXB 4R7NA 3EBAA 4D0DB 1B88A 4UIMB 4X83A 1V7ML 1CFNA 2P7TB 4HWZA 3RWDB 5ICYA 1QLRB 4XBEH 2VN4A 2R1YA 3DVFA 3GMQA 4G3YH 1J1OH 3AU1B 2X4TA 4N0CD 1KIRB 5JR1H 4GH7B 5DZLA 4Y16B 3REWA 4JB9L 2QSQA 5FGBC 5H37H 2DOCA 1X5XA 5TDNB 2FHBA 1ZHKB 4XPGL 5JA9A 1MLCA 2XYCA 5J0BA 3QDME 3WXWL 1PZ5B 4BSWA 3FQUA 4GAGH 1KPVB 2Z8WC 3N0PB 4OLEA 3CMOH 1IGTA 4HH9B 4H0HB 3PWPB 1Z3GL 4NQEB 1UJTA 1UYWL 3KYKL 2GK2A 5E95B 3UTQB 3WFCH 2Y9RT 4LAQL 2HVJB 2IALB 2Q6WA 3BRGC 1AGBB 1A7NH 1KG0B 4M8QB 3WFBL 5DD6B 2QKIB 4MCYA 2FIRT 3W9DB 2HH0L 1V3JA 1RK1B 2O5ZH 3F12A 3VA6A 4KK8C 2VC2H 4GS7C 4C56B 1FNSL 1KELL 1JZ4A 1LEGB 2AJXL 1DN0B 2L4OA 2CD0A 3QUZA 4MA1C 4MYWB 1N64L 2E7BA 3SDAD 4ZFFA 3LN9A 5EWIH 1MFDH 2FH6A 1RZFL 1G7IB 5LCVL 3OG4B 1F5WA 4M4PA 4LNRA 4OGYH 1N2RB 5D1ZA 5J13B 4KTYA 1FBIL 5HGBA 4LQ1A 4DKFL 4GBXD 4JZOA 3QQ3B 2F58L 2ADJB 5IWLA 3KPMB 3OKLB 3JV5A 4NZDA 3FN3A 1H5BB 4PB9H 3OV6A 1X5YA 2ESVD 3FT4A 3OX8A 3ARWA 3WN5C 2VABB 1EMTL 4LPWA 1TJHH 1CLZL 3SKMB 1BVKA 1L6ZA 1YMMD 2VDPL 3B9KB 2GK0B 1J0JA 1KPUA 1YMME 3BW9A 4F15B 1GZQB 4JREB 1PG7X 2OX5A 1A6VH 4MZ3A 2LAGB 3QFJB 4JFPA 4X6DB 1UJ3C 4U1MB 4U1KA 2O5XL 1TQBC 1NGWB 1RZ8A 4TSCH 5F3HA 4WO4B 1MJ8L 1YYLL 2Q8BL 3RHWF 1C08A 3SDYL 2VNCA 5C71A 3U7YL 5T3XH 1D9KB 3HE6C 3WD5L 1MCEA 3VFRA 3P4LA 5GQBA 1CCZA 4NM4H 4Z5RB 2HMIC 1EFXB 2HJLA 4EVNB 1JWMB 2VLKE 2QADB 3NIFF 2J4WL 1K6QH 4PJXA 4L4VB 5EO9B 4LHUB 4NO0B 2E27L 1EFQA 2F53B 4YK4B 5BOPA 3T2PA 1JL8A 1CXLA 4WW2B 5ICZB 4DW2H 5IQ7L 1HHHA 5FYJU 2W9DH 5GS1B 4ZPTA 3ES6A 4QHUB 5FUCE 5FB8B 2R69L 5F9JA 3CIQA 3OJDA 1MWAH 1P69B 4PD4K 1K5NB 3DYPA 4RWHA 4OIBA 3UTZA 3VH8A 3NAAL 5EU6B 2R0LH 5SWZD 3H9SE 3UTTA 4R90L 1MCRA 1RU9L 4R8WL 3UTQA 4WFFE 4DVRH 2VXVH 1KIPB 2SEBA 2W59A 1EVTC 4LNVA 3IKCB 4H5SA 4ALAL 3IJHA 1B3JA 3GBNH 4C54A 3KGRA 5TQ2L 3Q2CA 3MRBA 2VXTL 3JV4B 4KROD 2Q76A 4K3EH 1Q0YL 3ULSA 4KJWD 2D7TH 3IJYB 4FG6D 5T1KD 3G08B 4G8IB 4ESKA 4QGTA 3A6BH 5HI4D 2C1OB 3OKMA 4KQ3L 1YY9D 3ZE0F 3WXWH 4BSJA 1U36A 2ZPKH 1ZT7A 3E3QE 1K4DB 1YDPA 5KN5B 2NZ9D 3PWPE 1JF1A 3MRRA 4ZS7L 3V6OE 3N9GL 3VGDA 4ONFL 1GVIA 2D4FA 1MWAA 1FGVL 3DRTB 1XGYL 4PJBE 5DJYB 2HT3D 5FYJL 4PGCB 3QCUH 5GRYA 3I2CH 3QDMD 3IFNH 3VFMA 2C3VA 1D5XB 5BV7C 1JYWA 1IEAB 5IHZB 2YK1H 5LAXB 5D8JL 2ADGA 3M45A 2VIRB 1CE1H 5TQ0H 2WMPA 4QRPB 5JOFA 4YBQC 4OF7A 1L7IL 1F4XL 3BVNB 2GFBB 3BGFB 1IEBB 1GZPA 4QRTB 5KOVC 5E2TH 1NGPH 1TXKA 2DM2A 4RMUA 4RMWA 5IBUB 2GEEA 5HVFB 1CZ8L 3DRQB 4HUXA 5SWSE 3BPOC 2F5AH 4MXWL 3RX8A 1T1XB 4EOWH 1UZ6F 2VZOA 1W72B 5GJTL 2OZ4H 1RK0B 3CC5B 2P24B 4LPCA 4IEFB 5I2IA 2EE3A 4QHLB 3MCKA 2OZ4L 4ZPVB 4FXGA 4NNYA 2YKLH 4EXPX 3RWDA 4EI5A 3KXFD 3MREA 3ZSSA 1UEMA 5CBAA 2LAAA 4JM2B 2Y07H 3BUYB 3REVB 1L0QA 2QHRH 5DD3L 3NIFE 1RZGA 1OTTC 3KXFB 3SQBA 3FT3B 5DEGA 4YXHL 4NM4L 4MNHA 4M61A 1MRCH 4P9ML 3UPRB 4R3SA 1SMAA 2J4WH 4JJ5B 4Y5XB 2PR4L 1ZA6A 5KVEL 2DQEH 3K3QA 3NACL 1HINL 5CILH 4PJIF 3PWLA 4MHHI 1K8IB 4PJGB 1X6NA 5MERB 1TMCB 2CIIB 5ISZE 1DR9A 4DKFH 4YHOH 2X05A 1QSVA 1U3YA 4FZEL 3S37X 1ZA3B 1OP5K 1OAUL 3U36A 2OLDA 3LKOA 4XMPH 1UENA 2EYSA 1K4DA 1IGJB 5CHNA 4EI6B 5E6IC 3MV8B 1A1NA 1T0NA 3MBXH 1OY3B 4XCFH 1XCQB 5HGDA 43C9A 2OJEB 5I1LB 5F89A 1I7RB 3ARGA 3VXRA 1N6QH 3CFBB 5F7UA 4Q97A 4NRYB 3U6RA 5GS2H 1WITA 5AAWA 3DVGB 3TZVD 2M26A 4L9DA 3TO4B 4S1DC 5TDOA 4AL8H 5E8OA 3SCMC 3MX0A 4WY7L 2YD4A 4PRHD 1T1ZA 5K9JH 4WW2A 5ICZA 1O7VA 2F15A 5J4MA 5EZJA 5I1EL 2HKHH 6FABH 1OGAD 3PHOA 2HG5B 3GMPA 3IRZA 5I1EH 4XNZC 1VGKA 2D2OA 3U7YH 5BV7L 4HWNA 3QDHA 5I8CA 2JJSC 4HBCH 2KQNA 4I18C 4CL7A 2X2YA 1YECL 2DS4A 3C08L 3RZWA 4ZXBB 4BQ6A 3X3GL 4X4ZA 1J8HB 1DLFH 4U1JB 5DYOB 3HB3C 3ARBD 4L9LB 1MCKA 5ETUB 5FYKU 4PLKD 2NR6C 2Y06L 3MXVH 4D94A 4TPRL 3DETD 1IILE 2HLAB 4HKBB 2CIKB 3KYNA 3PWPD 1OPGL 3LHPL 3NFPB 3LD8B 4ZUSB 4WI2A 2W9DL 3QRFM 4LSRL 1LNUB 4NPYB 5A16B 3UTPD 3EYVA 3T0DA 4OUUB 4G9FE 5MEQB 4Y1AA 5CWSA 3UO1L 4OFVA 1DEDA 1NLDH 1HSBB 1AXTH 4NNPL 3GKWL 5CJQL 5DSCA 1HI6B 5E70A 3CJJA 5HI3D 2H9GB 4I3RL 3HMWL 4HG4J 1NKOA 3GKWH 4ISVA 2HFTA 4BELD 3QG7H 1HSAB 2IANB 1DQDL 4CU8A 5TH2A 1N5AB 3P2TA 4OFKA 5C0AA 9CGTA 3WFEH 1CLOL 3OKNB 4PJ9A 4LQFH 3V0WH 5D70H 4NN5C 5C0CE 4KZDH 4HXBL 3GJFK 3A6CH 3RAJL 3S8WA 3AAZA 4OQTA 2W91A 1JRHI 5CEXA 1HHGB 3Q3GB 1PZUB 4G8FA 4KK5D 3TVMA 3OJMB 2XRAL 4RMVA 1QRNB 5BZWB 2EDQA 1F90L 2DKMA 5L88L 2PYEE 1I7TA 1RZIA 4GKZA 5MEPB 3EDEA 3MRGB 4QRPD 5ACZA 1FZJA 4LLUA 5FHAL 1QD0A 5CD3B 1RJLA 4ODUA 4WEBL 4YHNB 3I75A 4R2GB 2FZ3A 4PP1C 3ILQC 2K3TA 2PR4H 4NRZB 1BBDL 5DDHB 3DRTA 1L7IH 2R29L 3CXDH 3WN5A 1KLGB 1KLFA 4BQ8A 1CLCA 3JWDH 1SYSA 5F71A 2N7BA 4QXTA 3TBTB 3ARDC 1BGXL 1U3HA 3TO4D 5SWSD 2V5TA 2VC2L 2P7TA 2VLKA 4HWZB 2H8PA 4GSDH 4K55A 1LD9A 4Y5YB 3B5GA 1RURH 3MPCA 4KY1L 3L5HA 1TETH 4J12A 4PIRF 3MLUH 3VA2C 5FKAB 3VRIB 2EDXA 3QHZH 3GSWB 1G7IA 3VXMA 1PDKA 1EEZA 4GUPB 2NY1C 2IG2H 2EZ0C 4I9WE 1S7XA 4XBEL 1FQ9C 3QHZL 2QEJA 3SN6N 2HWZH 1KC5L 5ESAB 3HB3D 1X7QB 2WQRA 1S7VA 4XVJH 3L3DA 3RUGA 2Z31D 4LLVB 4PJEA 2ORBH 1FFPA 5IM7A 1BEYL 5KOMC 5HDQL 2QV2A 4GLRH 2ED8A 4XNYH 3INUL 3FO0L 4KDTC 3U9UA 5B4MC 5HI4C 1NDMB 5EU6E 5CGMA 1U2HA 3ULUH 4FQ1L 3D3VD 5BZDB 2QADD 2KL6A 2XN9A 4P9MH 5FDWA 2CJUL 5IG7B 4KRPC 3MRCA 3RY4A 1MAJA 4EIZC 1MHCA 5GGQL 3TNMB 1AD9A 1BOYA 5JTWA 3ZTNL 2CK0L 5F9WC 2G2RB 3QBTB 5JO5A 1KJMB 4XC3H 2HLFC 3TV3L 5AZEH 1ZHNB 2NY5L 3NABL 2Z8VC 3VXUA 1NGXB 3MFGB 1G7QB 4WUUE 4P9HH 1KJ3L 2DRUA 2NXYB 2W07A 3LN4A 2NY5H 4HIHB 4UDUA 4UINH 4CW1B 4PJ7F 5DEFA 2VDOL 1H3XA 5DRNA 4HJ0C 3CFJA 2LU7A 3CSYA 4X6FA 1P7QB 3NBNA 4FQCH 2DIBA 2YMXL 3MOBH 4UOW0 1KXVC 2WP3T 3C6LD 4HGKC 4XPHL 5IB1A 3WO3B 4JFPB 5DVOA 1MCPH 5CIPA 4WGWB 5K9KA 4RX4A 4ZFZB 4PUBL 32C2A 3LY6A 2V5MA 2VXQH 5IMKB 2B4CL 4LHQB 1QLEL 1XT5A 4DVBA 5C0RH 5HHXH 3H0TB 3FL7A 4ODXA 1FL5B 1XR8B 5E99H 4RGNB 4JFEE 4HC1L 4URTB 4TTDC 3FMGL 4NQVB 4GAYA 4LCWD 4OQTH 3NPZB 5IBLC 3I6LE 3KNBA 1KN2L 3FQRA 3EYVB 1A7QL 2H32H 4WW2F 3B5HA 3OPZH 4GMTL 2NW3A 1IM9A 3CLEL 1Q9LA 4WFHD 4Y2DD 3C6SA 3JV6A 4JZJA 3DX7B 4LP4A 4P5TC 4OAWB 1G0XA 3ZHDA 3EO1B 1P9MC 5HHOA 4LPVA 3H3PL 4M5YL 4X9BA 2WWKT 3FO2B 3FN0H 4HX1B 5F3HB 1OGAA 2DM3A 3QEUB 4UAOC 3WO4B 5CP7A 3EHBC 3MACL 4F33B 1DDHA 4PJXB 1YJDH 5TH2B 2Z0BA 4K3DL 5C92A 1J05B 2B2XH 1ZANL 2FO4B 5K59F 3HLAA 3B9KA 1AR1C 2ZCLH 3BT2H 5D93B 3IFOA 3KPOB 3L7FA 4NQDE 1OP9A 1XGUB 2E6JA 3SE8L 5E4EC 3UYRH 1YQVL 1NCWL 2I24N 4JE4B 1S9XA 3K74B 3RWGB 1KCRH 1IAIM 3OG6B 5JHDD 1IC5L 1C12B 4JPWH 4HH8A 3H9SD 3C5JB 5H2BB 2X89D 3D18B 3PHQA 3R0NA 1MFBH 2EE6A 2ESVE 1OM3L 3VMOA 2DDQH 4F8QA 4NP4H 2HRPH 4NCC1 5ENWB 2CRYA 5FGSA 4HS6B 5DK3A 5FO7A 1ND0A 1I3RA 3QUYA 4BFIB 1CZ8H 3FN9A 2BMKB 4Y5XA 3QHFH 1LEKA 5JQ6H 1KJ2L 3RFZC 4G8GB 3FQXA 4XAKD 4U6XB 1BIIB 5EOTB 1EPFA 2ADIB 5KW9L 4ORGB 5SWZB 2EDYA 3D0LA 1IT9H 1FH5H 3B9DA 3MZTA 1IM3A 5F88B 4QRSB 2XRAH 3AVEA 3IDIA 5DTFB 4LCCC 4I13B 3GFUA 2OK0L 2G75B 5FEBA 2OSLA 1XAUA 1XCTB 1UGNA 2QR0B 3KR3L 1XIWB 1MCLA 1YNLH 5IMOA 5DK2B 1QSEA 1KELH 1CR9H 1V3LA 1F4WH 1G9ML 4HGWA 4LKCA 1Q1JL 3G6AA 3PIQA 3MA7A 4GRWB 3RPKA 4F2MA 2XZAH 5IM7B 3RWJB 3CZFB 4WHTB 3C8DA 5ANMA 2EYTB 3QDAA 1JPGA 3LEXA 4JFDD 4XP6L 1GIGH 2QQLH 4JRXE 1LDSA 2UUDH 5I1HL 2Y7QA 1MFCH 3PP4L 2ENYA 2YOCA 4PJHA 4UTBH 4UT9H 4OGXL 1FNGB 1WCQA 2HWZL 1FNFA 1LO2L 3VGBA 5MENA 1VACB 1TVHA 1RK0A 1ACYH 4PLOB 4JFHD 3S37H 1UWXK 5GGVH 4I0PC 3GMNA 4HUXB 3BSZH 3GIVB 4LSTL 4NKOB 2YD2A 1QRNE 4QNPF 1RIUL 3MODL 4LOUD 3QZWB 3C87A 4PJ8A 1YEJH 3CVIL 4P2OA 1CXKA 4XVUC 4FQJH 5LG1A 5CGYC 3U1SL 1KB5H 4ZPVA 1EK3A 1AO7A 1NFDB 3S88L 5H37G 1K8DB 4R4NC 3VFWB 3FRUB 1RV6X 5SX5K 1G7JA 3RPIA 4AH2A 4YXKL 4XX1E 5TGBA 4NZTL 1PSKH 4OQ1A 1QBMH 4PTTB 4QRQB 4IMLB 1QG3A 1ZHBB 5F70A 3B8YA 2VISA 3QUYC 5D7LE 1FL3A 4NBXB 1RUMH 5D7LD 4KJQC 4NCDA 1SEQH 4MD0A 1BQSA 2G5RA 2I9LA 1OAKL 1EA9C 5J11B 4K8RL 3RDTB 4CVXB 3E6FB 1U8HB 1YQVH 1RZJH 2EC9T 1YYMH 4JDZB 5AD0B 3DX6B 3RBGA 5DTFA 4CN1A 1I75A 5BZWA 4YHIB 4Q9RH 2PYFA 4I77L 1EHXA 4LCWB 1MFBL 2DIAA 4RSVA 4ODHL 1P7QD 4G80A 3RBSA 1EGJA 1MRDL 4RA3A 1WWCA 3UP1A 3LOWA 3GRWL 4KK8D 4RDQF 3JXAA 3JBG7 4PJDB 2NXYC 5J7CC 3FRPA 4ACPA 3MLTB 5F6HJ 3O3BA 5AG9A 3D85A 3QRGL 3QISA 3IXTB 2J88L 4ELKA 3HC4L 4QXTB 3TBTA 3OR7B 1NC4A 2WK2A 4P2RD 5IVXA 4X6CB 3LS4H 1Y6MR 4GMTH 3OPZL 4CN6A 1CTOA 4XH2B 1G9NC 5IB3B 3N9GH 4UV4L 5EZLB 5GGSB 1A14L 4YIQA 2R0ZL 3OR6B 4LF3B 3SDDB 2VL5B 2A0LC 5IMLA 2IGFH 3WIIL 3TCLA 1FNAA 3KDMA 2EE9A 3ZKNC 2AP2A 1U8QB 5T3ZE 2C3GA 3HRZB 5HHOB 4U7MA 2YPKB 4LFHD 2OM5A 1EFXA 2VDKL 2W9LA 2FLBT 3SJVB 4Z77A 5C0EA 1FYTA 2ZSVB 4Q6YA 3G6JB 4JCMA 4HCRA 5FCSH 4W6XB 1MCHA 4MMXC 3VFOA 5M7QA 3V0AC 5JUEL 3QDGD 1JZ6A 4F3FA 1OARH 3PWUA 1T5XA 2WBJA 1BLNB 2YPLE 1NCCH 2E5EA 2O61B 2F54D 3QDJE 3UTSA 2DYPA 2V7NA 4XP9H 3MYZA 1FNEB 4XCYA 5IROA 4HHAA 1U8OB 3ZE0E 1KJ2H 3LKQA 2Z35B 1S7QB 4X4XA 3KS0J 4IMKC 1KB9J 5LQBL 3OX8B 4RX4D 4Y2OA 5KVGH 4MXWH 1CI5A 4JRXD 2IQ9H 3L3HB 4YH6A 3GSQB 1DZBA 3VH8B 2V2XA 1UM5L 3QUYD 4P46D 5A2IH 3A6CL 4GRWE 1AR2A 5DUPL 3DSFL 4TOYL 1IGYA 1WBYB 4TNVK 3OKOB 4CAGA 4WO4A 2GK0A 2ORBL 4GMSH 1T7VA 5I66A 3F12B 4JO2H 1EUTA 5GS1C 3SKNA 1CGUA 1CT8B 3E6FA 3HG1E 5I17B 5DD3H 4HKZA 4YXKH 1MUJB 2Q7NA 3RTQB 3WS6C 1TVBA 4LCYA 3KPRA 2A6IB 5B3NA 3I85A 1CBVH 2HJKB 3WMSA 4B53A 1WICA 2GJ6B 1XMWA 3IXTA 4MDIB 5I16A 1EV2E 5I71C 3KPMA 3OKLA 2HYMA 3MRMB 1OTSD 1KJMA 2DQEL 4Q74A 4NKOA 1FG9C 3KJ6L 3PGFL 4OV6F 5D4QA 4MLSA 1ZLWH 3CDGB 4WUKL 4OCXH 5C0AE 4P2QB 1YYML 4K7FB 2NYYD 3FB6B 4XZUB 4QHNA 2ZG3A 1UKSA 3MV7B 4DZ8B 5E08L 3NCYS 5LGJB 1A7OH 4IJ3C 3U4EB 1NPUA 4D0BB 1CQYA 5FO9B 4FABL 4JLRB 4TUKL 1N4XH 4OF3A 1S7VB 5ADOL 1FLTX 1INQB 3QPXL 1A7OL 1A6VL 4NJ9H 4A6YA 4QHLA 2JJWA 4HUUB 3S36L 3WKMH 5LVEA 1D5BB 5ICXA 3QDJB 5F6IC 1T2JA 1R6VA 4X80L 5T1LD 1T7XA 1DQJB 1J86A 1CG9A 2MPAL 5A3ID 1BPVA 3QQ4B 1LEIA 1DANU 3ARQA 1QHPA 5F93C 2HJFA 5T5NF 3VXSE 4YX2H 3KXFE 2ZUVA 4OT1L 1SJEA 5FYLD 4X7FC 4MAYD 2ATKA 4K3GA 4CW1A 5CAYB 4FXKB 3W5NA 4RFNB 3ME0A 4POZC 1MI5B 3PGCB 5F6HI 5DWUH 4R4BB 3L5JA 5KN5A 5IV2A 2OI9C 5DUMH 3DIFB 4WDIB 1D5XA 3KG5A 5IB5B 3RWHA 1BVZA 1MREH 4R0LB 4HZLB 1RZKH 1C5DB 5EPMA 1BZ7A 2XA3A 3L5XH 1UWGL 4JFEB 3TO2B 1DQMH 4XVSL 5DMJB 4WHDA 2IFFL 3W0WA 1BZQK 3MUGA 5I66B 4QRSA 2ZUUA 4JFDA 5JIHA 3T2NH 4J4PA 1I8KA 4PRPE 3L3GB 5D7SH 1L7TH 3STLA 4E0RA 4WFGE 1KEML 2IFGA 3DXAA 4IRSA 1BJ8A 3K2MC 4L3EA 2H8PB 1NLBL 2XWBB 2Z31A 5E6IB 3X17A 1FN4A 4F57H 5CMAB 1FGNL 3E0GA 4QRTA 2R4RH 2LQRA 3QIWA 2ZUQC 3EW3B 3BEVB 4FZ8H 1GXEA 2CK2A 3PQYA 5LCVH 4JPKL 3G04B 2GY5A 1GAFH 3EOAB 1WIPA 1QR1B 1CFBA 1PW3A 3QYCA 1EHNA 4TVPD 5HYJE 3VFOB 3V5HB 2JE8A 5KSBB 2XFXB 4X4MA 3HE7D 1UACL 4N90E 2YXFA 4YHML 3SY0A 1DE4B 3ET9F 4IOFC 1M7IA 3S98A 1KCKA 2J2ZA 3MGAA 5JOPD 4GJTB 1BZ9A 3O3EA 1FVDB 1T7WA 3WS3B 3RDTC 1ZTXH 2ID5A 3M1BA 3R1GL 3V7AG 3QJHB 4KJYB 1A6AB 2PTTA 1XIWA 2BOBA 2DL9A 5FM5O 1IVLA 3GMRA 4OCRH 1A6UL 5HHVL 3G5ZA 1V3MA 2BY1A 3MLUL 3SDYH 7FABH 1F6LL 1WF5A 4XP4H 4Y2DC 4FOMA 4I2XE 4MNQA 1MCFA 2BNQB 2DQGH 3M07A 2VDRL 3DX7A 4MA7L 4OF6A 4FMFA 3FQNB 4K94C 4OGAD 3QUXD 1D3CA 1NJ9A 4U7KA 1C1EL 4XC1L 1S9KC 3UROR 3NFSH 3L3KB 5EA0H 3H9SB 2OCFD 3QNZA 2OTWA 3OJVC 4PG9A 1BOGA 1J0HA 4MNGA 3CSGA 2A2QT 4PD4J 2IQ9L 4MXVE 1U8OA 3BIKA 1BEYH 3X12B 5FGCE 4DW2L 4UDUB 4LSSH 4Y4KA 1WBXA 1ND0B 4ERSH 1KENH 4G43A 3T3MF 5EO1B 3CCHA 4NN7B 32C2B 4NRYA 5ITBH 3U6RB 2ZCHL 4QOKB 1PGRB 3DUHA 2D0GA 1T22B 2FHCA 1BQUA 5DQDL 5L8LB 1H5BA 3ARED 4LSQH 5E8NA 5L8JB 3FO0H 4CDHA 2D9CA 1ZT1A 1FSKC 1NMAH 4IRSB 3VJ6B 1KPRB 2LV4A 1U2CA 3RNKA 4HMCA 2D7OA 4NQCE 3MLWL 4WUUA 1U8MB 3STBA 2X42A 4B50A 2GIYA 3PWPA 4J3VA 5D72H 1CGSH 2Z31C 4NQVA 2UZIH 4YEFA 3AS0A 2R0KH 3GSUA 2VDQH 3GUTA 4O5LL 1KCVH 1FVCB 4IMLA 5D72L 5C0CB 1A22B 1MF2H 1J8HA 3KJ6H 1QSEE 3BH9A 4NRXA 2D4DA 4XH2A 1BVLA 4XPHH 1UWGH 4QCIB 3TO4A 4BJLA 3MRDA 4IS6B 4I8DA 4W6WB 5HHME 4OFIA 5INDA 1CF8H 2A73A 3Q5TA 2FO1A 4U1HB 5D2NA 4FABH 4O00A 4EZMA 3VWKA 1G6RL 4G9FA 4XTRD 1MFEL 2WLYA 1AGEB 3VRJA 3UCRA 1U58A 5DMKB 4JDVB 4U1LB 3TBSA 2R8SL 1I1AA 3W2DH 3LKSB 4HAGA 4JZOB 4CMMB 5BXFA 2PTVA 4ZD3H 4AEFA 5DC9B 3RGVC 4G6ML 4M7ZC 1BFOB 3X13B 5BS0A 5IW1B 4YUEH 3MYJB 4BSVA 4GKNB 1DQTA 4GAJH 2Q8BH 1I9RH 4XNQB 3DUUA 5DMIL 3FN0L 4YX2L 3WIHA 3LEXB 1F3DJ 1JPFA 3PDGA 3OHXA 4XGZA 1YN6B 3CFKA 3CLEH 2X1XR 2EXYC 2BK8A 1QRNA 1HE7A 1EEYA 5D2LA 3OGCA 4WJ5B 3OSKA 2XPGA 1YC8A 2ZG2A 3VFUB 5IFJA 2YD7A 2Y06H 1NAKH 3SGKC 2P48B 3N1QC 1ACZA 3VFGH 5LBSH 5MP6L 4U1IB 4KRLB 5ESVB 1XF3B 2V17L 4MQ7A 3STZB 3SGEI 5IV2B 4G6JL 4KKLD 1S5HB 4CN4A 4L8CA 3JUZA 3UO1H 5TE6H 4XXCA 2A83B 3BPLC 5EO1A 1YUHA 2WBJD 3EOBA 1Q9WA 3IXAB 3MLSH 4LPTA 4L8BA 5IMOB 3SCMB 3WIHH 3EO9H 3PUCA 3BKMH 1BWWA 3EOTL 5KVEH 2G9HA 3WFCL 3KHOA 4HSQA 1DSFL 4P3DB 2ITCB 3O8XD 2BSSA 2X1QA 1MHEA 2BFVH 3BZFA 4RIRA 3O3UN 4U6VL 5GZOD 4KRMB 3CDCA 4Y19B 4KXZH 2ZZUT 4ZOAA 4OM1L 4S1RL 5FM5M 1NGZA 1YQ2A 3TIEA 3TT1L 4KH2A 4F7MA 4R2GD 1H3PH 4P59L 3S34L 5JPMB 3NTCH 2IAMB 4PJ9C 3VH8G 1FVCA 5MI0C 2FGZA 1QSFB 3IU3B 4PR5A 3S3SA 3T2QA 3L1OL 4D9LH 2A9MH 1M71B 5CEZH 2RGSA 5MHSD 4TULH 1OOAA 4CRPA 4FN0A 2CDFB 4NFBA 4LGSB 1P9MA 4BH8B 2JCCA 1EMTH 3QDGA 4PJ7E 1ZGLA 4LCUB 2AEWA 3DTXB 1Q9OB 1E4KC 1F8TL 3QDMA 4R7DB 4XP6H 4P2QE 4PGCA 4QRRD 4PRNA 4P2QD 2P5EB 4ODWB 5KZCD 2P49B 2VH5L 4PP1D 1T80A 3O3DB 3MV8E 1HXYB 1UG9A 4X6CA 3RVTC 5MEOB 4ZOEA 5DK0A 1KIPA 3QUMH 3VMPA 1QBAA 3CXHJ 1B0WA 3HLAB 4UIKL 4ODBD 4JFQA 3VJ6A 4P99A 3S6CA 5BVPH 1AHWC 3UTTB 2A6KB 5E4EB 4ZUWB 1E6JL 1SY6A 1UZ6E 3HMXH 5M95B 3SDXE 3ILPB 3VXQB 2JELH 4X5XA 1BBJB 4PREA 4X6BB 2AKRA 1IE5A 1HHIB 4AM0A 4HHAB 1SBSL 5MENE 2NY7L 3VU2A 5ADPH 3T1WA 2O5YL 1KENL 4HF5L 2JIXD 2WANA 5GSRA 1SBSH 2G5BB 5CUSH 1BFSA 3QWRD 4JDZA 4U6XA 4X8JB 4KKCD 2QQNL 2FR4A 2V2XB 5D2NE 3S96A 1NMAL 1JWMA 3MLRH 4LLQA 4JFED 3AMLA 3IDMB 4WW2C 4N9GB 2XXMB 1CDUA 3BP6A 4F37K 4TUJB 4MXQD 4R2GC 3WLBB 1G7HB 3KWWA 1JF5A 5C0JB 5E7FA 4XMKH 4PG2C 2Q86A 4ZAKA 5F7EL 1QSED 5AZEL 2HG5A 1I3UA 2D31B 4CVUA 1QFWI 3FB8B 4WW1B 3J7HA 1UC6A 4MA8H 5C09A 3VXTA 1A9EA 2GJZB 3SCMD 3LIZH 4AG4L 4NWUH 1W0VB 2JCCF 2HT2D 1CGWA 3R8BB 4UINL 1KCLA 3MJGX 3FFDB 4Q0XL 4YDVA 4Z7UA 4XXCC 5T1KB 3TBYA 4ODHH 3CPLB 4M1GH 4KHTH 5EOCJ 3KPRE 4RGND 4TVSa 3I6GA 1MCCA 4PJXF 5EZIL 5D96B 2EKSA 1J5OL 5D7JB 1R5IB 2EYSB 5DJ6B 3MJ8A 3H3KA 2N4IA 4HV8A 3NN8A 3W2DL 4B5EA 4EN3B 2R23B 2Z93B 1AJ7H 2W60B 2JB5H 1BQHA 5HGAB 3JV6B 4JZJB 2JF1A 1PG7H 4HUUA 3B2UD 3ARYA 1DEEA 2FX8H 1DBJH 5D7KD 5F1KC 3THML 5DR5H 4FNLL 1R5VA 3MRQB 5DT1L 3VD9A 4KY1H 3HC4H 2FIKB 4KVNH 3ARFC 4Y8AA 5D1ZD 1ZAGA 4N5ED 3CZJA 2IPTH 8FABB 4X7DC 3BISA 3DPBA 4D3CH 1GH7A 5F9OL 3BWAA 2ITDB 4M48H 3T0EB 3W0WB 4JY5H 1FO0H 2HJFB 4JQVA 1HDMB 4HKJA 4WI3A 5CGYD 4HUWA 4HZLA 4GG6B 3KLDA 3CMOL 2YRPA 2XICA 2AXFB 5TE4L 3DMMA 1HH9B 5DGQA 1LK3H 4QNPE 3VFVB 5CSZA 2RHEA 4FQ1H 1EFXD 2UWEF 4P23C 1FYTE 3CSPA 2YA1A 2KBGA 3FQXB 1FLRH 4AIOA 1I1AC 3FOLB 4NHCL 1FJ1B 1E27B 3ZYJA 3U7WL 5FYKL 1AXIB 4U6VH 2Q76B 3T8XB 1FCGA 3QFDA 2EYRA 1TVHB 2XNAB 5TDPB 5HPMB 3TFKD 5JNYB 4RRPG 3SOBL 4G8FB 4KKAD 1NCBH 3TVMB 1A7BA 2H26B 3ZKMC 5I8KL 4U7SA 3RY6A 1GYAA 3N1GC 1A6TA 4NKIH 4OKVA 5E8DL 1IKFH 3CU1A 4OI9A 3D85D 4XP5H 1MPAL 3NIGF 4J3XA 5F9AC 5I8KH 3U83A 1IL1B 2CXKA 5DVKA 4NQDB 4ZOBA 5EU4B 1TJHL 1WUNT 2D7MA 3GMNB 2Y72A 4KAQL 1U92A 2Q7YA 3TYGL 2IANA 1JGUL 1N7MH 4TULL 3P11H 3GGWB 4Y4KC 3SEPA 5IBLD 3ES6B 3TA3B 4PJHF 1KJVA 4P4RA 3C2AH 3ZDYF 1NBZA 4RAVA 2APTA 3GSXA 5FHBH 2VITB 3PWJB 4WHCA 4Z95L 4IRJA 4J1UA 3GHBH 4LEOA 4X5XB 1PLGL 3MOAH 4A2LA 1FZJB 2M8XA 4Y1AB 2IADA 3OBAA 3L3KA 1JGVL 5FYKE 4TTDD 3A0OA 1T04B 1S7TA 3F5WB 4HWEH 3T0ED 4NQTA 1CDJA 4Z77B 5KVFH 1A6WL 1AGDB 3W11C 3OAZH 3WUWA 43CAA 3WHE0 4UT9L 5FUOH 2XFXA 4OCXL 4XPTL 1E6JH 4OD2A 1KB9K 3MNWA 1J5OH 5DQ9B 5C7XH 2XZZA 3FQTB 4G9FD 5D1ZB 2FEDC 4N8VB 4H88L 4M62H 1KPUB 1IQDB 2ZUXA 3D39D 1G7LA 4AJ0A 2V7HA 3WFZA 4HLJA 4X7EC 2F54E 3QDJD 4NBYB 2OTPA 5DRWB 1P4IH 5F44A 4ERSL 2NTFA 5AYQA 1URLA 3UZEA 3IVKB 3UYRL 2B1HL 4MNGB 4Y88A 2FGWL 1MQKH 2OXHA 4U1GC 1HWGB 2OTUA 5KSBF 3BXNB 1P2CA 1JFQH 5AAMA 2H6PA 4Q9BA 4U1NB 4KVNL 5TQ2H 5B4MD 4LRIA 5GRUL 2X10A 5J6GA 2VUOA 1G7PA 1G7QA 5DMYA 2P5WB 1A2YB 3CU7A 1AD0A 1OTUC 1QVOB 5FOJA 3ZTNH 3P73B 5DWUL 4PY8J 5C2UB 1EEUA 1J1OL 5EC1A 2P5WE 3BDYH 3PWLB 1U8HA 2VJXA 2A38A 4G42B 3WHXB 3DX6A 1B6UA 3DVIA 1AD9B 5C0FB 3LPFA 4OJFL 1U8KB 5CEZD 3IFLL 3LAFA 5C2BL 5CEZE 4OCLC 3B3IB 3B83A 1JRHL 5IFJB 5ALCL 3CGTA 3BKJH 3VFGL 4PRPA 4UB0H 5EH1A 4K7PL 5J1AA 4H0IA 2YMXH 3O6FD 2Q1EA 4GW5B 1FPTL 2EDJA 3LQMA 5CBAB 4NIKB 3I84A 3U4AA 4YHZH 2BOBB 4AY0A 3TBWB 3CFCH 5CCKL 4XNQA 4JKWA 3LKRA 3K4DA 4NJAL 2JB5L 5KJRH 1CXEA 3UBXA 3EHBD 3C6SB 4QYOB 4L29B 1KIRA 2D0FA 5E99L 4CADB 4OKDA 1DQQB 3DX9B 3CK0H 5DI8B 1ADQH 2EE2A 4HS8H 1INQA 2G9HB 4N8PA 5L2KA 2Q3ZA 1MHHA 4X98B 4GXVL 4LLVA 4PJEB 3X14A 1AQDA 3DXAE 1V7NL 2R2BA 1FAIL 1ETZB 3NZHL 2E6QA 3JV0A 3UZQA 5KTEH 1TJIH 2MJWA 2PTUA 1ZLUH 2P42B 5D1QB 5IP4A 2K1MA 1P6AB 2EDOA 1Z0MA 3P30H 4OF5A 5AG8A 4N1EA 3QFDB 1UCBL 5B8CA 5I1JH 4MQ7B 5JNYA 5J1TC 4KV5F 2YPLB 2IG2L 4UQ2A 4O4YL 3D3VE 1HNGA 1B0GA 3ZT5A 4JGMA 3WJJC 3PG2A 3BT2L 4PRID 3QEQE 1KC5H 3HCVB 3O4OB 4I1NB 2NY1B 1IM3B 2E9WA 2PN5A 4X7CC 1T1YA 2NX5A 3VI3F 3SJVD 4JRYA 2JIXB 4GG6A 4FTVD 2VZUA 1T03H 1MAKA 4YWGH 2AXFA 5L6YH 4K9EH 4KUZL 1KV3A 1A64A 1XGTB 5I15H 5IVZB 1HQ4A 2V2TA 1XF5A 3RWHB 4M43H 1KNOA 2P24A 4R96A 3F6LA 4NQSA 1YMHB 5A2LH 3GM0A 3AU1A 1R3KB 4JHAH 5CGTA 3BD3A 5IJKC 2BVOB 4YDJB 4UMGA 3BJLA 1XZ0A 2BCKB 3GJFH 5E9DB 4GXUM 3B3IA 4NO5A 4PJEF 3C5ZB 4ZDHA 2YWZA 3CNKA 3P9MB 3VXMD 5AZ2L 3P4NA 3QQNA 3NAAH 2XWTB 3SDDC 3V6FA 3MLYL 1T21A 5D2NB 4R0LC 5C07B 4BFIA 5HTSA 2QQNH 5HPOA 3PWVB 5DMGD 1HYRC 1BFOA 2EIEA 2P8LB 3QUXA 4KVCH 3VCLA 5E1AA 3ISWA 4QOKD 5BXFB 1KGCD 3VG0H 4L4VA 4K94H 4M1CC 2IMNA 4K3EL 5TF1H 3I02A 4LLMA 1WWWX 5DRXB 4MA3B 4N8CH 1TTUA 5T1LA 4OUUA 1K9TA 2IAMD 1JWSA 3UTTE 3TIDA 4HXBH 4JPVH 3BO8A 4MD5B 4AEHH 4HS3A 4ZPTB 2CH8A 4QYOA 4X7SL 3VG9C 4AEIL 4MA8L 3RVXC 1A7QH 2EEDA 4WEUD 3JTTA 1FORH 1UQSB 4Y4FC 1B4RA 3JWOH 4UV7L 4PBXA 1PEWA 2R2EA 5ITFB 1D6EB 1XR9A 3VFTA 3EJZC 1WAAE 1LEKB 4MQXD 2MQCA 2WV3A 5FGRA 1QUNA 3IJHB 2WIIB 5J6GB 2CDFA 3Q6GH 1JPST 4TUKH 5DUBA 1YEGH 3PL6C 1CS6A 1I7RA 2WWMC 2HAZA 4DTGL 5D7IA 1H3VA 1LGVA 1JUFA 4YBLB 1YEGL 4Z7NE 5A2KH 5EZOH 1Q0XL 3MRJA 4X8JA 2B5IC 4J6RL 4DCQB 3WNMA 1T2QH 2OR9H 3CMGA 3QJFA 5T3XE 1ZSDB 2I07B 3D5OF 1IC1A 3CFEA 4QRUA 3PXHA 3GHEL 2IC2A 2VLLB 4XNMB 4AQOA 3HI6L 5K9OB 4DEPC 3QUZB 3EKCA 5IWLC 2FO4A 4FQQB 4YR6A 2ZJSL 4P23A 2PXYD 3KJ4B 2CDGA 3KJ4C 2VZ3A 4B41A 3TO2A 5B39A 2RR3A 3NA4A 2D9QB 1FV1A 2F53A 1F4YH 5F7KC 3FQWB 2RJMA 4HWUA 5DFVD 3ZKND 1LO3H 2AQ2A 3LS5H 4NFDA 1T7YA 3ORJA 5GS1A 3RTQD 5I73C 2ENSA 4NZUH 3U0TA 5HYFA 3MLPA 3MLSL 25C8H 2YZ1A 4RFEB 2P44B 5L2JA 1OP3H 1PY4A 2A1WH 3GMLA 2XWJB 1XGPB 1XF4B 4MS8C 1C5CL 1Z5LA 1PVHA 4ZO7A 4Y4HC 1BJ1J 4DVBB 1NC2D 5ILTL 3OAUL 2D03L 2F74B 1SJXA 1PQZA 2CKBB 5I1CL 1KSRA 2BDNL 5D7LA 5IBUG 1YPZE 2X7LA 3RZCB 2DD8L 4DK3A 2H2SD 4IRSC 4JANA 3TT1H 5CLTA 1TETL 1DSFH 1Q1JH 3SY0B 1OLZA 1P7KA 1XIWC 4JG1H 3T65A 2DD8H 4JM2A 4RGOH 3V2AR 4TRPL 4PYGA 4Z18A 1AIFB 3MRFB 1FAIH 3LZFH 4QXGH 5CEZL 3QUMA 1N2RA 2H26A 3MYJA 1N5YH 1ZE3C 4Z7VF 3T0AA 4NBZB 4WU7B 1NFDA 4M7JH 5I1IL 4YHYC 4EDXB 1MCPL 1S7XB 3BJ91 3LQZB 4XX1G 3B6SB 2NY4D 5E08H 1CLYH 1JGLH 4KQ4H 2OL3H 2P8MA 3F7QA 3LV3B 5B21A 4BKLA 4FP8H 4UT6H 2E8YA 4M7KL 4WEMB 2WIMA 3MJ8B 4N68A 4XNYL 3ZL4H 2E7LA 2YKLL 1D5IL 1WJ3A 3JSSA 5FYLH 3S5LG 1HIML 3C5ZA 3FFCB 1QACA 3KVQA 5INCB 1ZLVK 5F7HA 3VGAB 3DMMB 5D5MA 1BFTA 3O0RL 2YPVH 2AJUL 4YHIA 1XF1A 5DD5L 3VXPB 1FNGA 1I8LC 3MNZB 2DWEB 1QFWH 2DKSA 5JIIA 4OSUL 4GFTB 4ONHB 2R2HA 3I9GH 3RVUC 5DHYA 4KUZH 5SX5H 4NNXA 1HQRB 4JN2B 3GSOA 4K9EC 4M02A 8FABA 3SJVE 4JHBA 5I16B 1IAOB 5T1DH 5JPNA 5IFHL 2O5YH 4HF5H 5D7IE 1I7UB 5F7DB 1LE5B 1HKLH 1FC2D 1SJVA 3MCG1 3GB7A 3E6HB 4DQOL 4OM0L 3FFDA 2OS7A 4O51B 3RQ3A 1TZGH 5D5MF 5HVGB 4YDIL 5M94B 1I9EA 3HI1B 3PQYE 2A77H 2Z35A 2HN7A 3WEXA 1QBBA 4KZEH 3BD5A 1Z5LB 4YC2B 5DJDB 5E2WH 4DKEL 3HUJE 1R3JB 2YRZA 3F65A 4YO0A 2YN3A 3D2UB 3H42H 5JXED 1Y18B 1PFCA 3NPSB 3VE0A 4AG4H 4X99B 1CD1A 2XKSA 3PDOB 3WIFB 5D1QD 4P57B 4XHJC 4Z7VA 4OB5L 1UB6A 5IOPA 2F5BL 2F74A 5BRZB 3QEGH 5F7EH 2EXYD 5FO7B 1TVBB 4W4OA 4JPKH 3QRGH 3RVVC 2FWOB 3HZYB 2CGRH 2Y4SA 4PJ8D 3NFNA 3FO9B 4AENA 2V7NB 1ONQB 2AJ3A 3PHQB 1CT8A 1T89A 4NWUL 3O8XB 4K07A 5C0FA 3FB7A 3AS3A 2VZTA 1ZLWK 1IRAY 4OZGA 2J3SA 4NHUB 1Q9OA 2GW5A 3L3IA 1I9IH 4KHXL 3VXNA 4BQ9A 2ARJQ 4XCEB 4ZFOA 3NOIA 1GHFH 1MWAB 1YY9C 2DMCA 4I3SH 3GIZH 5ECJE 2E7HA 2IGFL 3B9KC 3O9WD 5BCAA 4I5BB 4CVWA 3BGMB 4U1NA 1W72L 4IOIA 4JR9H 4DZBB 4KGLA 3OKNA 4L8SB 1XGRA 4XTRC 3K8LA 1VEMA 1AJ7L 3PJSB 2UWEE 3B9KD 4YUEL 5DUBB 1FL5A 3UJTH 4ETQB 2VL5A 3BESR 2WUCH 3U36B 1CE1L 4L29A 3LZFL 1D9KC 3HE6B 5E03A 2MPAH 1MHPL 2VMFA 3TT3L 2ESVA 3NZ8B 3HRPA 1OCWL 5F1IA 2F19H 2FB4L 1D6VH 4P5TB 1VSCA 5ALBL 4NQCB 1JMXA 3VGFA 1MJ7L 4JB9H 4EI6A 1YNTB 1KTKE 4PJAF 4MAYC 1JJUA 1U95A 3HE7C 3P4OB 1X6LA 5DVMA 2PW1A 5HDLA 5CP3H 4HD9A 2NNAA 2OK0H 3SGKA 4HDIA 3UJIL 4KU1A 2XKNB 2PETA 3HI5H 3O6MH 4PP2A 1UXWA 1B0RA 4Q9QH 4OSUH 1YNLL 3DX8B 5CLWA 1ZHKA 4IRJB 1M7XA 4TOYH 4OZHF 4J1UB 3ZYZA 3P9LA 4LCUA 1U8IB 5C09D 3FT3A 2HH0H 3B8SA 2BVEA 3ULUF 1ZGLP 2ZWLT 3MRHB 3TWCH 3DI3B 2VUYA 5DRZA 3LB6C 4NKMB 2VWEC 1IKFL 5IJVB 5H94A 1BQLH 3F7YA 4PR5B 1CL7L 2BFVL 2O5ZL 1ADQL 3O2VH 3EYFA 1Y18A 3NACH 4M1DL 4WWKD 5CSBA 1R3HA 3QP3A 1FL6A 2M1KA 1YPZB 4FQXC 3FRUA 1NBVL 3M8OH 1AP2A 2IANE 5DURB 5SWZE 3MUY1 2FJHB 1NFDF 5GGVL 4HK3J 5HGDB 43C9B 4PLNC 1X5HA 3QA3A 4NC1C 1NSNL 1BREA 1KBGL 2E7MA 1JGLL 2GYSA 4Y7MA 4ZUUA 4LIQH 1AFVH 2BVYA 4YHPA 3GNMH 4Y4FA 4GO6B 3L3OB 2NX5B 3B2UC 4KPHH 3OJ2C 4PGBB 3WYRA 5E8PB 4XP1L 5ID1A 4LLDA 3HAEH 4Z7OE 1KLGA 3C8HA 1T0PB 3HC3H 4L4TA 4OI8A 1LQSR 5DS8B 4P46A 2XOTA 3MV9B 1C5DA 3GI8H 1QSZA 1G7JB 1UM4H 2Y7QB 4BH7A 2P46B 1WZKA 4KTDL 1YJDC 2YZ8A 1R3IH 5JQHC 2DWEA 4JKPH 1MELA 4KMTL 1T1YB 4WCYH 1SEQL 3QCUL 4Z78B 1IKNA 3B4NA 1R3IL 2X70A 1U3JA 4OM0H 2ZOKB 1I3GL 1OWWA 1NAMH 2QL1A 4N0FA 2MMXA 1NDMA 3LPGA 4D0CA 2H32B 3QI9D 4U3HA 2CO6B 1T5WA 4JM2C 4LLUB 4BK4A 3MRCB 3QQ4A 4HMDA 4G6JH 1H3TA 2X1OA 2NR6D 3MLXL 5E2WL 5JOFB 2VLMD 5E9DD 3SKUD 4O2EA 2NY0C 2PCPB 3D9AH 4NKDA 1MY5A 1AE6H 5FF6B 1BQHB 5HGAA 4U1SB 1T2XA 4O9HL 1LP9B 2VXTH 3U4BL 1KACB 3EYQC 4KK6D 4HBQA 2J88H 3S7GA 2ARJB 3BP4A 5E8NB 1JWUA 4PJ9D 4H20H 3HAEA 4YPGB 2X7LB 5JHDA 2AJYL 3UTZB 5DLMH 1MRFL 1YEDB 4XCYB 3MXWL 4LBEB 1VFBA 4ZTPL 3TA3C 3HNSL 4N90D 1F90H 5L88H 3RVXD 1MIEH 3GSUB 1I1AB 4I0PA 4GMSL 5EFIA 2VSCA 1Z3GH 2AAVA 4LRNH 3QFJA 4WUUB 3U0TB 2RB8A 4ZS7H 2EDKA 4DUXA 2FD6L 3X12A 5DD0L 3WJLA 5INDB 4FQPA 3OKMB 3MV7E 2X4QB 3PL6B 1UH2A 2VLKD 1J8HD 4LPUA 2Z92A 1DFBH 4H8WL 1WZMA 4YC2C 4GW1B 5E4IA 3FZUD 2VB5A 1P4LA 1FNEA 1DFBL 3IU4L 5D6CB 4QXUH 4GSDL 1OCWH 3T65B 1ERNA 2DQGL 4FQLH 1S5IL 1U93B 3CH8A 4JFYB 5SWSB 1T83A 3EO0A 2CMRH 2PUQT 4XBPA 3M1BB 5FYJE 1MJ7H 4UOW1 4UZGA 5GHWH 4Y2DB 2R4SL 1AFVL 5B39B 2FDBP 4POZD 3NFSL 2ADJA 2GSGA 4UU9B 3BP5B 2Y07L 1KT2A 3E2HB 3DGCR 3QWOA 2YD6A 2VDML 4NJ9L 3T0WA 4JFFD 5LBSL 5MP6H 1OGAE 1V3KA 2VLJB 3EZJB 1H8NA 2J8UE 1EHLH 2BNRB 1T20B 3IS0X 1AQKL 5C6WH 4FTVA 1BLNA 4HEPG 5IK3B 1INEH 1M6OB 5F7FA 2GCYB 3QNZB