4BQCA

Crystal structure of the fn5 and fn6 domains of neo1 bound to sos
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
203
structure length
197
Chain Sequence
b'TGTPMMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 34
structure length 197
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA02
4P59L 1QLFA 4LLVB 5IQ9A 5L2KE 4PIRF 5D1XC 4JFHE 2NXYD 4XBEH 1NUDA 1TQCB 1AGDA 2OBGA 1QFWH 2OR9L 3H3PL 3RKPA 4JY5H 2CRYA 1DQTA 2Z4QB 1G7IA 3S4SA 5TE7L 5EA0H 3HE7D 1RUQH 1TXKA 4NQEA 3GHBL 2GK2A 4K2UL 5C0CD 1VGKA 1AP2B 4MB3A 4I3SL 1QSFD 3X17A 4NRXB 2Y72A 1NKRA 1SEQH 3TBTA 1CN4A 2GHWB 2GJJA 4P2QD 2JLLA 1CS6A 4YDIL 4ZUVA 1GJIA 4FTVE 3QCTL 2QQLL 3UTZB 3TFKC 5CCKH 4OB5H 4U0RC 2A1WL 2VZSA 5CBEA 3FB6A 3CXDH 5J11B 1FNSL 4ZD3L 1LE5B 5LXGL 4YGVA 4GQPH 2X4RB 4JPIB 3CFDB 4ISVA 1RUAH 4F9PA 3MBEA 4Y5VC 5TH2B 5I30L 5I19H 3VFRA 2IAMD 3RTQD 4F58H 5EU5B 4KZDL 4TULL 4JHWH 1ZHKB 1HYSC 1KPUA 4YXLH 1CGXA 4H5SA 3MRLA 3RVUD 2RIKA 1WBXA 2GK0B 5E6YA 1P4BL 3VFWB 1S7WB 5I76A 1UYWH 1GOHA 4M7KH 3WS3B 3WHE1 4IMKA 9CGTA 3F58H 1CIDA 1U6AH 4N9GA 1WAAA 2J4WL 3E6HB 3RGHA 2XA8L 3SKJL 1G9EA 1BD2B 5EUOA 2FBOJ 3O45B 4OKDA 1MRFH 2VAAA 4PJBF 5DJXB 4JQXA 1AXTH 1ZHLB 3SOBL 5ESVB 1IZJA 4G42A 3ARYA 5CP7A 1E4WH 3ARVA 5IR1B 5GGVL 4CNIA 5CLWA 1CGVA 2ADJB 3LRHA 1CXLA 5AUMB 1LILA 2WM0A 3MRFA 4YHLL 1OM3H 2HJLB 3CH1A 3DECA 1BFVH 3ARGC 1MI5E 1A3QA 2JB5L 2OXGA 4H25B 4P9HH 3O9WD 5GS0L 3P40A 1EEUA 5JUEL 1JF6A 1N3NA 2AXJA 4GXVL 1MCHA 4ZAKB 4JKWA 1NDMB 2UWEE 1YEFL 4NFCA 5HI5D 5IJVA 2VERN 5JO5A 1DVFB 2FIKA 1FIGL 4OZGA 2HT2C 4UMGA 1VFBB 3QNZB 3MUZ1 1HWHB 3LKPA 5GIRB 4ZOBA 5ILTH 4ODTL 1HQ4B 1NBQA 4HGMA 1GOGA 4EUPB 1NBZA 1E4KA 3I9GL 3VFMA 2VLLB 4PRAB 3VXUB 4ZSOE 1NAMA 2NW2B 3B9KC 5SWSA 4RGNE 4ODXB 2B5IC 5DJ6B 3INUH 2ZCKL 2PXYC 5I1IH 2DL9A 2XNAA 4PGJA 2IPTL 1HHKB 2L7UA 1ZA6A 4JZJC 2R29H 4M3JA 1KBGH 4P5KA 1F4AA 4M7LH 5C0BD 4HH9B 1RJCA 1HSBB 3MLSH 3UPRA 4U1SA 2X4PB 1NH6A 3QNXA 1HYRC 1RZGA 1IEBA 5DMKB 2FJFB 5SX4H 1CLZL 2BJML 5IUSA 1ZS8B 4K9EH 1IC4L 1BEYH 2Y4SA 3N1FC 1T0MA 2BCKA 4LASH 4U1MA 1UXWA 1S9WA 2YBRB 2FEEL 3LEVL 3SQOH 1MCCA 3NIFE 5CEZH 4HWZB 4WO4A 2D31A 4OIAA 5DRXB 4KKLD 4ZYKA 1IGYA 1VKXA 3BP7B 4NO3B 1CCZA 4FQCH 4WIQA 3K74B 5GGQL 2HA1A 4OFIA 1UH2A 3NCFB 4XZUB 4G80A 1GGBL 2OX5A 1X9QA 5E2JA 3QCUL 3VWKB 1Q72L 3HZMB 3PP4L 4HJJL 4K8RL 3PWLA 2G9HB 4P57A 4FFVC 4YFEA 4P4KB 2W9LA 5DK2A 3SCMD 1RZ7H 1MIML 1TJIL 1EXUA 5DJCB 5E2WL 2GJ6A 2VDQL 2MNUA 4HWEL 1EA9C 5D7IB 4KUCF 2P48B 1G7PB 3OXRA 4Y5VA 1XZ0B 1BWWA 2ZG1A 3ARTA 3CFCL 4XPFH 5FOBA 1JHTA 2QQKH 1NC2D 4PJ9D 3SPVA 4OCRH 3WO4B 3M1BB 4WHYH 2W91A 3BJ91 3PHQB 4YUEL 4YNYA 3U1SH 2Q3ZA 4OZHF 3RIAF 2VISA 3MRIB 5ICYB 4NZRL 3LN9A 1WAAE 4LAQH 1ZSDA 3MO1B 4LFHG 5JQHC 3ZDXF 3S88H 4MB5A 2YPVH 3TN0D 5EUOE 1RFDL 1YEEH 2R69L 3MGOA 4LSVL 3MRCB 4HS6B 2HLFD 1NGXB 1DBML 2WWMC 3BGFB 3OZ9L 4FXKB 4R3SB 2MCG1 1E6JH 3DX9B 1SJXA 5DHYB 2I5YL 2GY7B 3OKMB 3HG1B 4TVPE 4QHUA 4POZD 1KIUA 3FB5A 3L5IA 4PBWD 4CVUA 1KIPB 3LS5L 5TQ2L 3RUGA 2AJUH 5B8CC 5EU6E 3MFFB 4XPTH 1FVDB 3O3EB 4MQTB 4N0YL 3KPSD 3FRPG 3WFEH 3MLUL 1H3PH 3MRKA 4LBEB 4MZ2A 5IHUH 1QQDB 4HCRL 3G5ZB 4DZBB 5FF6A 1H9VA 1QRKA 3TV3L 3QUYC 4H8WH 1Q9LB 1GRWA 4U6HA 2CPCA 4OZGE 4QT5A 4N0UB 5BRZE 5CGYC 4MCZB 1FLTX 3D87B 2CIIA 4G6MH 3QG6A 4QXUL 5D6DC 3UTPD 3UYPA 1OTTC 2GITB 4PLOB 2ORBL 5GS1B 2DWDA 2XFXA 4LVOB 5EBMA 5SWSE 5IHZB 1KPRA 3MQIA 1PLGL 1Z9MA 4X4XB 5KAQF 5K9OB 4CADB 3CFBA 1OAXL 4YBQD 2AW2A 5HDBF 3IKKA 1UCBH 3B9KA 5MEQB 3BH8B 3UCRA 3VH8B 2PXYA 3UBXB 3IFOB 3S37H 1AQDB 4LNVA 1E6OL 4JZJA 4KGLA 3PGFL 3C2AL 5AWNH 3RWJA 1EERB 2PW2B 4NQDB 4S10A 5F9AC 3CUPA 4OZIA 4UDUA 4ELKA 3KPLB 2JK5B 1MY7A 5MI0C 3KYNB 3T0AA 4KRPC 3CIQA 3BQUC 4HLZG 5IVOA 5E8OB 5GGVY 2OL3B 4X6CB 2JELL 3QO0A 2ID5A 2VJXA 1FGVH 1IC7H 1JNLH 2HFEA 4A2LA 4ONOA 5EBWA 3L7FB 4O58L 5DJ8B 5DLMH 1Q94A 4AEHL 5JXAH 3QIBA 5IOPB 3FFCA 2ICEA 4O02L 1RZFL 5AYUH 5CEXA 1HHGA 3O3AB 3KR3H 4XTRC 1R0AL 2QHRL 1X7QA 4OLUH 4WU7A 4NJAH 2OJZH 4Y2DA 4ZODA 1MCIA 3CFKA 1VFAB 3OPZL 1JPTH 3FFDB 4FZEH 4W81A 5F93C 1RK0A 4V1DB 1BZ7B 4OQTL 5TDNA 1TVDA 2GJ6E 2PYEB 4MVBC 1GH7A 1IFHL 3LSOB 4FP8L 5I8OL 4HXBL 3FO9B 3A67H 3DV6A 3Q5OA 1YEDA 3MA7A 1A7OH 1DE4B 1UZ8A 1Z5LA 3RVXD 5FYLH 1YEJH 1TFHA 2ZSVB 4M6ML 4K3EH 3RKDC 3SY0A 4YQXL 4PB9H 1WLHA 4LLWA 5I9QC 1UB5A 3AM8C 4KMQA 4CU7A 4RA3A 3BP6B 3KJ6H 5EIQA 1DQDL 4NHUA 3QDGB 3HUJF 3O6KH 3WXVH 3IAPA 5D2LE 3UTTA 2FZ3B 4MJIA 3IDIA 3UDWC 4L4TB 1M7IB 2V2XA 2IADB 4GUPB 3TVMA 5HDQL 3HAEH 5ALBL 1SVZA 5DMGD 3N9GH 1KJ2B 4TSCL 5I16B 1CFTA 2CK0L 4TNVF 3TCLB 5D7LB 4PRPA 3OKNA 4P5TA 2WBJC 3GMPA 3U83A 3UJIH 1K6QH 2JJVA 3L5XH 1FO0H 5CIPB 4QRSB 3N0PB 3U2SA 5C7XL 2WW8A 1T80A 3BGMA 5GRJL 4BZ1H 5CZXD 4E0RB 3O2DL 3X14B 1MAMH 1RJZB 4N90E 4Q9BA 2DQEL 4FFZH 4H0IA 1S9YB 1U8JA 4L8DA 2ED9A 4H0GA 5EBLA 3C8DA 5A2JH 1OTUC 1Y0LB 1DQLL 2ZKHL 4FXGA 5D2NC 2C26A 4BFEA 4PY8I 3D39A 5HVWA 1KN4H 1SQ2N 1S5HB 1Q0YL 1P7HL 4DN4L 1R3JA 3TNMB 4ONHA 1JNNL 4OCYH 3DHMA 3DTXA 5D6DA 4CMMA 1N5YH 5KSUA 3EFDH 3U36A 2MPAL 1C08B 4WTZG 3ZE2E 5DZLA 5CJXC 1ZLUH 5D72H 3Q0HA 1YMMD 3PGDA 2VO5A 4S1DD 3QDHA 5LGKA 4CVZA 4J23A 1WTLA 4QOKE 5EORH 1JHLH 3U4BL 1KJ2L 4Z7WB 1RUPH 4V2CB 1YEIH 4OZIE 3QJHA 5D1QA 2UYLB 4BH7A 4PGEA 2P5WD 1TMCB 3I85A 4EUPG 4Q9QH 3RWEA 3WDJA 5TF0A 3MNVA 2NY6D 4LSRL 2EZ0C 4MXQD 5AZ2H 5CWSB 4I2XA 4NBYB 2HVJB 3BQUA 1JN6B 5C9KA 5E9DB 4DVBA 1O5DT 4H1LH 4KK6D 3UPCA 1X5HA 4R90L 4XPBL 2X4SB 5DZNA 3MCLL 5F96L 4J8RA 4PV8A 3AB0C 3O4OC 3FFCE 5FDWA 3V4PH 1OQOA 2XWBA 1OY3B 1WVZA 4PD4K 1I8IA 1INQA 1QBBA 3SDYH 1WUNT 4JO2L 3ZKSD 1GC1C 3I3EA 5L7XH 4IHOB 1JWSA 1ZGLP 4MHHG 1FZJA 4QRQB 4K3JL 5A40E 5EH1A 3BJLA 3VWJB 5KW9L 3LQAH 4M1GH 2O5YL 1U3HD 5C0AA 4PG9A 2GTWA 1CD0A 5E7BA 1BZ9A 4Y16D 3TA3B 5IBLD 1GAFH 1XF1A 1YUHB 4N0FA 3X11A 4O4YL 5H37H 1N4XL 2A77L 2HP4A 1YPZA 2W0FA 1MRCL 4D2NA 2GFBA 2YKLH 1A4JB 5T3XE 1MUJA 3EHBD 1KEGL 1RJLA 3ESVF 1CD8A 4PB0H 5T1MB 5SWQB 1KB5B 4MQXD 4RWYH 2DQFA 4N8VB 5BVJA 3P73B 1KJ3H 1ITCA 5JHLH 1I4FA 2R9HC 1CBVL 3SE9L 1JGVL 3SJVE 2CLZA 4NWTH 3AM8A 4FQHA 4N0CD 4Z76B 2X4OA 3UTTE 5GSRA 3R8QA 4C58B 4MJIE 1M71B 3P77B 4TRPH 1QUNA 4XPAH 3VXOB 3KPMA 1RK1B 2NMSA 2HFGL 4D9RE 3MRNB 1J8HD 3GRWH 5D1ZC 2R0ZH 3TBYA 3TZVC 4R96A 4JPKH 1ZGLM 4Q7DA 1KIRA 5DYOB 1GGTA 1UXSA 3ES6B 3L3GA 4GQ9L 2DQTH 4NQCD 4KDWA 2DLFH 4YHOL 4RBPK 2RGSA 4XCYB 1BM3L 1G6RH 1FL3A 3JTSA 2AAVA 3FQXB 12E8L 2DD8H 3U30C 1K4CB 5C0RH 1T7YA 1OL0A 3HN3A 4NM4H 4W4OC 4JKKA 4YR6A 2NW3A 3ARBD 4KUZL 2ZCLH 2CUIA 1BF8A 4PPTA 2W1NA 1UWGH 1KB5L 5ELIA 3HI5L 1EEYA 3A6CH 3N1GC 3MR9B 2CJUL 5FM8A 4WUUD 1GGCH 1IAIL 4F7MB 3WL9A 1AR1D 1IC5H 1U8NB 5F6HI 3ARUA 5GRYA 3BT2L 1X5KA 3TYGH 3BAEL 1INEH 1HH6A 3W0WB 2NY2D 3CFJB 4CGTA 4NN7C 1WFUA 1NCBH 3WFBL 3E3QC 4NNPH 1LNUB 1EEZB 3EYQC 4AL8H 5CJXA 3F7QA 4X0KB 4YX2L 3WIFA 1BFOB 1MLBA 3P0VL 4UTBH 1CLYL 1VACA 2B39A 4QRPD 5EU4A 5DD3L 3VXRA 3HS0B 1CE6A 2BNUA 3KPQA 4I2XE 5F7UA 4HUXA 3ULVH 2V5MA 2ZP0T 3I6GA 2B4CC 5DI8B 4X6FA 4P49A 2JB6A 3MOBH 4P2RB 3VFTB 2ZG2A 3HZYA 1DQJA 4XP4L 4P59H 4WI8A 1J7VR 2FH6A 1Q9WA 3MRBB 3ZTJG 4XVTH 1A6ZA 3VH8G 3WIIL 5D7JA 3UBXG 3B5TA 3H3PH 1NCDH 4YHMH 1JZ6A 1MFEL 3QIUB 3GJEA 3WNKA 4XPGH 4R4BB 4F7CA 5CEZE 2NX5D 3JV5A 5IESH 4FQ2H 4WEBH 5IF0B 3GHBH 5IM7B 1A1OB 2KL6A 3QUKA 5F3HB 4RMWA 5C0AE 4J7RA 1HHJA 3OKKB 2DJSA 5DHVB 4PGCB 1RIHL 4QXWA 1I3VA 4QTHA 1OD9A 4YDVA 1YY9D 4XCNB 2VDLL 2XKNA 3TM6A 3OR7B 3F7VB 2HKFH 1YPZE 5DQJB 1J0KA 3O6LL 3SKMA 3VD4A 3ARFD 2A6KB 3ARDA 4XCFH 4MB4A 1EX0A 4M4RA 1AGBA 2I9TB 5F7NC 1A1MB 1AKJB 2DBJA 4NCC1 4NGHH 3NIDF 2EDXA 1KEMH 4OKVA 4X5WB 4ZOCA 4HGWA 2R1XA 4BFBD 3RDTD 3DRTA 3PWVB 5L9DL 4OIIH 3T77B 1HH9A 5GGTL 3W2DL 4MD5A 3T4AA 1EV2E 3RZCB 2FLBT 1VDGA 4X80L 5I15L 4AIZA 2P8LA 1RZKL 5JMRA 3OKDB 4YFLI 2APTA 1A3LH 5FAAA 4UTAL 4JFPB 1U41A 1I3UA 1XH3A 3T2PA 4KMLB 4JGJA 2AK4A 2BVYA 3BD5A 4JN1L 1Q1JL 5D1ZA 3JWOC 3NFSL 1K5NA 4LLAA 4AENA 2CGRH 5JXED 2J3SA 2VQ1B 1A5FH 4S1QL 3HAEA 1P4LB 7FABL 1I8KB 3KLAB 4LCIL 3MYJA 4PBXA 2DLEA 3RY6C 4LSQL 3M07A 3GMQB 3EOBB 3SGJC 2K1MA 1VEOA 4N8CL 3MV7A 1FO0A 4HEME 3D1MC 5DHXB 3T8XB 4ALAH 5EZLA 3QXAA 4OCWH 4GXVH 7CGTA 1UJ3B 2B0SH 2Y5EA 4HJ0C 5BQ7B 4OZHA 1YEFH 3L3OA 2DMCA 3QDJE 1C5CL 4KXZI 4YC2C 2NTFA 1R3IL 3DARA 2DQGH 4HC1H 1IM9A 2AJZB 2HT4D 4MXVF 1P4IH 3HI1B 1V7ML 3BD3A 2AXFB 4XNYH 4MX7B 3I9GH 1LD9A 3FQTA 1T5XA 5GGRB 4B50A 5MENB 1JUFA 4UBDD 1WFOA 3V6OA 1CK0H 2EC9T 3GIZH 3VXRE 2ZCKH 1QHPA 3IB4A 4I48A 3W81A 4HGKC 4NCC2 3C60C 2HVKA 4GRWB 3RL1A 3A0OA 5KVMC 2WINB 4CDHA 3VW3H 4GJTB 2LAAA 2UVEA 3QIWD 3ALPA 1IQWL 5E2VH 4ETQA 5DRZA 4FQ1L 3VMPA 3RGVD 1S78D 1LWRA 1CLZH 2BJMH 1N0XL 1AFVL 3P4LA 4Y0GA 3RVVD 1D5IL 2R0KL 1OAUH 1FFNB 3ZYJA 1KT2A 5K9QG 3IJHA 1A6AB 1AO7A 4M43H 5D7SL 3P4MA 4H1LA 3GSXB 2D7QA 1G7HA 4Z78B 1K3ZA 5CGTA 3Q1SL 4OCLC 2BSED 2B2XH 4X6CF 4P23B 3ULSA 5F9WC 5HD8D 1OGAE 4MJ6A 4EI5C 4K94L 3WJJA 3T0EA 3BEVB 2ZG3A 3V7AE 3V0AC 1JWUB 2BRRL 1J11A 4DKEL 3QCUH 4K8RH 4HIIB 2D9QB 5E2UH 4KU1A 3PWUB 3BW9A 4D0DA 4M00A 3BP4B 2V5TA 1JZ5A 1CWVA 5E2WH 2AJ3A 4GRLA 5I1JL 3BKYL 1EPFA 3DVFA 4BYHA 4HWEH 3QCVL 3S36X 2AJYL 2E9WA 4R2GB 4OM0L 4K71B 1R5WB 1RUMH 2XWTA 5FYLE 5HGAB 3QO1B 5L0QC 4J3SA 3MBXH 1ZTXL 2OTUA 3CD4A 4K3HA 1KSRA 2ZJSH 1S7VA 1X5FA 3TWCL 3UC0L 3ILQD 3L7EA 4I0CC 1L6XA 3KNBB 3WNPA 1ZEAH 1ZVSA 3VGHA 2AK4E 4JKPL 5FECA 1OSPL 2VC2L 5E4EB 2EH8L 1TQCC 4N8VG 4PJGB 4D3CL 4BJLA 1DBMH 3ULVD 1PSKL 4GMTH 3B2VH 3GMRA 3U0WH 1NFIB 2R8SL 5ECJE 2DYPB 3REWA 3QQ9D 3OV6A 4KK5C 2I5YH 5HYQA 2IANB 3QHZH 3GRWA 2R1WA 5HYSB 4J2XA 1KCUL 2DLHA 5EO1B 4TSAL 5F70A 1JI1A 3MV7E 2H1PH 1FYTB 3QXWA 3PL6B 2AV1B 3QUXD 2JKXA 5GISL 3T3MF 3FN0L 1KCSL 1D6VL 3S96A 4MDIB 4L3EB 1UWEH 4OZHE 2BVQA 5J11C 2VZ3A 3KVQA 3DI2B 1EFXD 1UH4A 1I1AB 4KKCD 1SMOA 5I1EL 4YWGH 1I7TA 3OX8B 5FO7B 3KYOB 3TBWB 3W9EB 3ZDXE 1MHEA 2FB4H 2C7UA 4I0PC 5GS0C 2EXWC 5C0JA 3KXFB 5MEOB 1W72B 3O4LB 4M1DL 5IQ7L 5FO8A 3E3QE 4LLMA 5TE4L 1EZVX 5DUBB 5BJTB 2J8HA 1Q9OB 4N68A 1TJGL 1NDGB 2PR4H 4N1HB 1DP0A 3O3DB 4JJHA 1CGWA 3CSYA 3V6OE 5E6ID 2JJUA 4U2YA 4IOIB 5H35A 4BFGA 1I1RA 4AYFA 4OF0A 4QXGH 2I07B 3HC4L 4HLJA 2AERT 1LO4L 2VLJD 4L4VB 5IVXB 1E6OH 1KNOA 1FRGH 5ERWA 3TJEH 4PRHA 2I60H 3FOLA 1YNKL 2DQDH 2G2RB 3V52H 1GHFL 1EDQA 4OLVL 5ANMB 3D25B 1L7TL 4Z7WF 3DMMD 1A7NH 4B41A 3NOIA 4JFXB 3C6LA 4QF1B 1AO7E 2HFFA 2LU7A 2CLVA 4Y4HB 4LPUA 4ZS6D 4AEHH 2ZOLA 1FDLH 1FVEA 4JPWL 4JQIH 2BNRA 4O02H 1RZFH 3GKZA 3QAZB 3CMGA 3T0EE 3WN5B 4AM0B 1W72L 1CXEA 1R0AH 2RCSL 4LARH 4TVPD 5KVDL 5HDBE 4ZAKC 3CXHJ 4UNVA 3KPPA 5FEBA 2YSSB 1DVFC 5EU6D 5DVNA 5EZJB 1UJTA 1OF2A 1F11A 4G43B 3KYKL 2L0DA 4HIEB 3GK8L 4F2MB 4MNHB 1WIPA 4QHKI 3ZTJH 2IPUG 4G7YH 2W9EL 3CDYA 5D5MA 2F54A 5BRZD 1MCWW 4HKXA 1KG0A 3HE6C 5L88H 2ZUSA 5HY9B 1QEWA 3MOQA 4OBSA 4BSWA 1CU4L 1A14H 4ZOAA 5JOFA 5E08L 2OL3H 4RRPA 5FHBH 5FK9B 1KJVB 5HI4D 4F7PA 1DQDH 2A6JB 4XP9H 1VADB 5DFVD 3EJZC 4QEGA 3BSZH 4LLVA 4PJHA 1TETH 4LAJH 5E8NB 1G7MB 2HAZA 5TDPB 3IXAB 4PREB 3BDBA 3VXMB 5DA0B 4PRID 1GZPA 2VXTH 1B4RA 1MLCB 3R1GH 4HT1L 3QEQB 3GSNH 3NCMA 5D1XD 1J86A 1AP2A 4LSUL 4GKSB 2CIKB 3QUZD 3OHXB 5JIIA 4DGVL 4Y5XB 2R0WH 5E99L 1QNZL 4Y1AB 5C7XH 2LFGA 4HXAL 4WFED 3VWKC 1FFPB 3FQNB 5GGRY 1NKOA 3GSVB 3UTZA 5EG6C 1A6WL 1IARB 1ZE3C 1N6QL 5SWZB 1LE5A 1C5BH 3SGKC 4JPIA 3HUJE 4O2EB 3CFDA 4KTDH 3CC5B 5TH2A 2D7OA 4X83A 5EU5A 3VA6A 3TFKD 1DBKH 1JNNH 2YS4A 1CFVL 3WO4C 4F33B 3K3QA 3C9NB 4LHUB 1QRNB 2FWOB 3KPRE 4ODUB 5T1DH 2GK0A 2D03H 4YO0B 2VITB 3VFWA 1S7WA 2QV2A 4M9PA 5FYJL 1PQZB 3LD8B 4JVUA 4HC1A 4YDJA 3OF6A 2B1HL 3WS3A 3UZEA 4ORGB 3VDBA 4PTTB 5J89A 5J1SC 3DO7B 2VWEC 4YBLB 4JANA 1HYSD 1P9MC 1TTUA 2VLRD 1EH9A 1BQSA 3QPQC 4KHXL 3E6HA 4DN3L 3VFVB 2IH1A 1BD2A 1EAPA 4NNYA 4OQ1A 3O45A 5TQ0L 3SKOB 5CIPH 1M7XA 5F7EH 3TT1L 3JWDL 1G9NH 1ZHLA 4LSRH 5ESVA 1PEWA 2R15A 1W2KT 2VLKB 2M2DA 2WK2A 1ULVA 2BY2A 1UADC 5IR1A 5LWYL 4PRNB 3EBAA 5AUMA 3W5MA 5LQBH 4XVJH 5F88B 2HJLA 3MV9D 4U3XA 3DWTA 2EKSB 2DLGA 3VMNA 1OAKL 3WFHB 1JPFB 4YXHH 5ACLA 2XZAL 1KB9J 1CGSL 1J5OH 3DVNB 5TFSH 1F4XH 2H26B 3GKWH 4K3JH 4JRXB 5E70A 1MHCB 2EEAA 5JW5B 1B0GB 2R39A 3PGCB 5KW9H 3H6JA 3P0YH 1OLZA 3ARGD 3KHOA 4ZAKA 2O5YH 2BSRA 4WV1C 5E0QA 1M7DA 4DFHA 1VFBA 3MV01 1IQDA 3QNZA 5T3ZH 5T1LD 1T7WA 1HQ4A 3T0XA 3A6BL 5DQ9B 4WGWB 5GS1C 4EUPA 1J1OL 5GJTH 5K9JL 4V2BA 4UDTB 2VLLA 2F54E 4PRAA 3VXUA 5IBTH 4OD2B 5KS9F 3EZ8A 1YEHL 3L5WB 4LL9A 1DANT 2NW2A 4IDLA 1K8DB 2HT2D 5CJQL 2F74B 4ODXA 3S5LB 5DJ6A 5DD1L 4JFQB 2KUTA 4KVCH 2G5RA 2IG2L 2PO6B 5C07A 1GXEA 1HHKA 1QO3A 3FT4B 5EUKB 3HLAB 4Y4FC 3PIQB 4JRYB 2O93L 1JGVH 1CIUA 4BUGA 3HCVA 4HH9A 4HK3N 4PJ5A 1HSBA 1U9KA 4N1CA 1SBSL 3RHWF 3D85B 3KHQA 5DMKA 2FJFA 1ZS8A 4OD3H 1HINH 4QOKD 1NLBH 4GG8B 4PJ8B 4N8PA 3MJ8B 2HFGH 2YBRA 1BBDH 2DAVA 5HHMB 3MRQA 4HWZA 5GRXG 4DGIL 4FNLL 1CFSB 1CFBA 4NRYA 1LO0L 3AREB 3ZHKA 3BP7A 3OKLB 5FGBA 3IDYB 4NO3A 2VQTA 4LPVA 2GY5A 3IU3A 4QWWC 3D0LB 1BM3H 2RB8A 1RHHB 1IGML 3DUSA 1ZLSH 1XF2A 5DUPH 5DVKA 1MCNA 3FB7B 4M48H 4XZUA 2LVEA 3B2UD 4HPOH 3BDYH 4U6VL 3HZMA 4HS3B 1TVBA 1FG2B 4LQFL 1UFUA 4KUZH 4GAJL 4P4KA 2ZCHL 1I9RL 3MLYL 4MWFA 3DBXB 5HVFB 1NJ9B 5DJCA 4HCRA 1B2WH 2VLME 1MCPL 3L3DB 1LO3L 5D7IA 3SGKA 5BMFH 3BT2H 2YD5A 4OT1L 3SDCD 4FFVD 5CZVL 4UV4H 2W0LA 1BVKB 4D9LH 5EC1B 4YHNB 1B88A 1K9TA 4HAGA 2BRQA 3LPGA 3M1BA 3PHQA 3MLTB 3MCKB 5CBAA 2YD9A 4POUB 1RZ8B 3U0PB 3WFBH 5EC2B 4GAGH 1UCTA 2QSCL 3CMOH 5F1IB 4YX2H 2XN9A 3MRIA 4ODSL 1X6LA 5T3XD 5I74B 4F57H 1U92B 1PYWB 3HMXH 4Y5YA 4WRLA 1O0VA 2DB8A 1BD2E 1P9MA 3CLEH 4LOUC 2DQJH 3MRCA 3WKML 4HS6A 2N1KA 2WNGA 1X4XA 3H9SB 4FXKA 4HK0B 2DQUL 4UILL 3T3PF 3SJVD 2UVFA 5ABDE 4Q58C 4XNMB 4LHQB 2X9WA 5LKNA 5DHYA 4OD1H 2DWEA 1BAFL 1JGLL 1H5BC 3OKMA 3HG1A 5DUMH 1ERNA 4U2ZA 3CFEB 4GRWF 4HUNB 2VE6B 3VE0B 1FH5H 2WWMD 3MFFA 5C08D 3VXNB 1FVDA 3O3EA 4D9RD 2JF1A 3U7AA 5JPNB 4O2FB 1QQDA 2ZNXA 3G5ZA 5E94B 3UYRL 1ROWA 3I2CL 4DZBA 1KCRL 4BKLB 1REIA 4J4PA 1HIML 1QG3A 5EWIL 4K7PH 4JFFB 5C0NC 2EIZA 5C1MB 1Q9LA 2VR9A 1ODAA 2DM7A 4KTYA 4N0UA 1RIHH 4G6FD 4MCZA 4W70A 3UPAA 2UZYB 4Q74A 2UY7A 4ZG1A 3PQYB 4MYWB 3VXUE 2DTML 3QUYD 2GITA 4MA7L 5GS1A 1D5MA 5IHZA 2F5BL 5HI3C 4X4XA 5K9OA 1XIWC 3MTRA 1EHAA 4CADA 5F9JB 2VL4A 4OCSH 2YMXH 4OQTA 5MEQA 4G8FA 3BH8A 3G04B 4M93B 2MCPH 3UBXA 3IFOA 1AQDA 4JM2B 1OTTD 2LVCA 3SKNB 1A9EB 1JFQL 5HDOA 5BOPA 5L9DH 3OL2A 3OAUL 4WU5B 1RJYB 1FFRA 2PW2A 1ONQB 2E7CA 5TPWL 2BSSB 1EHLH 4Y19B 5T1KB 2W9DH 2JK5A 1QPXA 4WFGD 5I15H 1BX2A 4MXWH 4LPCA 5DURB 4APQC 1RZKH 2MOVA 5E8OA 2AEQH 3P30L 1H3UA 2OL3A 5EFIB 1WFTA 2ADIB 5SV3A 3FKUS 3IKCA 2AJXH 4HBCL 3L7FA 2X44D 1UKQA 5DJ8A 2FATL 5IOPA 2E7MA 5TGBB 3BQUD 4D9QE 2NY0B 4P2OC 4YHYB 3MLRL 3AXLB 3O3AA 2AQ3A 5E8EB 1WBYB 3AS3A 3IF1B 2RFXB 2GSIA 4PJGF 1ZWIB 1YN7A 1F5WA 4TUKL 3NIDE 1L9NA 1VFAA 1E4XL 4R4FL 4KROB 3TA3C 5I17B 1QLEL 1B6DA 1JGUH 1OAZH 1BZ7A 4V1DA 3MLWH 5E5UB 4X5XB 4XTRD 2PYEA 3UYOD 3LQZB 3MNWB 5D7IE 5CJBA 5I6XC 1CICC 3FO9A 1ZVYA 2Z35B 3EYOA 4MAUL 2DBLL 2YK1L 4BK5A 1DE4A 2VKXA 4UT9L 4ZXBC 1MCJA 4X6DB 2YD3A 4N0RA 4Y4KB 4AK1A 4MVBD 5IFAH 5T3ZD 1JYXA 2MTPA 4ZQKB 3HB3C 1SYSB 4FQJH 4JM4H 4RMQA 5IHLB 1DLFL 4ZPTA 1T20A 5C86A 1KCVL 2NR6C 3BP6A 4RNRB 1IGIH 4EDWH 1E27B 2VR4A 5A3IC 2L7JA 3QDGA 1HCVA 1YEGH 2IPKB 1H3GA 3D48R 1FORH 3C5SB 3RKDD 1MFBL 3NZHH 3V4UL 2FZ3A 2C3WA 4L4TA 3KG5A 1M7IA 3C5ZB 4FQXB 1PZ5B 5HYFA 2CUHA 2IADA 1N2RB 2H8PB 4GUPA 2EH7H 1MFAH 2YD2A 2YR3A 4LLQB 1R3KB 4LHUG 2X41A 3HG1E 4GLRI 1G7IB 4U0QB 1EJ6A 5IMMB 5E1HB 3TCLA 5D7LA 4RMTA 4NQEB 4URTB 5IVXF 3UTSB 4NRZA 4DK6A 5CIPA 1UENA 3MXWL 4L29B 4Q6YA 4KGJA 3EFFA 3LRGA 3X14A 4GKNB 3GJFB 1RJZA 2HKHH 4JY6B 4LPTA 4M61B 4JZNA 4MXVE 2P24A 3QFDB 2VABB 3QP3A 4HKBB 3CX5K 1S9YA 4KH2A 2JCCB 4U4BA 2WBJD 4NC2B 4XH2B 5MEPB 4N0UE 4RBPH 3B83A 3F6IA 5JHDA 1JJUA 1HZHH 4R8WL 2H9GA 3CX2A 1QBLL 3QFJD 4K94H 4G8GA 1S5HA 1U8LB 4AQ1B 3MBEB 2XY2A 3TNMA 1VGEH 3H42L 1MCKA 1OTUD 3V6BR 1C08A 3MRLB 1WBXB 4U33A 1XGYH 3NAAL 4GRWH 4KQ3L 3I84A 1OCWL 2K7QA 2J5LC 4OM0H 3QDJD 4NQDE 5GGUB 2YA1A 4Z7WA 1URLA 4JFZH 2P49B 2UYLA 1RPQA 1A3RL 4RIRA 2ATKB 3UC0H 5GS2D 5CWSA 2HVJA 2NXYB 4X6CE 4LVHB 4M5YH 2F19H 1JN6A 5E9DA 5CP7B 4PJIB 2AKRB 4JKPH 4CNIB 3S5LG 1OSPH 2X4SA 1DDHB 3VXRD 3P11L 3WUWG 2VC2H 3BWUC 2ZUQC 2CRZA 2EH8H 3HE7B 2FX7L 4NOFA 1BFSA 2IJ0C 1F6AB 5MP6L 3BX7C 2WAHA 4D3CH 5ALCL 1N64L 2EZ0D 3QIUC 5C0CB 5TF1L 1TNNA 3Q5YA 3FONB 3MV11 3ZYIA 1QSFB 5EOCL 2WQ8A 4IHOA 4OJFH 4LLYA 1FC1A 1JWMA 2QLVB 4QRQA 1U95A 3OSKA 3OKYA 3SKUD 5I1HH 1NC4D 5FUOL 1I85C 4UT6L 3VWJA 5K33A 4FQLL 2Y06L 5FB8B 15C8H 2V7NB 5IJVB 1QFOA 1BGXL 2PYEE 4X5LA 1EO8L 4NO2B 2BY1A 6FABH 3LHPL 4J3OC 1YUHA 3WNOA 5C09D 4ZUSB 1G7JA 3MROA 2IAMB 3RTQB 4DW2L 2BNQD 3BKMH 1A4JA 4HG4J 5ADOH 1OGAD 5HPOA 1NAMB 4NWUL 2YUZA 5T1MA 1NQBA 4Z9KB 4KDTA 4N8VA 3E8UH 3SGEI 3P73A 3N85H 5I1KL 5HXMA 1NCTA 4JKMA 2XV6B 4QHNB 3BYYA 1TJGH 4P5KB 4R7NA 1IT9H 3QDGE 4OLWL 1X5JA 4G5ZL 1SHMA 4HQQL 4I5BB 4C57C 5DEZA 5D8JH 3N06B 1M71A 3P77A 3FJTA 4L4TE 1RZGB 3M8OH 3O3BA 3VXOA 1LP9F 1RK1A 2EE2A 1A0QH 1LO4H 4DGYH 3MRNA 1MCFA 3T09A 3TLRA 1V3JA 4KPHL 5D7LE 3I75B 2ZUTA 4JE4B 3T3ME 5DYOA 2C1OB 3ES6A 4MNGA 4ODVH 2FHBA 2VMFA 3NIGF 3SDXB 1IBGH 3FQXA 3WSQH 1A22B 2AABL 3TZVD 3O9WB 3SDAD 1K4CA 4JLRA 4E41A 1MFCH 1NAML 3DYMA 3U48A 3PWLB 2WLYA 1KULA 1IKFH 2VZ1A 4UOW0 1C1EL 2C5DC 1A7PH 4S2SA 5CJ5A 5J12B 4HWBL 2R4SL 4F7MA 2EDNA 2E9JA 4HSQA 1SVCP 1MRDL 4OFYD 3RL2B 1IGFL 2JJWA 2K3TA 1L7IH 3W0WA 1D5ZA 2X6MA 3CFJA 4K94C 3SBWC 5FDYA 3HTLX 1CXHA 5DO2C 1F4YL 1LNUA 4YNYB 4C83A 4J3UA 4PLJC 1R24A 3BKCL 2DM3A 5GJSH 4Z7WE 3KPOB 1FZMB 2F53D 3I6LE 3LS4H 1BFOA 4LCWD 2EYRA 4XHJC 3GSQB 3FQWB 5C0BB 1HNFA 1P2CB 3QB7C 1BJMA 2R56H 3QRGL 1JYVA 2Z92B 5ISZD 1ZVHA 3RVWC 2GIYA 2AJSH 3K81A 1D9KD 2FNBA 4YE4H 5E9DE 3QEUB 1DUYB 1MCOL 5DI8A 1WWAX 4NQXB 4P2RA 4W4NA 1DBBH 1QVOB 1AIFA 4NO0D 5HYIA 5GGTA 2CDFA 3TT3L 4IEFB 3MRBA 4DAGL 4K23H 2Y36L 3ET9F 2FGWL 1LQSR 3RUGB 2ITDB 4PJ7B 2QR0B 3O2WL 5I75B 4OBRA 1NCWL 4EBQL 4HF5H 2RHEA 3Q48A 4R4BA 4IRJA 4TNWF 1CR9L 5FF6B 5KVFL 3Q6GH 4AJ0A 5IF0A 5IM7A 3BGAA 4P23C 2OK0L 5F3HA 1U93A 2XZCL 4JB9H 2IWGA 2PUQT 4LSUH 4AEEA 1FPTL 3OKKA 5DHVA 4XMKH 2XYCA 4PGCA 3WIHH 3BMVA 3EOTL 4QLRA 4XCNA 1NL0L 2CIIB 3F7VA 2JIXD 2MKLC 3MLVL 5HSFA 2A6KA 2J88L 1IKNC 2EO9A 1KPRB 4QXTB 2I9TA 1A1MA 1AKJA 3DHJA 1IGJB 5GRVL 1NC2B 4PJ9B 2VDNH 1HHIB 1TPXB 5CEYB 4R2GC 4K71C 5IW3A 1XGRB 3QXDB 4X5WA 3MRPB 3CVHB 1SM3L 3PWVA 4RFEA 5FYKH 3EYUH 4NT6B 3BPOB 3EDFA 3G6DH 3RZCA 1CL7I 1ZHNB 3TN0B 2F5AH 3ZT6A 5ENWB 2FX9L 4L9LC 1NLDH 1G9ML 3OKDA 3REVB 4NKQB 2ZUWA 3GM0A 5HHXL 4IS6B 5E4EC 4JFPA 5EIIB 1A6UL 2HFEB 2YRZA 3PHOB 4KXZH 3DRQB 5CEXB 4C59B 3KPSB 2VQ1A 1I8KA 3GMLB 4WU7B 5HHOD 3H8NA 3ZE1F 1V05A 4Y2DB 1Y6NR 3HR5A 3FHQA 3GMQA 3EOBA 5EU3B 1F90L 1W0YT 1OAKH 3PL6C 3MLXH 2W07A 4TTGA 2XZAH 1OTSC 1CDHA 1EJOH 1II4E 3QUMB 3T8XA 4O9HH 4CVXA 1UEMA 3CVHL 1I1AC 1L0QA 1UJ3A 1JIBA 3LKQB 4KRMB 5B39B 5BQ7A 3W0WE 1WIOA 3MA7B 1UZ8B 2VXSL 3WJLC 1Z5LB 3CJJA 2GAZB 5FO9B 1OD7A 2LTQC 3PJSB 3X12B 1RVFL 2AJZA 4GBXD 1MFNA 5EULV 5FV1L 4G3YL 1T1ZB 3HZKB 3HI1A 3SY0B 3A6BH 2AGJH 5GHWL 2EDFA 3TEUA 1AI1L 3OKEA 3SBWA 2AXFA 4LFHD 3T0BA 4HJ0D 3E6FB 2ICWB 5MENA 1OAQL 5CUSL 5EZIH 4YLQT 2X2YA 4XP5L 2G5BA 3U9PH 1J0JA 3RAJH 1IGCL 5KSAD 4HEPG 3IDIB 4X9FA 4E5XB 1RD6A 4XBEL 3THML 3K80A 3RWFB 2V2XB 1QFWL 3WLBB 1ZLVK 4JY5L 4R26H 2WINA 3GM8A 4P2RE 3CCHB 3KPRD 1P7QD 4UB0L 4HX1B 5EA0L 2K9UA 5HGDB 1PG7X 1RUQL 3C60D 5DC9B 4PRPB 1CVRA 4JZOA 2EIDA 3PDDA 3O6MH 3S37X 1FNHA 4LF3A 1OLLA 4Y4HC 1FFNA 1SEQL 4UOW1 1A6AA 4K55A 5EOCJ 1JPST 3GSXA 4FNLH 1LO0H 4Z78A 1N6UA 5KVEH 5CCKL 1JPGA 3WN5C 3LKNA 5C0EB 3UJTH 4P23A 5CHNB 3CXDL 5EBLB 3D5OF 3TO4C 4KQ4H 4OGAC 4XC1H 1F42A 1HKLL 3D39B 3RA7H 2YN3A 1JWUA 1VEMA 1AHWB 5I19L 4O5LH 4U6VH 1XMWA 4HIIA 4F58L 4LQFH 3G5VA 4JHWL 4KI5E 2ZCHH 4CMMB 4YXLL 1DN2A 4AH2A 2YPLD 3HNSH 3BP4A 3CDGA 3MREB 4EI5D 1I7ZB 4RGOH 2MMXA 1UYWL 4IJ3B 4M7KL 2A2QT 4OT1H 2WIIB 2UWEF 1R5WA 2YWZA 5CZVH 3F58L 3KDMB 1U6AL 4LCCB 3QO1A 4LRNH 2C3HA 4JVPA 3PWPD 1MRFL 1J1PH 2OR8A 3MJGX 5FA3B 3KNBA 2HRPH 3MACH 4X6DF 3R0NA 1E4WL 3LIZL 3V4VH 2R2BB 1OT1A 3W9DB 4K07A 4PV8B 2ZPKH 1OM3L 3SN6N 3B8YA 1JTPA 4PJGA 1GVIA 2P44B 5FDWB 2DQUH 4X4ZA 1JVKA 1INQB 2A0LD 1NFIA 1GL4B 3U0TB 4P9HL 2DYPA 3CU1A 3LVEA 1JGLH 1FZJB 5C92A 4EDXB 5HYSA 5IGXH 4Y5XC 3JWDC 5EO1A 1U36A 1EUUA 1P1ZB 2VH5H 2X89A 1U8IB 1T4KA 1FYTA 3UYRH 3PL6A 1N8ZB 1BJ8A 2AV1A 4BSVA 3MJ6A 1SYVA 5ILTL 4KK5D 5T5FH 3V79C 1QFPA 3IFPB 3WFDH 4MDIA 4L3EA 3OJVC 3SO5A 3D18B 3MXVH 3WCYA 3PHSA 3EW3B 4R4NC 3OX8A 5FO7A 3TBWA 1MUJB 3KYOA 3W9EA 2X40A 3T0VA 2UY6A 3WJLA 3INUL 2JCCF 3KXFA 5I1IL 1W72A 3O4LA 4QYOB 2DJ4A 5DRWB 5DUBA 5BJTA 4O00A 2R29L 1YMMB 5MENE 4MA7H 3T3PE 1NDGA 1MEXH 3CNKA 3O3DA 2F5BH 4M7LL 3V2AR 5IFHH 4I0PD 4YJZL 1FIEA 5GS0D 4FQHB 3MLSL 1KFAH 2D9CA 2EXWD 2VLMD 4HDIA 3KWWB 2P5WB 2I07A 4GRWE 1EK3A 4K9EL 2AXHA 1CTNA 4JCMA 3KPMB 5IVXA 4LASL 4L4VA 2NY6B 5DGRA 2VTFA 3C08H 3SQOL 5JIHA 5FYKD 3IFNH 1T6WA 2Q6WA 5TPWH 5CEZL 3DVGA 3V5KB 2G2RA 2C4FU 5KOVC 3D25A 3L3GB 1WSST 1YMHB 1MJUH 3P30H 2HTLD 3BYTA 4W68A 1CDUA 4JFXA 2A9NH 3G08B 4FQCL 4KV5F 4LQ1A 4QF1A 1FL3B 4NPYB 3GO1L 4AG4H 4HBCH 4Y4HA 3UMTA 1ORSB 1IAKA 4UQ3B 5BVPH 5KSBA 3FO0L 2W0KA 5JOPE 5HHVL 1RZ7L 1U3HB 5HTSA 3WN5A 3VCLB 1UM5H 5ESAB 3BIKB 3M45A 4Y16B 1OVZA 4RISH 4LDOB 2YSSA 4KMTH 5C3LD 5IG7A 1TZGH 1E4XH 4LEOB 2EDRA 1T1YB 4XPFL 4G43A 1EHNA 4OLXH 1GGIL 4HIEA 3WIHA 4F2MA 4MNHA 4OCRL 3VRIB 3I02B 4MGXA 3U1SL 5HPMA 2EXYC 4PJEB 1DVFD 2AXGB 1MJ7L 2NY5H 4XAWL 3WIFB 4PGDB 4X7FC 3CGTA 4S11A 2F9BT 3O2VH 4LLDB 5HY9A 2PO6C 3S88L 5F1NB 1CDIA 1QBMH 2YPVL 4YPGB 1YEEL 3MUGB 2GJZB 1X5GA 5DJYB 1JYWA 4HUXB 5FK9A 2ENYA 3HE6D 3EYVB 2A6JA 3DUHA 1VADA 1Q9KB 1HSAA 4WWKA 2V6HA 1J8HB 1HWGB 4PJGE 4PJ8C 1DQJB 1LEGB 4YHKH 1G7MA 5TDPA 1T2JA 2AJUL 2FBJH 3IXAA 1SJHA 4XPTL 3VXMA 4NQCB 3WFEL 1H3PL 4TQEH 3PUCA 2IANE 1KTKE 1A6VH 3AREC 3IYLW 4ONFH 3EJZD 1MLCA 4ZFGL 5ICXB 3QEQA 3QUKB 4H8WL 3MOAH 4IRSC 4GKSA 3OHXA 1HI6B 1CT8B 2R0LH 1HHJB 3QPXH 1FYTE 3ARBB 4DWHA 4Y1AA 3ZYOA 1KYOJ 4YDVB 4ZTOL 5JR1L 1S7TB 4WENB 4WUUB 4L3EE 3GSVA 5IMKB 3UTQB 4G6ML 4P46D 3O6FC 4F7TB 3SDXF 1WIUA 3ARDB 1OSZA 3QXVA 4OCNC 5SWZA 3B9DA 3KXFE 1AGBB 2NY2B 3O4LE 1PDKA 3VWKD 4O2EA 3CC5A 4X7SH 3VFGH 4PRDB 1ES0B 2PKDA 4HGWB 3S37L 4F33A 3C9NA 1T66C 4KKAD 5AWNL 3VXQB 1QRNA 2FWOA 2HFTA 3F6LA 4YO0A 2VITA 1PQZA 4MMZC 3DLQR 4QRPB 5I74C 1RIUL 1J12A 2X10A 4ORGA 5IVXE 4L4VE 4AIZB 1KLGA 4PTTA 3DO7A 2PETA 4IDJH 3BXNA 3DV4A 3BPLC 3S8WA 4J6RL 1FGVL 1IC7L 1JNLL 1VENA 5GZOD 5ANME 2AJVH 4YGAB 3SKOA 1NGQL 2NCMA 5IVNA 5DLML 5JXAL 4EZMA 1T7ZA 2VLKA 3L1OL 2NYYC 1I7UB 5AYUL 3KR3L 4PRNA 3EO9H 3OG4B 3HAEB 4OLUL 3P11H 4NJAL 2OJZL 5F88A 2FX7H 2EKSA 1JPTL 5E00B 5ALCH 3BRDA 4FZEL 3WFHA 1JPFA 5I1GL 5KJRH 3AMKA 2BDNH 4JO1H 1FO0B 1RU9H 4DEPB 3DVNA 3LAFA 1KELH 2H26A 4PS4H 2P8MB 2NY4B 3F5WB 4JRXA 3RWIB 3RUGF 1MHCA 4PJ7F 3A67L 5JW5A 1B0GA 3PGCA 4Z7NF 1VFUA 2ZUUA 4X9BA 4FQLH 1A7OL 2ICWJ 3L3OB 3S98A 5F97E 1YEJL 3ARFB 1J0YA 3NGBB 4Z7VB 4E42A 5DZOA 3LHPH 3DETC 4K3EL 1IM9B 5DQ9A 2HT3C 2Y07H 3MLPA 2V5SA 2SEBB 4UDTA 3VI4F 4FQPA 4OD2A 2WQRA 3S97C 2EC8A 3AY4A 3L5WA 4DW2H 3KJ6L 3RDTB 1S9KC 4LKCA 1F58H 1K8DA 2F74A 4JDVB 4NWUH 3S5LA 1TIUA 4JFQA 3WXVL 2PO6A 5I1KH 3QDMA 1G7QB 3FT4A 3BPCB 5EUKA 3HLAA 3PIQA 4JRYA 1F45A 2HVKB 3RL1B 4F37K 3EO0A 2IMNA 2P4AB 2NXZD 5C71A 3N9GL 3RVTC 3ZKNC 3RX8A 4U7SA 5FYJE 2FHFA 3VXME 1K6QL 4GG8A 1RY7B 3L5XL 4QO1A 4NQDD 1FO0L 3F7PC 4Y4FD 4HZLB 3MJ8A 4A2MA 4HJGB 4BZ1L 1A6TB 1MAML 4OZIF 1MVFA 1KT2B 4C55A 3QEQE 1CFSA 2I9LB 2OP4H 2DLIA 1YY8B 3AREA 1CQKA 4YHYC 2NPLX 2KBGA 3OJ2C 5CILH 4Y1AE 3STBA 3D0LA 4U1NB 1UH3A 1RHHA 3WDHA 1MCWM 1ZHBB 3U4EB 1A47A 3WS6C 2AABH 3FB7A 5FGRA 2R4RH 2CLRB 1T89A 2IH3B 4C54A 4L4JA 1QBAA 5DEGB 4HS3A 2BVOB 1FG2A 3HC3H 5SWZE 1G1YA 1ACYH 4QWWD 4OCYL 2VDPH 1N5YL 1O7SA 3DBXA 3VXSD 3QI9C 4F8TA 1FBIH 2R4SH 5FUCE 1NJ9A 3LY6A 2FO4A 4U6XB 5A2LH 1JZ8A 1AJ7L 3BIBX 3L3DA 4GRLB 5D72L 3RI5F 2A83B 4Y4KC 1IMHC 1QRNE 4G8IB 5EORL 4P4RB 1JHLL 4M8QB 1ACZA 3SGDH 4U49A 3KLHC 1RUPL 4RGNC 4YHNA 5EC1A 1YEIL 5IB2B 4OZFB 1YN6B 4QKXB 3MLTA 3MCKA 5CP3H 1RZ8A 2BVTA 4Y2OA 1B90A 5EC2A 1ETZB 4Q9QL 1KJMA 5F1IA 5AZ2L 3ZKXB 3RIFF 1CXFA 3NIGE 1FG9C 1U92A 2D2OA 1PYWA 3MNZA 4PG2A 4TUOB 4LIQH 3EYSH 2ZNWA 3C8KA 32C2B 3C5ZC 3QHFH 3I6KB 3U46B 3RGVB 3H9SA 4HK0A 1QZ1A 2X7LB 1X44A 3G5XB 3H3KA 4ODHL 3ROOB 5L7XL 1FLRL 1YQVL 4X4MA 2H45A 3T0DA 3NN8B 4XT1C 3REWB 4LOUD 5HYQB 3LCYA 3ELAT 3CFEA 4WHYG 2FHCA 3LQAL 5IP4A 1MWAH 3O81A 1NGZB 3QG7H 4M1GL 4XCCH 5JPNA 1I9JH 5E94A 4H26B 1GAFL 4JRXE 4PFEA 4H20H 1G6RB 2BSTB 3ZHLA 2X4UB 4Y8AA 4DZ8B 2GW5A 2E7LA 5TJWK 2YEZB 3HPJA 3Q3GB 3C6SA 4RGMC 2VDKH 1PKOA 4U7KA 5T5NG 2YKLL 3UTOA 4HWNA 3BOVA 1I7TB 2QJDA 4F9PC 3MBEC 4PB0L 5E2TH 2W60B 2VUYA 2XICA 4RWYL 5C0ND 3D6GA 3IDXH 3OR6B 4HUWB 4LLMB 1KJ3L 3MLVH 4OLZH 2EDYA 4Y88A 4IIQB 4QRTB 2NY1D 2ADFL 4NWTL 4L9DA 5F9JA 5FYJU 3MGAA 3QZWA 3B4NA 4X98B 2WZPD 4TRPL 3FQUA 4JRYE 4XNZC 4JM2A 3SKNA 3LEYL 4WU5A 1RJYA 1RIVH 1ONQA 4OGZA 5HI3D 1XIWD 4EEEA 3GRWL 2BSSA 2R0ZL 4NFBA 4PRHB 4Y19A 5T1KA 4JPKL 4HZAA 1Y6MR 3PWNB 4LVHC 5DRNA 5JIPA 3F62A 2DQTL 1G9MH 3LKSA 1C5DB 2DLFL 5I71B 4OSUH 5HHXH 5J1TC 5HHME 1N0LA 2R2CA 3GI8H 2LQRA 1G6RL 4NQTA 3K4ZA 3IT8D 5KTEH 2E9IA 3FT3A 2DD8L 1LDPH 5IMLA 3IS1X 4JFDD 2Q8BH 4NM4L 4OFKA 5TGBA 4FS0A 4EXKA 4APQD 25C8H 1L9MA 1FVEB 2ZCLL 1D5XB 2BNRB 4JFED 3AXLA 1UWGL 5E8EA 1WBYA 3A6CL 3GSUB 4I3RL 3G6AA 1GGCL 3IF1A 4JQVC 3L3JB 1IC5L 5LGHH 1XF5B 1ZWIA 3FTGB 3WS6A 1F02I 5KOMC 5I17A 3TYGL 2O61A 1XGPA 1OF2B 4IRZH 4P2OD 1INEL 4XCEB 1M05B 1EFXB 4X5XA 2BX5A 3LQZA 3MNWA 1EMTH 1NCBL 1E4KC 3CVHH 2IAMC 3ESUF 4NNPL 3RTQC 3UAJC 2Z35A 5D93B 4AL8L 1NUNB 3TA3D 5B21A 1A8JH 5GQBA 4GLRH 2OZ4H 5D5MB 4Z8FH 3RVUC 1BMGA 4UTBL 2Q87A 5JOEA 3NBNA 5FKPB 1RVFH 5E6IB 1QEWB 1CICD 4ZQKA 5B4MC 1SYSA 1YPZF 3L3HB 5JOFB 3DUUA 4YHIB 5JIKA 3ULVL 3VDCA 3UEZA 4RNRA 4ZXBD 5CUSH 1E27A 1CYGA 2VLJB 4BA8A 3WFCH 2PYFB 2IPKA 3AROA 3C5SA 3MOBL 2DM2A 4RAVA 2ICES 1P84J 3UZVB 1IL1B 3ZE1E 1T3FB 1IGCH 3H9SE 2IGFH 4PJHB 3ZE0F 3C5ZA 4FQXA 4XVTL 1PZ5A 3THMH 5DJ0B 1N2RA 2H8PA 1B6UA 2NR6D 2XQYK 1NCDL 4YHML 4X4ME 4RCAA 4WO4C 3DMMB 4LLQA 1AD9B 1R3KA 8CGTA 1GZPB 5A3ID 5GRUH 1N5AB 4XPGL 4B7IA 4UB0H 5IMMA 2O5ZL 5IESL 4FQ2L 4WEBL 4UQ2A 3UTSA 1PY4A 1TJHH 2XXMB 4L29A 3QUMH 5FIEA 5F1OB 1EUTA 3O9WC 3KS0J 1DLHB 4GKNA 3GJFA 4JFFE 4JY6A 4M61A 1YQ2A 3IETB 1T7VA 1LGVA 1LVEA 3QFDA 1IAOB 2VABA 4HKBA 2OR7A 1M4KA 2JCCA 2HKFL 5T5NF 4BELD 1R3HB 5HI5C 4XH2A 5MEPA 5J12C 5EU6B 4QCIA 4XCFL 3VFOB 4E9LA 4U7MA 1HEZB 5D71H 3PQYE 2P45B 1HKLH 3HAEG 5EN2B 1U8LA 4NGHL 5C0FB 2Q8AL 1KEML 3NCYP 3NCYS 4OIIL 2DIAA 4ESKA 2H41A 3ZDZF 3JSSA 1WCBB 3RBGA 4KHTH 1LHZA 2V2WB 1JGEB 1WITA 2K7PA 1NFDB 2XPGB 4YDJB 1BWMA 2KZ1B 2DLTA 3GI9H 5GGUA 1NUGA 3SEPA 4JANB 1A3LL 5HGGS 1DSFL 3OJMB 1U2CA 4Y19E 1BIHA 1KLUB 4PJEF 2IH1B 2UZXB 2ATKA 1EAPB 4NNYB 2AEPH 3IFLH 4GRMA 2A6IA 4CMHB 4KTEH 3WO3B 2CGRL 4PJIA 3LIZH 4M7ZB 1BFTA 4GKZB 2FGZA 3PDOB 2AKRA 3WEXB 1A5FL 4TOYL 4PRIB 1DDHA 2WV3A 1OWWA 4I18A 1NEZB 4XPHH 4KKLC 2BXZA 3HE7A 5I75C 2P5ED 1F6AA 5LJYH 3BZDA 5C0CA 2YD6A 4U6TA 3QUZB 5H2BB 3FONA 4P2RD 2X9YA 1I3GL 1QSFA 1UKSA 5JQ6H 3SGEH 2ZSWA 3QWRD 4ALAL 4OCWL 4JQVA 3ZL4H 4P2QA 2B0SL 4N5UA 1A02N 3GHEH 3QIUD 5FB8A 2V7NA 3LB6D 2BSRB 1YNLL 1AY1H 2BK8A 4NO2A 1M7DB 1IQDB 2DQGL 4HC1L 2AV7A 4WUKH 1P4IL 3GMOB 1XR8B 1Y18B 1ITBB 4H1LG 4ZUSA 1DQMH 4XNYL 4OZ4B 1EGJH 1G0YR 5EO9B 2IAMA 1H3WM 4QRUA 1MFDL 4X6DE 2IC2A 3RTQA 4XNUH 1QSED 4PJ9C 5DEFB 1TCRB 4HUKB 4QY8B 2O26U 1CK0L 3GIZL 1FAIH 1QP1A 5KAQG 4HWBA 5C07B 5IROA 3RPIB 4LLUB 4QHNA 4Q9RH 1QO3B 2P46B 3BPOC 1A6PA 1DR9A 5FM4A 5AZEL 3VW3L 3VD3A 4HULB 1PJ9A 3HCVB 4I5BA 4PJ5B 5ACZB 1CGTA 2VLRB 5E2VL 4L5FH 3HR6A 3JVGA 4GAYB 3VGEA 1KGCE 5CP3A 3D2UB 1BOGA 4U1HB 1Z9OA 5L8KB 1CFNB 3TH2T 5H37G 4KVNH 3O0RH 4MNQD 1OAUL 4FZ8H 3I75A 3MRQB 4NQEE 4OZFG 3BUYB 4WNQB 3QIBC 4M43L 5GPRA 3UTSE 2C1OA 4LMQE 1I1YB 1T2XA 4NRYB 3ALWA 4QNPF 3MV9B 2B2XL 1MELA 3DX6B 3SDXA 3IU3B 2N4IA 1MAKA 5C6TH 1XCTB 4Y2DC 2KKQA 5HDLA 3DUSB 5H94B 1XF2B 3GO1H 3O9WA 2JCCE 4FQQA 2FX8H 2DTSA 1PD6A 3H9HB 3PE9A 3FO0H 4P3WA 3VGAC 4XBGB 1TVBB 5E2UL 4OI8A 2QKIB 5HHVH 3ARGB 1MWAA 2PCPB 3MMEB 3KLDA 4MWFB 1U91A 4N5ED 1YDPB 5T1LB 3RL2A 1CF8H 4I77H 1I3RB 4YZFF 1RUML 4O2CB 5KANG 5E03A 3BRFA 1GGIH 3MBXL 3JWNC 5DMIH 3ZKQD 1MQKH 3LKRA 2VIRB 5CBAB 4DQOH 2VXUL 2ZJSL 5I66B 4PJFA 1MJ7H 1NUFA 4LSTH 3KPOA 2XN9B 1FZMA 4XAWH 2JJSC 1ZEAL 3GSQA 4KV5E 3FQWA 3DJ9A 3QH3B 3C8HA 5C0BA 1P2CA 4Y5YB 1J05B 2Z92A 3OXSB 3IDMB 2B5IB 4LNRB 5DO2D 1CVSC 3S34H 1FGNH 3TVMC 4PLJD 1NCCL 1I1FB 4PJIE 4GMTL 3B2VL 3QEUA 4LDEB 3U0WL 1DUYA 4OF7A 2XTLA 2XTJD 4XHJD 4NQXA 1HCFX 2A38A 1QVOA 4P5TC 2DWEB 4OF6A 3QHZL 3RVWD 5C0CE 3ULUD 2ITDA 4PJ7A 2QR0A 3T04D 4P9MH 2BC4A 2D4FA 5BS0D 2H1PL 1LO5B 3D9AH 4OF3A 1X6NA 1BF2A 2DQCH 2X1WL 1BQHB 5EOTB 4ZFGH 5IB4B 2CMRH 3RQ3A 3V8OA 1FL5B 4RAUB 1NBYA 2EIZB 1UWEL 3LV3B 1GSMA 3AUVA 3UO1H 3SDDD 4LRIA 4FG6D 1CL7H 4BFIB 4P9HC 4YWGL 3SCMA 5DD0H 5F21B 3N50A 2FB4L 1QFHA 4ZTOH 3TYFB 5JR1H 3C2SA 4JY4A 3S36H 4KZEH 2NY7H 1FE8H 3LDBC 3PABB 5LGJB 2Z8VC 3RVXC 1BLNB 1V7NH 2PR4L 1D5MB 3SDCB 1UA6L 2XKSA 4QXTA 4XAKD 4IJ3C 4MAYD 4UINH 3IDJB 1IGJA 1NMCC 1NC2A 4PJ9A 1F3DH 1HHIA 5CEYA 2EKJA 3HNVH 1XGRA 3QXDA 4G8FB 1H8OA 4QXGL 3FO1A 1WZ1L 4ZS7H 3MRPA 4PJAB 4LCCC 3CVHA 1XFPA 5D96C 5I0DA 5D1QC 2FECL 3QQ4A 3K46A 4NT6A 1FRGL 4NZTL 3TJEL 4ENED 4KJQC 2OZ4A 2I60L 3OKOA 1ZHNA 3P4NB 2FJGB 2DQDL 3TN0A 1BP3B 3V52L 5L2JB 5ENWA 2GCYB 5CKAA 3JUZA 1BX2B 1RIUH 2GEEA 5F3BB 3REVA 1CG9B 4IS6A 5DMGC 1A7NL 4QTIH 1I8LC 5CSBA 2ESVD 2FRGP 1OPGH 5EIIA 3GNMH 3WYRA 4J6RH 4XVUD 2AK1H 3IKCB 4NO5B 5DK3A 2NY3B 1NGQH 4K9EC 3PHOA 3DRQA 1FDLL 3SDXE 2P43B 1EIBA 4RRPG 4JQIL 3L1OH 5C08B 3KPSA 4ZFFB 1CDGA 4Z7UA 5BV7H 4NP4H 4LARL 3GMLA 2GSIB 2VSDA 1YN7B 5C0GB 4LPWA 1AGCB 2UV3A 4OUOA 5EU3A 4YHPB 3J8F7 3KS0H 3VGGA 3GSNB 5I1GH 1JTTA 3OB0K 2IAND 3QUMA 4G6FB 4N1EA 5TDOA 4G7YL 4Z95H 5LAXB 3LKQA 5B39A 2IFGA 3EYOB 4G8EB 5J6GA 3O8XB 2QQNH 2GAZA 5FO9A 5L88L 5JLZB 1OTSD 3PJSA 2J2ZA 3X12A 5KN5B 2EYTB 1T1ZA 1T1WB 3HZKA 3QULB 1VPOH 3NPSB 4U1IB 4K7PX 1A14L 1I1AD 2ADGB 2OL3L 3QRFM 3E6FA 5FHBL 4ZPTB 1T20B 2ICWA 5C0BE 3L95B 3ARQA 2FLRT 3BZ4B 4OCXH 1P69B 4XP9L 2JJSA 3BSZL 4QHMB 1WISA 4HW6A 5E5MB 4H88H 5DXWA 4E5XA 1TETL 4PYGA 3S9DB 1FFOA 3RWFA 1Y6KR 3WLBA 4Q6IB 3LEXB 4UOJA 4I1NB 5J6HB 4KKNA 4G9FB 3VXTA 3CCHA 1IM3B 4RX4D 4UZGA 4HX1A 2VXTL 5HGDA 3R1GL 1X5XA 4L8SA 3RUGE 4PJ7E 3GSNL 5DJZB 4Z7NE 1U8MB 2YXMA 3EJYC 4NRZB 2R0WL 3EFFB 3AS2A 3MODH 1ZK9A 4X9GA 4AMKH 4TTDC 4JZNB 2P24B 1FZOB 4HIHB 4TUJB 3VI4E 1U3HC 3TIEB 5C0EA 4FMFA 3ULVF 1F4WH 5CHNA 1NGPH 4Y16C 5JHDB 4S1SH 3F7YB 3T1FB 2F58H 2H9GB 5LG1A 4WHTB 2A6DB 1C5BL 5J7CC 3ZT5A 4KTDL 4G8GB 2V17H 1AHWA 3BESR 4H8WC 1MHPH 1B0WA 3C09B 1DBKL 2Z8RA 2CDGB 3RPKA 3EHBC 3X3FH 3TO4D 4R0LA 3QNYB 3MREA 1JZ7A 4POYA 4MQXC 5T1DL 1I7ZA 2D03L 5HYJD 4EN3D 4CW1B 1JI2A 1AJ7H 2AS5M 1MHHB 5F9DC 5CD5D 5E8DH 3P2TA 1OGTB 2WIIA 1NEUA 4YPJA 4R9HA 3KDMA 3TIDB 1EGJA 2E7BA 3WKNA 4LCCA 4XMPL 3KPTA 1KACB 3GBNH 5ESQB 4HAFA 3T4YB 4RIRB 1NCUA 3S6CA 1IZKA 5F7EL 1G9NL 4PJXA 5D5MF 4CJ0A 5FA3A 2F15A 3NA9H 2R2BA 1HKFA 1JMZA 1I8LA 3W9DA 5MHSD 3UXFA 2XRAH 4LKXB 3AMLA 5D7JC 5LQBL 4XVJL 4ACPA 1PW3A 4M03A 5F89B 5M94B 2NTSP 2EDQA 3KPSE 4IMLB 5C8JB 4YXHL 1KTDA 3U0TA 4ODHH 4M5ZH 1FLRH 4KDVA 1ZLWK 3B5GA 1YQVH 2HTKC 5B38B 1KXVC 1J5OL 4LLYB 2DDQH 1JWMB 5TFSL 1F4XL 1K2DB 5FYJD 4PJHF 3GKWL 4EDXA 1U95B 1S7SB 4KK8D 3RIAK 3S35L 3X3GH 3P0YL 2WBJB 1P1ZA 4KY1H 3D3VD 2KPNA 3QQ3B 1U8IA 1DQQB 3K8MA 1N8ZA 1J0HA 5D70H 5T3ZL 3QFJB 2QQQA 3IFPA 1N59B 4X6BA 1H3TA 4OTXL 5GJTL 3ARDC 1G7JB 3MROB 5IBUB 3D18A 5IBTL 1N26A 2EDTA 2HYMA 2NY2C 4OZFH 4ZUTA 4BUHA 5FHAH 1NCAH 2DI8A 5D2NB 5DMYA 2AQ1A 4KVCL 4QYOA 2XWJB 5DRWA 3VD5A 1YMMA 1JRHI 5C9JB 1WT5A 2D0HA 2IBGA 4GOSA 1YEKH 5J3HC 4EVNA 4PLNC 4LVEA 3QDJB 4R4ND 4R7NB 2ADFH 2WP3T 3HC0B 5C2BH 1A7QH 3FQRA 1SY6L 3KWWA 1TITA 2P5WA 4U1LB 3RU8H 1DANU 4OD3L 1HINL 4PJBB 4TPRH 1JCKA 1NLBL 3O3BB 4JHZA 4LHUD 3LEYH 5F7HA 5DJ2B 1V5JA 1I7RB 1BBDL 4X8XA 5DGQA 1T7XA 5HHQB 3V5KA 5K9KA 4PRPE 1K3IA 1S7RA 4MNGB 1K4DB 1YMHA 3EO1B 5I8KH 3DXAD 5I73B 3ARZA 1A7RH 1QYGH 3B9EA 3G08A 3BISA 1ZLSL 5JW4N 4NPYA 5DUPL 1DEDA 4M48L 1ORSA 3LZFH 4HPOL 2P8PB 4ZO6A 4JLRB 1AQKH 3BDYL 4UQ3A 4E41B 1NC4B 3O4OB 3ZSTA 4DEPC 5ITFB 2E6PA 1U3HA 2NY4C 4S2SB 4MCYB 4I3RH 3D39E 3VCLA 5ESAA 2YD4A 3BIKA 4Y16A 4QRRB 2FJHA 1WJ3A 3MV8B 1OB1B 1B2WL 1K8IA 5F6IB 1INDH 4LEOA 5BMFL 5C09B 1V3KA 3JV4B 3NGBC 4FFWC 3EUUA 3DNKA 1T1YA 1HQRB 4UV4L 4WI9A 1D5ZB 4D9LL 2BNQB 3H0TA 4JRXD 3VRIA 3RNQA 3I02A 1JPSH 4FN0A 5DJDA 4PJEA 4C83B 2AXGA 4GAGL 5GS3A 3CMOL 1R24B 1KF9B 4PGDA 5DT1H 1H8NA 3V6OC 4LLDA 4NBZB 4F57L 1DBJL 2EYRB 3GSOB 3HMXL 5F1NA 1BVLB 1ED3B 3BN9C 3CLEL 3MLZH 4JR9H 4YPGA 2WUBH 3C87A 3MUGA 4PBVC 2DQJL 2GJZA 4Q2ZB 5CKGA 3WHXA 3MA9H 5DJYA 4XVSH 4YXKH 4PRBB 1BREA 3EYVA 1B9ZA 1TENA 2PO6D 2OTWB 5DQDH 1Q9KA 3U82B 1J8HA 4OD1L 4U1KB 1AIFB 3MJ9H 3IRZA 5DUML 1J0IA 1LEGA 2CDFB 3PV6B 1MQ8A 4UIKH 3RY4A 1LEIA 1FH5L 2R23B 2CR6A 4ONGH 5JXEC 3VFPB 4NQCA 2B1AH 2Q7YB 3D85D 4UV7H 3DYOA 5ADPH 1RZIB 4IRJB 4U6YB 2O5ZH 4XWGH 4K7PL 2IFFL 5ICXA 4PJ8D 3TZVB 5L8JB 1QA9A 3SDAB 1U93B 2X4QB 5EDXA 1HI6A 1CT8A 3AS0A 5HHMD 2IALB 3WJJC 3T0EC 3ARBA 3AGVA 1T2QH 2IQAB 1S7TA 3P4OB 4WUUA 4WCYL 2ZZUT 5IMKA 3AS1A 3UTQA 1L6ZA 1SJVA 4F7TA 4LSPH 4IRSD 1U8QA 3LQAC 2OQJB 4MA8L 3P9WB 4GRLC 1NBVH 1S3KH 5FA4B 3ZHDA 4OCSL 4TNVK 1PEZA 2YMXL 2J8OA 2CO7B 1YMME 3AAZA 4PRDA 2Q8AH 1ES0A 4JG1H 2MCPL 3ZE0E 2DMBA 3O6FD 2J7LA 4RFEB 4XC3H 4S1RH 2QSVA 4UBDC 3VXQA 3SO3C 2F53B 3BKJH 4LCWB 1EHLL 4D0CA 2P5WE 4GAFB 5D7IF 2W9DL 3ZKXC 4QRPA 5ISZB 5DVLA 4MXWL 4XMLH 3ABZA 5D6CA 2BY3A 2AEQL 3MC0A 4AT6B 1D9KB 2LAGB 4EI6B 1DSFH 3BUTA 4ZUUB 3S3JA 1MJ8H 3RGVC 2AP2A 1S78C 2AJXL 4NO0B 1P6AB 4EQ3A 1YJDH 1JZ2A 2VN4A 3OGCB 1I7UA 3OB8A 3TF7C 2XQBH 3NCJH 4NC0B 4TVPH 4TYUA 4TOYH 3B5HA 3IDNA 2FR4B 2VAJA 5L2KD 2NX5A 3VGDA 4JFHD 3QR2A 3HR5B 5EU7E 2X70B 1RZJH 5E00A 2PTVA 2VDRH 5HD8C 1CE1H 3OG6B 4KK9C 1OAZL 1JGUL 5JNYB 1I3GH 3MLWL 3N1PC 4JHAH 3ZDZE 2P8MA 3F5WA 2Z93A 3RWIA 3VRJB 3VG0H 4CVXB 2FD6L 1TZHB 5CZKA 5E24E 2JIXB 1PX3A 4PP1C 3ARFA 5IJKA 4Z7VA 1UVQA 1YNLH 2EDKA 4M6NH 4JFFD 5IFAL 2Y5TB 4PJEE 2J6EH 5HVHC 4IIQC 3QT2A 5IT2H 4WFHE 2CD0A 4FTVD 1MH5A 2SEBA 3OKEB 4FQJL 1ZGLB 4JM4L 2G60H 4OLYH 1MFDH 3RDTA 4HKJB 1IGIL 3V0WH 4EDWL 3MPCA 1IE5A 4JDVA 3PQYD 2FEEI 2G5BB 1WQVT 4NC1E 1YEGL 3DETD 1FORL 5JORA 3DIFB 3GUTA 3NZHL 2HT3D 6CGTA 1G84A 1G7QA 2YUXA 3BPCA 2HH0H 4DKFL 2EH7L 1MFAL 2XT1B 2EEBA 3K2MC 4XGZB 5AZEH 1J8HE 2APVA 3MRMB 3QBTB 4MA3B 4PY7B 5E8PB 4AEIH 4PJAF 5I71C 1Z3GH 3ULVC 4NQCE 2H6PB 2H32B 4JZOB 3C6LC 4HZLA 2WP3O 4RSVA 5HJ3B 1FNEB 2C9AA 4HJGA 4LF3B 4UI2A 1A6TA 5JXEA 2ERJB 4BQBA 4NKMA 2HKHL 3RVTD 3ZKND 2I9LA 1JGDB 3WHE0 1YY8A 5HHOB 4F15B 2OJEB 3MGTB 5B22A 4UIMA 1OHQA 2W38A 1CGUA 1JPGB 3LKNB 4LEXL 3SQBA 3VMOA 1HZHL 1TTFA 4U1NA 4HUVB 4MHHI 1ZHBA 2AEIT 3U4EA 4WUUE 3I3BA 3IS0X 4O51A 2CLRA 1FNAA 4HS8H 2IH3A 5DEGA 1MI5D 2BVOA 4W6YB 1VGEL 3LQMA 3ARRA 3G5VB 2R1YB 2QHLA 5T33H 2OI9C 4AH2B 4G6KH 4Z0BH 1QKZL 3CDGB 5D93C 5B38G 4U6XA 2CKBB 1XGYL 3NH7H 1IEAB 4GBXB 3DSFH 1V3LA 2A83A 4ZFZB 4G8IA 4MJ5A 2W65B 4P4RA 1G7LB 1P6FA 4M8QA 5E6IC 2X42A 5L6YH 4JFZL 3WUZA 2LU4A 1MCSA 3QI9D 1YN6A 1TTGA 4OZFA 4YC2B 5IB2A 3WNMA 4QRPE 3TP4A 2VXUH 1ETZA 1NMBH 4NJ9L 5KSAB 4LU5L 4LP4A 4QNPE 3PXJA 1FCGA 2E8ZA 4Y4KD 5IBUG 4M8VA 1F00I 4M5YL 2F19L 3HA0A 3KLHD 4RGND 4MLSA 4TUOA 1HDMB 4YBHA 4BH8B 3NCEB 5F1KC 4JDTH 32C2A 4NBXB 5DMJB 3QIWA 3I6KA 3U46A 1MPAL 3HMWL 3RGVA 1QHOA 1B4JH 3C60B 1NCCH 2X7LA 1YC7A 3Q6FA 3G5XA 2Z31D 1ZT7B 5DD5L 1DCLA 1YNTB 3ROOA 4OJFL 5ETUA 3NN8A 4K7PY 4MSWB 1MNUH 4LSSH 1F97A 3C5ZD 4KJYA 1WBZB 2AEWA 4GH7B 5I1HL 1OP3K 4MS8D 3IU4H 3ORJA 3EKCA 1NGZA 4IM8A 3ZSSA 3AC0A 4RQQB 15C8L 3QYCA 2YRPA 4YZFE 5AG9A 2CKBL 2DI7A 4H26A 5I1CL 1T4KB 5IV2B 4NQED 4X9IA 6FABL 1IGTB 4BSVB 1G6RA 1HHHB 2BSTA 1SYVB 1H15B 2PTUA 2X4UA 4DZ8A 2FEDD 5F8RC 5I2IB 2YEZA 3Q3GA 1R6VA 4L3CA 5C6WH 5INCB 4Z7VE 2Q3AA 3BKML 5ADOL 1Z0MA 3O11A 5F9WB 1D5BB 2YPLB 5SX5K 2W60A 4EI5B 5JTWA 3E8UL 1CZ8L 1F3JB 3N85L 3OR6A 4HUWA 3QXUA 4WI5A 4FFYH 1AC0A 2E27H 4IIQA 2Q86B 4QRTA 2V2TB 1IT9L 1UA6H 2DMKA 3VI3F 3MBED 5D8JL 2WBKA 4X98A 3EOYG 5CINH 4HDIB 3FT2B 1WZ1H 1J88A 1H3XA 3M8OL 3PWPB 3BP5B 3CSGA 1A0QL 4DGYL 5EZOL 4JN2B 4NZTH 5DFVC 1RMFH 5HGHB 3IJSB 2Q6WB 4NDMA 2E3VA 5L0QB 5F72S 3DVGB 4C56B 4CMHC 3G6JB 3PWNA 1UM6H 5I8EA 4ODVL 5KZCD 4NKDB 4M7ZC 1C5DA 1IBGL 3EOAB 2MKWA 3WSQL 3IVKA 1DFBH 3HZVB 2VL5B 4K7FB 4R97B 4CAGA 3UBXI 3QUZC 2WWKT 4NKOB 1IAKB 3MJ9A 1KENH 1MFCL 5KSBB 3F8UB 1J18A 4NM8H 3PNWA 1D5XA 1IKFL 3LN4A 1A7PL 3GSUA 2PW1B 2VZTA 1OAYH 3L3JA 3ECBA 4XX1G 4P3CH 1AC6A 1XF5A 3QUXA 3FTGA 3VD9A 3VD7A 5DFWH 4JG0H 5IG7B 5BW7A 4WTWA 2PTTB 3SE8H 4XCEA 4OI9A 1L7IL 4KKBD 1M05A 3OAYK 3W5NA 1EFXA 5DC4B 5J9PA 4W6XB 1CD9B 1BJ1J 4D8PB 4YAQB 4KRNA 5HPMB 3RNKA 5IWLA 4K8RC 5GJSL 5T3XH 1S9XB 3CAFA 5GZND 3Q5TA 3LS4L 4AEFA 3LH2H 5IB5B 4GS7B 5FKPA 1OP9A 1A9BB 5ID0B 5E6IA 2R56L 4I0PB 4HH8A 4HPYL 4X4YB 3L3HA 3UAJD 2AJSL 4YHIA 2H2PC 1S9VB 2B20A 4YE4L 2WMPA 5SWSD 3GSWB 1RSFA 1UM4H 2VLJA 1VFMA 2PYFA 1PKQB 5E56A 1WEJH 3NZ8B 1HSAB 1DBBL 4WWKB 1IL1A 1Z9SA 1T3FA 1X4YA 3OGOE 5B4MD 4K23L 5JA9A 5DJ0A 3OQ3B 4NQSB 1SJHB 5JW4M 5BCAA 3DMMA 1AD9A 4HF5L 1KN2H 1N5AA 1HXMB 1X5LA 2CUMA 5FGBC 3Q6GL 5FM5O 3ZTNH 2EDDA 2YXFA 4JB9L 3FZUC 1NGYB 4M6AA 4Z77B 4XMKL 3WIHL 3U4AA 4JKLA 4PD4J 4WO4D 1K85A 4WDIB 1DLHA 3MRJB 3IETA 1KPVB 1IAOA 4M1CC 4P4KC 5K59F 1R3HA 1FNGB 2W59A 4KJWC 5EU6A 3VFOA 1OSZB 1HEZA 1G6VK 3FAXA 2VDNL 2DJUA 5EN2A 1KCKA 5C0FA 3W82A 1UB6B 3KAAA 3RWDA 1J1XH 4YH6A 1T5WB 1UACH 1LEKB 5FYKL 4Z5RA 1Q0XL 4EXPX 2XZQH 3EYUL 2ZUXA 3QJFB 5BRZA 2GJ6D 3G6DL 1WCBA 4WJ5A 2V2WA 3MRDA 1D6EB 1JGEA 2F5AL 2XPGA 1NFDA 2X05A 1L4IA 1GOFA 4M7JH 4XXCA 2J6EA 1NLDL 5FM5M 1KLGB 1DBAL 4CUCA 2OLDA 4Y5YC 5JW3L 1JHKL 3BXNB 3DV4B 4PRHE 2BVPB 4CBPA 4XMPH 3EJJX 1AGFB 4PY8J 2Q20A 3HE6B 5DTFA 5ID1B 1U3ZA 1KLUA 5IMOB 1XR9B 1RUKH 3BGFC 4TVSa 4NN5B 4ZO8A 2C4FT 5DWUH 5EIVA 1PY9A 3ULVE 4U3HA 4GKZA 3PDOA 3WEXA 2YUWA 4PRIA 4XP1H 1NEZA 3WD5H 4YHZH 2A73B 4P3DB 5EPMB 3WNLA 1NFKA 1I9EA 2BNRE 2OMNA 4Q0XL 5D1XA 3MLXL 4DTGL 3QUZA 5H2BA 3L5JA 5K9QI 4J4PC 3BVNB 1EJOL 2I27N 3C5JB 3B2UC 1G0XA 2GUOB 4O9HL 3DOSA 3S35H 2P42B 4JRWA 1EVTC 5FOJA 4P46B 1KIQA 5FXCH 5CD3B 4FABH 5INDB 1X5IA 1MCBA 4UU9B 1JE6A 4N90D 4E42B 3GMOA 4F8QA 1XR8A 2EIEA 2KQNA 1Y18A 4OTXH 1RURH 1HOCB 2AGJL 4LVOC 3SDCC 4OZ4A 4LVNB 5D5ME 5EO9A 1C12B 4NKIH 5DEFA 1TCRA 5EZIL 2GTZB 1FVCB 4LKCB 3U9PL 4QY8A 3RAJL 1V8HA 3RPIA 4LLUA 1UEYA 3QDMB 2E5EA 1UC6A 4YEEA 3BE1H 2VLJE 4KI5F 3GMNB 4R26L 5ACZA 3B9KD 3EO0B 3GBMH 4HFWB 3V7MA 2VLRA 1SY6H 4BZ2H 4PJHE 2PXYD 3EDKA 3RRQA 4GAYA 5D9SB 4F3FB 2BVEA 3D2UA 3ZMRA 4U1HA 3O6ML 1CFNA 1KTLB 4XWOC 1G1CA 4WI4A 3TNNB 2NY3C 3BUYA 4WNQA 1LDSA 1IAII 5F7KC 2D4DA 5D2LA 1I1YA 5DDHB 1WV7T 5KVEL 1N7ML 2DF3A 1QSZA 3MV9A 3UJTL 3DX6A 3AVEA 4XHQA 4NUGL 3RX7A 2V9RA 1XCTA 4OGXH 5H94A 4KQ4L 4XC1L 3RWCA 3QIBD 3RA7L 5J1AB 1YYMH 3FFCD 3H9HA 3M17A 3O41B 3QEGH 4O5LL 2IQ9H 4XBGA 1U2HA 2QKIA 4JO4H 1S8DA 2DI9A 3ARGA 3VRLF 2PCPA 3NVQA 3MMEA 3EDJA 4Y2DD 3HNSL 1YDPA 5CAYB 2FO4B 2WWKO 4RGOL 3IXTB 5T1LA 2VXVH 3O8XC 1X5YA 3TCXA 5HYSG 1QSVA 3B8SA 1OOAA 1I3RA 4O2CA 3OB0H 4WV1B 3BH9B 3NPSC 2IF7A 4LRNL 1T1XB 4MZ3A 2O5XH 1NFDE 2VIRA 4LCYA 3QWOB 5I66A 5GS2H 1J1PL 3JZ7A 1KJMB 3MACL 2HRPL 1DL7H 3QH3A 3V4VL 1DBJH 1PG7H 1ZANH 3MNZB 2AI0H 1KLFA 1J05A 3NABH 5EOQL 2NXZB 3C8KB 3IDMA 3OXSA 5F6HJ 4RFOL 4LNRA 5BO1H 2ZPKL 4Q6IC 2FL5B 4NZDA 4XNXH 1I1FA 4CKVX 2A9ML 3FO2A 4QOKA 2N56A 1PX4A 4RMSA 5FCUL 4PRIE 4Y4FB 3W39B 4NYLB 3UTTD 1WTGT 3ARSA 4MJID 2BHZA 2IMMA 1ADQL 1EO5A 1AH1A 1GPOH 5IGXL 1QR1B 4NUJB 3TVMD 1G9NC 3U7WH 4A6YB 3CK0H 1DN0B 1GC1H 2VH5L 5F7LB 4B5EA 2QTEA 4XBPB 1LO5A 4WFEE 1IAIM 1BQHA 5EOTA 4PRPD 2XACC 43C9B 4P5TD 5D4QA 3EGSA 5T5FL 5IB4A 2QADB 2IFFH 1FL5A 4RAUA 3WFDL 3VFUB 3LV3A 3DGGB 4GW5B 2V9QA 3HPJB 4P99A 3C6SB 1WWCA 3MXVL 3D69B 5JPMB 3V8CA 4BFIA 3QA3B 1LK3H 3WXWH 3TYFA 3VXSB 2HRLA 4WCYH 3C09C 3LRSA 1IVLA 3PABA 3ILPB 5LGJA 1BLNA 3SDCA 4I13B 1BJ1H 4MA8H 5C3TA 1MEXL 3D39D 5CGYD 5IFHL 3IDJA 2DM4A 1KFAL 3OJDB 5C07E 3QZWB 4ZPVA 4RA0C 1BOYA 4NHCL 4PJAA 3FQUB 3G5YB 1YYLH 2CDEB 1KXQE 4PJ5E 3RJQB 1P5VA 3C08L 4M6OH 5HHNA 4U1GB 5F7DA 2VLRE 4JAMB 1I75A 3E1F1 3IFNL 3RBSA 3P4NA 2FJGA 5L2JA 2F8VA 2GCYA 4HMCA 3DO3A 4A6YL 3ZKMC 5IFJB 5DRNB 5CGMA 1VSCA 5F3BA 5D7KE 1CG9A 3LKSB 1MJUL 1R5IB 1JF5A 4GMSH 5D1QD 2A9NL 3SJVA 5FGSA 5M95B 4KJQD 1MIEH 4NO5A 3FT3B 4AG4L 3MV9E 5DK0B 5IMLB 2VR5A 5BVPL 4KRPD 1ND0B 5C08A 4ZFFA 1NAKH 4ZFOB 4UT7L 2Z91B 1UM5L 3G6AB 3VWJC 5CFHA 1T03L 4RISL 5C0GA 1H5BB 1AGCA 4KMTL 4WEUD 1TZGL 4YHPA 2AQ2A 1C7SA 2O61B 3GSNA 1XGPB 5B8CA 3ROLB 1ZLWH 4OLXL 1BQLH 3CXHK 4WFFE 5CEZD 1ZT4B 4R7DB 2YC1A 5BOZG 4B53A 1EBAA 5DF0A 2FD6H 5LAXA 4D0BB 2W0PA 5C0AD 3X13B 4G8EA 3QUYA 2AVGA 2NY5L 3O8XA