4BQCA

Crystal structure of the fn5 and fn6 domains of neo1 bound to sos
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
203
structure length
197
Chain Sequence
TGTPMMPPVGVQASILSHDTIRITWADNSLTDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords NEOGENIN
publication title Structure of the Repulsive Guidance Molecule (Rgm)-Neogenin Signaling Hub
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 197
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bqcA02
5LWYL 1D9KC 4FFWD 4UIMB 2AEPL 4IOIB 3D9AH 4LLDB 1ADQL 3REVB 1LO5B 5H8DA 2MSPA 3IYLW 3MRFA 1FNFA 1WC7A 3QCUH 4JM2D 4NQDB 2O5ZH 3MC0A 5B3JE 1AKJD 5DJXB 3I6LE 6CGTA 1L6XA 4MAUH 3DTXB 4OLZL 1DUYA 1ERNA 7FABL 4Y4HD 2IQAB 4GKOA 3MNVB 5IW3A 2X4PB 2FEDC 1F6AA 4KTDL 4NUJA 1JYVA 1IQWH 5GSRB 1JK8A 3MV7B 1QLFB 4LSPL 1TQCC 4KJPD 3AXLA 4M8VA 3G5VB 5JOFB 2YUZA 2B0SL 4FXGA 1RK1B 1T21B 5DUBB 3PV6A 1AQDB 1CFTA 1D5ZA 5FA3B 1GZPA 1PGRB 1H3PH 1UYWL 3WFHA 3QUYD 5E0QA 5AD0A 3G6AB 1KIPA 3T2OA 4PGJA 3TESA 4XHJC 1NFDB 4TPRL 5DDHA 3OB0K 1YN6B 1HEZA 4EUPG 2IAND 1G9NH 3GMLA 3QFDA 4NCDA 5EOQL 2KH2B 3MOAH 2D3VA 1CXFA 4KK8C 1HH6B 3LKOB 3FT4B 4CN6A 4X6BA 4QNPE 3RNKA 5AZEH 4H5SA 3X14B 5FOBB 5KSBB 4UDUB 3IJSB 5HI3C 1FO0A 3DVGA 4X8XA 1MFDH 2NY5H 3BH9A 4M48H 2R56H 4YFEA 3W0WE 1QRND 1CGWA 2DLIA 1CGSH 3E3QE 3VFUB 5GS2D 1T1WA 5KSAD 3QWRD 3T4AA 1H8NA 2DLEA 3AS0A 4HK0B 4FQPA 2FWOA 5E8EA 4HX1B 3BVNB 3TT3L 3B2VH 1BBJA 3PL6D 3DV4B 4FQXA 3W9EB 4E0RA 1CFNB 4MS8D 2YPLE 2D31B 3LKQB 5I17A 2O61A 1A64A 2GTZB 3JVGA 3QRFM 3PQYA 2FHBA 2CXGA 3P9LB 4YX2H 3L95B 3CDCA 6FABL 4LKXA 1GGBH 4OSUL 3QUKB 3HE7D 1NH6A 3V4UL 3DI2B 2VKWA 3VFOA 1MQKH 2W9LA 3AROA 1KBGH 2Y36L 1FIEA 4GRLD 3SE9H 1G6VK 4YHIB 2XKNB 5IBTL 2VQUA 1UB5A 3QXWA 1U0QA 1MRFL 4KK5D 2GSGB 4P2QE 3OJVC 3C08L 4AENB 3V5HB 3EFDL 3AU1B 4FNLH 4G7VL 4GBXC 1JZ5A 1WCBA 5EZOL 3P9MB 5B8CB 4LRNH 3D48R 4Q6IB 3IT8D 2FX7L 2PYEE 1JNLH 4PTUB 1MHCB 3TVMD 1ZA6A 4WDIA 4DUVA 3SGKC 4OCXH 1OTSD 1WAAF 2MMXA 1D6VH 4X9IA 4MX7A 2E6PA 4MWFB 4XNZB 2EDOA 4KMTH 1R5WA 5E94A 2FGWH 5MHSE 1P1ZB 4K8RC 1P5VA 4Z7UF 2QLVB 5MEPA 3GSVA 1DLFH 3VI3E 4XZUA 2AJVL 4MJID 1BFSA 3VGGA 3PGCA 3PWUA 1KENH 3QCTL 1KC5H 1U91A 4IDJL 1R3IH 5ADOL 4NRXA 1MAKA 3MZTA 4XRCB 3MPCA 4GG8B 2PYFB 2R2BB 4RDQG 1YNTB 4DKFL 4OIIH 1C5BH 3T0XA 5ILTH 1EHLH 3GSNA 4CL7A 3V6OC 5C07E 1U58B 3GSQB 1EVUA 4JZJA 3UZQA 1FDLH 3FAWA 2DRUA 2XFXB 1CYGA 4LCWE 4IOIA 1WIPA 2Q20A 1LO5A 4OLVL 2AI0H 4LAQH 1T20B 1XF1A 4NQDA 2C1PB 3CU1A 3B43A 2GJ6A 2GSIA 2BY2A 3RPIB 4RAVB 5SX4I 1DZBA 1CE1L 3RFZC 4M4RA 1FGNH 3LKSA 2CXKA 5DVNA 2YEZB 2IQAA 3MNVA 1F4HA 5HHME 3KYKH 3OAUL 2QSCH 3FZUC 3Q5TA 3QCVH 4WY7L 5T1LB 4JHAH 5HPOA 5GSRA 1PZUB 5BVJB 8CGTA 5I1EH 1B4JL 5IVXE 3W0WB 4IIQA 3TBTB 1GIGH 4OKDA 4IEFB 1MEXH 1TETL 4U1SA 4PFEA 1RK1A 4Y4KC 1T21A 4CU6A 2HH0H 3VW3H 4CJ0A 4DWHA 4OZGB 2A6KA 2XXCB 3O3EB 4P9ML 3D0VA 3EYQC 2BRQA 1RJYA 1DQDH 3QUML 3CFBA 5EOTA 4JRXE 5E6ZA 5GS3A 5C8JA 3TT1H 2J2ZA 4PJ5D 5K9KB 3IKKA 1YN6A 2AEIT 1N8ZB 5JUEH 1TJHL 4ORZC 4FZ8H 1TCRA 1PYWB 1IQDB 1TZHA 3DX8B 2A6JB 3L5XL 3QAZC 1AE6H 3RY6A 1GOFA 3LKOA 4YC2B 2NQCA 5ID1A 5C7XH 1G9MC 3X14A 3H9HB 5FOBA 4BH8A 5D7JA 1YEHL 5KSBA 4UDUA 3WEXA 4KKLC 3IDNA 1ZLVK 2O93L 2CMRH 4P2QB 1VEMA 1SJEB 2I5YL 1A22B 1Y6NR 2MNUA 3VRJB 3QDHA 1U8QB 2D7OA 2VUOA 1FFOA 3W11D 3VFUA 4WUUE 4KQ3H 2PYEB 2X9WA 5E6IB 3HNSH 3QPQC 4HK0A 2VLKB 2BVPB 3HCVA 3VFTB 2RQ8A 4UBDD 4KHXH 3BVNA 5IW6B 4N0CD 2NY4B 3PWPA 5D5MB 3UTSA 4ESKA 1HWHB 3MRJA 4GOSA 1XR9B 4M7ZB 5F89A 2KKQA 3L95A 2R0WL 4MNHA 1SYSA 1X5GA 2KZ1B 2G60L 4F8TA 1S78D 4WI7A 1UC6A 1HH9A 3NH7H 4CJ1A 3TBVB 1X7QB 3BP7A 4KI5F 1I8KB 2W9EL 1FN4B 1QHPA 4U1NB 4P23A 5C0DB 5C0AD 5C07B 5FF6B 1VENA 3CLFH 5EU5A 4LCWB 1SMOA 3A6OA 4N1EA 3QIBB 3P9MA 2DQCL 3D2UB 3DXAE 5C3LD 2DQJH 4PTUA 4R97B 4ZUTB 4X8JA 3E8UL 5HHMB 4RDQF 4FQXD 4OLXL 1BF8A 5JA9A 3WDIA 4NPYB 1JF6A 2JJSA 4JFDA 1Z9MA 1MIML 5I73B 3PQYD 2R4SH 3TZVB 3NBNA 1E4XI 1T04B 3UPRB 3LD8B 4PJDF 4EJ1C 2ZKHL 4WV1A 1JWMB 1UCBH 4Q58C 4EUPA 4Y4FA 4P46C 3HC0A 3MA7B 4PRNB 1T03H 4NO2B 3EJZD 3LN5A 4LVHC 1DCLA 4JRXB 1BVKB 5JMRA 5GHWH 1A1NB 4Q9QL 2QQQA 3QO0B 1S7RB 5TF1L 4DQOH 2DQHH 4XNMB 4KZDL 4JKKA 5IG7B 3HB3C 2C1PA 3L7FA 4Z9KB 5D2NE 4RAVA 3A6CH 1MI5E 3QUMA 4OD1H 4NQUA 2X4NA 1GL4B 2YEZA 5EC2B 4JPIB 4JM4L 3WJJC 1JGLL 2R4RH 3MREA 5CEZE 1HN1A 5EU3A 5E6YA 2COQA 5HYSA 4CMMB 3WXVL 3CZJA 4ZOBA 3QG6B 1ZVYA 3VE0B 5HDLA 4I9WE 4RMVA 2R0KH 5FYLE 2GYSA 3MUHL 3O3EA 5DJYB 3K2UH 3BIKA 2OP4L 4OM0L 4JN2B 4NQSA 1CICC 1OTUD 1F3JA 4CU8A 4IHOA 4POZC 1A6TB 2P8PA 4JKMA 3MCLL 2YPLA 5IK3A 1N8ZA 4NNXB 1MCIA 1WT5C 5HGAA 3UCRA 1FIGH 4AL8H 1BEYL 2GJ6D 2IPUK 1A3QA 3NZ8A 4U3HA 3LEYL 4XCEA 3FO0H 3K4DA 4HEME 5LG1A 4TTDC 3DX9B 4BZ1H 3LEVL 1HQRB 4NJAH 4KDTA 2EC9U 2X7LA 4P2RE 3EOAB 3KR3L 3O4LA 4KXZI 4PIRF 4K3HA 4R6UA 4ONGH 1U42A 1SJEA 1JBJA 4J8RB 4FQIH 3B9KB 3LQAL 1A6VL 3STZA 5DQDH 1N2RB 3MXWH 2R0ZH 1BFVH 4G6KL 3SKMA 4I13B 3V5DB 3DXAB 4O4YH 4YZFF 4JG1L 3ES6B 5DJDA 4LK4A 4HFUL 2FD6L 3UYRL 3HKFA 3U7YH 3C6LA 3PWJA 5ESQA 2AK4E 5IW6A 1X3DA 2CH8A 4NYLB 3HR6A 1RUQL 1JHTB 4G6FD 3VGAB 4AY0A 2BOCA 1N7MH 1RURH 1XR9A 1AXTL 1M7IA 2UVFA 4JG0H 1S7WB 2NY7H 1IC7L 1YY9C 2AEWA 1P4IH 2HP4A 5HDQL 5D7JD 1X7QA 1I8KA 4PJGF 2X09A 5F7EL 4MVBD 3OJ2C 4JY5H 4U6VH 1ZA3B 2H1PL 4QY8A 5C07A 2D7MA 5FF6A 5GGTH 5E00A 1FP5A 4GRWE 4E42A 3B5TA 1RZ8A 1K2DB 4GMTL 3U4EA 1KTDA 3D2UA 5E2UH 2OTUB 5HGHB 2JELH 1CE6A 3ZHDA 3PJSB 1MI5B 3UTTA 4YHNB 4ZUTA 1J05A 4KRNA 3SKNB 3DMMB 2NY2B 3PWPD 3OKNA 3LS5L 3VDCA 4NPYA 3UTSD 3ULUC 2IPTH 2A0LC 3GK8L 4X4ZA 3BHBB 4BQCA 4G3YL 5IVXA 5JO5B 4DN3L 3MMEB 5E2TL 4R0LC 4HUWA 3MNZA 1QFWI 1FFNB 2D7NA 2Y6SD 2ZSVA 3UPRA 1U8KB 4HIIB 3T4YB 1N59B 1NJ9B 1LDPH 1IKNC 3O6LL 3R06B 4OLUL 4OCSL 2JB6B 3LZFL 1IC4L 1A1OB 1J10A 4P23D 3RWJB 2J4WH 4LSQH 1EEQA 3ZYIA 4KI5C 4HIXH 3L9RA 3ZMRA 3G6JF 1A1NA 1RUAH 1U3YA 4ZO6A 2IH1B 1JF1A 4HUUB 3ZL4H 1OPGH 1INDH 3I50H 3V9FA 2CRIA 3IFPB 4HK3N 4ZFZA 1U3HB 5E8OB 1U2HA 3VGEA 2UZIH 3VRLE 5JW3L 3MRBB 5E8DH 4M6AA 3I3DA 2JIXB 5FYLL 5EC2A 3TN0A 4ALAH 5C0JB 3NPZB 4ZFGL 4JFDD 4KVCH 5A16B 1EZVX 4YDLB 2DKSA 3QRGH 4CMMA 4HW6A 1MWAB 1UJTA 1X6NA 2WZPD 3NABH 4C4KT 4X4YB 3KYOB 4ZUSB 3GNML 4M7KL 4L9LC 2ZOKA 4LPUA 1N5YL 4WUUA 3QQNA 1KV3A 2VDOL 4Y4FD 3RKDC 4HC1H 1B4RA 1IAIL 3WUWB 2VXQH 2WIMA 4U6YB 4I0KA 4QT5B 4K3EH 5DJYA 4ZAKD 4B41A 3PP4H 3CXHJ 4UNUA 2AK4B 4M6ML 1E27B 4MD4A 4ORGB 5CJOH 2AJ3A 5DC4B 4TQEL 1X6LA 3SE4C 1S3KH 1QBMH 3P4LA 1NCCH 4GXVH 3VXSE 1V7ML 5MERB 3V0AC 1J8HD 1WBYA 3HI1A 2B1AH 4IMKC 3RY5A 2R9HD 2PO6D 4W81A 5B39B 4NT6B 3HAEG 1KCSL 3MFFA 1DBBH 4J1UB 1A0QH 4MD5B 5F1SA 2ZPKL 4MQTB 3IDMA 1MPAL 3SDAA 2OMBA 3EOAA 1CIUA 3NACL 5TDPB 4QRQB 4APQC 4YHYC 2FX9L 3BIBX 5I15H 3ZE1F 1T7ZA 1F4WL 4GRWB 4ZS6D 1MRDL 2CLZA 2JKXA 2ZCHL 2BDNL 3KPSE 5HYEA 1CXIA 1KLFA 4PJ9B 4PJXB 3DXAA 3M8OH 2XG4A 3WFDL 3ES6A 3O3AB 4X0KB 3NIGF 5JHLH 1S9VB 4A6YL 1DANT 3PHQB 4JDZB 1JGEA 2EEAA 4O58L 3EYOB 2PN5A 3LPFA 1AFVH 2YPLD 4JGJA 4QHLA 3S8WA 4NYLA 4XVJL 4OUUB 4FQQB 4IRJC 1ZGLM 1FV1B 3EYFA 4FQCL 1B88A 1CDYA 1F00I 3GSOB 1JFQL 1DUZB 1Q94B 4C58B 1DDHA 3VFWA 3I75B 2VSDA 3HZKB 3ABZA 2V7HB 3NA9L 3WE6B 4GKSB 4HXBL 5C0EB 2QQLH 3VWJC 3O4LD 2XA8H 5C2BL 2VITA 5LJYH 1MAMH 2LU4A 1PW3A 3L7EA 4UU9A 5JR1L 3QEHA 3RKPA 3EGSB 5F70A 2FX8L 3TNNB 3ARXA 3DNKA 1F2XK 1GC1C 1BJ1H 2EDYA 4KKAD 2W92A 2CLRA 5DUML 5ACZA 3CSYB 1Z5LA 3L1OH 3ZDZE 1K2DA 1CGTA 4NFDA 4RAUB 3VH8A 5FHBH 1A7QH 5D2NA 5KS9E 4YEFA 1JL8A 4NSKB 3C6LD 3EOBB 3VA2C 1MI5A 4YHNA 4RIRA 3T65A 5I6XB 2N7AA 1CGVA 1G6RB 4CKVX 2GQHA 3F5WA 5B3NA 4R8WL 3O3BA 1OM3H 3IFNH 4FFVC 3I3EA 5ADPH 4DTGH 5DEZA 4WJ5B 2PCPA 5ITFB 3BHBA 5D1XC 5JO5A 3MMEA 1EAJA 3EAKA 3HZYB 4DK3A 4UOJA 3K46A 3WS3B 4IS6A 4PJ8D 1FFNA 1K5NB 1KTLA 1WIUA 1TPXB 1JPFB 3SDCB 2I07B 1JE6A 3BT2L 4MAYB 2CK0H 4GXUM 1MVUB 1JI1A 3RWJA 1RUKH 3MBXH 2A1WH 1R3KA 5E8NB 3BEVA 4UIKL 4OZIA 2IH1A 5CP3H 5BO1L 4EVNA 2IAMB 3VXSB 4JFQB 5IFHL 1E0OB 5K9OB 1D9KB 4WO4D 3UTTD 2IPUG 1OSPL 1CXKA 4I2XE 3M17B 1Q9WB 3UYOD 1XT5A 3GSUB 4XNYH 2BERA 2ERJC 4P2RA 5FK9B 1A6UL 4KMLB 4RFOL 4HBQA 1U8HB 5DD0L 4MNGE 1RJCA 4GW1B 4N0UE 1A6WL 3N50A 3K8MA 4OD3H 1MWAA 3JUYA 3KYOA 1TQCB 5CD5D 4U0QB 2QV2A 4M03A 4PJFF 4WHTB 5DD3H 1GH7A 1VADB 3MLSL 1TTFA 5CAYB 3MQIA 2DB8A 5FYKH 4N90E 1YMMD 2FB4L 3O0RH 1GGCH 1L0YA 5EC1B 3LEXB 2QSVA 2DI9A 4HIHB 5GGUA 3V6OE 1J11A 2O5XL 1H15B 2F53E 5FM5M 2FATL 1RVFL 4F33B 5B39A 1Z3GH 4A6YA 4K94H 4MCZB 4CAGA 2AJYL 1WWCA 3TN0D 5CBAB 4PB9H 4G6AD 4BELD 4J1UA 1BZ7A 3I2CL 3FQNB 5F7YC 3UTPD 2DLFH 1KELH 4QRQA 2VDLH 3FT3B 4EIZC 4OGAC 2O5ZL 1Z2KA 2B1HL 1ORQB 2IBZX 5K9QI 3EOTL 1EVTC 5C0IA 4CRPA 4KHTH 1NGPH 1OT2A 4LCIH 4MAUL 4WUUD 4QKXB 1AD9A 2P5EA 2D4FA 1RZ7H 3S97C 3ARDD 5KS9B 4CNIA 2ATKB 2R29L 4Y5YC 4EQ2A 1IQWL 5MENA 4EI5A 4PV9A 4JDZA 3CMOL 4RA3A 3PWNB 3KGRA 5E1AB 4RZCA 1HIML 4OUUA 2EYTA 3UTQB 5FO9B 5DXWA 5D70H 5E7BA 2Y9RT 2JK5B 1H3PL 3RP1A 2CJUH 2NPLX 2J3SA 2WUBH 3BP4A 3HZKA 1FVDA 1CDJA 3I75A 3T0EC 3TJEH 5IHZB 5LGHH 3P30H 4P9HL 4XMKH 3SDDA 4L4VA 2VISB 1U8NB 3SDAD 1KNOA 3SQOH 2OSLB 4Z7NF 2ORBH 1BZQK 3D18B 5FB8B 3MOAL 1YJDH 5KANI 1WFNA 2WBJC 3RVUD 3CSYA 3O6KL 2XV6B 4RAUA 4OFVA 2DIAA 4GBXB 4K9EH 2BRRH 2VUYA 3MV01 3PWLB 3IDYC 3WO3B 1LEGB 2H2SD 4LLUA 4ONOA 1GZQB 1XZ0B 4KQ4L 2Q7YA 1MFDL 1G6RA 2CO6B 2R56L 4IM8A 3BUYA 4K3JL 2P43B 5BZWB 4MQ7B 4MNGB 2HT3D 5DMGD 1CGSL 1XCTB 3JZ7A 4N0UB 1KT2A 3QNYB 1WQVT 2H9GA 3QIWD 4X7FC 4LGRB 5EOCJ 1DEDA 2H2PD 2P47B 3VXUE 4KMQA 3P11L 5BS0E 5HI4D 4X80H 2I07A 2XZQH 3PWVA 1CR9H 1MVUA 4OBRA 1GRWA 1CD1A 3QQ3A 3RZCC 3NIFE 1OP9A 5FA4B 1HXYA 1L7TH 4ZYKA 2NY0C 1J0YA 3EYSL 4F3FB 2IAMA 1EO7A 4F57L 4JFQA 1AP2B 1MQKL 1J87A 2CPCA 2F53B 5LGJB 1KIQB 5F21B 5IFAH 4PJAF 3ARYA 3QXTA 2AXJA 4L4TE 4OQTL 1NC2D 5I8KH 4AIZB 5MEOB 3C60A 1Q9WA 5I74C 3FQXA 3GSUA 1WWWX 5MEQA 2XQBL 1X5XA 5DLML 1FNEB 4ZQKA 5EUKB 5CWSB 1U8HA 3WN5A 5I2IB 3OAZH 4LRNL 1ZLSH 3KPOA 2J6EH 4P59L 1CFQA 3QDJD 2JTDA 5D2LF 4LSVH 1JNLL 3KPSA 1MHPL 3UTZA 2WQRA 4OCXL 5FYLD 4R96A 2DAVA 1J1PH 1YC7A 1D6VL 3Q3GB 3WFBL 1FGVL 3SDXF 1A4JB 1LGVA 5HHVH 1AIFB 5DJZB 3T2NH 5C9KA 2FGWL 3DRTB 5FYJE 2XXMB 3NCFB 3Q2CA 3IJHB 3F6LA 3UJTH 2AJZA 1UM4H 5CMAB 2VH5H 1A7RH 4HIHA 3BKYH 4JKLA 4NRYA 1KC5L 3WIHH 3B3IB 4R9HA 4MJ5B 3GHEL 1LO3H 4OIIL 5JMOC 4MCZA 5ILTL 5CBAA 4P2RD 4QRPE 1MCFA 3QAZB 4H1LA 4FZEL 3FQNA 1W72A 4Y1AA 4Q6YA 5IGXH 3VGBA 4HUMB 4N0RA 3FT3A 4G8GE 2AI0L 5DRNA 1A14H 2B2XH 5DK0A 4XAWL 4Q2ZB 3ARFD 1CLYH 1NEZB 4LQFL 3UBXB 4YBLC 1FGNL 3QWQB 2YUVA 3H9YA 4M3KB 2QSCL 4LVOC 2ATKA 4HXAH 3LIZL 1LP9F 3QCVL 2WWMC 1IM9B 2V2XA 4Z7UE 1YYLL 1M05A 3PWNA 4YLQT 1G7IB 2H32B 1MEXL 1AR1D 1BD2E 4DZ8B 2HJKA 2VOTA 2VZOA 4XP9L 3VW3L 1QP1A 1J5OL 4GW4B 5BQ7B 3VXUB 2JK5A 1MH5A 1CD8A 3F6IA 3EDFA 5KVMC 3SOBH 3WNPA 5DHVA 1MSPA 3TIDA 1IAKB 3RWDB 2AQ2A 4JANA 4NDMB 5JUEL 3B9VA 4PGCB 4ERSL 4P49A 5J6HB 5EDXA 4UTBL 3D18A 5AUMB 5FB8A 4TULL 1RMFH 3R0NA 4TSBH 1Q0YH 5HXMA 2D0FA 2P5ED 1QLEH 4JCLA 2QQKH 1EH9A 3MRNA 2EXYC 4GBXA 1XIWA 4L4TB 1MREH 5D8JH 2CDEB 3PWLA 4LEXH 1U3JA 5MEND 1LEGA 4I2XA 3BD5A 4EI5D 1WVZA 5C09B 1XZ0A 1YEKH 4M93C 2VNCA 5EO0B 1M71A 1OGTA 2EZ0D 3QDGA 3S37H 1XH3B 3SGKA 4OF3A 1P9MC 5EBLA 1BX2A 1XCTA 5GJSL 4N0UA 3ZKSD 3C5ZA 4L8BA 4KQ3L 4XI5D 3JV4B 5CIPB 3HNSL 4OQTA 2G5BB 2F54D 4LPXA 4L4VD 3U79A 4O2FB 3L5WA 1KCVH 3C8HA 3DOSA 4L5FH 5BZDB 4Z95L 2PF6A 1VFBB 2YK1H 3ARBC 2R0LH 5FGCE 3U36A 1KJ3H 3JV5A 4WRLA 4P46B 5FA4A 4C57C 4GQ9L 2X4QA 3OKLA 1FJ1B 2EDXA 4MMZC 4BSVB 4LVHB 1AGEB 3V6OA 4F58L 2XY1A 5GZND 1G9NC 5DS8B 2NY1D 2VLJA 1EFXA 2YZ1A 3LMJH 4JO3H 4WI6A 2APFA 3U48A 4JFEE 5GQBA 4R4FH 1IFHH 4OJFH 5DQJA 4QRPB 5ANME 4JGUA 3MXVH 3CLFL 1MNUH 4P4KA 3AC0A 1T1YA 3DVNA 3MRIB 3UJIH 3RWGA 1K8DB 2P45B 1FZOA 3BQUC 4G8GB 3NCJH 1QFWM 3W82A 1WBZB 1I7RB 2F8XC 3ULUE 5CILH 4WCYH 5B21A 2DQJL 3ULSA 2HJLA 4M6OH 5B4MC 5CZVH 1V5JA 5I16B 4XPBH 2XWBA 5T3ZH 5DF0A 3ZDYE 1FPTH 4XCFH 4Y4KA 1A4JA 4HCRL 4Z7UB 5LXGH 4UT7L 2HRPL 4OF7A 2GFBB 3DRTA 4M1CC 1OAYH 1YQVH 1QD0A 4R2GC 2Y23A 4RGNC 5B38B 5C92A 5CMAA 1MRCL 3ESVF 4H26A 3HA0A 4NJ9L 4PG2A 4PJEE 5BMFH 2X42A 3ECBB 1UCBL 4UDTB 5JW5B 1M4KA 1F11B 4I3SL 1FNLA 4U7KA 4N1CA 4GMSL 5D7SH 3C60D 4OM1H 4LLWB 3L3DA 3H9SE 4HMDA 2DMKA 1MFAL 4UT6H 2C4XA 5HTSA 5GS1A 1BQLL 3QNZB 4HK3J 4AYFA 4BFGA 4U6HA 5DUPH 4S1QL 1AGCB 3KPSD 4Q2ZA 2MPAH 1NEZA 3P4OA 3B9DA 2WINB 3UBXA 4PUBL 3I6KA 5IHUH 4I77L 4Y2DC 2UWEA 3THMH 2R4RL 2EC9T 4RQQB 2GAZB 4G7YL 4YDJA 1IM9A 4G8FB 3OKDB 1AGBB 4XNUH 4G6ML 3RVWC 4PJDE 2PXYA 2BSED 3S9DB 4M9PA 3UZEA 5E2VL 3VFSA 1ITCA 2AK1H 2IALA 2R0KL 1NKOA 4PGEA 3IB4A 4MA7L 3WLBB 4YHKH 3HNTH 5LGKA 1WF5A 3K2UL 1J86A 3QR2A 3RAJH 2C26A 5BS0A 3G5YB 4Z18A 4X5XB 4WU5B 3RWDA 5CSZB 3L3HB 4OGXH 5IEKB 1Q8MA 3LN4B 4NDMA 4Y1AD 3VFMB 4HF5H 1W0WA 4QYOA 5DWUL 1KB5H 4O9HH 1AO7E 1U8OA 2Y06H 2EDBA 3QUXD 4HPOH 2NXZD 3MUJA 3RDTC 3SPVB 4QTIH 3QXUA 4HMEA 3ULVH 4XCYA 4YXKH 4KRPC 4GJTB 1S5IH 1I4FB 4QHUA 4ODUA 4JFEB 4JAMA 4MXQD 1RIUH 2MHAB 3NTCH 3FQRA 3U46B 3CZFA 4FQIL 5GRJL 1NDGB 3KJ6H 3QI9D 5JDJA 3MXWL 4QWWD 1SMAA 2R0ZL 2DWEB 1I3RB 1ZV5A 1WBXA 2HG5A 2DYPD 4WGWB 1HILA 1L7IH 1OAUL 3U7WH 2G5BA 1JHKH 4AEIH 2D0GA 4B7IA 1CDUA 4FXLA 3MODH 4WI9A 4QF1B 3MTRA 1L4IA 2W07A 1VACB 1CG9A 3MCKB 1T6WA 3HTLX 4P46A 4FQJH 2EDTA 4HWZA 3ISWA 1T0NB 2EH8H 4BSVA 3KVQA 2LAAA 2NXYC 4PJEB 1EEYA 1OGAA 1P4IL 1XIWD 2E7LC 1JYXA 4XPTL 4FFZL 4RMSA 4ENEC 4HCRA 1P4LB 3TCXA 3H9SB 1KJMB 4WW2A 2R8SH 5GGTL 3QDGD 4MB3A 2JE8A 1RIVL 4FXKA 4YZFE 1K8DA 3C5ZD 2XN9E 2C9AA 4M1DL 2Z4QB 1FNGA 1ORSA 2BCKB 4G8GA 2HAZA 1XF2A 1QVOB 2JELL 3NFPA 2I9TB 1LK3L 4G8IB 4HQQL 2YBRB 4PLKC 1CCZA 3BPOB 3NN8B 4L9LB 1XGPB 1ZOXA 3LRSB 4CN1A 3GMPB 4RAHA 5JQ6H 1YUHA 4PJCA 1VKXA 4K2UL 4X4XA 1CDGA 2VDPH 4PJDB 4KRLB 1S9WA 2BVYA 1CICA 1BD2A 4WI5A 1MUJB 4NGHH 5HYFA 2Y5TB 4PJGE 1TTGA 2VLJD 3VMPA 1EFXD 3ECBA 3MLTB 5JW5A 3LHPL 2X4OB 5K33A 4ZUWB 1EDQA 3RTQC 3GO1H 1N26A 2J4WL 3R0MA 3STLA 4X5LA 2CIKB 1OQOA 1FG9C 4HIXL 5D7LE 3W9DB 4P4KD 3FB7B 3O3DB 4F7TB 4RMWA 5F88A 1B6UA 2X4TB 2H3NB 3I50L 1DBMH 5GRWA 5F8RC 1AO7B 5BV7H 3VCLB 1RFDL 1M6OB 4APQB 4YHYB 3IU3A 5KVGH 5IBLD 1HSBB 5E8DL 3OKEB 1C5CH 3FOMB 5BVPH 2FNBA 4Y4KD 4M6NH 1MIEH 1EJOH 1I85C 2GAZA 1CL7I 3FRUB 4KI1A 1H0DA 5FXCH 2F74B 2HTLC 1AGBA 1YMMB 2CSPA 3K7UA 3NABL 1E6JH 1GGTA 2V7NB 3OPZH 3PABA 1ZVHA 3BXNB 4JO1H 3FO2A 4HC1L 1TZGH 4NWUL 5CZXD 4IRJB 3V52H 2B20A 3ALWA 4M5YH 4K3EL 3G6JE 5IW1B 1IE5A 4EBQH 2HLFC 5FHAH 5F7DB 5I1IL 1ED3B 3IAQA 3G5YA 1N6QL 2ADJA 4X5XA 3VFVB 4WU5A 1N4XH 4S2SA 3ZKXC 4BSWA 4TVSa 4FMFA 3C8DA 4GXVL 4TVPE 1DL7L 2PUQT 3S5LA 5HBBA 3CXDH 3SCMD 4YGAB 4Y8DC 3SKJH 2ILLA 1DBBL 1A0QL 2CDGB 1FZMA 5DJ2B 1MLCB 1NC4D 5I1AB 2RAMA 2DQUL 4JFEA 1QBLL 3PDOB 5I15L 3TBYB 5ANMA 3D69A 1EGJA 2PXYD 3IU4H 3LKNB 5FO8B 3CFCL 1ZHKA 1FQ9C 4X5WA 2P5WD 1I3RA 2ADGB 4OUOA 2VIRB 5F7MC 2HLAB 4NC1C 1T1XA 3INUH 5D1XB 4F7PA 3O2VH 5CBEB 3CLEH 4R0LA 4YE4H 3T0EE 1MQ8A 1RK0A 2EYRB 5INDB 1A02N 4PJ7E 2AGJL 2I26N 1UVQB 1IKNA 1OCWL 2F5AH 4JFHD 1UZ6F 1S7QB 2QSTA 5GGVY 4U1JB 1B0RB 2WWKO 4PJGB 4PJEA 4LLYA 2EDJA 5CCKH 2NX5E 3GKZA 1ZK9A 3FO1B 3BW9B 3TYFB 5D4QA 5KN5B 1FFRA 5J56B 3H9SA 5D7LB 1KJMA 3OKMB 2QKIB 5FECB 3MRPB 1LDSA 2E9IA 1P7KA 3RU8L 5GS2H 3OJMB 3DHJA 3MRKA 2IMNA 4XAKE 4HG4K 3L1OL 3NIGE 2ERJB 4LEOB 4OLWL 1JV5A 3AM8C 3UTOA 4IRZH 2GJJA 2VR4A 2I9TA 4G8IA 3C2AL 1IAOB 4FQLH 1ZHBB 1NLDH 2F5BH 5FM4A 4Z5RB 5ESAA 5DURD 4QRTB 3NN8A 2OX5A 1OM3L 4ZTOH 4L9LA 3IFNL 2E27L 1KLGB 3MLVH 4CVXB 4LCCC 1CT8A 4PJDA 3HMWH 4NRZB 5CLWA 5TQ2L 3AGVA 4LBEB 1YYMH 1OGAD 1JJUA 2DJ4A 1ACYH 3HR5B 1BFOB 1TNNA 4X6DF 2BZDA 3ZTNH 4GH7B 2CK0L 2Q1EA 3SE4A 5D9SB 3G6JB 1DQMH 4ZUWA 5E24E 4NKOB 2IG2L 3BH8B 1KLUA 3MBXL 2CIKA 2A1WL 3GSXB 4HS3A 3V7AG 4BQ8A 3FB7A 3TJHC 1QFUH 5CKAA 4ZODA 1JPSL 3C6SB 2R69H 5HYJB 1MHEA 1Q9KB 3RJDA 4ZFOL 4R26H 2H3NA 1BFTA 2HJFB 4HC1A 5CUSH 3T0BA 3RWFB 5HGDB 2DDQH 4OF5A 4WFEE 3VCLA 4APQA 2F19H 1VEPA 5IEHA 3OKEA 3TCLB 3TO4C 4TOYH 5KG9B 1U8LA 2YMXH 2ZUWA 3CFJB 3DGGB 4X6CA 4YBQD 5DSCB 2FZ3A 3MO1B 2XA3A 1DSFL 4ELMA 1RUMH 3C2SA 5ALCH 3DBXA 1R3HB 2DTSA 4PTTA 3GBNL 3FRUA 4ZUUB 1RU9L 3CX5J 3HPJB 1X4YA 4Y5YB 2XOTA 1N6VA 4X4ME 1I9JH 3L5HA 1JTPA 1CXHA 3BXNA 3D25A 2JJVA 1RUPH 4DKEH 4UINH 2ZG1A 3VFNB 3N1PC 3HHRB 4YDVB 5FYKL 4OCWH 1LO0H 4OF0A 3DI3B 5CLTA 2PW1A 3T0EB 4FS0A 3FOLB 1SVCP 1KEGL 4NNPH 1KJ2L 4H88H 3VWJA 5IB2B 1HOCB 3CCHA 4OCLC 4XCNB 4PJIF 3GI8H 2J8OA 1UB6B 4NKMA 4D0DA 5T1KA 4RGOH 4K94L 1KG0B 4R7NB 1NAKH 3IXAB 2NX5B 3MA9H 4PB9L 1TJIL 2D03H 1OSZA 2WBJB 5I76A 1I8MB 4X7TB 3TBYA 1PQZB 1DQLL 1I8IB 3IDYB 1I1CA 5FEBA 2FBJH 3LKNA 1UWGH 4PGBA 5DVMA 3BKJH 4PRIB 2P24B 4KHTL 4PJFE 4LCIL 5ELIA 4PRDB 4JHBA 2XN9A 1NAML 3V4VH 4YIQA 3O6MH 4I4WB 1WLHA 1FRGH 1NFIA 4U2ZA 1ZGLB 2VIRA 2CLVA 3EFFB 2D9QB 5BW7C 2C3VB 4K3DH 3MGOB 3BFOA 3VJ6A 1WZLA 4F80A 1SEBA 3LRHA 1HHIB 1IGIH 4JR9H 5INDA 5L2KB 3KWWB 3TNMB 2K1MA 5GRXG 1SQ2N 3S37X 1AGFB 3RZCB 2A74A 2CJUL 3TJEL 2WUBL 1S7QA 4ONFL 1OWRM 4U1JA 4PRHE 1B0RA 4FTVE 1ZEAL 4OD2B 4XMKL 3GMQB 4MA8H 3OX8B 2VRAA 4GT7A 3FT2B 1LE9A 2NY0B 2DKMA 4P2OA 5JPMA 5L8KB 2X89A 2CO7B 2NR6C 5KN5A 2FDBP 4E41D 2X4SA 4YPGA 4LP4A 5D7LA 2CIIB 1S9YB 4NQEA 2QKIA 5FECA 3GMNB 3QISA 5I74B 3CH1B 4LLVB 4KKBC 2IBBA 2Q3ZA 4GG6F 5IB4B 1T4KA 1BOGA 4LEOA 4JPVH 5ALBH 4K9EL 5EA0H 4ZFFB 4OCNC 1QTYT 5I1LB 3ARZA 1ZHBA 3QIUC 5GGQH 1I9IH 5DR5H 2FJFB 5C86A 3IVKB 4M61A 1A6PA 4LOUD 4ZFOA 4OZHF 1KB9J 2CKBB 1BQHB 5KSUA 3PIQA 2DQDH 3VXRB 1H3VA 5D71L 1YN7B 3MUGB 5EN2B 5I1HL 2IPKA 3HR5A 5A2LH 5I1DA 4XWOD 3WS6C 1UZ8B 3LKPB 1FO0H 2XZQL 4QOKE 4D94A 5DHYB 1LILA 4NKOA 3FFCE 2BOBA 1I3VA 3BH8A 4YAQA 4JJ5B 1L7TL 3CDFA 4L29B 3WL9B 1F4YH 4NM8H 1U6AL 2Z35A 3K2MC 3P73A 5IFAL 3RWFA 5I8KL 2B4CC 4BH7A 4AT6A 3CSBA 1U2CA 1CTNA 1T5XB 2UYLA 5I1JH 4YBLB 2DL2A 3BUTA 1KJ2A 2YXMA 1A7PH 2WW8A 2A6IB 1ZLSL 4ZUUA 4LVOB 2J6EL 4BQ6A 1LEKB 1N0XL 4RFNC 4LSVL 4PJFB 4PLNC 1QG3A 1XF3B 2EDFA 4NKIH 1DEEB 4OGYL 1J1PL 4S1DC 4NQTA 2GJZB 5CP7A 4WU7B 3JTSB 3ESUF 5JW4N 5IESH 1AXSB 1JIBA 4F2MA 1EZVY 1TZIA 3V6BR 1EJ6A 2SEBB 1GGUA 5KAQG 4WWKA 3RIFF 5EBGA 4PR5A 3PHOA 2OL3B 5C2UB 1NAMA 4PJ7A 4PJAE 2VH5L 1A7RL 4QRRE 3BKYL 4AEEA 5TGBA 3UO1H 3P0GB 5E8PA 4HZAA 4XCNA 4BYHA 1S7UB 3BGFC 3B6SA 3WIHL 5DFVD 4PRHB 1KJVB 1FL6B 1UB6A 1VGEH 4FTVB 3SDYH 1LO3L 2QHRH 1BBDL 5LWYH 1MJUH 3IXAA 4HFWA 2APXA 1U41A 5GGRA 4QXUL 2M26A 5BJTA 5D2LE 4X7TA 1PQZA 1I8IA 2LAGB 4OLZH 2B2XL 1LE5B 1CLYL 3ARGC 4MXVE 4M93B 4KTDH 3WHE0 2G2RB 1B0GB 5ICXA 1ZGLA 4LSPH 5ABDE 3HPLA 3GSNH 5GXBB 3EFFA 3RI5F 1MJJA 2X4UB 2B0SH 2EDRA 3TA3C 1P4BH 4XMPL 4LSUH 1UEMA 4OV5A 2R1WA 4M7LT 4JPWL 4OKVB 1A5FL 4WFGD 3VWJD 1UYWH 3VFPB 1YQ2A 5IP4A 1U93A 2W65B 3D39B 2W1NA 3TNMA 3ARBB 3WLWD 2R1XB 1I7ZA 1OP5K 3QEUA 5T1KD 3EO1B 5IJVB 4FOMA 5GGSY 4WGVB 3PXHA 3LQZA 4QOKB 4BKLB 2BJMH 3RVTD 5F9OH 1LK2B 2HVKA 2XQYK 4DCQA 5EOQH 1NBZB 1NGYB 4FQ1H 4X9BA 2CIIA 4NBZB 2XG5A 4X9GA 1D5XB 1OOAA 1RMFL 3GM0A 1Q0YL 4UQ3A 2ICEB 2VLRE 3KLSA 4YO0B 3IFOB 2EKJA 2DQFB 2HVJA 3HFMH 4RWHA 5GGSB 4M5ZH 3G5XB 1MREL 3PUCA 1GVIA 2DYPB 3BQUB 3LRGA 4I0PD 1JZ2A 5I1LA 2E9JA 3V2AR 4YDKL 2BHUA 2FJFA 3BD3A 1ND0B 1BIHA 1LD9B 2PTUA 5INCB 1BQHA 4V2BA 3TT3H 1Q72L 1YN7A 3D1MC 3GMOA 2FCBA 1X5IA 4JFYA 1JYWA 3K0WA 4P2OD 2C3WA 4R2GB 1UZ8A 4L5FL 1EA9C 4RGNB 4R4ND 4P5TA 3EJYD 5HD8D 4HLJA 4NQED 2LABA 6FABH 2J6EA 4OSUH 2GK2A 3V4UH 4M62H 5ICZB 3C5JA 4XTRD 4JJ5A 2AJXL 4PJAB 4TUOB 3GB7B 4QRRB 5IV2B 4U1IA 5IBTH 3T3ME 5JXEC 1JNHB 2H6PA 4N5UA 5E70A 5E5RB 1MRFH 3DIFA 4ONHA 3C08H 1IFHL 1YJDC 1NGWB 1RHFA 3EFDH 4G7VH 5L6YL 3OWEA 1NMBH 1MNUL 3O8XA 5KAQF 4RFEA 1FLRH 1C8PA 2FX7H 5D2LB 1G84A 3M1BB 4IRSA 5EBMA 2R2HB 2P1YA 1LEKA 5EZJA 1IGTB 3AREA 3MSPA 5CILL 1A2YB 1TITA 3JWDL 4XPBL 3SDXB 4HD9A 1HQ4A 43CAA 5D7IF 3C9NB 5D96B 1UKQA 1NGZB 3TF7C 5DO2D 1JGVL 1DR9A 3RWIB 4AJ0A 2AJVH 1MVFA 1YQVL 3L3IB 4ZXBD 2VR5A 5F93C 4TVPD 4IDJH 5ADOH 3KPNB 1IGFH 5BMFL 4L8DA 4DKFH 4KK6C 4QHMB 5FYKD 1K4DB 1MLBA 4FN0A 3VI4F 4OM1L 4EN3A 1FL6A 5DJ8A 5DRXB 5EU6A 1X4XA 5K93A 3QUZC 1IILE 5IF0B 2X9YA 3E6FA 5DI8B 5A3ID 1AD0B 1XF5B 5TH2B 3RDTB 4ZNEA 5GS0C 4OLVH 2ICES 1ZWIB 3IETA 1WJ3A 3RWHA 4KRPB 4LLQA 3RZWA 1CE1H 4HJJH 3MCG1 3MFGB 1DQTA 2G9HB 1F4XL 1JGUL 1AC0A 1BVLB 2MPAL 3MRHA 5ITBH 1IGMH 4EUPH 2GEEA 1LP9B 5IHUL 4NP4L 4WFHE 2W9DL 4NO5B 2O5YL 4WY7H 4GRMB 4Q7DA 2OCFD 4DVRL 4P2YA 2Q76B 3DYOA 4WWKD 2BY0A 1TETH 4OFIA 1ZHNB 4WI3A 2FECI 3CC5A 2IBZY 1N64H 4XNUL 2XNAA 3IDJA 2DM3A 5CSGA 3OR6B 4P9MH 4OKVA 1ZLUH 3VGDA 2AK1L 3QHZL 2W65A 5GZOC 2AKRB 3HNTL 3P4NB 3QUMH 3S34H 2J7LA 2EEBA 1ACZA 5I71C 3RAJL 4D0BB 5IJVA 1H5BC 5C0CD 5J6GB 2L0DA 4HUVB 4EXPX 4QOKA 2BVOB 2NY3D 3DROB 2NXYB 2A6DB 5DJCB 4QCIB 1LEIA 2OQJA 3FFCA 1DP0A 4V2CB 4G43B 5FV1L 1NBVL 4OFYA 5T3XL 1ITBB 4J6RL 4DN4L 4PRAB 4GSDH 5TE6H 2CKNA 3HS0B 2Y06L 4MGXA 5JNYB 4L3EE 2LE9A 1ES0A 4EXKA 4L3CB 1YEHH 2HN7A 2AP2A 3ULVL 4JJHA 2DQFA 3BZDA 3G5XA 1S5IL 3MLZL 1I75A 4LHUB 3VD7A 5GRVK 3ULVF 3TH3T 3WIFB 2WQ8A 2XICA 3AAZA 2UY7A 3K8KA 4JQXC 3QJHB 1BZ9A 1IEHA 3MRCB 1A6AA 4O02H 4ZSOB 4YK4C 3BWAB 1OP3H 4NIKB 4ODXA 5C6WH 4OCRL 4XPGH 3REWB 1L7IL 3G9VA 3U7WL 1VHPA 3X17A 1JHKL 2FJGA 4AEIL 1AHWA 3W39A 2W59A 5I30L 3O6FC 2HRLA 3WBDA 5SWSA 2R0WH 4K07A 1HINL 2JF1A 3RTQB 3SJVE 1F90L 1U95B 3MLYH 4X6EA 4UILH 4TUOA 3GB7A 3BI9X 1NGXB 4LQ1A 4ZDHB 5SWZE 1HXMA 2W9EH 1DE4A 3IAGC 1J0ZA 2EO1A 4FG6D 4EIGB 1CU4L 4XHQA 4HT1H 3O11B 3OXRB 4URTB 2A2QT 1PKQE 2R8SL 1WZMA 4MJ2A 5DYOA 4TUJB 1AGDA 2DQCH 2LU3A 1YNKL 2J8UF 1LNUA 5EZLA 5F9JA 2A83A 3KYMA 4Y2DA 4Q97A 1KXVC 5F44A 1QSED 3N9GL 2BVUA 3E1F1 3Q6FB 4JFZL 3SKOB 2R2HA 5J89A 5D6CB 1F42A 2YUWA 3I9GL 4UNTA 3ZE2F 1VSCA 1ZHLB 4YDIL 4G8EB 5E6IC 5IVOA 4P5TD 1MIMH 1SJHB 4KV5F 3C9NA 5ID0A 2AXGB 3HE6C 3E0GA 1HI6A 2Q86B 5KTEL 4CGTA 5JQ6L 5DJAA 4S1RH 4LCYB 1QR1A 4OCMC 3L3IA 4G9FE 5D72L 4NGHL 3MLWL 2NY6D 5JPNA 3R8QA 3ZKXB 4HKXB 4F9PA 1K4DA 2HFEB 4F15C 5T1DL 3DETD 3GO1L 3S36L 3H7BB 4NFCA 3JWNC 2MCPL 5IF0A 1XGTA 5TF1H 5DI8A 4Z0XA 3O8XD 5FYKU 5IMMB 5TH2A 3RDTA 3VMOA 5HDBE 4IRSD 1JWSA 1ZWIA 2EXWD 2Z31C 3HRPA 1A4KB 2ZP0T 1T0MB 1DBML 4MDIB 2XQYG 3ARED 4DJMA 4OFPA 1JCKA 2G9HA 4PJHE 2C3HA 1DN2A 5EPMB 1ZT4A 5KSVB 2VLRA 3P0VH 4POYA 4RBPK 4G42B 4J3VA 5BVPL 1CLZH 2K7PA 4M6NL 4OIBA 1EJOL 2ADIA 3WXVH 2Q76A 5IWLC 4YNYB 4FFYH 1ZHNA 5E03A 9CGTA 4HH8A 4KKCC 5BOPA 3LPGA 4ODHL 3KNBA 1I1FB 1E6JL 2GI7A 4PPTA 4OIAA 2Q6WB 3NPSC 5CEYA 1ZT1A 1YMHA 2AKRA 3P4NA 3VRIB 2C7UA 5DEFB 4EN3D 4M5YL 5JA8B 5EU6D 4FP8L 5KZCB 3CIQA 4EBQL 3QXDA 5J6GA 2Z92B 4CDHA 5J11C 1I3UA 2BVOA 1N4XL 1MCEA 1BEYH 3IDUA 5DJCA 1UKSA 1MJ8H 3LEYH 4UOW0 2YS4A 2E7LA 4AQOA 3QQ9C 4Z7OE 5CS7A 5EZIH 3D87B 1S7XB 3KHQA 3V6ZB 4JM2F 3MR9B 3LEVH 3MGTB 3MV8E 5CJ5A 3RY4A 3SKJL 5ENWB 3GSRB 2QADD 3JXAA 4IJ3C 4X99B 4LHUA 1QFHA 2XPGB 1PKQB 3LQAH 5GJTH 1A6VH 1EPFA 4CVZB 5JDSA 3IU4L 4G6KH 4Y16C 1QSFB 4LPYA 4JG1H 4YBHA 3M07A 4HFUH 2M8XA 1U92B 3UDWC 4C83B 1Y6MR 1FNAA 3RGHA 2DM4A 4O00A 2MWCA 2ESVA 4F7EB 4X7CC 2IJ0C 3CLEL 3LV3A 4J4PC 3QDMD 4WNQB 1A3LH 4XP6H 4YE4L 3FFCD 3WNLA 4OFYD 2D9CA 1RY7B 5CINL 3NCYS 2LFGA 2MQCA 3BGAA 3SEPA 1CXEA 1IC7H 1RHHA 5HDQH 4L8CA 2VDML 1GAFH 3VXNB 5I66B 1AY1L 4LHJB 4P5KB 4ZUVB 3B9EA 4M7LH 3MLXH 1RZKL 1IC1A 2MKWA 1NCTA 3EW3B 3MBEC 4F37F 5HGBA 4YWGL 4HKBA 1UH2A 3OXSA 1EO5A 1HNGA 4D8PB 1D5BB 3KJ4C 5DMKB 2VDRH 1U8PB 5HHPA 4GMTH 5FGBC 3H3BC 4AEFA 3OHXA 1EAPB 4PJHB 4IRZL 1TVBB 4C4KO 1OAZH 3VG0L 2OR9L 1NLDL 3GK8H 1S7VA 1G7PB 1SJHA 5DC0A 4G3YH 3HUJF 5SWSD 2Z91B 3WKNA 5E2TH 5E5MA 2P42B 1NCWL 1JN6A 3HMWL 1TMCB 3ILPB 4LCYA 4P4RB 4G80B 4A2MA 4DVBB 1VFAB 4PLJD 2BNQE 1YYML 3B2UC 4XPHL 5L2JB 2C3XA 4OLUH 2ID5A 5DK3A 3JWOC 3OG6B 5E9DD 1Z0NA 1IC4H 3ZTNL 5FCUL 4RSVA 4LPVA 4KGLA 2Y7QA 3MUY1 4F9LA 3RGVD 2FJHA 4P3DB 1Z9OA 1EMTL 5CEZH 3V0WL 12E8L 1JVKA 1F3RB 3BO8B 1YPZA 2YPKB 3SBWA 4R26L 3BKMH 1XGUB 1T0MA 4RA0C 1J0HA 3V0VA 4L3EA 3MV8B 5KVEL 3FB8B 5FYLH 3U9UB 2F19L 4KUCD 1FZJA 3LB6D 3CPLA 3GM8A 2YMXL 4JY4B 4HKJB 4G42A 1X5JA 4UUJA 5J3HC 1RUML 4NO0A 5ALCL 2C1OB 4M3JA 5I0DA 2V2WB 3GNMH 3MGAA 2YPVL 1N5YH 2ICWA 4KK9C 1I9JL 1IAIH 4TN9A 2XKUA 4UQ2B 1ZS8A 1RUPL 4DKEL 4H8WH 1DBKL 3A0OA 5HHNB 4ZPTA 4OCWL 1I8LC 4TQEH 4MLSA 1LO0L 3KPLA 4Y19E 4HJ0C 2Z92A 4LCUB 3L3KA 4HZLB 4JQVA 4K7PH 3MRGB 4ZO9A 1NLBL 3TBWB 4NNPL 1R3JB 5DC9B 4H88L 2PTTB 5ERWB 1MWAH 3MRLB 2DBLL 3SJVA 1XMWA 5J13C 1KCSH 3V6ZA 5EUOA 3FRPA 1T83C 1U3HC 1MPAH 3MRDB 2DQTH 4C59B 5SWZA 5ENWA 3GSRA 2XTJC 3NACH 4AEHL 5IMOB 1SM3L 2D03L 4X99A 5T3XD 1F4WH 5BV7C 1MRDH 4MNQE 2ZCHH 3AM8A 4XGZB 2BDNH 2FBJL 1UWGL 4PBWD 4NQCA 4XXDA 1B6DA 3WFDH 3ULVD 2R23B 3QIUB 3O6ML 1RZJC 2PW2A 3VWKC 4PB0H 1U92A 4ZMAT 4O58H 2LQRA 1YZZA 4XVJH 4Y5VA 4LCCA 3WNMA 4TNVF 2X05A 3EO9L 4FQCH 2YD6A 2RFXB 1JGDB 1JFQH 1L0QA 4GRWH 3EDKA 4MD0B 1CZ8H 3ZKQD 2HTKD 3NA9H 5C0ND 1QQDA 4HXBH 3QEQD 4R3SB 3HRZA 2BNQB 4G9FA 3VXNA 4FFWC 4YJZL 2ED7A 4ZUVA 3U1SL 4XH2A 4ETQA 2W60B 3FQTA 1Y0LA 3OJDB 4JM2C 4LASH 5L8JB 4QTHA 5JR1H 4Z77A 1J12A 3EDDA 5J12B 5JHDE 5IB3A 5CGYD 3BWUC 4Y4HC 4J3XA 5DUMH 1U8PA 1HHHB 3TO4A 5D7KE 2EDLA 1I1RA 3D3VD 1YEEL 1PLGH 3G04B 5DD6B 4NO3A 1U8IB 4PG9A 2X9XA 4JPVL 4KJPC 3IKCB 5ALBL 4PJHA 1DBJH 3L6FB 3RPKA 3HG1E 1I3GH 2ESVD 3KAAA 1TVBA 4L4JA 4R8WH 3MX0A 3I02B 4EKXA 1MFEH 3FO9B 5DR5L 1CBVL 3GEWB 5H2BA 2DD8H 4YPJA 1KGCD 1PG7W 43C9B 1G7HA 1T66D 1DVFB 3RX7A 5JOPD 5CJXA 4Z7VE 4X6DB 3BT2H 1WWBX 5E1HB 2BC4B 4J23A 1T1ZB 4JZOA 1E4WL 1FO0L 3PF2A 4LPWA 2AABL 2BVEA 1G6RH 4QGYA 4YUEH 2D0HA 5D1ZB 2NTFB 4UIKH 4MQXD 4Y19B 3DECA 5IFHH 4AH2A 1A6ZA 1YDPB 4BFIB 4GG6E 2RIKA 5IBUG 4NHUA 3BO8A 1F4YL 5JIKA 4NM8L 3P40A 4PD4J 3C09C 3S6CA 3V95A 4DK6A 1R3LA 5CD3B 3MV8A 1QHOA 5EG6C 2J1KA 3DX7B 1JWUA 1A8JH 4LDEB 1OY3B 4GAGL 5HI5D 5JLZB 3ARGB 5DD0H 5KSAC 2WK2A 5FGSA 3GIVA 4MNQB 4CMHC 1MJ7L 2BMKA 3TV3L 3KXFA 4LRIA 4HHAA 3PL6C 3B4NA 1IBGL 4LSRH 4MS8C 2YA0A 5GISH 3TA3B 3C5SA 1VA9A 1UEYA 2E5EA 2H8PB 2FB4H 3BYTA 3J8F7 3HE7C 1G7QB 3WFZA 4AIXA 4M43L 1P84K 4LIQL 4LCUA 4P57B 3L5JA 4GRLC 3LSOB 2BNRE 2CGRH 5IKCB 2FATH 5IQ9B 2A77H 5ERWA 3UO1L 1BWWA 4L3ED 3QXAB 1UQSB 4KK5C 2AJYH 4YEEA 3QNXA 5JXAH 3SDYL 4HIEB 4D0CB 1V05A 1D5IH 3MRDA 1MJUL 3ARQA 5HHOD 1BIIB 5IMOA 4TTGA 2IH3B 4X98B 4NO0D 3MLUL 5JHDB 5TDOB 3ARTA 3TVMC 1IAII 4JVWA 2B1HH 3T08A 3PG2A 3EOTH 1OTSC 1T5WB 1E6OH 2FEEL 1IRAY 4KROD 1BM3H 5EBWA 2ZCLL 3QIUA 5J1SC 2R29H 3N0PB 4PGZA 5C08E 1RD6A 4C56E 5GIRA 4XC3H 3HG1B 3BP6B 3CMOH 3FONB 3DYMA 4YQXL 1VPOL 3GSNL 3AS3A 3OSKA 4H1LH 1U8JB 5ETUB 2JCCF 1HIMH 2GKIA 1W72H 1P4BL 1JI2A 5C0CB 4LSUL 35C8L 3T1FB 3DPBA 4HBCH 2E9WA 1JGDA 5L9DL 2J88H 2P8MB 4K3GA 3TFKD 4JFFE 4MD0A 1T89C 1V3KA 1I1AA 32C2B 3SJVD 4Z7VB 4P9HH 3V5KB 1FL3B 2NW3B 3PGDA 4HPYL 2YA1A 4D3CH 4R3SA 3H6JA 2A38A 4MJ6B 2GTWB 5SWZD 1BAFL 3RWCB 4QRSB 5EFIB 2BJML 5F9OL 2AV7A 5A43C 1S5HA 1Y6KR 2YSSA 4FQ1L 2BSTB 4GG6B 4NQCD 2IADA 1EHAA 3O6KH 1HHHA 5T5NG 1EEUA 4JFPB 4RMRA 5DD6A 4DUXA 3HFML 4PBXA 5E2WH 3QFJD 4M5ZL 2UZYB 4KQ4H 3L6FA 5DHVH 3T3PE 4ODWB 2VXTH 4GUPA 4K3JH 4BSJA 4HGKC 4U1KB 1IMHC 4OZHB 3MRRB 1TFHA 2MFNA 3F7QA 3RHWF 43C9A 4OZGE 5ISZE 1VB9A 2MOVA 2YR3A 5HYSG 4OI9A 2AJUH 2YC1B 1ZVSB 4LSSL 4G9FD 3P11H 3BEWB 1T22B 1LQSR 2V5TA 3ARSA 5JOEA 3ZSSA 2RHEA 3MLPA 4JRYE 1T1ZA 2VLLA 1RZFH 5JZ7D 5E56A 5KSBF 5MI0C 4Y19A 3WSQL 3EYSH 5I8CB 2GT9B 4M62L 3RIAF 4F57H 3RVVD 2BNRB 1OAKL 5J1AB 4HGWA 4M02A 3QUZB 1EFQA 5C9JA 5TDNB 3PNWB 4N5EC 3X3FL 5HSFA 4OQTH 1V3JA 1IM3A 1DLHA 5D1QD 4PRPE 4DGVH 1S7SB 1V7NL 2XQBH 4QHNA 4A2LA 3DX7A 5DLMH 3W11C 4JHWL 3GMRB 2V5MA 5JLZA 3IDXH 1NMBL 4ZNCD 4P59H 1FLRL 4UBDC 4JFXB 4Y0GA 1RJZA 4Q0XH 2QQNH 3GUTA 2VLKE 1MHPH 4V1DE 3KLHD 1WK0A 1BMGA 4PGDB 4N0CC 5AG9A 3S88H 2C3GA 1HYRC 3O9WA 3KPRD 1CD0A 5C08B 3TA3A 3WFBH 1FGVH 4C56B 2XI9A 5D5ME 4UV4H 5F1IB 2LV4A 2H8PA 2J5LC 3RNQB 2W0PA 3KYAA 1ODAA 4JZNB 3L3JA 3D85B 1S78C 4ZOEA 3EZJB 1F3DJ 5FUOL 1UADC 3TO2A 3MYZA 1NCBL 4EDXA 5I71B 1KSRA 4P57A 3S4SB 1H5BB 4JFFB 2QTEA 5IB1A 1YEIL 5IQ9A 5A40E 1KIUA 3CVHB 5DTFA 2VAAA 5DEGA 2YKLL 1IGFL 5F9AC 3GHEH 3DV6B 3FB5B 3FCTA 1UXWB 1JP5A 2E7HA 1T3FB 3JSSA 1TVHA 4FZEH 2BSRB 3DSFL 1IC5L 4UIMA 1FCGA 3FQWB 3ZT6A 2JJTC 4LLDA 3REVA 4X98A 1JRHH 4XAWH 2Z9TA 2RB8A 3KXFD 4KDWA 4KH2A 5DJXA 2AS5M 4LQFH 4HJJL 4FQXC 3G5ZB 3DTXA 1N6UA 1I7TB 5ITBL 1IGML 1OD9A 5D7IE 2X4PA 1FFPB 3DRQB 2X44D 3LIZH 3JVGC 5J7CC 5AG8A 1JPTL 5T3ZE 3MV7A 3R8BB 1QLFA 1YYLH 2VL5B 4YK4B 3CAFA 3A67L 3G5VA 1U8JA 3GZKA 1XR8B 5JOFA 5CHNB 1N64L 4MYWB 1G9MH 4XP9H 4GKZB 4PRBB 5DUBA 4KJYB 1AQDA 5FA3A 5ISZB 3NZHL 1MF2L 3EJZC 2P8MA 1J5OH 1OAQL 3CFDB 5FKPB 3Q0HA 1F4AA 1Q1JH 3VXME 4O2EB 3G6AA 4Z7VA 1NFDA 3S34L 3O6FB 5CJ8A 1UACH 3VFGL 4ZG1A 2NNAB 4JRYB 1SBBA 4QRSA 4ERSH 1PZ5B 3MV9E 3GIZL 4MQSB 4NZJA 4UTBH 2R39A 4TULH 1WICA 5JXEA 2BSTA 4GSDL 5TE6L 1HH6A 3FT4A 5DZOA 1OT1A 3VXTB 2L7UA 1CQYA 1FVEB 3FQUB 4JFPA 4Z7WF 3IJSA 5C70A 2IQ9H 4PRPB 1IJ9A 1CFSB 5FO7B 1P53A 4M00A 5DFWH 5HGGS 1KPRB 4U1KA 4XX1E 3KPQB 1GPOL 5GJSH 3UPAA 1I1AD 4O02L 4V1DB 1OTUC 4HX1A 2YC1A 2EDQA 3HE6B 4XPGL 1JPST 1CK0H 2VL4A 1UJ3C 4Z95H 1X5FA 1JZ3A 2EIDA 2P8LB 3DV4A 4O51B 2GUOB 5J1TC 3KDMB 3W9EA 1CFNA 1EIBA 3X12B 1PY4A 2D31A 3LKQA 2GTZA 4TUKL 4GQ9H 3P9LA 3BP5B 1G7MB 3QUKA 2GT9A 2RCSL 4F15B 4GS7C 4F58H 4KZEL 3MLYL 4QXTB 3QUZA 4UILL 2FHFA 3PNWA 3UP1A 2VLME 2ZOLB 2XKNA 4YHIA 1QRKA 4KU1A 4IIQC 4WFFE 2WAHA 3UAJD 2Z31B 1LMKA 1S7SA 2GSGA 4HT1L 5EIVA 1IEAB 4AENA 4CW1B 1HE7A 1M7DB 4XNXH 3V5HA 4UAOC 3AU1A 1GGIL 4LNVA 5B8CA 3AMKA 5H94B 5FYJH 3VXOB 3VD3A 3FN9A 4Q6IA 4JFXA 4C54A 2M2DA 3VDBA 1MHCA 4HJGB 4U1MB 5FGRA 4PGDA 5D7IB 2PNDA 5I19L 3OKYA 2AVGA 4LL9A 4GAYB 3ROLB 4MWFA 4CDGC 2DJSA 3GJEB 4HCRH 4UT7H 2HRPH 3WXWL 1P1ZA 3NPSB 3RUGE 4NHCH 4JZNA 3O81A 2CUIA 4MXWH 4U1GC 3H0TB 1C5DB 1MRCH 4S1RL 4NJ9H 5D7JC 4TSCL 4XB8A 3S4SA 4KJWD 5KJRH 1H5BA 4MVBC 4I3SH 3SHSA 4ACPA 5J11B 3QBTB 4RISL 3CVHA 4GMSH 4XRCA 3VXMB 3CU7A 4GG8A 2PYFA 2R2BA 3DV6A 1YNTA 5F9WC 3FB5A 1T2XA 2ZSWB 1AQKL 1T3FA 1MFAH 1U58A 3GSQA 2NLJB 5GSVB 2BSRA 2OXGA 2J8UE 3ALXA 2XFXA 3MV9B 5MP6H 3LKRB 1BQLH 4Z7QF 2ZUUA 2DLGA 1RI8A 1T20A 2HYMA 3ELAT 3WFCH 4S1QH 1KCUL 3RPIA 4UV7L 2ARJB 1MFCH 4IJ3B 4K7PX 4PUBH 4YHPB 5IVXF 4JY6B 1GSMA 4RGMC 3O9WD 4OFKA 4I77H 2D7QA 2UV3A 3S7GA 3K74B 3VH8G 5KW9H 3C8KB 3P0VL 4Y16B 1YEFL 3GJFB 4JQXA 3JBG7 5T1LA 4G7YH 1CLZL 3CDGB 4Q9BA 5BVJA 1HZHL 5CKGA 1BPVA 2VL5A 4G6MH 2DMCA 3W0WA 4JO4H 3TBTA 2Y6SC 3PHSA 1XR8A 4FFYL 1FYTE 5CHNA 5E2VH 4GKZA 3U83A 4OZGA 4MA7H 5ISZA 1YEGH 4P23C 3IGAB 5BRZE 2JJWA 1GHFL 4O2EA 5SWQB 1MCKA 1X9QA 3O6FA 1FBIH 1C12B 1ZANH 5K9KA 3SO5A 4ETYA 4BQBA 5SX5K 4MSWB 4NQDD 4OF6A 5DWUH 4D2NA 2HFFB 1MJ8L 3TYGL 1PYWA 1IQDA 3DX8A 1JZ8A 2A6JA 1CN4A 5EZIL 5HPMB 3CFKB 3MBEB 3T0AA 1KB5B 3KS0H 5BXFB 4MA1C 3VXTA 5J9PB 3FKUS 3H9HA 2JJSC 1TJGL 3KJ4B 1EV2E 3MV7D 4O5LH 4PRPA 1CFSA 5GRUH 3BPCB 4P2QA 2EKSB 3VXQB 1P6FA 3OAYK 1H3XA 5GRJH 4WV1C 5GJTL 3VRJA 4AM0B 1U8QA 3KPQA 2NZIA 4Y4FC 5DD5L 1TLKA 2VZ1A 3TGXA 2PYEA 3QEGH 2OR7A 1G7JB 3MV11 5E6IA 4ZAKC 2EDHA 1OAUH 2VLKA 2BVPA 3VFTA 1CI5A 3HE6A 1N5AB 4L3AA 4O51A 1UXSB 3KDMA 4XP4L 5D5MA 2R9HC 1A3LL 4XP6L 2PO6C 2I9LB 3RUGB 1EGJH 5DMIL 2YZ8A 1G7MA 3V4PH 3TP4A 4OZFB 4CADB 1L6ZA 3WDHA 1Z6JT 3KYNB 5FFLA 1GAFL 4XPTH 4H20L 4FFZH 3TBVA 3ULUH 4K71C 2AAVA 3NAAL 5HHXH 1W0VB 1FN4A 4M7LL 1FNSH 4U1NA 3MLXL 1T7XA 4ZS6C 2ARWA 5B39G 5C0DA 2E6JA 4O2CB 3FFDB 1IEAA 1RIVH 2J8UB 4LCWA 5I9QC 1A3RL 2DICA 3QIBA 4M1DH 2VDRL 3CVIL 2L4OA 4PJXE 4N8VB 5IVZB 2Y07L 1KIRB 1LK3H 4HQQH 5SV3A 3EO0B 4U1MA 5D7IA 1D6EB 1OAZL 2AQ1A 4OZ4B 4GXUN 5I8EB 4GAYA 3ROLA 4OFDA 3VMNA 1HCVA 2IANE 2FIKB 4K2UH 3TZVA 3HC3L 2AV1B 1T04A 1FYTB 1P7QB 4JO2L 3IFLH 4ODVL 3ZTJH 2XRAL 5TE4L 2ENYA 1JWMA 3WHE1 3PXJA 5BRZB 3LHPH 3MA7A 4PRNA 5D93C 4NO2A 5IVNA 3L3GB 4JDVB 2R2EB 3KPMB 2ZSWA 1BVKA 3ILQD 4JRXA 1OAXL 1IZKA 2WIIB 5IFJB 5J13B 2P4AB 1S7RA 3CSGA 3QO0A 5CEZL 3MV9A 3JV6B 1EEZB 4XNMA 1QRNE 3I6LD 1L0XA 5IG7A 2XTJB 3C6LC 4HV8B 1RFDH 3BKML 2ARJA 2GK0B 5BV7B 3F65A 1YNLH 4XXCA 1BHGA 4JPIA 5C0FB 5F3HB 4Y16A 3GJFA 3SE8L 1KCRL 1TVDA 1PG7L 4U1HB 4HAFA 3BPOC 3VWKB 3P0YH 4PJ8C 2YD9A 2BY3A 1T2QL 3QG6A 3VE0A 4MHHG 2NYYD 4OZIF 1D3CA 4NWUH 3L3OB 3IGAA 3VFRB 4J4PA 1DQJB 4H8WL 4JN2A 2FGZA 5F97E 5C0BB 5CZKA 5I1IH 1Q9LB 1A6TA 1N6QH 1WEJL 1J7VR 1IAIM 1X5HA 4MSWA 4NNXA 3RVXD 3OMZA 4K7PL 1DL7H 1R0AL 4WO4C 5C3TA 2MTPA 1HYSD 4JM2B 4KJQD 3TIEB 4HH9B 3O45B 1MWAL 1AKJB 3LPWA 5HPMA 1FG2B 3DX9A 5BXFA 1HQRA 2P44B 4Y4HB 2EECA 4M1GL 2DQTL 2W38A 3MJ9L 5T1LD 2DQUH 1ONQB 1P2CB 3BKCH 1IAMA 1QBLH 5FGBA 5HHQB 1KN2H 3K81A 2ED8A 3W0WD 4WIQA 3VXQA 4J8RA 3CH8A 1G0XA 3B9KA 3CFCH 3JUZA 5CD5C 4QGTA 5CEXB 4AM0A 3N85H 1N2RA 3IDGB 3RL2B 4N9GB 3JV0A 5CSBA 5F1NB 3V5DA 2B5IC 4MJIE 1G7JA 1NKRA 4XC1L 4HIJB 4PB0L 1X5YA 1N5AA 3QUYB 2AERT 5TE7L 3BOVA 4JKPH 2VSCA 2R1YB 4LGPB 3S3PA 3SN6N 3F7PC 4M8QB 1JHTA 2AGJH 2E6QA 2IANB 3O41B 4OI8A 2VABB 1OCWH 2I9LA 3RUGA 5IJKC 1CZ8L 1S7WA 4CADA 1OQXA 4KAQL 3TN0C 4G6AC 1ZTXL 1I1YB 3GI9L 3QH3B 2VQTA 4PREB 1CGUA 4WW1B 2X5PA 1K4CB 5EOCH 4LASL 1ZA3A 4P2QD 3U6RB 4U1LB 3C09B 3RU8H 4H1LG 5JQHC 2B7DT 1QRNB 3ARDC 4XPAL 1IGJB 3TBSB 2PYED 4OLWH 5E6ID 2VLKD 3QHFL 4N8VA 3RA7L 2OTUA 5HGHA 5KSAB 1PLGL 1KIRA 3PJSA 3IF1B 3C2AH 3LQAC 1DBJL 3SKNA 4CMHB 1I3GL 3DMMA 1O5DT 2NY4D 3HUJB 3PL6B 2FIRT 4N8CH 5MHSD 2E27H 1MFEL 3HC4H 2DD8L 3CXHK 1ETZB 4WEBH 5E99H 4FABL 2HT2D 3I3BA 2AV1A 5TQ2H 3HI6L 5E4EC 1P7QA 3OL2A 1U8KA 4W4OC 4HIIA 3SDAC 2VE6B 3HE7B 3T4YA 1N59A 2VWEC 4N9OB 1I8LA 1VDGA 1NJ9A 3LQMA 2BNUB 3R06A 2JB6A 1SY6A 2Q8AH 4NQXB 1A1OA 1RZIB 4LP5A 3L3GA 2IG2H 4GRLB 5C07D 5M95B 3KG5A 1G6RL 4YUEL 3VRLF 3G6DL 5D1QB 2AXFB 4NOBA 4LCWD 4G6JH 4HS6B 3RVUC 7CGTA 5IFJA 1JPSH 1RIHH 4HUUA 3QIBD 4J3OC 4Q9CA 3D2UD 1KF9B 1IKFL 3IFPA 1U3HA 1Q0XL 1F58L 2GIYA 2FO1A 5E8OA 2H2SC 1BLNB 4HV8A 4QRUB 1N3NB 3MRBA 3TVMB 1CGYA 3DSNA 5HHMD 1FL5B 2JIXA 4J3WA 3HZVB 1UA6L 1MCDA 4PJBF 5C0JA 1ZE3C 2HT3C 3G08B 4NN5C 1DSFH 5DMGC 5IOPB 5F3HA 4IMLB 3KPRB 5A16A 3GBNH 4LMQI 3TZVD 3QIWC 1RU9H 4M9OA 2H2PC 3VWKA 4XBPB 1F5WA 2KBGA 4X4YA 5HI4C 4ZUSA 4NCC1 3R4DA 1IT9H 4TVPH 4LSRL 4MJIB 3A6BL 3WUWA 5GISL 2F9BT 4U6YA 3MJ9A 4HUKB 3D0LB 4QT5A 4NZRL 1Z9SA 2M1KA 1A1MB 2YD7A 1R5VB 4JRXD 2AK4A 1U36A 4LLMB 5CJQL 4MZ2A 1E27A 1Q9LA 4ORGA 1VGKB 5DRWB 3S35H 1MCPL 4CUCA 5C0AE 4WI4A 4I5BB 1KEGH 1KJ2H 2YD4A 5D2NC 4WTZA 1CIDA 5MERA 3DUSB 3KLDA 4H0GA 2CGRL 5HY9B 2BFVL 4OCYL 1P69B 2A77L 3TIEA 2ZCKL 3Q5YA 3VG9B 4NT6A 2VJXA 5DJ0B 3B9AA 1FG2A 4RWYH 4P0DA 5JXAL 1TJIH 4MD5A 4D9LL 2BSSB 1D5IL 4H0IA 1C08B 1F6FB 5TDPA 1P2CA 3BN9D 1CLOH 1DQLH 2UY6A 2HMID 3PQYE 1E6OL 1QA9B 1NAMH 3IDGA 1BM3L 2PTVA 4PJ9A 4PJXA 4HUNB 1HHGB 5F1NA 3SY0B 3O3AA 4X0KA 3KPTA 5ESVB 4X6FB 5HJ3B 5J4MA 3IS1X 1S9VA 4XC3L 3PHQA 4X7EC 3EYOA 4HUXB 3QHTC 2VZSA 2HT4D 2RGSA 3GRWA 4PJ5B 4EEEA 4FQQA 5DD1H 1W72L 1FV1A 5FOJA 4HBCL 3GSOA 3MRFB 1DUZA 1Q94A 1WC7B 2J88L 2QHLA 4ONFH 3NCBB 2V7HA 1ZEAH 3WE6A 1KFAL 2APBA 1DUYB 3QH3A 3EHBD 4GKSA 5MI0B 4D3CL 1WV7T 5C0EA 2VO5A 1AJ7L 3AFLA 3BGMB 3QZWB 4NFBA 1F6AB 4NUJB 1JK8B 3ARFC 5EIQA 3EGSA 3B9KD 3AXLB 1YY8B 2CRZA 2X70B 5KOVC 4HKZB 3TNNA 4U49A 2ICCA 3DXAD 1G7LB 1CFTB 2IFFH 1HKLH 5DT1H 1GZPB 4Z78B 5KSAA 4LKCB 3WFHB 4NSKA 3EOBA 5AD0B 1NEZG 5E2WL 3UBXG 1KIPB 2JCCE 1INQB 5DDHB 2VXTL 1AR1C 1SVZA 2ADFL 1HWGB 2DBJA 1HEZB 3CFEB 3QQ4B 4Z76B 3QFDB 4JVPA 2IFGA 3DUHA 4WJ5A 1FE8H 5ITFA 5D71H 1IGCH 2KQNA 3HZYA 2AJUL 2J5LB 3WS3A 5I1HH 1K5NA 5TFSH 1JPFA 3SDCA 5KVFL 3RNKB 4H5SB 4MAYA 2VDKL 1R6VA 4W6YB 2V9RA 4YFLI 1RZFL 1RZIA 4DAGH 2ZG2A 1JNJA 2AXFA 5C0AB 5E8NA 3T2PA 3VXSA 2BXZA 4L9DA 4TNWK 1U6AH 5K9OA 1D9KA 1T1WB 4EI5C 2F58L 1BLNA 3EYUL 1MI5D 4MMXC 5E8EB 4QRUA 3DMMD 4K8RL 3M17A 1BBJB 1I9RL 2NY2D 3ME0A 5C09E 4DGVL 2EZ0C 3HZVA 2BVTA 5LAXB 5CEZD 3EKCA 3G08A 5FK9A 4FQXB 4XI5C 3IDXL 5I17B 4GW1A 2O61B 2XWJB 4S0TD 4BFBD 1N0XH 3PQYB 4Q0XL 2QQNL 1XCQB 3WNOA 4I9WD 4LKXB 1VFMA 4OGYH 5D6DC 3VFOB 1WISA 4WHTA 3S88L 3ZKMD 1VADA 3QO1B 1LO2H 1OL0A 5F9DC 5E08L 4UV4L 1R5IB 1VGKA 5EC1A 3LEXA 5HVGB 4LDLB 3HMXL 2E3VA 5GZNC 3HZMB 3OGOE 1QFOA 3K80A 5IHLB 5T33H 1U3HD 2NY1C 1EBAA 1H15A 4WHDA 3FMGH 4F33A 5IUSA 5F1OB 1ZA6B 2EE9A 4WDIB 2JIXD 1BBDH 1NBQA 2EDDA 2HKFL 4QXUH 2BSSA 2DN7A 2NZ9D 2FH8A 4MX7B 2DLTA 4KFZC 3RX8A 5SX4H 1TIUA 4NWTH 1ZMYA 1R5WB 3PWPE 15C8H 5E94B 3B5HA 5F7LB 3RBSA 1JRHL 2N56A 4WHCA 1ORQA 1WAAE 4S1SH 5MEPB 1QSZA 3BPLC 1AI1H 4XZUB 4XVTL 2K7QA 3PGCB 2P7TB 3K8LA 3PWUB 5KS9A 1U91B 1BF2A 4WTXA 4NRXB 4AK1A 2AK4D 4YHOL 3IS0X 4PP1D 1KEML 2JCCB 2V6HA 1CTOA 1KTRL 3N1GC 4U4BA 3ZZ1A 4XMPH 3CMGA 3FHAA 5E1AA 1WITA 4JPWH 1IVLA 1A5FH 3UTQA 5FO9A 2F8OA 1UJ3B 1G9ML 4LPCA 1QKZL 1NMAL 4YXLH 3Q1SH 3F58L 3C60C 4N0YH 2AJSL 2GJ6B 2GSIB 1QLRB 1Q1JL 5IHZA 1EK3A 1TCMA 5B38G 1UACL 1EUTA 3LKSB 2VISA 3WN5C 1U8NA 2HFGH 3BGMA 4GS7B 2WLYA 3QZWA 4MCYB 4I3GA 4MB4A 2DQGH 1CWVA 1OTTD 2OSLA 3PGFH 4BM7A 2UWEF 4JFDE 1YY8A 2X70A 4IIQB 4HKZA 4S10A 4PBVC 4U1SB 4PJ9D 1G7LA 2A6KB 4UAOB 3D0VB 1DN0B 4Z78A 4LKCA 1CLCA 3NGBC 1RJYB 2IQ9L 1UG9A 4XMLH 1GZQA 4YH6A 3CFBB 5K9JL 4YDKH 2EIZB 1ROWA 5EOTB 4MZ3A 1INQA 1WFOA 1F45A 5C8JB 4K23H 5BZWA 4ELKB 3CFEA 4MQ7A 4YHZL 3QQ4A 4MNGA 1CVSC 4Z76A 1WCQA 2YD5A 5IBUB 5T5FH 3BYYA 3QNYA 1TCRB 4G6FB 1Q72H 3GKWL 4J3UA 1J8HE 1TZHB 3NIFF 4JPKH 5I18H 2EC8A 3SDDD 3ZHLA 1CK0L 5ID1B 4U1GB 1TTUA 4AQ1B 4LHQB 1WZ1L 3QJFB 2IMMA 4BH8B 1F8TL 5D7JB 3BX7C 1GJIA 1MCSA 1T7VA 3WEXB 1A7NH 3IRZA 2IBGA 3IDNB 4BZ2H 3EDEA 3QUXC 2DMBA 4P9HC 2NXZC 5C0AA 3O4OC 2AJXH 5F9WB 4F3FA 1G0DA 4U0RC 1DQQB 4Z7WE 1AP2A 1FFOB 2W0LA 3P4MB 3V6FB 2F53A 5LGJA 1KIQA 1UFUA 3S5LG 2JJTA 5AYUL 3HCVB 1N0LA 5L7XL 1X5ZA 4MXQC 5F7KC 4AIZA 5MEOA 2RJMA 1G1YA 3QI9C 5L6YH 4QO1A 4QWWC 5LAXA 1YC8A 3HMXA 1FNEA 4LAJH 4N0FB 4XNXL 4RGMB 3PWPB 4OB5H 2FHCA 5EUKA 5CWSA 5FUCC 3UTSB 5I2IA 5FYJL 3MRJB 2XWJA 5F89B 1B2WH 5F71A 2NY5C 1XCQA 2G75B 4MNHB 1BQUA 1SYSB 3NA4A 3SDCD 3JWDH 1HH9B 3U30C 4MAYD 4QLRA 3H8NA 4WENB 1E4XH 3BP7B 3Q3GA 3QO1A 1JGVH 2I25N 3O4LE 1AIFA 5DJZA 4P23B 2OZ4A 4DFIA 1TNMA 1R5IA 3IJHA 4NHCL 3N06B 3KLAB 2I60H 5EU5B 2IAMD 4MXWL 3VXSD 1EUUA 1XIWC 3HZMA 4KI5E 4WW2F 1D9KD 3EOYG 5KJRL 2HFTA 3DX6B 3B3IA 4F8QA 4MJ5A 1RULH 2BK8A 2OTWB 4UI2A 4X8JB 4XPFL 1EO8H 3C5ZC 2YRLA 5LBSH 5MP6L 1PSKH 4MA1B 2FEDD 4JFDB 1ADQA 4CVWA 1F4XH 3WFCL 1JGUH 1AXIB 1MFCL 4PJCF 3LCYA 2X1XR 2Y72A 4NP4H 3ZTJG 2W9DH 1MFBL 4WV1B 2O5YH 2P7TA 4DVRH 4EUPB 5KW9L 4Y4FB 3HC0B 3WD5L 3LN5B 3MYJB 5C6TH 3TEUA 2JCCA 4ZAKB 5A2KH 4XHJD 4JO4L 4U7SA 1G7IA 2H32A 5D96C 4DZ8A 3U4AA 4KKNA 3QHZH 1UJ3A 5A1AA 1J8HB 1YEGL 4GW4A 5BQ7A 3VXUA 3L7FB 1QLRA 1SBSH 3RX5A 2PO6B 4P4KC 5DRZB 3QUMB 3UTTE 1FBIL 3U0WL 2X4NB 1ZANL 1IAKA 2VTFA 2X1PA 4KK8D 3TC9A 4Z7QE 3MREB 4MCYA 1OW0C 1VFUA 3ZLQC 4PGCA 1NBVH 5T3XH 4J6RH 5J6HA 4DN4H 4K71B 5EU3B 5HI3D 3OB8A 5AUMA 5IBLC 5HYSB 1MAJA 4KXZH 4Z7WB 2XZAL 3UEZA 4XWGL 1X5AA 5I9QB 5FM5O 3MLZH 3WHXB 4L4TA 2GCYB 2CDEA 1DN0A 4XBEH 1RSFA 4O5LL 1JUFB 3BIKB 3LDBC 1B3JA 4NQSB 5C09A 5GRUL 1F3JB 2EIZA 4IHOB 5EO0A 2P8PB 4PG2C 1QO3B 1YMME 1XH3A 2YPLB 5IK3B 4ELKA 5CZXC 4M7JH 1CFVH 5HGAB 4OCRH 3JV4A 3GGWB 3QEGL 5CIPA 3NZ8B 4JDTL 4XCEB 3S96B 5E4IA 1WWAX 3PV7A 4BK5A 1RPQA 4O2FA 1ULVA 5GS1C 5BZDA 3QJFA 1VFBA 2X7LB 5I30H 3O4LB 4KUZL 4N5ED 3UTPE 5D93B 1EGJL 3SCMC 1HINH 3V4PL 1F90H 1FJ1A 5TJWK 4NZTL 1AGEA 3STZB 1REIA 1DQQA 4CBPA 3P4MA 3V6FA 3SKMB 4GBXD 5ACMA 5DS8A 3ULUL 1JNNL 4H25B 5DJDB 5HHXL 1CU4H 1U8MB 1FNSL 4FQ2L 2PXYC 4KTYA 3C6LB 3PWJB 3ULUF 4QRPA 5ESQB 4PS4L 3MRIA 1YNKH 4N0FA 1A47A 2V9TA 3F12B 3N9GH 4JFZH 3WJJA 3ZDYF 2BOCB 5JIIA 1WAAA 1FORH 1WBZA 1I7RA 1M7IB 3I9GH 2G75A 3E6HB 4K8RD 4YDIH 1R24B 2D2OA 5I16A 5IMLB 1H3TA 4PJ8B 2Q8BL 4Y2OA 2IWGA 2CQVA 4N90D 4PY8I 3MLRH 4PJEF 5KTEH 1QFWH 4Z7UA 2VWEE 5LCVL 2Y25A 4QY8B 2GFBA 2BXYA 3U82B 5E00B 4HS8L 3KLAA 4KGJA 5D72H 2EH7H 5B38A 4E42B 3MLWH 3IFLL 2F53D 1RZ8B 2XYCA 2FL5B 2JB5L 4UDTA 1KTDB 3U4EB 3WYRA 1F11A 3DX6A 5CFHA 5J57B 5T1DH 1CE6B 1WT5A 4LLWA 3S36H 4WO4B 2OTWA 3UTTB 5F96L 2MCPH 1SHMA 5J06A 1J05B 1I7UB 3HNVL 3MROB 4NKQB 4UT9H 3OKNB 5L88L 4W6WB 3FZUD 3BRFA 3QNZA 3S35X 5IVXB 4LDOB 1NSNL 1AGCA 1FHGA 2WINA 4HUWB 3MNZB 1KN4H 1QYGH 2ZSVB 4AMKH 4WUKH 3ROOB 1QSVA 1YNLL 4RQQA 3O2WH 1XAUA 3MYJA 5H37H 3EYQD 1A7BA 2B5IB 4G8FA 4ZAKA 3L9RB 3OKDA 3P0YL 4ZD3L 5T1MB 1G9EA 4ODHH 4I48B 4OT1H 1JF1B 1XF4B 1U9KA 1K6QH 3MJ7B 5TQ0H 5DGRA 4ZFZB 5FKAB 3WLBA 1IZJA 1J8HA 4WW2C 4ODTL 2ZUQC 2ZNWA 4FP8H 2PO6A 4TNWF 4KVNH 5DRZA 2DKUA 5ECJE 3TN0B 1ZGLP 5CSZA 3GFUA 3L3HA 5IEKA 3LN4A 2GHWB 2HWZH 3VFMA 2E7CA 3UYPA 1XGRB 5HYJE 4X6CF 1NL0H 4ODSL 2DQIH 3B8YA 3CK0H 1FLTX 4KKLD 3TPUB 2E9BA 4ELMF 2J12B 1OHQA 2DQEH 3SO3C 4YBQC 3SPVA 3QDJE 4Z7WA 1UM6L 5A2IH 5DA0B 4ZTPH 2ZOKB 4WUUB 2ZZUT 4YFDB 4HEPG 4Y8AA 1K85A 3ARWA 3WHXA 1I4FA 3ARDB 2GCYA 3F7RA 1IM9D 3BKCL 1JUFA 1PX3A 2WV3A 3QPQD 1KN2L 4G5ZH 2MHAA 4MD4B 5DMJB 3U46A 1NDGA 2AJ3B 1QO3A 4OZIE 3N85L 2DWEA 1WBYB 5DZNA 1BP3B 3HI1B 2X1WL 3VXUD 4LSTL 3GGWA 1QACA 2P46B 5EORL 2VXSL 3S96A 5BS0D 3U0PB 4R90L 1UGNA 1BJ8A 3MFFB 2AW2A 1DBAL 4QF1A 5E4EB 1GC1L 3IDMB 4JKPL 3SDAB 1S9XB 5CINH 1VACA 4XCCL 2NTSP 3MCKA 5EWIL 3FN0L 1KTKE 3LS4H 1T0NA 2VDMH 4I3RH 2CLZB 1AY1H 5TF0A 3BZEB 1B0WA 1V8HA 3WNKA 4L4TD 1RZKH 2DLHA 5C0GB 4MDJB 3ZE1E 3MNWB 4H25A 4OI7A 3ZE0F 4YWGH 5C09D 1P4LA 1U8MA 5EOCL 4DZBB 3WV0A 3MJGX 4LFHD 1JGEB 3BE1L 3SE3C 4QHLB 4X7SL 3V8CA 3FB6B 4PRIE 3ZSTA