4BQCA

Crystal structure of the fn5 and fn6 domains of neo1 bound to sos
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
203
structure length
197
Chain Sequence
TGTPMMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEOGENIN
total genus 34
structure length 197
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA02
4HXBH 1OGAE 4MWFA 3PWPE 2E9BA 5CGTA 3MA9H 4FQQA 4OM0L 4G8GB 1ZVHA 1R0AL 2OQJA 1ADQH 5JIIA 5CHNA 1A6UL 1INDL 2XZQL 1R5WB 2AXHA 1HHHA 4MA3B 4XBEH 5D2NA 1IM9A 2HP4A 1K3IA 3GI8H 5CSGA 1I9JH 4NN7B 2A0LD 4ZFGH 1QO3A 3EUUA 3X3FH 3ZDZE 1HHIB 4TOYH 3UTQB 3ARYA 3UDWC 2VKXA 4Z78A 4EEEA 3O6FA 3SCMA 2VN4A 1YNKH 4PGCA 1Y6KR 3MRNB 4XNMA 1EMTH 2B0SL 3PGCA 5DMKA 2CKBB 2J8UE 1RZFH 4QRRD 4M4RA 4JFFB 3CPLB 4M5ZL 3BDXA 2ICEA 3EZ8A 3O9WD 4YUEL 5J6GB 3J8F7 2BNQA 1DVFB 2C3XA 5L6YH 4YC2C 2EH7H 4UDTA 4Y1AD 1A6AB 5I1HH 2EDDA 2VXSL 3RY6C 4ZFOL 3C5SA 1JWMB 2ZUSA 2P5WB 1QRNE 4FXKB 5F93C 3D18B 5DS8A 3KHQA 5IVXE 5FO7A 2HH0H 4NKDB 3FRPA 1B0GB 4RWHA 5D1ZD 1TZHA 2GJJA 1VDGA 1D9KB 3U46B 5CEYA 4Z7OF 3PL6A 1HEZB 3QAZC 3CUPA 3DETD 1MHCB 1DCLA 2JIXA 4P2OD 3OSKA 4X7TB 2V7NA 4OIIL 1G7LA 2FIKB 3RJDA 1DL7L 1PD6A 3V52H 2CGRL 3S34L 2EIZB 4RFOL 4WHYH 3IDMB 1PGRB 2EEAA 4PJ7F 3WO4B 2YSSB 2P1YA 4K7PX 4X6FB 32C2B 5C7XL 3CK0H 1LDSA 3MUHL 4PJ9A 1TZIB 3VWKB 5I16B 2IALB 3D87B 4WFHD 2ESVB 3TCLB 4WIQA 5BJTB 3O2DL 1K8DA 1YPZB 2HAZA 4JO3H 2AJXL 1RZJH 3S37X 3OAYH 3U7AA 1HQ4A 1JVKA 1CI5A 1MRCH 4CN6A 3QWOB 1FVDB 1F4AA 2YKLL 1MH5B 4OB5L 3QCUL 1N64H 4H0GA 3TBSB 4WJ5A 4PJ9C 5AZ2L 4MJIA 1XT5A 1F6FB 2WBJC 5DYOB 5FK9B 5IV2B 5F7UA 2BRRH 3BPLB 4HPOH 4KK8D 4XNXL 5IG7B 5DJCB 4WHTA 1E0OB 2QADB 1A7NH 1KIQA 3OAZH 2GT9A 3BZEB 1U6AH 2EDNA 4KU1A 5K9QG 5JDJA 4ORZC 5E8DH 3I50L 1TVHB 2LFGA 1T6VN 3A6OA 4TULH 1SBSL 4M1DL 1G9NL 4YAQA 5BQ7A 3QFJB 5BXFB 1E6OH 4CW1B 4OGXH 4YQXL 5HYFA 2VLKA 1MQKL 3ARBA 2XZAH 2YK1H 2EDOA 2HTKC 3KR3H 3DROA 2VDOH 3RZCC 4QRRE 3D25B 4KGJA 4LEOB 1JYWA 4PP1D 2VIRB 3DYOA 4JPWL 1KNOA 1PEZA 4KK8C 2ITDA 1GL4B 2ICCA 3VA2C 3BAEL 1L7TH 4OFPA 4NQCB 1M7DB 3HE7C 1D6VH 3MNVB 3WNKA 1ZGLA 3PP4H 5IR1B 3ZKMC 1A2YA 4RISL 1GAFH 1IEBA 4UOJA 2VRAA 4W6XB 3KXFE 2IH1A 1RI8A 2G5BA 4OCXH 2WBWB 4GRWH 3SEPA 3UJIH 1NMBL 3L9RA 4YDJA 3H9SD 3VD4A 4LOUC 3NFPA 5E4EC 3BDBA 4P46D 2DF3A 4OZ4B 1NBVL 3M45A 1GC1L 3DIFB 1S7SB 4S1SH 3HG1E 1T0MA 2HFTA 4UV4L 4OZHA 2Z93A 1JHTB 2F74B 3V0WH 2BMKA 2A77L 1MI5B 4YPJA 3MYJB 1T1XA 2QADD 4NJ9L 1BD2D 4JREB 3QCVL 3TV3H 3ARDA 4NQSA 3D85A 1B2WL 1EK3A 3BMWA 2VQ1A 2AJSH 4KMTL 3T0EB 1JN6A 2ADFL 3JUZA 4LLDA 4TNWF 5E1AA 3H9SA 4X6BB 3S34H 5FDYA 5HDBF 3WFHB 2FBJL 4EQ2A 4ORGA 2HJKB 4IRZL 3MNWA 3PHOA 3EO9H 4UUJB 4X7SL 3LEYH 5FUCE 2OJEB 1MVUB 3S8WA 3MLWL 3KJ4C 5E95B 3T08A 5FOJA 5FHAL 3ZDYF 3GMMA 1QRKA 3MNZB 1RULH 3MO1A 5CP7A 2CIKA 3OKYA 5C6TL 2HJLB 1UFUA 1IBGL 2J8OA 1YEEL 2EC9T 2OR9H 1GGBH 4K8RH 1BZ9B 5J89A 1QFWH 2EDFA 4PJFA 3CH1B 2F54E 1BJMA 1UACL 3JWOH 4QWWD 2KQNA 4QRRA 1ZKAA 2ERJB 4XAKD 4ELMB 1T0NB 3M17B 4A2MA 4OLYH 3OJ2C 5T1KD 4F57H 4GUPA 4QRTB 5F7WC 2PR4L 2ZJSH 3CIQA 1ULVA 2JB6B 1IMHC 2ATKB 2EXWC 4P2OA 3CX5J 4XVTH 4IRSA 5DQJB 1U2HA 2O5ZH 5CMAA 5C3TA 3WSQH 1HINL 4JVPA 5FHAH 3DOSA 3ZYIA 3VG9C 2VAAB 1CDIA 1FBIL 2GK0A 1RUQL 3W0WE 1Z9SA 2QHRL 4ZTOL 3IXAB 1HQRB 3O3BB 2YPLE 1B6DA 5DR5H 5EC1A 2YN5A 5D7SH 5D8JH 1DBBH 3F5WB 3IU3A 1IGIL 5MENA 5CFHA 4NO3A 4K2UH 5FYKD 4YZFF 2EC9U 1YEKH 2BY1A 4KRLB 4LSRH 1O0VA 4UOW0 3V0WL 3MOAH 2AJ3B 1CGSH 4JZOB 1AY1H 1BGXH 1ZLUK 3BKCH 4NQEA 4QWWC 3W9DA 5F97E 1KLUB 4NNYA 4X4ME 3UPRA 2FEEL 1LE9B 4XWGH 4Y4HA 1OPGH 5T3XE 5EOTB 1PG7X 2QSQA 1S7XA 1MY7A 3I6GB 3PWPD 2R2BB 3LPGA 4K7FA 4ZOBA 4MXWH 3C8KA 2LABA 1WJ3A 6FABL 1OTUC 3B9KB 1R6VA 3VG0L 4XP6H 5DD6A 3AUVA 1UB6A 5DLML 3SE8H 3LHPH 3LEXB 1NGPH 1R5WA 2BNQD 3TA3B 4G3YH 2ZUTA 3NACL 2BXZA 3DSFH 2P24B 4XCEB 1LILA 3HG1A 1CFSB 5H94A 5DSCB 3B2UD 4N5UA 4BJLA 1CICB 3DMMC 4TUJA 1EERB 5FECB 1Q9OA 3FTGA 1RURH 4ZXBB 1LD9B 5IWLC 4EI5C 3PP3H 4Y4FB 5DFVC 5HHMD 4NOBA 4I0PA 5JLZA 4YIQA 5EIIA 3SJVE 1LHZA 3MV8E 5D2LF 3DV4B 3IDNB 4P2RE 5F96H 1UJTA 5HHOA 5HYJB 4I2XB 1I8KB 1N59B 2BNQE 1T04A 3BWAA 4R7NA 3RNKB 4RZCA 5CJBA 5FUOH 2X1OA 1OAZH 3H7BB 4Z7WE 1ITCA 1KLGB 3PXHA 4L3EB 1CD9B 1A8JH 3FB6B 4P99A 1YEKL 2G75A 4XC3L 4GQ9H 3TFKC 3F5WA 1ZLSH 5D1XA 5A3IC 4WEBL 3VGFA 4HLZG 4HQQL 4M62L 3UJTL 2ZCLL 5HGHB 2K3TA 5FGSA 2NY6C 5I0ZA 1OTSD 3DX9B 2EXYC 4N1EA 4LNRB 4MXVF 3DTXB 1YY9C 5D7IB 1AXIB 2AV1A 2OM5A 3V6BR 2Y07H 3QQ4A 5F9AC 4D0CB 3I6GA 3FB5A 1XGUA 4KKLD 1BWMA 1FNEA 1HZHH 4PJDB 5IFHL 2N1KA 1Q9WA 1OAXH 3PJSB 5GGQH 5FF6A 1E27A 2MHAB 1Y6MR 2LAGB 1OQXA 4K3EL 1GOFA 1WIPA 4PJGE 5DJAA 1FNSL 3PP3K 2DDQH 1T66C 1RPQA 4JHBA 2H2SD 4M6AA 4FZEL 4Z7OE 1N2RA 3EW3B 3BD5A 4QCIB 3TFKD 4YE4L 5CZVH 2R9HD 1R5VB 3MROB 2X4TB 2AK4B 3FQXB 5SX5H 4QHKJ 1UT9A 4JDZA 1ZA3A 4YDVA 4RRPG 2X4RA 5E24E 3ARSA 3D5OF 1VEPA 2M8XA 4EZMA 3GI8L 4Y16C 5JO5A 3IJYA 4QRSB 2EE2A 3UX9B 1T22A 3ABZA 1L0QA 3BP4B 2JLLA 1V3LA 3FJTA 3IJHB 2WAHA 3TJHC 4QNPE 3VFOB 2WBJD 4YHZL 2EECA 1PEWA 4LF3A 1J1XL 1LVEA 5E2UL 4Z78B 1LP9A 1ZEAH 1CE6A 3O4LD 5F7HA 2P5EE 1YZZA 4J8RB 1OHQA 4LVOC 1JPTH 3H7BA 5DDHB 4PTTA 2F54A 1ACZA 2BSTB 2HWZL 5ID0A 1JGUH 4GAFB 4JFFA 4PJ5D 5HGAB 3HC0A 3V7MA 2R1YB 4PRDB 3VWJA 1YC8A 1DVFA 1F4YL 35C8H 3VDAA 2DOCA 2XZZA 5CWSA 3STZA 3DJ9A 1A7RL 2GY7B 2LU4A 3AFLA 4AMKH 5D7SL 2VDRL 1I1YA 3D0LB 5GSRA 3RVWD 1U8IA 1WWBX 2AV1B 1H3UA 5DUBB 1FFPB 3QUYA 4OB5H 2D7TL 2SEBA 3QQ4B 5J12C 1F3JB 2HRPL 1OOAA 3EJYC 3SDYL 2OX5A 1NDMB 4F7CA 5HPOA 4K9EH 3QUZB 4DTGL 3PNWA 1BP3B 1TJIL 2G9HA 4X6DB 5SWQB 4RA0C 5ETUA 1OPGL 4LSQH 3GSRA 1YMHB 4XXCA 1AO7A 1EJ6A 5GXBB 4I48A 1NBYB 1QFWI 1R3KA 3VXUD 1WBXA 4RX4D 4P9HC 3LRHA 4U1NB 3S3PA 3V4UH 4GW4B 2Z31B 3CVHB 2VLMD 4E41A 4L8DA 1FL5A 2BSRB 5EZOL 2KH2B 1GVIA 2IAND 1I75A 1MCWM 2VQ1B 2WWKO 3GO1L 4X5XA 2GSIB 3BIKB 3G6JE 5E8DL 4KPHL 3QWRD 2RGSA 5T5FH 3I3BA 4Z5RB 2Y6SC 5F9WB 1AGBB 2UYLA 2V2WB 4C56E 1KTLB 2O5ZL 1K3ZA 3WSQL 4BFGA 1F4WH 4KKCC 3LAFA 4ZSOB 3NFNA 4U0RB 2HH0L 1I7TA 4NP4H 2OZ4L 1GHFL 2XPGB 3QZWG 4JHAL 1YN6B 4F37K 5HGBA 1I8LC 3UTTD 2FO4A 2X4UA 2V9RA 2D7MA 4OTXH 1Z9MA 4U1JA 1YUHA 3RKDC 3MUJA 5L2KA 3O8XC 4JFFE 2JJSC 5I0DA 5ANME 1A6TA 3CMGA 3G6JF 5C3LD 2BHYA 3QI9A 1FZMB 1CDHA 4MNQE 1YPZE 2VDKL 4XPAL 4CKVX 3ARTA 2AJZA 4U1SB 3MRBB 3ULUL 1JE6A 2QSCL 4NZRL 1OM3L 4XT1C 2YWYA 3VG9B 2ED7A 4HX1B 3DHMA 1MCBA 4ZFFA 3VXPB 4PY7B 4IOFC 5IW1A 3VDCA 3WEXA 4X5WB 4OBSA 2Y23A 4X6DA 1FFQA 5F7DB 1AKJD 1DQDH 4TSBL 3SDXE 3Q3GA 1RU9L 5DQDH 3SDDC 1U93B 2ZSVB 3BN3B 4Y5XC 4M02A 2GAZB 3MOAL 4KKCD 4HKZB 5IMOA 1JI1A 2XA8L 4U7SA 1J8HA 1U8PA 2HG5B 5T33L 4NZDA 4IRJC 2VWEE 4YHNA 5DMIH 1AIFB 3D69A 5DD6B 1OD9A 1ZVSA 4AMKL 1RIUL 4I77L 5E9DE 1FNGB 2NNAB 5HJ3A 1UM6L 3KPOB 1QSFE 6CGTA 2DYPA 4WU7A 2DTML 2VLJD 3TBSA 4Q74A 2W1NA 3V5DA 5BW7A 1U3HD 2EDJA 4C57C 1KB5L 4HLJA 4D9QE 5B22A 1VFOA 3DETC 3X14B 4ERSH 2XN9B 1XF5B 2EIBA 4L3AA 4NC1E 3SE9H 5DRNB 2XRAH 2NY1D 3WD5L 1AFVH 4C56D 1FNAA 3P0YL 1VPOH 1ZHBB 4QRPD 4ZYKB 1I1AA 1E6OL 2R1WA 3OKDA 3ZKXB 3NH7H 5GHWH 2J4WL 3Q1SH 3LIZL 2DQHL 3P0VH 4WW2F 5ISZB 3WLBB 5DMJB 1BECA 1LO0H 1J7VR 5F3BB 4MS8C 1AY1L 1BGXL 4DAGL 4FXLA 5F1IB 4LHJB 4ZXBD 5KJRH 2C4XA 3O11B 3NCBB 3VXPA 5J6HA 3GMOA 4KPHH 4WTZA 3PXJA 2NY4B 4MA1C 1JNNH 2ZCLH 3FZUC 1KPUB 5B21A 1MSPA 4FZEH 1NFDA 4TRPL 1A02N 1UWEH 3GBLA 1X6LA 4RMQA 2HMIC 3CU7A 1IKNA 3D2UA 3FN3A 5D6CB 5FCUH 3TA3D 3QIWD 4QTIL 4LVNB 1U8OB 3FCTA 5KVDH 3ZZ1A 2GJ6A 3DUUB 1IGTA 3G5XA 1KJ2B 5E94B 1KB5B 3CFJB 1ACYH 4U3XA 4EOWH 4NQUA 1M71A 2W60B 1JPFB 4D3CH 4G8GD 3S4SB 5HVHC 3WFBH 1CWVA 2MJWA 2VZ3A 2H41A 2D3VA 2VXVH 2W0FB 2R1XA 3GSOA 5FO9A 1XGQA 1JMXA 3FAXA 1GZPA 3FFCD 3TN0A 1FNGA 4WV1A 3IDMA 1NKOA 1OP9A 4FQCL 3QG7H 1YJDC 4OCLC 5E03A 3HE6C 4RAUB 3QNXB 3VXNB 1R5IB 2AABH 3THML 1LK3L 5DFVD 1ZT1B 5DI8B 1T80A 4X8JB 3IAGC 5ANMA 8FABB 5TF1H 1N4XH 2VITA 4XNUH 5I19H 1A14H 4OZGE 4WY7L 2DQHH 4WV1C 3K8KA 3EOBB 5GS1B 5E5RB 3TV3L 5J1TC 3DPBA 3MCG1 3DUSA 3FRPG 2Z9TA 3V5HA 1BOGA 5D2LE 3KLHD 2LVEA 4HC1H 1HE7A 5TE6L 5IV2A 5T1MA 4ZMAT 4LQFL 2IAMC 1X7QB 1H8OA 2BFVH 3BW9A 2NTFA 4NCC1 1QACA 4HJ0C 1K2DA 2X10A 4LARL 2F54B 2ICEB 3TH2T 3UYRH 2PF6A 1XCQB 3GMOB 4MJ4A 3QB7C 4NC2B 1P7KA 3ARXA 4HAFA 4YIQB 3BJLA 5EIIB 3HLAA 1YEJL 3ZSTA 2DLTA 3CCHA 1E6JH 1FHGA 1A1MA 2BVQA 1YJDL 5DVKA 3IDYB 1CXFA 3H8NA 4YHIA 3IDJB 1FNSH 1DANU 5IB5A 2VXVL 4H8WL 5I2IB 1P84K 1S7QA 3P0GB 5I74B 3ZT7A 4PJAB 4P5MA 1TTUA 2OSLA 5IMLB 3KLAA 2NY5C 4P57B 5D7JB 3Q3GB 1OAQL 1YMHA 2VLJA 4OCNC 5IF0A 5ITBL 5F6IC 2FIRT 2YK1L 1YDPA 3GJEA 2KZ1B 3VMNA 1AGCA 2OXGA 4JDVB 3ZE0E 2O61A 4H26B 4OD1H 3C8HA 3QIBD 1WFOA 3BKJH 1W72H 1G7IA 4HKZA 1DBBL 4JR9L 4PGBB 1WGOA 1OGAA 2D7OA 1CIDA 2QQKL 4Y19D 5IEHA 5IW6B 1EZVX 1S8DA 4J3SA 1H8NA 4QYOB 1VKXB 2D2OA 3GFUA 4K71B 3U7YL 2E7LA 2ZNWA 3MJ6A 5DUPH 1AO7D 2PW2A 1PVHA 5KVFL 3WHXB 2ICES 2XOTA 2GJZB 2Q6WA 4XVJH 5C07E 4QCIA 4UMGA 3WXVL 1ONQA 2HVJB 1CLCA 3UEZA 2R8SH 2GSGB 5F21B 4NIKB 3IDGB 4YNYA 3UTQA 4KKBD 1J0IA 3EZJB 3O8XB 2XWTB 4Q7DA 3QXAA 2FJFA 4R0LC 1VPOL 1Z5LB 1P6AB 4UQ3B 5J06A 1INEL 5EIVA 1XF3B 4JKPH 3MLZL 4J4PC 4YDKL 4ERSL 3MV8D 1MCPL 1YY8A 2GHWB 1HHKB 3SQBA 1KELL 3VXMB 4QRTA 5IBLC 1T1YA 4KI5D 1F4WL 2Y72A 5IFAL 5JNYB 4GMSL 3D6GA 3ZHKA 3MO1B 5CP7B 4ZTPL 4GG6E 2XACC 5E08H 1AI1L 1RJYA 3QHFL 4G9FB 1JNHA 1KXVC 2BNUA 4MZ3A 5KSVA 2DLIA 1IGMH 3PHSA 2QTEA 1MF2H 5T3XD 1V5JA 1JNNL 1NGPL 1ZT4B 4MDIB 2ADFH 2WBJA 1GGIH 1OCWL 4AEFA 3D85D 1LQSR 3QXWA 2CR3A 3PP4L 2HT2D 2FGWL 3PF2A 4Z7UF 2VZTA 3IB4A 3BYYA 3WEXB 2P5EB 4X7TA 2V2XB 1JV5B 3AU1B 3QA3A 4F7EB 1NEZA 2HT3C 3ALPA 4BSVB 2A38A 2IG2L 4G8EA 2JJTC 3ARQA 3KPRA 2NXYC 1EO7A 1BVZA 7FABL 1J86A 2DQDL 4N0CD 3RVVC 3GHBL 5IB4A 1CDJA 5ALCL 3VXOA 2HFFA 43CAA 4GW5B 3DBXB 3PGDA 4OKVA 5H2BB 4TNVF 2YMXL 1IC4H 5E8NB 2ADIA 1X4ZA 4C56A 3H7LA 4OZIF 3VGAC 1A7RH 5HHME 4PTUB 4EJ1C 1AO7B 1HKLH 2UVFA 1MFNA 1IKNC 4JVUA 4NZJA 2NY6B 5HHVH 5DZOA 1NAKH 4DKFL 2YD9A 4XX1G 4CMMB 5ESQB 3FFCE 1LK3H 2RFXA 1C5CH 4I5BA 5DD5L 2H6PA 1H15B 4Y19B 2ZUVA 4J1UA 4MNHA 1F90L 2I5YH 1PKQB 1IC5L 1B4JL 5DMIL 5IKCB 4LSVL 5D93B 4NKIH 1IC4L 1FDLL 1S9XB 2PYED 4KVNH 5T1KB 4E0RB 15C8H 4WGVB 3HS0B 1L7IH 3VD3A 4HHAB 1UADC 4POZD 3ZL4H 1NGXA 4XMPH 4BKLB 4GG6B 4EUPA 1XZ0B 4LVHB 3BVNB 4EKXA 3DURB 1QYGL 1FO0H 2NXYB 2AXJA 3QEQE 4YFLI 3PGFL 1U6AL 2OP4H 3BPNC 3BT2H 3H6JA 3QDMA 3MLYL 4QRRB 1KOAA 2CKBA 3RWJB 3CK0L 3O4OC 1NCWH 1F8TH 4PJAF 2Q3AA 5CINH 3RVTD 1QZ1A 1HSBB 4P3DA 4U1HB 2Z8RA 5IBTH 2BVQB 4YEFA 1HILB 1KJ3L 2P45B 3KXFA 1AHWC 4NUJB 4JHWL 4FOMA 5D6CA 1WUNT 2CLRB 3HAEA 4EOWL 3EYUH 4EI5D 5HGGS 1S5IL 3V2AR 3TNMA 3RWEB 2CLZA 1R3HB 1T1ZA 4NN6B 2NMSA 5C92A 2VXSH 5E9DA 1RZ8B 1UWEL 3TBYA 4U3HA 4ZAKD 5HI5D 4KDTC 1GHFH 2MQCA 3BGMB 3GMRA 3MLRH 1EHAA 1TQCB 1IBGH 2EDEA 3C60D 4OGYL 2NY4D 1U93A 4PRIE 5LGKA 3MRCA 2F58L 5D5MA 1G7IB 4R96A 4WHCA 1W2KT 2R29H 2AEPH 4X4YA 3ARDB 4TOYL 3CLEL 1MJJB 3QNZA 1WFTA 3LB6C 1MCCA 4GMTH 4OIAA 3UP1A 4V1DB 3VE0B 4N0CC 3JV4A 1FIEA 2NW3B 1F58L 1BMGA 3CSGA 4FQ2H 2IF7A 5IMMB 1AXSA 1BREA 4AEEA 3LOWA 3RTQC 4L9DA 1TQBC 3BEWB 3C09B 2EXWD 3LS4L 3P73B 1ZA6B 3L3OB 3UAJD 5BO1H 1P84J 5JPNA 5EORL 4QXTB 1G84A 1U9KA 5TDNB 4WUUD 4DFHA 2NTFB 3TO4D 1ZAGA 3GSQA 4EN3B 2EKJA 2R1YA 4P2CG 1DQDL 4TSBH 5C0NC 3DMMB 4YDLB 1IZKA 4MAYA 2NYYC 4FABH 1MWAB 3MOQA 3VFNA 4Y1AA 1A7OL 5C0AA 4W81A 3F58H 1N59A 1NDGB 3BWAB 3B2VL 2CR6A 2VDLH 1PJ9A 4OGAD 3TZVB 1J0HA 3NPSC 1B0RB 2XA8H 3W0WB 2X4NA 1IILE 1I1AC 1TQCC 2A6KB 1E4KA 1UZ8A 5DDHA 5C0BA 5L8JB 3GMPB 1IAMA 2EDRA 2DIJA 3LZFL 4N0UB 1DJSA 3R1GH 4X7CC 1MJUH 1T20B 1X5ZA 1IAKB 4KRPC 4PD4J 3GM8A 3S5LA 4NN6C 2E3VA 4NQXA 1ORQB 2YXFA 1VFAA 3RIAF 5HDLA 4IOIB 1ES0A 4JFQA 2MTPA 1P4IH 3CVHA 2DN7A 4ZUUA 3UROR 3DGGA 3G6DH 3NVQA 2BHUA 5I16A 4AQOA 3VXSB 2DQEH 5L9DH 1QRNB 3GSWA 1F3JA 1JTTA 2WP3T 4NOFA 3UTPE 1IEHA 1WZ1L 4LIQE 3ZDXE 5IMKB 5E08L 1KJMA 4CMHC 4U1KA 5CZXD 4AT6B 3GB7B 1EBAA 1MCJA 5FYLD 4NZUL 1T4KB 5IJVB 4QY8A 1JI2A 2R56H 4M7LH 4NKOA 1EIBA 2BRRL 4ZUSA 2NX5B 1JWSB 1W72L 1BF2A 1IGCH 4EVNA 3TN0D 1LP9E 1KGCE 2E8YA 5TDNA 5CJXC 4U1JB 3NZ8B 1T7XA 5E6ID 4EDXA 1SMAA 3CU1A 1T89C 3ES6A 5DHYA 1YEDB 5GGVH 3VFUB 3TC9A 3BRFA 2YUVA 2DBJA 1G9MC 1U8LB 1XIWA 4NWUH 4QTIH 1KXTB 4AL8L 2QQNL 5FYLE 5F89A 1AXTL 12E8H 2IANB 3BP5A 2PYFB 4LRNH 2CRMA 4F7TB 5IVXF 4HX1A 2ZCHL 3AY4A 3KNBB 3PGCB 4N0UE 2OI9B 4BK4A 3DYMA 3KPRE 1BBJA 1XGTB 5D1XB 5MERB 4FQLL 2FECL 5GRVK 3T2PA 2H3NA 2KL6A 1GC1C 3SE4A 2E7HA 4YXHL 5E56A 3MODL 2HYMA 3K3QA 1VEOA 2WWMD 5B39A 4GG8B 5E5MB 1I9RH 5FA4A 3EDFA 3NPSB 1U8OA 2P4AB 4PBWD 4JCLA 4OCWH 4WO4A 3FRUA 3K2UH 1TFHA 4KQ3H 4E5XA 4IRSC 4LSVH 4QT5A 5T1DL 4ODVL 4DGIH 1JGLH 4OFKA 2X1WL 4I3SH 4U1IA 3BE1L 4DZ8B 1ED3A 4PJGB 1AHWA 4UINL 3EO0A 4LFHG 3VW3L 1K6QH 3HZYA 4DFIA 3K4AA 3MGTA 4M6OL 5E6IC 1FL5B 1VHPA 4HGMA 4JFZL 1JPTL 1JGLL 1FLRL 4X5XB 5D96C 2MCG1 4LGSB 1FE8L 5HHOE 4DGVH 2C3GA 3FO9A 4O2FB 2GJ6E 5LGJB 2XQYK 1J8HD 1VKXA 3C8DA 4ZS6C 1S3KH 3BMVA 5ACLA 3WFHA 3OKKA 5MEOA 1OVZA 1YEEH 1YYMH 4GG6A 2HRLA 4C54A 3VFTA 4J2XA 5FYJD 3LKQA 4X7DC 4S0TD 1P1ZA 5HDQH 1NEUA 1A1NB 3DGCR 1N4XL 3KPMA 4Y2DD 3RAJH 3L5WA 4PLJD 2VL5B 4OT1L 1S78C 3QJFA 4L1DA 1QHOA 3CDGB 1G7PB 2ARWA 5I9QC 5SWSB 3MLRL 1SEQL 2NY2C 5DR5L 4YX2L 4WI4A 4JFOA 3P9MB 3QO1A 2ATKA 3MV7A 3KXFB 5DRZB 4HWZA 3I6KA 1INQA 5DJ8A 3WUWB 3MJ7A 5LGHL 5F7EL 3RY4A 2JB5L 1YMMB 1ZHKA 3SPVA 3KJ6H 3NCCB 1JPFA 3HR5A 4FTVA 4JHWH 5IOPB 1O7SA 3RUGA 1HI6A 2EDYA 1UACH 3PNWB 1AFVL 4DQOL 3EDDA 3ZTJH 1ZANL 2BXYA 1GGBL 2FIKA 3S98A 1PX3A 1E4JA 4RFOH 2C4FT 1NBYA 4I48B 4QRQA 4JZOA 1EMTL 2B0SH 2W0LA 4N0YH 3KPRB 4RDQF 1IGJB 3TPUB 5KJRL 4M6ML 1NC4B 5I1LB 3FMGL 1WITA 4EBQH 1KJ2A 5E94A 2EDQA 3CC5B 4FHBD 3TJEH 1C12A 4Z18A 5EZJA 3X3FL 1CTOA 3MV8B 1Y0LB 3ARZA 4MWFB 5DGQA 3M1BA 4HIIA 4HULB 3NTCH 3VRJA 1K8DB 4M93B 2OJZL 5CJ5A 1FAKT 5D7LB 2OTUA 1KC5L 5I1HL 4Y2DB 4YPGA 5AUMA 1MAML 1IJ9A 2YPLA 3WDIA 3O2DA 1T21B 4YWGH 2AJVH 4N1HB 2FB4L 1KG0A 1MFBL 2DQJH 3MLPA 5I8EA 1LNUA 4KY1H 5EU7E 3O6FB 4G43A 3BQUB 5I1EL 3D9AH 3HI1A 4WTZG 2A0LC 1NLBL 3V6FB 3PWUB 5K33A 5DMKB 2CJUH 3ILQD 1NMBH 4V2BA 3R8QA 3SJVD 4S1DD 3V6OA 1HXYB 3B6SB 1XMWA 3BUTA 2YBRB 3AS2A 3KPPA 1K4DB 1NL0L 5E8EB 3JUYA 1MWAA 3QDGB 3VFNB 5EN2B 1E6JL 3DUSB 3VXTA 1I8MA 1TETL 3QULA 4RNRB 6FABH 3MRJB 1YECH 1CE6B 5DJ8B 4YFLF 1DN2A 3AAZA 3MRIB 3RWIB 4HIJA 3TNNA 2AK4D 4NRZA 4YHML 5IT2L 3A6BL 4LKXA 2JJSA 3CSYA 3DROB 3DYPA 4XVTL 2XFXA 5BRZD 5I1EH 1KFAH 3DNKA 1W0VB 1T2QL 1S7RB 1TJHL 2FEDC 4U31A 4LLWB 4G6KL 1RZ7L 3GGWB 3KR3L 3OMZA 1JK8B 3SBWC 3EFFA 5F7FA 1LO3L 1NC4D 5GPRA 3AU1A 1CFQA 1CLZH 1KYOJ 4XI5D 4AEHH 1T7WA 2FRGP 4S1QH 1AGCB 4X7FC 1I7ZA 1LO5B 4NCDA 4BK5A 3WJLC 5C0ND 4JPVH 3M8OH 3O4LB 3O3EB 3S36H 3ZT5A 3PWVA 1DBAH 1QSVA 2VLRE 1QRNA 3VD9A 1Z2KA 4X9FA 1CZ8H 1MCKA 3ME0A 2VLME 1S7VA 3MV8A 5EO0B 2OSLB 3MXWH 1JJUA 5MENB 4QHUB 1A3LH 4FTVE 4YDIH 5GS0D 1RHHB 2JE8A 3CX5K 1P6FA 3GBNL 3DX8B 4HUWB 4F58L 4R6UA 4PV9A 2R4SH 4H0HB 4OZHF 4Q9BA 5EZIL 5CEZH 4OGZA 3AM8A 3DECA 1OW0C 2X4PA 4IOSD 3OB8A 1NC2A 2WK2A 4U6HB 3ZYJA 5IJKC 4R96B 5C2BH 4PYHA 2XWJA 2DKSA 4LCCC 5TE7L 3NGBB 5IM7B 2NR6C 3QXDB 5C0DB 3V6ZB 3U4EB 3QDJD 4F7PB 2EO1A 4NO0A 2R0LL 4P5KA 1X5LA 4GO6B 4Y16A 3HC4L 1G6RH 1SQ2N 5KVDL 5L0QB 4U0QB 1A3LL 4CN4A 5ERWB 1KBGL 4IM8A 3OGOE 1PDKA 4ZSOA 4LCUA 1UJ3B 1XAUA 5HVWA 4PGDA 3QFJA 5BXFA 4LRIA 2WP3O 2DI9A 3NCYS 5I9QB 4PJFF 1JTOA 1F8TL 1LP9B 4LSPL 4CUCA 4XVUD 4KK9D 5DEZA 1GGTA 4P2QB 4UTAL 4WUUA 3O2WH 3WS3A 2PTUA 3OF6A 2DWDB 3GHEL 3O6ML 1AQKL 1CDYA 2W92A 4U1MB 5CBAA 1XGTA 3ALWA 1A6AA 4Y4KD 1KN4H 3HE6A 5BZDA 3EAKA 2DD8L 1MIMH 3C5SB 5TQ0L 5DUMH 4Y5YB 5DJXA 2R69L 4U6VL 5FM8A 1LEIB 4X99A 1VGEH 1YN7B 4HGWB 2PCPB 1OTSC 4XX1E 3CFEB 5F1NA 5HPMB 1U8IB 4MZ2A 2IPUK 1WFUA 3CAFA 1VEMA 5D2LB 2AQ1A 2AXFB 2CKNA 3S35H 1NDMA 4M9OA 5E6IB 5CZKA 4PJ8D 4X0KA 1MHEA 3CDCA 1HIMH 4FZ8L 4F7EA 3N06B 1RK1A 5FYJU 3TBYB 4ZUWA 5J7CC 4NO5A 1SMOA 1U3HC 2CDFB 3VWKA 4NRXA 1JGUL 2ZG2A 4P5TB 1BFOB 4O5LL 3RVUC 5D5MF 1U91B 5DVOA 1S8DB 4PG9B 1PG7L 3PIQA 4H5SB 3M1BB 4K7PY 3MJ8A 5E1AB 2Q76A 1U3ZA 3HZVA 1DUYA 4NKMB 1P7QB 2HLFD 3BIKA 2EYSA 3RTQB 4GS7B 1U3JA 4M1DH 4XAKE 3RP1A 3UPCA 3ULVC 1S9KC 1JYVA 5EIQA 4IS6B 1QBLL 3QJHA 3QEUA 1ROWA 1NBQA 3SCMD 4WHYG 4NN5C 1CR9H 2RCSL 5E8PA 3GMQA 1MUJB 1EX0A 1FAIL 4RGNC 3CFDA 1CICA 5SV3A 4PB0L 1KPRB 2W91A 4HW6A 4Z0XA 1XF5A 3MRPA 1J88A 3QUMH 1EFXD 3LKNA 5JUEL 5TQ2L 4X7EC 2QHRH 3IFOA 3PHQB 3AROA 1JF5A 3L3DA 2XY1A 3FO2B 4R26L 4AL8H 3BVNA 3SDAC 5E2WL 1JZ4A 3JTTB 1O7VA 5IFHH 4D9LL 1AD9B 3WJLA 4R4NC 4HKXB 4GSDL 2VZ1A 3RWFA 1R3LB 1NLDL 3MV7E 3OAUH 3V6OC 2V7HB 4EN3D 4U6TA 1FO0B 3QDGD 4PJAA 4JO1H 1S7UA 5I8KH 3DMMD 1MHCA 3GUTA 1A6ZB 2FCBA 3KLSA 3BXNB 1NFDB 4M9PA 3VA6A 2W59A 3V52L 2EDTA 5K9KA 3R06A 2APXA 2E9IA 1TLKA 3WE6A 3ULUC 4R4BB 3TYFA 2VZSA 3TLRA 3VCLB 3UTSE 5FGRA 4C4KT 3PWVB 1S7XB 3Q5OA 4M5YH 5E8NA 1FJ1B 2IPUG 1QSEE 1PYWA 3C8KB 2V9QA 5L7XL 1CD1A 3AREA 1DSFH 5C0JA 2JCCF 4WWKB 1QBLH 4OV6F 4WI6A 2Z0BA 5LG1A 3F12B 4LIQH 3IVKA 4PJEF 3WKNA 4TSAL 4OBRA 5AYUL 1ZTXL 5JOEA 2XRAL 2HKHL 1G9ML 1QBBA 1AD0A 2DQCH 4L3CA 1F4XL 5J3HD 1V3KA 1IC5H 4Q97A 3QO0A 1SBBA 2DYPB 4WU7B 3WS6A 4JO2L 4JFZH 1EFQA 3MBEA 4J12A 5F8QC 2YD2A 3FQWB 4XCFH 1QKZL 3W5MA 4LPUA 5ICYB 2JK5B 3MRFA 2ID5A 5I76A 2HRPH 4M03A 3UTSD 4Y16B 1LMKA 2EE6A 5ABDE 1PLGH 1Q9LB 2YRZA 3N1QC 1NGQH 3ZKND 5HI4C 2VDLL 4M7JH 4PJ7E 2GQHA 1JFQL 4L8SB 4M48H 1I7TB 3O41A 5C08B 4OCWL 3GRWH 1BVLB 3G5VB 5I17A 1R3JB 5D70H 3MLVH 4S0SD 2NPLX 1EUTA 3HKFA 5LXGH 3U36A 5E7FA 3IF1A 4JANB 1JPGB 1E28B 4WI5A 4HZLB 1X4XA 4PRIB 3U1SL 5IUSA 5K59F 5FM5M 1IAKA 5D1QB 4DUWA 4HWBA 4RWYL 3E2HB 2P48B 3T65B 1EAPA 1SM3L 5C9JB 3MCKA 2D9CA 4XNZC 4QO1A 5AD0A 1I7ZB 4HKJB 3TYFB 1KV3A 1U2CA 3LKPA 3MV9A 3VCLA 4I9WE 1FSKC 3VI3F 12E8L 2X4NB 3ZO0A 2YRLA 1H3XA 3CFJA 5DUBA 3GNMH 3M07A 3MRMB 5GS2D 4EXKA 4JAMB 3QYCA 5E8OA 2V7NB 3DSNA 1URLA 4KROB 1OW0A 4XPHH 4N9GB 1FZOA 4BYHA 5DJAB 4PRHE 3QPQC 4NO5B 1S7TA 5BOPA 2NX5A 4P5TA 5I1LA 3O2VH 1D9KD 3EJZC 5C2BL 2MOVA 4OLVH 1RQ5A 4LPCA 1MRCL 4S1RH 1YEGH 3DV6A 3FQRA 1BQHA 3FFDB 3INUL 1EFXA 3P77B 2PYEA 3ES6B 5F9OH 2A83B 3L3HA 2XTJB 2CD0A 4KRPD 4K8RD 3V5KB 3MGAA 3RIAK 3B5GA 4G6JL 4HV8A 1T4KA 5GQBA 3T1FA 5FDWB 3IKCB 3CLFH 1FN4A 4ONFH 2HFGL 1AGBA 2UYLB 3IJHA 3EBAA 2QQKH 1KG0B 4PFEA 3HRPA 4FQHB 2NY2B 5C09D 4Z7WB 3L5WB 1AGFB 3NA9L 1FFOB 4L9LB 2WIIA 5EU6B 2RJMA 5DJ0B 3V4UL 2W65A 3S5LG 5F6IB 3IETA 5JR1H 1FZKA 3KYKL 4MCZB 3DV4A 3IDNA 1CQYA 1NDGA 1P2CB 3JTSA 2W9EH 1I8KA 3WMSA 4RNRA 2MPAH 3MLSH 3CVIL 4Y5YC 1NGYB 3ZYZA 4LVNC 2GTZA 3WL9B 4LSDA 5FA3B 1KB9K 3LMJL 5MI0B 2BNRE 3MR9A 1CT8B 1WTGT 3S37H 1R3HA 1T1ZB 5LCVL 1G7JA 2JCCB 2B7DT 4QRPA 5CEZE 1P53A 4J3VA 4D9RD 2VH5L 1OGTB 2ORBL 2J6EH 3PQYE 5H37H 4AIOA 4RX4A 4JFDE 1KLUA 3EYSL 3CZFA 5CGYD 2MWCA 2AI0L 4WU5A 1OLZA 1UJ3C 4ACPA 4R7DB 1KB9J 1DBMH 5EWIL 2R23A 1RVFL 3RKPA 5F88A 3P77A 4XCNA 5SX4I 3QFDA 4JZNB 4MB4A 4QHUA 2C4FU 3VXSE 4TQEL 3PWJA 1DQLH 4KKAD 4PP2B 5HDOA 4QY8B 4WGWB 2CUMA 1GGCL 1A7PH 4KAQL 2ERJC 2R2EB 2MQ3A 3EYSH 3MPCA 3RKDD 4J4PA 4FFWC 4AENB 3ULVH 3UZVB 1P5UA 3LQZB 4R0LA 2BJML 3N1PC 4NQSB 4LLMB 1RMFL 3D0VA 4K2UL 5DYOA 5FK9A 4ZD3L 3CMOL 4ONHB 5C09B 2FO4B 2OI9C 1WZLA 2X4UB 3VWJD 8FABA 1DQMH 1A5FL 2ZCKL 2FHFA 1IGML 4C59B 3QG6A 1X3DA 3FHQA 4PJEA 3S7GA 5D2NB 5D7LD 3IDXL 2CXKA 4MDJB 4KI5F 2V6HA 2R1WB 5KANI 2NYYD 4X6EB 4D3CL 3OKNA 1CF8L 3X17A 1KTDB 1ORSB 3B3IA 3G5YB 3WHE0 1BZ7B 3QSKB 2PR4H 2ZJSL 3BUYB 2MCPL 1QUNA 5IW3A 1DZBA 4R8WH 3OKLB 1IKFL 3SE3A 4Z6AT 4HGKC 1T0NA 1CT8A 1MJ8L 4KHXL 1F2XK 3EKCA 3RUGB 5EZLA 4JQVC 1A4JA 2AJYL 5E4EB 1SVCP 5EUOF 2D03H 1RZFL 4TTGA 3SN6N 4OFDA 2NY4C 4MA1B 4UBDD 1KPUA 4Z76A 1I1YB 5LJYH 2BCKA 3RVUD 3HN3A 4ZS7L 4X5LA 1LO5A 3HMXA 3LEYL 3PWPA 3FRUB 5KVGL 2YZ8A 3V0VB 5AZEH 4X9IA 4WDIA 5IBUB 1W0WB 2BVOB 3HA0A 1D9KA 3LIZH 2X1XR 5CGMA 2UZIL 3VRJB 1OLLA 4YHOH 3W5NA 1OT2A 2ARJB 2O5YH 3ZKXC 4H20H 4PJDF 1FV1B 3F12A 1R0AH 5D4QA 4CN1A 3RBSA 1TPXB 1V7ML 4HS6A 1NAMH 3HHRB 4KI1A 1S9VA 4MAUH 4PJBA 2Y06L 3SOBL 4GXUN 4O5LH 1L9NA 3HCVA 1U58A 5C0RL 5DD3L 4G42B 1YNKL 3EHBD 3H0TA 3GJFA 1TENA 4NQVA 3C5ZC 5EBMA 5ILTH 3KVQA 5FKPB 5BVPL 1UH4A 3B9KA 3CGTA 3DO3A 2R15A 4RFEA 1QFWM 1YEDA 4JRYA 5IVOA 3LDBB 1PSKH 4HF5L 3RGVB 4YXKL 2AQ2A 4KQ3L 5GJTH 3HZMB 2X05A 4IDLA 4FP8L 3FOMA 1JZ6A 2WQ8A 3MJ9A 1L7TL 1YN6A 3BGFC 1FCCA 1F6LL 5DT1L 3BIBX 4MJ6A 3Q6FB 1A7PL 3U4AA 4MAYD 2GK2A 5AWNH 1U8HA 4I0PB 1ZHLB 1AGEB 5KG9B 3MV9E 3SE3C 1ZTXH 4OUOA 1JPSH 2FHCA 2DLGA 1JNLL 2P47B 5DJZA 1LGVA 4Z7VE 3MCKB 3RWIA 1HYSC 5J9PB 3LKPB 1HNFA 1RUQH 1X5HA 3C6SB 4M1GL 4WDIB 4C58B 5IHBA 5TF1L 2LVCA 2ORBH 4FQJH 2VXTL 4XWOD 4KK5D 3QIUA 1JZ5A 1YQ2A 1KELH 5FO9B 4AM0B 5IQ7H 1T83A 4I3GA 1RUKL 5AZ2H 4OLXH 1RZJC 2JKXA 3CZFB 2WANA 5TE7H 2QLVB 4LVOB 4JFDB 1JGDA 3T0EE 5LBSL 1RY7B 3OAUL 4Y4HB 5GGQL 2FHBA 2XWJB 3D3VA 1EVUA 1BFOA 1T0PB 3NIGE 2MCPH 4FQXC 3FT4B 2OZ4H 1OTTC 4XHQA 3DXAA 4PB9H 2FX7L 3V7AG 3PIQB 4YBHA 5IW6A 5GRZA 3GB7A 4FQQB 9CGTA 4UV7H 5KN5B 3FOLB 4HEME 2OTUB 4NGHL 2FEDD 1CGVA 3IDYC 3IFPA 5GGSY 5T3ZL 3S36L 1SJEB 3F7QA 5HHXH 1LE5A 2L7UA 3C6LC 1CFSA 1YEHL 3BEWA 1P1ZB 3RUGE 4HQQH 4M62H 3UJTH 4NQDB 4UDUA 2DQGL 3RWDB 3G04A 2XTLA 4NC1C 5DJCA 5DJ2A 4HIEA 4QXWA 4RWYH 4R97B 3X14A 5FYJH 1RJCA 2QHLA 4LHUD 3BZEA 5F1KC 1WT5C 1T5WA 1I8LA 4HUXB 5KG9A 4Y4FA 2ZKHH 3OKDB 4P4KD 1NGXB 5SWZB 2E7MA 4M61A 3SGJC 3MBXL 4K7PH 2QEJA 3N85H 1BJ8A 3RHWF 5DJXB 3HRZA 1A1MB 3G6JB 5DFWH 4S2SB 1KCLA 3X13B 1DBKH 5HD8C 1GZQB 5H8DA 2P8MB 5DQ9B 3ULUF 2DM7A 3CFIC 3SE9L 2JELL 3QUXB 3N0PB 4J3UA 3JWDL 3JVGA 5KSVB 2X70A 1SEQH 2Z8SA 4AY0A 1KNOB 5CEZD 3MLUL 3U36B 1X4YA 2ADJA 1KJ2H 3K81A 3O9WC 4QOKA 1IT9H 1JGEA 4BELD 4ODSL 4AH2B 3VW3H 2VH5H 1CU4L 2IFFH 2HTLC 1L6XA 1HIML 5DA4A 4XCCH 1EA9C 2X09A 4IEFB 4QTHB 1MEXH 3K8LA 4NDMB 5LCVH 32C2A 1MFBH 4H26A 1VB9A 2YRPA 5I6XB 3DX6A 4ZOCA 5FA4B 4BH8A 5JIKA 4PRAA 5F1NB 5HPMA 1EEQA 4Y2DC 3IXAA 1MQKH 5IB4B 5B8CB 1S3KL 2OL3A 1RVFH 4OZGA 1HH6B 2FZ3A 2VC2L 3QZWA 1EPFA 3QIBC 3AREB 1FH5H 7FABH 4NUGH 4F9PC 2IAMD 2R69H 3WIFB 3NN8A 1UWGH 4U6XA 5HXMA 2M1KA 3NIDF 1NGZB 3PQYB 1LO4L 1HKFA 4U1NA 1EVTC 4L5FH 3U6RB 4P5TC 4XC1H 3A0OA 5EUOA 3H0TB 3NA9H 1OWWA 1MI5E 1TTGA 1YQVL 1J87A 3FO9B 3IS1X 3Q6GH 4HF5H 3BESR 1NFDF 1TZGL 3PWUA 3EOAA 4NKMA 1YY8B 5MP6L 4QEGA 2NW3A 1I8IA 3ARGA 3E0GA 5JQ6L 1MNUL 4Z0BL 4OLUL 3WFBL 5FAAA 3SGDI 1WEJL 2IFGA 2FX9L 3MLXL 2GIYA 1XIWB 3O6LH 3RWCA 3MQIA 4XCFL 4EI6B 4XTRC 4HSQA 3G5YA 1CFNA 4LDOB 4BA8A 1CFVL 1YYLH 3BGAA 1F2QA 1I3VA 5HYSG 1FO0A 1FGVL 3W11C 3E8UH 2AV7A 3IETB 1N8ZA 4C83A 1XCTB 3VWJB 3AB0B 3HFMH 5CAYB 2VUOA 3IJSB 4HMCA 3VGDA 2LQRA 4LAQH 5EO1A 5EU6E 1NKRA 4I9WD 1CXIA 4XVSH 1YN7A 1J18A 4FQJL 5DUPL 5TH2A 2ENYA 4JKWA 3LV3A 4MXQD 5MI0C 3QH3A 3LEVL 1XR9A 4POZC 4LPYA 3ZTNL 1TZHB 4P59H 3N9GL 1A0QL 4NNPH 4JQIL 2B20A 3BO8A 2I27N 2FL5A 5TJWK 4P46C 5LVEA 2DIAA 1YEFH 3L6FB 3L7EA 15C8L 1KCSH 1XIWC 4ZPTB 3L3IA 4XZUA 4GAYB 3NN8B 4JJHA 4OQ1A 5ETUB 3ULSB 4PJ9D 1DANT 4YJZL 1X5AA 4XBPB 4NPYA 1T7YA 2MFNA 4Y4FC 4KUCD 3Q5YA 3MRDA 1T6WA 1G6RA 3SGDH 3QO0B 1TQBB 2IJ0C 4JN1H 4LHQB 1WWCA 3QDME 1I9IL 3O3UN 4GW1B 4L4VD 5DI8A 4UNTA 4N0FB 3BD4A 4KTYA 4DKFH 4V1DE 1MCFA 3GSNA 1AQDB 3LEXA 3RL2A 4JZJC 1CD0A 1FFRA 3TA3C 4K23H 3BPNB 3LPFA 4MNQD 4Z77B 2UWEF 1TVDA 3RVVD 3U0WL 4OI7A 1D6VL 4QXUL 4J23A 2AERT 3CVIH 3HZMA 3LKQB 3IDGA 4JM2C 1EHLH 1VFMA 1WCQA 1J0KA 4X80L 3QUYD 2PXYB 3T1WA 1FFNB 3QDJE 4JPIA 5BVJA 1BEYL 2BFVL 3ARFD 3TT1H 3WS3B 5D1XC 2DQCL 5FUZL 3I02B 2W65B 1DDHB 4M61B 4QXUH 5JPMB 1GCFA 5D1QA 4NHUA 5BZDB 1IGFL 4UDTB 1MHPH 5HYJA 4S2SA 2UZIH 5EDXA 3P9MA 2FD6L 1A64A 4P59L 3ARBB 1IVLA 4LLAA 1A14L 3C5ZD 3QCTH 4F7TA 1I1FB 2CLVA 1FSKB 4ZTPH 1HOCA 3O3BA 4JE4B 3EYVB 4DJMA 3FMGH 4MMZC 4WWKD 4EBQL 2BOCA 1D5BB 4ZFFB 3WN5C 2DQIL 2YN3A 4P5MB 2NY5H 5HHMB 4Y8DC 2B4CC 4NO3B 4K94H 1P9MC 5D1QC 1A7BA 1V8HA 3T3PF 3LN5A 4PREB 4OLVL 3QUXD 4PJ7A 2R0KL 4FQIH 2OMNA 4HT1H 3X12B 2C1PB 1QBML 2W38A 4PJXA 3O0RH 4D9QD 4LVHC 2OR9L 3GMLB 3QUZC 5AG9A 4K94C 3QIBB 2C3VA 2AGJH 2YUZA 2X42A 5E6ZA 4ZPVB 3WFZA 3TCXA 2NY5L 3HZKA 1B9ZA 5ICZA 3TT3L 1XF4B 5D93C 3WHE1 5DZNA 3HZVB 3C6LB 1JCKA 2XG4A 4G8FA 4QYOA 5F6HI 2N7BA 2VISA 2AEPL 5I6XC 4U6XB 4R26H 4OFVA 1IM3B 1JF1B 5KSBB 5C7XH 2UUDK 1J05A 1LEKA 4JPVL 4NKOB 2YPLD 3GKWH 2O5XL 2NY0D 1H3WM 3KGRA 4PY8J 4YHKH 4X4XB 1UA6H 5SWSD 3K80A 4OD1L 1ZVYA 3RPIB 3UBXB 5GRJH 5IEKB 4HWBL 4E0RA 1U8KB 1AC0A 2X4QA 5FB8B 1MFDH 2YXMA 3OKKB 3ILPB 4DKEH 2AQ3A 1BIIA 1I1AB 2GFBB 5D7KD 1TVHA 4U4BA 2HN7B 5D1XD 3L5HA 5I1JH 2BZDA 5GRUH 4U2ZA 1U36A 3W9EB 1A47A 4GBXD 1RAMA 3HNTH 5I15H 2VDPL 2VZOA 3HC0B 3LS5H 5C07B 1UVQB 3CX2A 5GGTH 1PKOA 4Y5VA 4TUKL 1H3PH 4UI2A 4ZQKB 1W0VA 3MZTA 3UTZB 1Z0MA 4WUKL 5FHBL 1QFPA 3MRLA 4HCRA 3LB6D 4LHUB 5C9JA 4NQCA 3M8OL 4JQXC 2XQYG 4KXZI 4HWZB 3LH2H 1JHKH 2IC2A 5C0CE 3TBTB 2C3VB 3QIBA 3G5XB 4TTDD 2CLZB 3O3EA 5DK3A 5EWIH 1MCRA 4LCYB 3WLWC 1RK0A 1TNMA 1VGEL 4K9EC 2G9HB 3WNOA 4OCYH 1S7VB 3OG4B 4W70A 5FGCE 2A6JB 4XAWH 4Q0XH 4XBPA 4GKZA 1MEXL 3AM8C 4M1CC 3MREB 3MJ9L 3RGVC 2XZCL 3BKCL 3VFGH 4NHCL 3H9HA 4G8IA 4AENA 1QQDA 5HHVL 4WWID 3TGXA 2AABL 3THMH 1G7HA 3WNLA 2QSVA 4ZDHB 4DUXA 3S35L 4YHYB 2X4TA 5C07D 3X11A 4JM2F 4UT6H 5DC0A 5C0BD 4YBLC 5TDOA 4ODHH 3MBEC 4J1UB 2WBKA 1EDQA 5ICYA 3FOLA 4HPYH 4XP5H 1HQ4B 1JRHH 4PP2A 2NXZC 4XNYL 3WJJC 2DQDH 4BUHA 4KDWA 2R9HC 2HT4D 1TPXC 5JO5B 1RZJL 5B39G 4LCWE 3MNZA 1JMZA 3AMLA 3C9NB 4J3XA 2VDMH 3B5HA 5A2FA 1TCRA 3VFOA 5D1QD 2GUOB 2XWTA 1QBMH 3ROLA 2KZWA 3O6MH 1F45A 3IDXH 3UO1H 3W39B 5C07A 4HMDA 3WFEH 4BZ1H 5ADPH 1G7PA 5DO2C 3IFOB 4ZQKA 3BZFB 4MAYB 3TJHD 4Q6YA 4ZNEA 5SWZA 3HMXL 1AKJB 3FT2A 2Z91B 2VTFA 1NMAH 2CDGB 1HILA 3T65A 4G6AD 3OKNB 2H2SC 4NJAH 4IMLB 3WLBA 4CVZA 2VLKB 3ARFB 4MSWB 1U8MA 4XXDA 5DS8B 3BZDA 4TPRL 4YXLH 3L3GB 4EDWH 4NRZB 2DAVA 4OZFG 2D03L 2XG5A 4OFYA 2V7HA 4MB5A 3K4ZA 3SDDA 4CU7A 2D0GA 2IADA 4CGTA 2FL5B 1WCBB 1J5OH 2C1OB 3QWRA 4I4WA 4KFZC 4P57A 5D7JA 4ENED 5EOQH 1ZXQA 5IR1A 2YD3A 3LZFH 1QFUH 4PJBB 1NANH 1CF8H 1PX4A 3ZHLA 3ZE1E 5T3XL 4BSJA 3OXSB 4RMRA 2UVEA 2VXTH 4V1DD 4E41E 5CUSL 4YEEA 4D8PB 5BRZA 4LLYA 4KZDH 3GKZA 2APVA 4A2LA 2H32H 3OBAA 3IXTB 4OCRH 3PUCA 3VXME 4LFHD 5GGUA 4F37F 5L8LB 4RFEB 4RAHA 4O2CB 4KK6C 1AQDA 5GISH 4ZFZA 4MD0A 4K23L 1UYWH 3LHPL 3QFJE 5LAXA 1PSKL 2M2DA 4ODVH 1IGFH 1P4IL 4D9RE 2R0WL 1JWSA 3ZE2F 4KVCH 3KPTA 1MY5A 2NY3B 2Q86A 4PRPE 5BS0D 4JFDD 5FGCB 3T0WA 4OZFB 3N50A 1H15A 3O45A 1G0DA 3NZHL 1MLBA 3OR7B 1A7QL 3QXDA 5C0DA 4LGPB 3QHZH 5I76B 1BQLH 2WIIB 4YWGL 2D0HA 4Y88A 3T2QA 1U8HB 4O58L 4TVPH 4XPGL 4OZIA 2PXYC 3PWLB 2X9XA 4H20L 2GT9B 1ZHNA 4QRSA 3OJDB 3ZKNC 2VLLA 4HKBA 2PN5A 4WFED 1PQZB 4NNPL 5GS1A 4DVRL 2VLKE 4JB9H 3QIWA 4F8QA 4CVUA 1FCGA 4NZRH 5E2TL 4LF3B 3MV7B 5CJOL 5D2NC 3QULB 2X9YA 2VDNH 5ISZD 5HHPB 5A2LH 5DD1L 3P11H 4P2QA 4UILL 3W0WD 4ELMF 4CAGA 5DK2A 3ROOB 1BBJB 4BQ6A 5CCKL 3FB6A 4JN1L 2H9GA 4P0DA 2AW2A 4R4FH 2A74B 2LTQC 3P4NB 4HZLA 4X5WA 1CFBA 1HI6B 4YE4H 4Y4HC 5IVNA 2ITDB 3OXRA 3JV0A 1HH9B 4PREA 1A1OB 4P49A 3RNQA 4JFEE 3WJJA 5FKAB 3D0LA 1FPTH 2JJUA 1ZGLB 4W6WB 3FN9A 3DTXA 3OF6D 5TPWL 5KVMC 4U6YB 5B38B 4K07A 2HT2C 3TO2A 4PJXB 4OCSL 4E5XB 1XR8B 3LRSA 1WIUA 5I19L 4TN9A 3U46A 5BJTA 2NXZB 3H42H 1K9TA 4OLUH 1ZGLP 5C08E 3F62A 3PQYD 1FZOB 1MCSA 4YH6A 5LAXB 1KCVH 2UY6A 2NLJB 5E00A 5ENWB 3WO4C 4HJGB 1RK1B 5IJVA 4QRUB 4PV9B 1QD0A 3RIFF 5D7IF 2MMXA 1AD0B 1UM4L 2LU3A 1F00I 1JGDB 1BPVA 4JO1L 5I8KL 3U7WL 1EGJH 2NY2D 1FC2D 1QTYT 1WWWX 4HXAL 4QOKD 1KBGH 5F3HA 2QL1A 4UTBL 5FYKL 1VESA 1ZGLM 3VE0A 1S5IH 3PL6D 3V9FA 3BP6B 5IKCA 1GC1H 5DRNA 1T7VA 4KAQH 3IFLH 3VXQA 3MV7D 1GYAA 5BOZG 4PJ5B 3VFTB 1WC7B 1JYNA 4E42B 4Y5XB 3C6LD 3B5TA 4OQTA 2HVJA 4KVNL 4WJ5B 5EU5B 4R2GB 1E4WL 1HWGB 3V8CA 4Y4KB 2FSEB 2E7BA 3KYOA 3RRQA 1J12A 1ADQA 4B7IA 5GZOC 4F33B 4H1LB 4TUJB 3QEGH 4QHMB 4EI5B 1R3JA 1RURL 2W9LA 4N8VA 3TESA 4XBGA 3RL1A 4PRBB 4LEOA 4FFZH 4LASL 1PKQE 1U8QB 2VLRD 4M6NH 5DK0B 2J6EL 3HLAB 1CICC 4HS3A 3HNSL 3GNML 2P8PA 4FTVD 1H8SA 4JFOB 5HSFA 1GIGL 2E27H 4OLEA 2BERA 2VR9A 2H8PA 5BV7L 3LS5L 4QTHA 4N8CL 3JTTA 4HH9B 4XPTH 2J8HA 4MD5A 1A2YB 1RZKH 4IRSB 4NUJA 4HUMB 3QUMB 4WW2C 1ZT7A 4TVPL 4XPGH 5HYJD 3WD5H 1KXQE 4MQXC 3PL6B 1M71B 4NFCA 1RUMH 5EUKB 3SGEH 5I30H 5JHDA 2GI7A 5ESVA 2HTKD 1N3NB 2BSSA 5L7XH 2Y7QB 4XPFH 5CBEB 5AZEL 2H32B 4FA8A 4NQXB 1RU9H 3HNSH 3T0BA 1GPOL 1AE6H 2HA1A 4ZS7H 5HYEA 2Q1EA 4NPYB 1ES0B 3O2WL 4JFQB 1A22B 3U9PH 4MX7A 3RX5A 3HCVB 3MLUH 4G7VL 2PXYD 1G7HB 5ADOH 3JWDH 1OM3H 1HH6A 2FZ3B 4Y7MA 4HG4K 3U4EA 5T3ZH 4PJDE 4U1KB 3MJ8B 1EEZA 3KPNB 4X6CE 5KSBF 2APWA 2P46B 4ZUTA 4LEXL 4GFTB 3MCLL 3RTQA 5SWZD 2R2EA 2FGZA 1FGNL 1IM9B 5E9DD 5GZND 5KSAA 1WZMA 3BKYH 3KXFD 3DUHA 3L1OH 2VSCA 2BDNH 1PY9A 2HJLA 3VFPB 5H94B 3FO0H 4M7LT 5I1AA 3IS0X 3S88H 2H6PB 5JW3L 5GRJL 5KOMC 5IJKA 4X9BA 5IWLA 4L4JA 2YD6A 1HHKA 2RIKA 1U8QA 3M17A 3TEUA 3ZKQD 3ILPA 4XVJL 1UZ6F 3I2CH 1J11A 2FJGA 3PHQA 5CSZB 1DP0A 3G6JA 3KPRD 1JWMA 3VRIA 4D0BB 1GZQA 1V3JA 5SWZE 2PYFA 4F80A 4ALAH 5F9OL 4RAVB 1FO0L 3MRBA 3QDMD 3NOIA 4EQ3A 3VFSA 3W0WA 1OP5H 4PR5A 1SM3H 4J6RL 1VCAA 4JY5H 4PRPA 2HFEA 5L6YL 4M1CD 1FNHA 1N3NA 3H9YA 4FMFA 2NZIA 5CKAA 3STZB 3S5LB 3D2UB 3O6LL 2IH1B 1UCTA 5DD5H 5K9KB 4JDVA 1MLCA 5GSRB 3QXUA 3TYGH 5CLTA 5DJ6A 3A6CL 2YR3A 4G7YH 4HJJH 1C8PA 3QZWB 3F7YA 2VL4A 3GIZH 4JDTL 5LWYL 4NQDD 5I1DA 3WO3B 4LSTL 2FD6H 4PJ8B 1L9MA 4PJDA 1XGQB 1BVKB 5DLMH 1C7TA 2G60H 4MNGA 4GXUM 4FABL 2VISB 1TNNA 3IVKB 2NY0B 4OUUA 1JIBA 1FQ9C 2M26A 1JUFA 5HJ3B 5JORA 1G6RB 4KGLA 3VGEA 1FORH 1ONQB 1IAIM 1OF2B 5I1GH 1KLFA 1EJOL 4YXHH 3MC0A 3MXVH 4GRLB 5GS0H 1MIML 2NXZD 3O8XA 3L3KB 1BQHB 3FFDA 1MCEA 3OQ3B 4NQTA 4X80H 5DJDB 3FQWA 5LGJA 2BSED 5JZ7D 4Z0XB 1N0XH 4MA8H 2HJKA 3QRGL 5FV1L 2BHZA 3PHOB 4H1LH 3DI3B 4OJFH 1YEFL 5A40E 1R3IL 5MENE 4JFEB 4JPKH 2VLLB 3IGAA 5GGRB 4M7JL 1I3UA 4YBLB 3MACH 3HTLX 2BRQA 1I1AD 4I2XA 3KPMB 5F44A 1BFTA 2XICA 5CUSH 4KQ4L 4NWUL 5I8OH 1BVLA 3G5VA 5JMOC 1IC7L 3U0PB 1I7UA 3AVEA 4BFEA 3OKLA 4LAQL 4WFGE 3CSYB 2JCCE 2XFXB 3VWJC 2Y6SD 2DM3A 1NUNB 3QR2A 1VADB 5L2KD 3DHJA 3GRWA 2JELH 2H8PB 3ET9F 5CMAB 4CJ0A 4YHZH 5IHZA 5ALCH 5HBBA 2LAAA 2CLRA 4X8XA 4JQIH 1IEBB 3NMEA 4MVBD 3HPJA 2XY2A 3ARVA 4M7ZB 4WY7H 3NCJL 5HI3D 4XPHL 1U8JB 2A6KA 4ZO8A 5C0BB 4ETQA 4GW5A 5C8JA 3ARGC 3HR5B 4FTVB 3ULVF 1U42A 1MELA 2OTPA 1KJVB 4M6MH 1P69B 1NH6A 5KVEH 4ZUVA 3WIFA 4TRPH 4GKSB 1FLTX 3TBWA 5FM4A 1RJZA 5CINL 4GKZB 4HBCH 2QQQA 4YDLC 4PJGA 4NRXB 5JIPA 1MF2L 2X4PB 1W8NA 2C1PA 2VNCA 2D31A 1HYRC 1H3GA 3PDOA 3N1MC 4DAGH 4XP9H 1OAZL 1JN6B 2JB5H 4HC1A 1I4FB 5DMGD 2ZPKL 5IIEB 4B0MM 2F5BL 1IZJA 3AREC 2J4WH 3Q1SL 3QEUB 4HUVB 1QEWB 4O51A 4EUPB 4G9FE 1WC7A 5E2VH 1Q94A 5E7BA 3MRKA 1FYHB 1PG7H 1T03H 3KJ4B 2R2CA 1BFSA 1LD9A 4Z7WA 1S7WB 1TIUA 1QP1A 4PJFB 5CJXA 2V2TB 1IM9D 1DQJB 1FAIH 3B9AA 2CMRH 4WUUB 5C0IA 1NAKL 3CPLA 1CLOL 1DEEB 4W4NA 3ARPA 5I8CB 4FQ1H 1BIIB 3EFDL 1V7NH 3P0VL 1JZ3A 3BEVB 3LMJH 2DLFH 1BQHG 1FH5L 3O6FD 4BQBA 5FEBA 1Y6NR 4DK3A 2DI8A 4HFUH 4S1QL 4AG4H 4JRXD 5AYUH 1INQB 5FOBA 1ZT4A 4MXWL 1G9NH 4NT6A 4L3EE 4MNGE 1BX2B 4RFNB 5L2JB 3NGBC 4KJPD 1TJGH 4CU8A 2AP2A 5E8OB 5DT1H 3CUPB 1GIGH 1EO5A 5JHDB 3MLVL 5IFJB 3L3IB 2XKUA 1D5IH 4KUCF 4WNQB 1TCMA 3PV6A 4FZ8H 1DQQB 2NX5D 3QPQD 4UTAH 3ZHDA 1QQDB 4IRSD 2IBBA 4LSTH 4MXQC 3RX8A 2R4RH 1MRFH 2I07B 3BQUC 2IAMA 4X4MA 4ODTH 2AS5M 3H3BC 3WYRA 5EO0A 2ARJQ 3OB0H 4BSWA 1QHPA 3NFPB 5I1KH 2MPAL 1U95B 3LN4A 5HGDA 1NLDH 1OAXL 1ETZB 3G5ZB 4JFPB 4RDQG 5EBGA 1X5KA 3QDGE 1K8IB 1J05B 4KTEH 1KCRH 3STLB 1MCIA 3TA3A 1UG9A 2DBLL 4MMXC 2B5IC 3MRHB 4MQSB 3NABL 3E6HA 4HXAH 2AK4E 5I1AB 1JZ2A 4RGOH 4JM2A 5I8EB 4LIQL 1Z5LA 4BH7A 1H9VA 4L4TE 5JW4Q 1Q9OB 1NAMB 3CJJA 5F6HJ 2V2TA 3DVGB 3FT3B 3FFCA 2R56L 4M7LL 4PJXE 4JZJB 3TVMB 4KH2A 3U82B 2Q7YA 5I8CA 3L3DB 5JPMA 3FQNB 1P2CA 1OARH 2ZOLB 2DJSA 1PQZA 1ZLWK 3V5HB 3HRZB 1U92B 2R2HB 4KJYB 4QGYA 4U2YA 5BQ7B 1AD9A 1RJYB 4RZCB 3NIGF 4JR9H 4JRXB 1C16A 4CVXB 2XKSA 3MRIA 3OKEB 4YDKH 5ID0B 5F3BA 5TGBA 5E0QA 3GIVA 1KLGA 3NIFF 4PR5B 5IW1B 1XCQA 4HWEH 1NBZB 4N0UA 4JHAH 1A4JB 1MJUL 4Z7VF 5MHSD 1FVCB 5C09E 1XF1A 1FYTE 3HNVL 1M7DA 4MD5B 5IB2A 2HLFC 4WUUE 1VFAB 3SKMA 3EGSA 4LNRA 2ICWB 4LKCA 4RMTA 1C08A 5DD1H 4R4BA 1FFPA 3SO5A 4M93C 3I3EA 2D7TH 1N26A 2AEQL 3OKOA 4ZPVA 2R4RL 4XGZB 1W0WA 2BVOA 4DVRH 5EFIA 5E6IA 2A9NL 2DTSA 1U8NA 5IBLD 4KMTH 4ZFZB 4XB7A 1ERNA 4JG0H 1E27B 2MHAA 3UZEA 4O2EB 1K8IA 1R24A 4MNGB 1AO7E 2EIEA 1HHJB 2KUTA 3MLYH 4X83A 3U1SH 2J7LA 3AMKA 5GSVB 1RSFA 3PDGA 4K3JL 5EU3A 4ZUSB 5AWNL 1S9VB 4PJ9B 5CILL 1BEYH 5FYLH 3ILQC 5GIRB 1GGCH 5ESQA 1T1XB 1DQTA 5TDOB 4LLVB 3U83A 4JFYB 1OTTD 5F3HB 3DLQR 4MXVE 3KS0J 4JDZB 4YDVB 1FDLH 2DJ4A 4DN4L 5MEND 4OZIB 1DBML 2V2WA 3KPQA 2Q8BH 4O51B 4R4ND 2I60H 4PJHE 1YNTB 1BF8A 4RGND 5D9SA 4D0DB 1P4LB 3NTCL 2ZOKA 5JOPE 4LRNL 2H26A 3QIWB 3QHFH 4YR6A 1LE5B 3DXAD 3GMQB 4UT9L 4HCRH 1UM5H 3R4DA 4OZFA 4M00A 1N7MH 1BZ7A 2PO6B 3QXTA 3BHBB 4LCWB 1MREL 2BNRB 1A3RL 2JIXD 3KHOA 3SDCA 1T5WB 3TVMD 4YFDB 3VXMA 3HAEH 2FLBT 1ZEAL 4HWEL 4GG6F 2YBRA 3CZJA 3L3JA 3SDXA 3OPZH 4FXGB 4Z9KB 4ZFOA 3SO3B 4K8RL 5D6DA 1Q1JL 1A0QH 4GXVL 1B0RA 4P9ML 2R4SL 5EZIH 5CEZL 5DVLA 1CL7H 4NT6B 5DF0A 3CLEH 3C5JB 5DK2B 1BQUA 2ADJB 5FYJL 2DM2A 4NBYB 3T8XA 1U8NB 4LLUB 5JUEH 1UM4H 4KROD 2J88H 4BZ2L 5CBEA 3GKWL 2COQA 4GAYA 3P4OA 3H9HB 4G8IB 2NY3D 4ZD3H 5I75C 4XP4L 3FZUD 1CE1L 4OSUL 4H8WC 4XH2B 2VLRA 1QSZA 3IDIB 3X3GH 3T4AB 4S1SL 1CL7L 1YA5A 4HS8H 1PAMA 2FX7H 1AIFA 1Q0YL 4CRPA 4IHOB 3RDTB 1OAUL 4EXPX 1FL3A 5IIEA 4KI5E 2W0FA 1DUYB 3VRLF 4XVUC 3QDHA 4G9DA 4AIXA 4FG6D 3OKMB 4WV1B 5EBLB 1NGZA 4HUVA 3I75B 4JLRA 1QFOA 1TETH 2OBGA 2NCMA 3QPXH 2X4SB 3WNNA 1MJ7H 5ADOL 1SJEA 2Z4QB 2BY2A 4LU5L 4X4XA 3MZGB 5JMRA 2AK4A 4ZS6D 5JW4M 1VGKB 5DJDA 5BV7B 5ANMB 3LSOB 2JK5A 1FYTB 1FFNA 3FQTA 4JPIB 4PGCB 4XNMB 5CJQH 1GPOH 4NO0D 2F54D 3MBED 4ZODA 3NAAL 2K1MA 4QHNB 4LBEB 4OI8A 1IARB 1EEUA 3CVHL 1HWHB 2AEIT 4MAYC 2VDOL 4NN5B 2NTSP 4LP4A 5T33H 4QLRA 2CK2A 3AAZB 4WTXA 3FHAA 1ZK9A 4HIHA 4L3ED 1NGYA 2DS4A 2Q7NA 2E8ZA 4WI2A 2CXGA 3RA7H 4PJBF 4PS4L 1G9EA 4G6ML 4GOSA 3SDDB 4LSQL 1B4RA 4NFDA 3W81A 1OB1B 4CNIA 5IB1A 2C1OA 1N5AA 2H32A 5EO1B 2R0WH 5J4MA 3IKKA 4WNQA 3RBGA 1KJ2L 1X5YA 5CSBA 4BSVA 1KIUA 1IGJA 3TPUA 3ARWA 3OHXB 2Z35A 2GKIA 3NFSL 5IHLB 2XNAA 4XP6L 4OGAC 3CC5A 3K2UL 3U0TA 1A6UH 5I66B 3AS0A 3FN0L 1PZUB 4P9HH 1ZS8B 4NZTL 4XCNB 1KJVA 5T3XH 2HT4C 4JY6B 1OAUH 1ED3B 4HJGA 5C0BE 5IGXL 2IG2H 2R0LH 3I6LE 2OTWB 3AC0A 25C8H 5D1ZC 1F4XH 4NBZB 3ESVF 1U3HA 3VWKC 1QOKA 1OF2A 4N8VG 4YNYB 4JY5L 3ARED 2V5RA 3MRGB 4P3CL 2LU7A 4Z7UB 3MBEB 2CIIB 3VD5A 4ESKA 2H2PD 2VITB 3CXHK 1FYTA 2EH8H 3FQTB 2P5WE 2YA2A 1H0DA 3I3DA 4GRMB 4F58H 1EEYB 1UCBH 4JY4A 5DO2D 5MEQB 3OX8B 1ZHNB 1KULA 1PW3A 4NSKA 1I9EA 4IOFD 5CJ8A 2N7AA 2OP4L 3IJYB 3VH8G 5IFAH 1UZ6E 1SJHA 2Z8VC 2DM4A 3L5XH 4PJ5E 4OCSH 4LCWA 3KPSD 5L0QC 3TZVD 2E6PA 3UXFA 4XBGB 2FEEI 5DEFB 1JBJA 5DMGC 3E2HC 4A6YL 5EOCH 1JRHI 4P3CH 2Z31C 4YC2B 3C87A 4MJIE 1T2XA 5E2JA 1IFHL 3O3AB 3T2NH 3RWJA 1FRGL 4LPVA 4B5EA 1RUKH 4HAGA 5IB1B 3V6OE 1JWUA 1NJ9A 4KMQA 2BC4B 4GRLC 5MERA 3WDHA 3BEVA 1CFQB 1TMCB 3JV6B 4B50A 3D39B 4BFIA 1WLHA 2P7TA 4M43L 3FN0H 1QNZH 4PJEE 5FGBC 5T5NG 3PWPB 3TO2B 5IVXB 3HMWH 4UNUA 2AXFA 3MUZ1 5B8CA 1A6VL 2FH6A 2P43B 3H3PH 3SGKC 2ICWI 1EGJA 1W72B 2YD1A 1RK0B 2EEDA 4YDJB 1B2WH 4YK4C 4NKQB 4PTUA 1QPXA 5J1AB 1AE6L 3MODH 4KWUA 4LARH 5M95B 1BQSA 5BZWA 2B1HH 4Z8FH 1P9MA 1K85A 4G6MH 4BQ8A 1FVEA 2FWOB 1OQOA 1C7SA 2A6DB 3VXSA 4F2MB 5BRZB 3MRGA 43CAB 1QSEA 4K9EL 5GHWL 2OL3L 4OQTH 3CFCL 2WWMC 1AJ7H 3GRWL 4APQC 4B53A 1ZLUH 5D71L 1ZLVK 1I8IB 4IS6A 5LQBH 1SBSH 3LH2L 2CDEA 4UUJA 4HHAA 4BKLA 4N8CH 5GGSB 4HWNA 4NSKB 2OYPA 3KPLA 4JQVA 2ZSWA 4CADB 5J0BA 4UDUB 3RWDA 1G9NC 1Z6JT 1NFDE 1AR2A 3D9AL 5C0RH 3MRPB 1I85C 1RIUH 5GGVL 3HNTL 1WZKA 1MCPH 3W39A 4MAUL 2DWEB 5KTEH 5GRUL 4BQ9A 1HN1A 3SKJH 3RDTC 4P3DB 4U1HA 4WI7A 5L88H 4MDJA 3ZMRA 2FATH 4FQ2L 1JF6A 3QEHB 3CCHB 3C08H 2YD5A 5I71B 2VXQH 4LSSL 1Q0YH 1BZQK 1VFBA 5DRZA 2ZPKH 2KKQA 5EO9B 5DQDL 4QXGL 3RPKA 4JKLA 1E4XH 3O11A 3RY5A 2GITB 5C8JB 2BOBA 4U7KA 1XF2B 4UB0L 5JXEC 1D5ZA 4GQPH 1NCDL 2WUCH 5DHVA 2DKMA 4RBPK 4BZ2H 2XWBA 1FGVH 1AC6A 2OMBA 3ULUH 4RGNB 1ZLSL 1LO2L 5LKNA 5DJ6B 3UPRB 1F3DJ 1Y18A 4F7MB 5JW3H 3GBML 4IOIA 2ZSVA 5EZJB 2YA0A 2D4FA 4YHPA 3EYFB 4A6YA 2EYTA 3JWNC 4QNPF 4W68A 2A6IA 3MREA 5A16A 1Q0XL 4PJIA 1JUFB 1EO8L 3WXWH 4OCXL 5CP3H 3OJVC 4Q2ZB 2BMKB 3TIDA 4CADA 1ZE3C 4GRLA 4P2QE 2Q86B 3BH8A 4MA7L 3ECBA 4GJTB 4U1GB 1E4KC 1UEYA 1MFEL 4U49A 4O2FA 4XC1L 5CD5C 3HI1B 3ULVL 3U7YH 4G8GA 1XF3A 1EEYA 4M3KB 1CZ8L 2OLDA 3ARGB 1WFNA 4XMLH 5DHYB 3IFNL 1CS6A 1M1SA 4G3YL 5E2TH 3SGKA 2Y5TB 1DEEA 4HV8B 1D9KC 4P2RB 2VXQL 4JZJA 2Y36H 3GMMB 4HEPG 4WFFD 2H1PH 1TDQA 3RWCB 3WV0A 2YC1B 3QDGA 4XB8A 1HSAB 2DQUH 4YAQB 2FSEA 4R7NB 3RNKA 5JOFB 4YUEH 1IL1B 4XMKL 3T0XA 1UKTA 2VDQL 4R2GD 5D5ME 3K0WA 1UH2A 1S7WA 3JSSA 4FG6C 3UAJC 5TQ0H 2DWDA 4XWGL 1UXWA 3NZHH 4EUPH 2VIRA 4KROC 5H35B 3ARDC 2DTMH 4WUKH 4P46A 4LLWA 2XI9A 3TM6A 4HCRL 4FFZL 3K46A 3O6KL 2B1AL 1I9JL 2P7TB 3D18A 1JFQH 3WE6B 2V5TA 1NC2D 2UWEB 1JPST 1UB5A 1XR9B 4NO2B 5A2JH 1B3JA 1R3IH 4XNZB 5IB5B 1IAII 1CVSC 2B2XH 5F72S 1Q72H 1DBKL 4YBQC 4FNLH 1BX2A 1XR8A 4Q9CA 2CJUL 2IPTL 3OR6A 5C9KA 3K1DA 1CYGA 2BSSB 3DVIA 4I3RL 4ZO7A 3HC4H 2P5ED 4LLQB 3HNVH 2OR8A 5D1ZA 1BM3H 3HG1D 5GS1C 3BN9D 5KSBA 3GSOB 4JO2H 2OTWA 2AJVL 4NQED 2VXUH 1AHWB 2DL2A 5F1SA 4KXZH 2HKHH 4OF7A 1EZVY 1IFHH 4OSUH 4MHHI 4YGAB 5EU3B 1D6EB 4LSRL 2YPVH 1IE5A 4IDJH 3GI9L 3MGTB 2HKFL 3DX7B 3J7HA 1I3GH 1B6UA 1IGIH 5GIRA 1IAIL 1J1PH 2A9NH 3MMEB 4L8SC 3W2DL 5HVGB 4KV5F 2WLZA 3NZ8A 4EDXB 1CXLA 1NCWL 4Z7QE 4K3GA 4KKBC 1KIRA 2ILLA 4DN3L 4AT6A 3BP6A 1OARL 1N6UA 1A7NL 5C0EB 3DVNA 1HHHB 2D4DA 1Q94B 1YNTA 4LL9A 4KK6D 3NIFE 1DN0B 3G6DL 2DQTL 4GBXA 4L4VE 3P4MB 5DEFA 4HT1L 3GSXB 3KNBA 2J12B 1KIQB 4OIBA 1S9YB 1CK0H 3CXHJ 1QVOB 3B4NA 4MQ7B 3VMPA 4WFFE 1ZHLA 1NFKA 1GOHA 1J0JA 2DQIH 4U33A 3SJVB 3CFBA 5F7KC 5DMYA 5KBNC 4H8WH 4Z7VA 4RAVA 5EO9A 3QP3A 4Y4HD 5F89B 3T0VA 3G08B 3TO4B 5DWUH 5HYJE 4IRZH 4C55A 2E7LC 3GO1H 5HYQB 4LAJH 1CG9A 1YNLL 5BW7C 1MRDH 5JZ7C 4KK9C 5L2KE 5J1SC 2EKSB 3QXVA 5IHUH 5DHVB 1P4BL 3QIUB 1D5IL 4XZUB 1IGYB 1WIOA 5M7QA 3C60A 1O5DT 5KW9L 3NIDE 1T83C 3BD3A 1FG2B 5E5MA 4JFDA 4XMPL 5IB3B 5HVHB 4PJHF 5D70L 4LEXH 3OJMB 5C71A 3KYMB 3B8YA 4PV8A 1OT1A 2J1KA 2Q87A 1P4BH 1U95A 5HGDB 5AYQA 4HWUA 2GSIA 1I4FA 4C56B 2IEPA 4A6YB 3OGCB 3KLHC 3WIHA 3DX8A 3FL7A 4GAJL 2D0FA 4ZSOE 1A7OH 4D0DA 1KB5H 1N2RB 3OKMA 5EBLA 3VFWB 2NQCA 1UQSB 4HJJL 4ZAKC 3RY6A 2UUDH 1SY6L 3ZSSA 3ETBF 2FX8L 3KLDA 3T4YA 4FQHA 4GH7B 5KSAD 4MJIB 3TBVA 3PG2A 4RIRB 3RPIA 5CLWA 1MFEH 4XPFL 5TE4L 5FCSH 4I3SL 4JGJA 4WO4D 4G6AC 2RAMA 5IG7A 4L4TA 4NWTH 4P2QD 4JRYE 5LQBL 1T03L 5T1KA 1FYTD 2XZQH 4XBEL 2L4OA 4PLNC 3OAYK 1JGVL 4XNQB 1HXYA 3B6SA 1A6TB 3P3YA 1IQDB 2R8SL 4K7PL 1KPVB 4KK5C 5CSZA 5F7MC 5LGHH 4PGDB 1DSFL 4WTWA 4HS8L 2ZKHL 4E9LA 4K55A 4CW1A 3WUWA 1DTUA 2ZP0T 5FOBB 4HH8A 2N56A 3CH1A 3VD7A 2GTZB 2CMRL 3WL9A 3RWFB 1ZLWH 5HGAA 3QQ3A 4JFFD 1MWAL 3BI9X 4N90D 3UTZA 4L4TD 3RVXD 4K3DH 2XIDA 4LHUA 3F8UB 2AJSL 4YLQT 3SCMC 3VDBA 4LVEA 4ZTOH 3WS6C 3PABB 3LKRA 3LDBC 3B2UC 4FQXD 3OXRB 4UIMA 1OAKH 1QLFB 2XT1B 5GZNC 3VH8B 5KS9B 4NNXB 3MV9B 3H42L 4R8WL 2YPKB 1J8KA 4NYLB 3STBA 2UWEE 3QEQB 1Q38A 4LCYA 3IDIA 1BM3L 3VXOB 4XP1L 5IGXH 2AGJL 3BO8B 2V5YA 4RMSA 5F88B 4OZGB 5B3NA 4WWKA 3T77B 1FV1A 5D1ZB 4DZ8A 4GKSA 2NY6D 4KJPC 1CE1H 4XP5L 4HUKB 4YX2H 1X6NA 1FVDA 5H37G 4WW1B 4JLRB 3GMRB 3QUML 2ZWLT 4JVWA 1FLRH 2VN7A 3PDDA 3LRGA 5T1LA 3LQAC 1C1EL 1EXUB 5EC2B 5D5MB 3AXLB 5JORB 4OI9A 1FVEB 2IALA 2P5WD 4DEPB 1MI5A 3FONB 2BJMH 4PRHA 1K4CB 2DIBA 4L5FL 5IK3B 5J8OA 4MNHB 1U41A 3V8OA 4LLDB 1HKLL 4JPWH 4LNVA 4F7PA 2V17L 2ESVD 2FBJH 2X1QA 2VUYA 4PJEB 2XKNA 4QHNA 4PGJA 1KTLA 2NXYD 3CD4A 4Q9QH 3EIFA 4JJ5B 1S5HB 2FBOJ 3AS3A 3BPOC 2EH7L 3EDKA 1MOEA 4MJID 3Q2CA 1NCUA 1B4JH 3BP5B 1LNUB 2Y36L 3KYOB 1TJHH 4QF1B 3OKEA 4RQQB 5IROC 5F9JA 4KDTA 1XEDA 4JCMA 2FR4A 3MTRA 4NRYB 1A3QA 5J6GA 1FZKB 2VQUA 4DW2H 2IBZY 2VB5A 5AAMA 1TVBA 2J8UB 4UOW1 2I9TB 5EU4B 5DJZB 3HE6B 5GJSH 5HHOB 2QBWA 4MCYA 2WZPD 3EGSB 4KI5C 4DCQA 5EB9A 1MQ8A 4Y8AA 3SE8L 5J9PA 2EDXA 4HKJA 2ENSA 4PJCB 1UGNA 4MB3A 4C4KO 3WKML 5I1JL 5KSBE 3DRQB 1BAFL 3IAQA 2ZNXA 1NMCB 2HT3D 4QOKE 2MQ0A 4GMSH 4MD4B 1BBDL 2ZUYA 4WI9A 2IBZX 4LLUA 4N1CA 5DUML 4GRWE 3R0MA 5HYSB 1DE4A 2A9ML 1QLEL 4JKPL 5ALBH 4NDMA 1S7TB 5K59E 3U9UA 2W0PA 1EXUA 5EC2A 4RAUA 1SJXA 2GAZA 2OJZH 1WVZA 3HI6H 3TCLA 4NP4L 4TPRH 4PYGA 4YXLL 3HMWL 3IFNH 1ZSDB 3QIWC 5IMKA 4F9LC 1A9EB 3RZCA 5I1DB 1QA9A 4MD0B 4Y16D 3V7AE 1F11A 4I18B 3MYZA 4ZUTB 1VACB 2IH3A 2CDEB 1AXSB 4Q2ZA 3MRHA 2DQEL 3KYNB 4LU5H 1VGKA 3D0VB 1RFDL 2R0ZL 4QKXB 4G43B 4HIEB 5E8PB 3ARDD 3FQXA 1OSPH 3S96A 4Y2OA 1QLRB 1PKQA 4X98B 5F9JB 5EOCL 1ZA3B 3KWWB 2CK0H 3O9WA 5SWSA 3SO3C 1V05A 3O2DH 3HS0A 3BYTA 1YEIH 5E8EA 5JOPD 5ACMA 2Y07L 1DFBH 3SDXF 2P44B 3OB0K 3UJJH 5DQJA 1SJHB 3OV6A 5JQ6H 1U92A 2R2HA 4KJYA 4OD3H 2QSTA 1Q72L 5I1IL 4HPYL 3I2CL 5FO7B 1DUZB 2WM0A 3TP4A 3EJYD 4AIZB 4PGEA 5I2IA 4WI3A 1DBJL 4V2CB 2K7QA 1MWAH 2GITA 1D5BA 3BN9C