4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
3HJHA 1G8KA 2X1VA 1NLMA 3CJTA 4IQ8A 3ODGA 3WLJA 3B70A 4QGGA 5TQ0B 2WINI 1K86A 1F9NA 2ECPA 4R05A 1TLTA 4Q3KA 3R74A 3HA2A 4E7LA 3IEPA 3KVNA 4MHOA 2X5KO 2Y1LA 4ZICA 1WIWA 2HEOA 2WAMA 3BGWA 1BGWA 3T7JA 3TFWA 3A01A 1G9SA 1RR7A 3HEBA 4W5RA 2E36A 1ENZA 1HKQA 4LKOA 4XYEA 4PCLA 1ENOA 4NZPA 4ABZA 1IGNA 5EHIA 3D0OA 1GADO 2GLTA 4BBJA 5HUQA 3IALA 1AKWA 3AU9A 3BR5A 3ZXSA 2V7WA 2C2KA 4IIUA 1DEHA 1M0SA 4H18A 1VGVA 4YFVA 2EQBA 3E9DA 2XSJC 5FD8A 2JMWA 2PBZA 2H2DA 2QXUA 2GEDA 2Z9BA 5AVKA 3JTEA 4HY3A 5BN5A 3S1QJ 2OORA 5GONB 2OLJA 3ZW7A 5FQOA 4RVOA 4A23A 3ZQ7A 2Q2OA 4BRSA 3HKDB 4DA8A 1P2DA 2R97A 4BQOA 1ZMTA 2IPAB 4GR9A 5HIMA 4G0NA 1D2GA 4HPWA 4EJSA 5DT2A 2FRHA 1R6TA 2BHRA 3TDKA 5F7XA 1CJCA 3H04A 3VYVA 2AEMA 3FA2A 5FBQB 5KYXB 1N77A 2JIBA 4BLUA 3UHAA 3O9VA 3ROQA 1E5TA 1NE2A 2PMFA 2TYSB 4IRHA 4AM8A 4I6GA 1UB9A 4HMQA 3LSMA 1ZIXA 4YMIA 2XVAA 5TGDA 1X9HA 2DA7A 4J76A 1TPZA 1E62A 4QT0A 3TRFA 2GCIA 1G4DA 4MCJA 1ZL0A 1F2UB 1JT0A 3LYUA 1X2MA 3GTQJ 1F8YA 1YIAA 2ZVPX 1WKCA 2MSEB 4KYUA 1UBUS 2HB6A 4MYDA 4RK0A 4ZTZB 2NYUA 4EY4A 4NOLA 3HU2A 4V0MA 3JQCA 2I6QA 5A7GA 2H0QA 3KQTA 4WN9B 2WTNA 2PKXA 2DQSA 2W6ZA 3E5RA 1KYWA 3EQ7A 4J75A 1O8CA 3A4YA 1QV6A 3A7EA 4JDPA 4ZOLA 4BXFA 1KOJA 4IPTA 1MZBA 1XZJA 1W87A 3FZGA 4WESB 5EJGA 5J4HA 3QP5A 1MIJA 4KNYA 3OIGA 4LC0A 4DV4B 2HJSA 1ZKMA 3UIEA 1VJTA 5AVXA 3DU6A 4PJ0C 2GI4A 2H5EA 3NEUA 2R7OA 2J3KA 2E87A 3N75A 4JN6B 4XVHA 5BW8A 4JFRA 5IDWA 1RPNA 4HGOA 2ZUFA 2NUBA 5BNTA 4BNDA 2B7CA 3FNBA 4BX2A 3E84A 2GVNA 2NZXA 3QBJA 4RD4A 3WNCA 3THWB 4D0PA 4DADA 3PNBA 3O8OB 4E7PA 1JPJA 3G9TA 3CDIA 5D1NA 5AKZA 5ALOA 5K51A 4XJXA 3C8DA 2ZJ6A 4CIWA 1I9GA 1N5LA 1UH5A 4KLRA 1KAEA 2OCLA 4CQLA 1TTHA 4MO9A 1GSHA 1E98A 1WA5A 1ZW6A 2BKXA 4KGZA 4IXWA 3U1TA 3S3OA 1AHNA 1T5LA 2NAFA 2QRKA 2ATVA 1G3RA 1X7DA 2G88A 3ASYA 5I7OA 4A8JA 3DV9A 3MWYW 1GTJ1 3HO8A 1DNPA 5I9NA 1UJ2A 3R09A 3GFGA 4TWZA 4BLTA 5CNJA 4DY4A 4CTOA 3DVAA 3AB7A 3LUPA 3TF5A 1BI3A 1IOZA 5JMWA 4IXMA 5LD2B 3C2BA 2GO7A 1OYOA 1M0TA 3JQ7B 4I7EA 2JGAA 4X6YA 3ZDCA 1GR0A 4H77A 3NANA 2V7TA 2YVLA 1MW9X 3GVCA 4O2BB 3F22A 4NFSA 4DA9A 3BTUA 1TVCA 3CRQA 4BVGA 1Q14A 3BXHA 3NHKA 4IDEA 2FBHA 2QSFX 2R11A 1SMYF 1M34A 2K9SA 2JIQA 3KP4A 4WCGA 1K92A 1QH8B 5LHIA 2YWXA 3NS7A 2X5XA 2ZJ1A 3AR4A 4FR0A 5B3LA 1GPBA 2R7XA 1SHZA 2FK7A 1W36C 1HQCA 1C9NA 2IXBA 2KDZA 2UZ3A 2WTMA 2QYHA 4FLFA 2V0NA 3ICQB 4GXTA 5HF8A 1LDEA 3JWPA 5SZIA 1PFVA 3OLWA 4CH7A 2Q5FA 1EVJA 1DGWY 2GKGA 3IQDB 4XEHA 4J6FA 1D5VA 3MTJA 4YCBA 1ZCBA 2ZSAA 1DIHA 1TL8A 2AQHA 3EA0A 2VRWA 1ULAA 3N3AC 3NVDA 2ST1A 1NTCA 3ZE8A 5F5XA 4JCCA 5L3DA 2YRXA 3BOSA 3PUHA 4PIPA 1ZREA 2BI4A 1BX0A 3LWDA 3VR3A 2C2OA 3S1MJ 4BNDB 2DVMA 3AHCA 4GM4A 4IJ6A 4ZYVA 4MW6A 3GA7A 1O3QA 4HDQB 2V8OA 3K70D 1AZWA 3AESB 3PQ3A 5JCJD 1Q0TA 4XJVA 2A1IA 3DFZA 4Y6SA 1A3CA 1KP3A 2YWBA 4I4TF 2B69A 3LQ1A 1TAHA 5BNGA 4LOJA 4RIEA 4KB5A 2E35A 3F7TA 1FFBA 2Y05A 5F7OA 3RD5A 4ZXFA 4P35A 1WKVA 2PPVA 1WB6A 2J3QA 2DWOA 1MD9A 3EGEA 4J0QA 1KP2A 4MPDA 4ZCLA 4FMBB 4D9HA 4ZV7A 5A6SA 1L8LA 2FSPA 2ELHA 3BILA 3IVGA 1J75A 3LBAA 4OGFA 5FTNA 5D00A 1I24A 3DM9B 4KDPA 1LRLA 1VECA 2RBKA 3GLUA 2GN9A 3U5ZB 2QSZA 3OE4A 3RYCA 2QEQA 4H2DA 4AO7A 4UEWA 5EQDA 1MAHA 2W2PA 2PH5A 3HVHA 2VDWB 4TT3D 4QG3A 3GGPA 3OQHA 5HKAA 2DPUA 2J32A 2ZIAA 2GO1A 1WW3A 1F1ZA 3M70A 1ADFA 1YL5A 5DM70 3PSIA 5JLWA 1IQ0A 4U6NA 1RD4A 4DSZA 1RPZA 4DZJA 4NBSA 1BM9A 4CVNA 1Q12A 4DAEA 5HCNA 4G5SA 3TSCA 5EERA 5BSUA 2HW8A 1VNDA 2CJJA 5DMXA 2BTEA 4H7IA 4X91A 4BKOA 2JIRA 3PNSA 4IHJB 5DD8A 1OQYA 2XAGA 3KETA 2C99A 3HJAA 1A2KC 4X95A 1BS9A 2WM3A 4B6EA 5DTIA 4M9ZA 4HDSB 1XZEA 4Q01A 2JFGA 3G79A 3R6LA 4B82A 5B1DA 3W34A 5DCUA 2MBFA 2QQAA 1YT5A 2IGTA 3VOTA 1DB3A 4B40A 2BJHA 4W7IA 3ZWVA 4WBNA 4P3NA 1OCCH 1UMBA 3RWBA 3I72A 3UT0A 3UCFA 4Z5XA 1Z18A 2O8FA 2OK7A 2WIGA 4V0KA 2H29A 4HQEA 1N2IA 1VJGA 1Z0ZA 3VOEA 1AGXA 5G0SA 4M49A 5FA5A 1WDTA 2TS1A 3HJBA 3KQWA 5IJXA 4V2IA 3H5RA 3BTJA 1P1BA 3HDGA 4E4YA 4KR3A 4OHMA 5L4SA 3PPVA 1M8PA 3PXCX 3MSCA 5F7ZA 3QNUA 4LHXA 1Y8AA 3J7ZI 4L9TA 1WZEA 4HMPA 4BBAA 2HOTA 2STTA 1H8EA 1RWQA 1SULA 1Y6ZA 3A70A 3ONFA 4IJQA 2XA9A 1T1RA 4JYCA 3TDNA 3PNYA 1I1NA 1PFYA 4KJXA 1ZI8A 4B6QA 2CLOB 3PFWO 3GMDA 3CBGA 5BR7A 4QXPA 2EBFX 5HG0A 4JKYA 2PCLA 1OR7C 1CTQA 1JHDA 2PH3A 2QN7A 3AG6A 1AS0A 5KOHB 2FWMX 4G94A 2SBTA 4OU0A 2XB0X 2MU1A 3GOHA 2ZBUA 1XTPA 2WWGA 4C7OA 5DNAA 3QPHA 1AT1A 4UM8B 1TQHA 2ZSDA 4WCVA 5FOVA 4DQ0A 4DR2B 4HN4B 2Z2XA 4US2R 3DE7X 5FKMA 1FK8A 1YZUA 2QLNA 4AYWA 1DAKA 5HDKA 2IKSA 2P2ZA 2EXXA 2G0EA 4HB2A 5CIYA 4ARCA 5MHTA 4J29A 4W5OA 2ZYDA 2EBHX 3T1QA 4MWBA 3U7IA 2UZKA 1USWA 3VPSA 2ZRDA 1FBTA 1Q1ZA 1WJGA 2XOXA 3C8ZA 4LYYA 4LPKA 5BY2A 2IEKA 4NC6A 5AJWA 4CJXA 3FDXA 3NAQA 1UXOA 2GAFA 3DR3A 4EHDA 1NJ8A 1QRRA 1R9MA 3TOBA 3FM5A 1IJEA 2QN6A 3PXDA 3LFHA 4KGXA 5DV9A 2NT4A 1JG6A 3F98A 2L9RA 1ZM3A 3SR3A 2ZPUA 5I4BA 1AQ6A 1N2BA 3L7WA 3LC2O 1SD4A 3LG2A 2KP6A 3W5DA 4TYQA 4KSYA 5BQ5A 2V8BA 5JBQA 4BLWA 4MTDA 1NI4A 3KQHA 1ZK0A 3K4KA 2HC9A 4X1YA 1XKXA 5LEKA 1YZ3A 2GCEA 2BC9A 4A12A 2ZT8A 3DQQA 5B4VA 3WA7A 5FTMA 1RHKA 3VPAA 4A2QA 5BN1A 5I51A 5K05A 3AJAA 1N0IA 2KT0A 4QLAA 2XRLA 1TK2A 1JKMA 2C54A 4R8RA 4Y2PA 4P22A 2LIVA 2CBXA 1H8AC 4KYWA 3FDZB 5LXTF 3RC3A 5JNVA 3HG7A 3PF9A 4UM5A 2FP4A 5IPAA 3NC1C 4LK0F 4HH3C 4QUIA 1K8YB 3TPCA 3NC0C 5AW8A 2VP6A 3PQ6A 2MC4A 1J5EB 3DXZA 3OYEA 1OLTA 3PQ4A 3MZ8A 2WPDA 2ZR0A 1GDTA 4TS1A 1CF4A 2BFAA 3TQIA 3AEYA 1P1KA 3ERMA 2DA5A 4BEHB 1AURA 5E1XA 4IXAA 1CQJA 1R9GA 1XLUA 3CURA 3KKLA 4BMCA 3CX8A 2EPFA 3A1TA 3STUA 1ZRFA 2HNAA 4HA8A 1RC9A 5GZ1A 1J9IA 3QWHA 3E1KA 4MKFA 3U3OA 3V9AA 2VPRA 3H11B 1IDYA 4YJHB 4BUCA 4RPJA 3L2OB 3CLQA 1Q1HA 4ZYDA 1SOAA 2OFXA 2QRUA 3BJIC 1UJMA 4HB4A 4RKRA 1DDNA 2IWRA 4DIBA 4UTXA 5KVQA 2FI1A 2J5PA 1GGEA 1N6PA 1TE2A 3KEYA 2I9PA 2OV6A 1X1PA 2OV2A 2OV4A 4P1WA 3FZQA 1LDNA 5FA6A 5A4KA 1Z3IX 2ID3A 5LKAA 4RV9A 4DQKA 3GRVA 3T5PA 2GD1O 5GTHC 3VNRA 3SWWA 5BVHA 2VVTA 3RYIB 1S3SA 3V4LA 4PSAA 2CZCA 4YAKA 1TU4A 3OPNA 4JELA 1I4LD 2X5JO 1MORA 5CYFA 3LZ6A 1ZR2A 1Z75A 4NQZA 3V34A 3WODF 2OBBA 3R6DA 1N2CA 3ZWAA 1AMUA 3RKYA 1G5RA 2QP3A 3ZXUB 4M8LA 1EK6A 2JGNA 4U7DA 1GT91 4NG5A 4PO3X 3WBFA 4NNOA 2FR1A 3TM4A 4XR4A 2DC1A 4DYHA 3RKSA 4PC6A 1GNQA 1WZNA 5KS2A 2VSNA 4JOMA 3ZJYA 4KE7A 2AMLA 2HPHA 1V1JA 5H02A 1GGHA 4N5NA 4ZVOA 1XRJA 1NYLA 1F3LA 4W5NA 1BE6A 2CVPA 3QNWA 3LP6A 5LMZA 4JD5A 1IXRC 4OEHA 5DLQC 4TLBA 5TMPA 1BXRA 1KZ7B 3GQBA 4R9VA 1I39A 5FHRA 2O2ZA 5LQAA 3HSYA 4PYLA 1N0VC 4IHXA 3LHKA 2DMPA 4FWBA 4KO8A 2HLDA 5GAJA 5CYVA 3SZUA 1X7YB 1ULBA 1R66A 2J30A 2XBUA 2PL5A 2IS4A 1KH2A 3B82A 2OWEA 5AM1A 4DPKA 4MIEA 2WTBA 1WULS 3LQKA 3LUGA 3PO3J 5EOVA 3RRXA 5C37A 4OMCA 3SBEA 1SVNA 5A03A 1G59A 5E4JA 1OWMA 4PN7A 2WIBA 2WB4A 1LH0A 3CLVA 5FI5A 1RQ2A 1Z5PA 3UJBA 1X80A 5GWXA 1MNAA 1ISSA 2B8NA 2BY0A 5E1WA 1D8AA 4HI0E 3ZDQA 1OB5A 3K10A 2CVOA 3NUZA 4IDQA 3ZI4A 2XLCA 2KIQA 2XGCA 2HK9A 3CG0A 2DHDA 4FMCF 4G1FA 4GC9A 3SKXA 1B4DA 4MDFA 2IPXA 3AOGA 2JAOA 1SBZA 4U6QA 4M9QA 4XDGA 3OQIA 5B2ZA 3UTCA 3ZCSA 4XWOA 1EX6A 3TTSA 2KZGA 1E3DA 1PL0A 3QG1A 4AJOA 3E9QA 1NRXA 4BLPA 2V9CA 3H0CA 2OGWA 2JKYA 1LSUA 1SB9A 1V0JA 2C88A 3BE8A 3PLNA 1BHO1 3LPMA 3TG8A 4XCXA 3D5RC 1A6IA 4V19K 4N0MA 2Z30A 2A61A 2QL9A 4JI1B 1SKMA 2CDBA 1RI2A 3NOOA 5JV5A 4MQFA 5CH8A 4RCZA 1Q0PA 3NG1A 4PZ9A 1AQIA 2BMJA 4OL0A 4TL6A 4UPDA 3BLYA 1RJGA 5AVZA 3D7LA 5J2TA 1ZU4A 3AM4A 5I01A 2QAGA 4Z3KA 2NTEA 4YJFA 3A6LA 3DJYA 4TZTA 2SECE 1I7PA 4JI4B 4BX8A 4F1KA 1O4WA 2DUJA 3LQQA 2NQTA 2XT0A 3AUXA 3AYXB 3CE6A 4PO1A 4HXFB 4ZAVA 2HDWA 3BR0A 2AFHB 4JQOA 4XEUA 4AC9A 3DO8A 4RGBA 5KQSA 4EGYA 1EDEA 1V4NA 2YDYA 1IRIA 1WW8A 1PGPA 2VZLA 3NIBA 3PGVA 4YROA 1G8MA 1TO6A 4A7PA 3A2MA 4FNAA 4EYQA 5EXXA 4CTKA 2P78A 2CNOA 2KJQA 4JP1A 2REOA 4RESA 3QEMB 1JHOA 2YS9A 1NSYA 1P72A 3MD9A 5I7UA 4FM9A 3QZUA 5BT9A 3QF4B 1KR5A 4BFZA 2H1LA 1GZ4A 1H8HA 4BWGA 3BGIA 3A32A 3UAGA 3OCWA 4ZYXA 5HKLA 5JXHA 1HDEA 3L82B 4Q5IA 3NIWA 1QIGA 1ORDA 2H06A 2WM8A 3GLKA 3M49A 4KDCA 5K6RA 5JXWA 3MJDA 4HAYA 1F14A 5K8UA 2JLZA 2FPGA 3GXBA 4NCHA 3Q5GA 4RACA 3K5WA 1RJ9A 3T4XA 4AECA 5ALTA 5G1NA 3UOWA 4AG5A 1EWRA 1OMOA 3IQEA 4EA7A 3ZWBA 1RLIA 1U7TA 2YWEA 1T6YA 3NNSA 1XEXB 3OT5A 1G5IA 4M1MA 1Z6GA 5EIEA 3GUYA 1MO3A 2MABA 4BCBA 2UYQA 2QU7A 1G3MA 4G26A 5CEJA 3D6JA 3KJEA 1U0NA 4QYMA 1XGNA 3H7IA 1K7FB 4H31A 2HTJA 2A58A 3F46A 5JNUA 3U7GA 4NMWA 2ZRAA 2RVCA 1CJSA 2PWYA 3MUFA 3Q11A 2CL6X 2EFCB 2TSYB 4IHJA 3QLVC 1KJWA 4K9OA 5K3BA 3A2LA 3U13A 3U1BA 1UCFA 3PIOF 2ZXIA 4FLEA 5KU1A 3LIIA 1GUUA 1E0DA 1WG8A 3QXXA 1C7IA 1JP7A 2BEUA 3ENKA 3H87A 3ZZNA 4GOXA 3TMAA 3I5UA 1D7OA 2XVXA 1NUSA 2HQ1A 4WOPA 2ZUDA 4I5EA 2GAIA 4EI7A 2XROA 2TRTA 3HJNA 1CUSA 4DMMA 5D86A 4CRWB 2OR3A 1WJDA 1NN0A 4HDVA 3C5HA 4ZYAA 2C4TA 3G2LA 3PNLA 2FSVA 2F4VB 1XRLA 3L6RA 3I62A 4RK5A 1MQ9A 2CXNA 1RYDA 1VDMA 2FLWA 4QODA 4LRTB 2JZNA 1E5XA 2FKAA 3MSXA 3T1HB 2O7QA 3FHJA 4B73A 2PMZA 2P6NA 1VE9A 1MX3A 1K8RA 2XJ9A 2ZIEA 1O9GA 4GPTA 2E4ZA 3V4RA 1YUBA 4Q9LA 1YQDA 2FOXA 1OILA 4YRQA 2HU7A 2V79A 1YJAA 4WVFA 5TY0A 4E7ZA 4ZQHA 2IV7A 3OT4A 1N92A 3FTFA 3ZBQA 4OM7A 4W5JA 3QFTA 1T38A 1WQ1R 4B6FA 1UDRA 421PA 2DMRA 1TUIA 3OTHA 5KJFA 3DOOA 4HLCA 2Q5JA 1AC5A 9ANTA 2QSJA 2RCYA 3CGGA 3DZIA 2CBZA 1R1VA 2YFQA 3OZDA 1GRCA 1GO2A 1QE0A 3TL2A 2OZUA 4IUCS 3DVQX 3NETA 2OAQ1 4YT4A 2EKDA 3BJ6A 2DUWA 2H2GA 2PEZA 2ZYWX 5JJCA 1CUVA 2FPIA 1U2DA 4HWPA 2ZI7A 2V6IA 2WF5A 3H36A 3IBFA 2YBDA 1RCFA 3PXEA 4FCVA 4IH1A 5AO9A 3AR8A 2IXTA 4ZI3A 5BMOA 5KQMA 2GBCA 1K79A 1J33A 4DEYA 1PV4A 4CCLA 5AI4A 3PPWA 1ECJA 5FNVF 1JTYA 2W2LD 4IKEA 1CFJA 4NHJA 3N1UA 3RC2A 1P9RA 3G2HA 2AYYA 3HBFA 4CKZA 2DFDA 3R8FA 1T33A 5IC4A 1RC0A 3QEJA 1KNQA 4F11A 5JDCC 2ZJ8A 1PR4A 3GLFE 2R84A 2VKHA 3JR9A 2D5BA 2R48A 4NULA 5CVIA 5KTKA 2IDKA 2JRCA 1FNNA 1WCIA 4DLXA 3DE3X 3MLEA 2XV4S 2G8NA 1RBYA 2Z2KA 3S1NJ 3EQ8A 3DOIA 5EJ9A 4PO9A 1Y63A 1XDDA 3O73A 4R9RA 1T35A 4DJTA 3JZMA 2PD6A 1S8OA 4U3JB 3U3XA 5HK9A 4O2BA 5FUYA 2QQGA 4MB0A 1GP2A 1EPUA 4P9NA 5DTEA 5T6BA 3UB4A 4Y17A 4RW0A 2IYZA 1Q0HA 2WLTA 4LRXA 5AK3A 2LY2A 1CEXA 2PKCA 1O5TA 2NZWA 4BZQA 2PV7A 4IJMA 1UKBA 3MJ4A 5THKA 1P1JA 1JHYA 2D1QA 2WJGA 1KXJA 2OOSA 3JVUA 2B5OA 2JFPA 1WOYA 4IFTA 4JHXA 2VZ0A 4R81A 3RUPA 4L28A 3TTXA 4D6YA 4ETWA 2VDVE 4K1LA 3NDJA 1EFUA 2JW5A 2HYDA 3PQ7A 4LI0A 4BVEA 3HHGA 4RAFA 3DCJA 4MI3A 1XRPA 1XMVA 3N39C 2I5PO 2NXEA 4WCDA 4OHCA 4CSWA 1Q7CA 1T9GS 2ZXJA 4RA6A 4KW7A 3RSCA 5KKCA 3Q40A 4KQ2A 3JQPA 1OFIA 2PLNA 4D26A 3G9QA 1QANA 1Y80A 1L8AA 4ITUA 3I6ZA 4WLUA 2IUTA 3I6QA 3TSZA 5ALNA 2GM9A 2ZRQA 1N75A 2VXZA 4MUEA 5IHXA 2G76A 2ERCA 1EH6A 4PZUA 2D1RA 3LLCA 3BZ6A 3SMVA 4LN1A 3C41J 4I4CA 1G6NA 1YYVA 2ZYHA 1VZ3A 1LNSA 3I0TA 3OWXA 3QVWA 3EZYA 4NMMA 1S96A 2I9KA 1HFKA 4ATNA 1B6GA 3TBHA 1CUDA 1I8TA 3P1JA 5JEEA 1CQPA 3BB4A 3GFFA 1E92A 2IUEA 1D0XA 3AI3A 3QVTA 1JDNA 2VN8A 1MH1A 4KUHA 4OTZA 1B23P 2PMKA 3TINA 2ZNYA 1EVQA 4OD0A 2DJIA 3OJWA 4JDUA 1NF2A 4XQGA 5BSGA 1J49A 5A2QA 5IVHA 4ZVRA 4B2YA 5EIBC 3ZGZA 1V48A 5LA6A 4OHRA 3FTDA 1KI8A 2FFQA 1YRQA 1OGIA 1PO7A 2AZDA 4BB5A 4FTHA 3MJHA 1PD1A 2HA6A 3FHZA 1FUEA 1U3TA 2IPQX 2C3YA 4X97A 4ESEA 3KZCA 7GPBA 2VJAA 4A9AA 2JLAA 1I33A 5HE9A 1RAFA 2B6HA 4CQMD 5IJAA 4C6TB 3NWTA 3ISVA 2BBTA 3OH8A 4MKRA 3P5JA 5ICEA 2B98A 3DLCA 5LP6C 4CF7A 5JDCA 2O7VA 4CMIB 5F73A 6ADHA 5ILGA 1KJ8A 5J3LA 1R3UA 1S1CA 3QKUA 4OMFG 2OC4A 4P81A 4YO7A 1N9GA 3GCMA 3C6QA 5CYOA 5FUBA 2G9NA 2EZHA 3CW9A 3MM4A 2GCPA 3V1NA 1RRCA 5C1DA 3E4DA 4O63O 4QUHA 2ZULA 1ESMA 3SM9A 1H5NA 1G6KA 3VOBA 2BUAA 1U2DC 3BJMA 1AUPA 5FNVB 2GOXB 1WD5A 1ZH0A 1QC5A 1LTQA 1C7RA 2D1FA 2GZ2A 2P3QA 4LIVA 2XMDA 3AVOA 2C9ZA 5A3RA 1GXPA 4ZDJA 5C2JB 4F84A 4FZVA 5KCZA 1U0BB 1NUQA 1HLPA 5EVCA 3W8RA 2V7PA 1H0HA 1K7XB 3UWDA 4RXMA 5ICCA 2G4LA 2R8ZA 3IXQA 5HOOA 3NAMA 3VDRA 2P6RA 4ND6A 2JC3A 4HAZA 3E8SA 4CL8A 4WX2B 4U6SA 3EBLA 4Y18A 3WKCA 2HEIA 1PHPA 3ELWA 1M0WA 1E5LA 2MJLA 1SFKA 2DU8A 3LXUX 4MWEA 4NJOA 5F0CA 3QWLA 4OMUA 3ITKA 4NNPA 3UT5B 3I3LA 3MWEB 1ZRSA 3VFDA 2MSNA 3KYDB 1LPPA 4GRIA 3R3ZA 5D6NA 1HRDA 4BVAA 1Y3FE 3KP1A 4P2BA 4B7AA 4LNHA 4FT8A 1Y9EA 2H4FA 1WXHA 3ER8A 1ZUIA 2E48A 4GKJB 1Y3IA 4G9BA 2OKCA 2E4VA 4ON0A 4U7FA 3OZTA 1QG6A 3FHLA 4C3HJ 4NICA 1J2JA 2I1WA 2Y66A 4Y7CA 1SG9A 4GMKA 3RBAA 3RH0A 1ZQ3P 1KY5A 3CUSA 1R6DA 3AGQA 2FZ5A 3JVVA 5JARA 3K6SB 4MDYA 1WLYA 2PYIA 2VJPA 1M72A 4YRTA 1JR3A 1TX4B 1P5FA 1WI3A 3DLLF 2HQNA 2DFPA 2YHIA 3F67A 2XYVA 3NR2A 4Q02A 3TCXB 4A0HA 1IJKA 2NUAA 3PD7A 3EVNA 2WKWA 3M6MD 1WCMJ 2IIPA 3WYDA 2R60A 4X5OA 2MH2A 2H07A 4LJ7A 4C9BA 4F6RB 1NAHA 2XGOA 3ZE7A 4A3EJ 5BOVA 1BJAA 3QLVA 3K0EA 1XD8A 4KQHA 5A7HA 4MV8A 2C2GA 1AY0A 3EIUA 1FTWA 3ZMDA 1SCQA 2AG1A 3RSSA 3I6IA 3L9FA 1AKUA 2WKQA 1IRFA 4LSMA 1GHTA 4QELA 3PX2A 4H15A 2PGAA 4ZI5A 2OC9A 4B4KA 3JSOA 2QRJA 3TQQA 2XR1A 1QIDA 2WMDA 1SUPA 2A1UB 1VQKI 2QGNA 1K3UB 2ZXFA 2YNMA 3GRRA 3GT0A 5JS8A 2W57A 4KLNA 4C0QC 2HR1A 1MXHA 2F90A 2WJYA 5LD2C 4MW4A 1FRQA 1DX4A 2WKSA 2Y4NA 1K7EB 1XDBA 1JKOC 3F1LA 5IOZA 2PU7A 1PGQA 3K0AA 4FEEA 2DTZA 2ZDHA 3K2BA 3G2MA 2VDOB 3ZCRA 4E5MA 3IYLW 3QUAA 4JLNA 4OXIA 4LF7B 1HDRA 3DEJA 3N2NA 1T0PA 2W7TA 1BX1A 1QONA 2BEKA 3WP1B 1WB9A 1G5FA 1X87A 2OCAA 4BJ6C 3QX7A 3B1KA 4CIXA 3M3PA 2W90A 3HCBA 5F23A 2FCAA 4OSPA 3QHAA 4LXIA 3KSDO 4UHFA 1JMKC 1QFJA 2IWHA 1KR2A 3ZVKA 3PX3A 4AIRA 4GYGA 3VYRB 4P4TA 4Q7QA 4IMRA 2AQEA 4AMGA 3TZBA 1NX6A 4UAGA 1Q16A 4YAFA 3WY9A 2BBWA 4HSRA 1KFEB 3O95A 4R83A 3MN2A 2D45A 1U3GA 1XYGA 3OZFA 2WA2A 4XJSA 4F06A 3KFLA 1YXMA 3TR5A 3ANLA 4PX9A 5IKOA 3A4IA 4L9SA 3E7LA 1REPC 1EH5A 3IVXA 2D00A 3PHGA 3STHA 1Z21A 1TQ2A 3EUFA 4HZUA 1SANA 4D41A 2FE4A 3VAAA 4F56A 2IDZA 1OA1A 4PYQA 2J9GA 5MFZA 1KYIA 5CVJA 4PN3A 2PHZA 2B9SA 4OQLA 3ZWQA 4AXXA 3IUQA 3BWXA 3K5PA 1YS2X 4YT5A 1Z12A 4YY3B 2JL1A 3OZVA 5JOQA 1KH3A 1J99A 3QAHA 2C4KA 2G17A 1UBEA 2P5SA 4ABYA 4BNVA 5BVGA 1Q7EA 4UB8C 2UYYA 1MV8A 2EJRA 1F2DA 3WJAA 1TC3C 2E4WA 1HE5A 5E4FA 3T5GA 3AVWA 4B09A 5ILUA 2CJXA 1K83J 1A96A 3X1KA 1P7YA 5KC9A 13PKA 4OL9A 1VYVA 2XKPA 2O1SA 5F1JA 1F43A 5FLYA 1XN1A 3QU3A 3QXJA 2P1ZA 4P96A 4Z9YA 4GR4A 2HA3A 3NRCA 2MYUA 3N2IA 3LDHA 4EGFA 4V2FA 4AKTA 3N2KB 1S6LA 4GSKA 4NWIA 3W9YA 2DR3A 1GYPA 1G6OA 4K5QA 1Z7YA 2CD9A 2QQEA 3K1PA 1G3UA 2K27A 5FB3A 3R7AA 4EEXA 1UJNA 5LA6B 4F4DA 1FFSA 4V0ME 1GN8A 3L8FA 2Y99A 2FMHA 3OX1A 4XSHA 1KDYA 2X0JA 4XRFA 3EGWA 4IIYA 4DV2B 3QYJA 5IXJA 3GMIA 2G83A 3DAYA 5TQ0A 4Z7NB 1T24A 3K1JA 1ANKA 3CKKA 4GXRA 3SZPA 1R1UA 1DG1G 2ICAA 2BGIA 3BXPA 4HUQA 1OAAA 3ORQA 3EZGA 4QOEA 3RJMA 2AL7A 2RB4A 2ACEA 4B4WA 2NPIA 3RIGA 1LEAA 3WLRA 4LXXA 2XGMA 3NIFB 2HPIA 2AOXA 4O4HF 3PNKA 4RKYA 3L00A 2COMA 3B9PA 3QV1A 3IH5A 1RZRA 2HRCA 1XTSA 2O3SA 3NOXA 3GROA 4TMZA 2C9OA 2GN8A 5F21A 4FMCB 1X8LA 1SVKA 4BAYA 1J2TA 1BEEA 5C1OA 5LSAA 1VI0A 3U09A 1BHJA 1HBJA 2HMWA 4H1HA 2VKTA 3OF2A 1OCEA 4K8RB 2ZB9A 1IBLB 4O0LA 4AUNA 2CQKA 5EAIA 1LLCA 4MI1A 3PUJA 3NYWA 4HVAA 1R4AA 1EWTA 1PK9A 1VIVA 4BL0B 4F97A 4FN4A 1P1HA 4J0CA 4DBLC 2IGOA 3FUTA 4DUGA 1YCHA 5L6LB 4TKMA 1GU7A 3OOWA 5CM9C 2OILA 5HILA 5B64A 2GPSA 3S55A 3CX3A 4P1ZA 3VX4A 3D4PA 1FNBA 4OVKA 4W6QA 4YFYA 5EJ2A 4DMGA 1WSWA 2ZWIA 5ECYA 1YZLA 2G5PA 4CLRA 2IT0A 3HL2A 1RZUA 3ITNA 1A5ZA 2D2FA 4YAEA 2FF4A 3QJGA 5DM60 4D81A 2VF2A 2D8AA 3N05A 1AD2A 1VQ8I 1JMYA 1Z8FA 4Y2XA 4FX4A 2YOGA 2C5HA 2JSPA 5DGCA 1UBJS 1QO9A 3W5HA 3HRUA 4GUDA 4ZEWA 1YD7A 2XRYA 4RUKA 3UCEA 5T3YA 3VSBA 2ID4A 2X7JA 3ONDA 4JUCA 1KJQA 3QRWA 4G1VA 3QX3A 1B0UA 3VNSA 3KEFA 1RRMA 4DMFA 3IUSA 4EYOA 3I9KA 2J46A 1U1DA 1U8CB 4L7QA 4NESA 5FI0B 2A5YB 1H69A 5HVQC 1PQPA 1DDIA 3FDIA 2NVUA 2CL5A 2B8TA 3VTZA 3ABKH 1IBCA 1VQLI 5JANA 5G02A 3AINA 3NMUF 3FWEA 2H1KA 1LBIA 1PR0A 2QIPA 3BSSA 3RSNA 3D31A 4BNKA 5A9RA 3EXHB 5KREA 1A4RA 1X7HA 2A5JA 2DPMA 5F04A 1OI4A 1XSDA 2BRUA 2ONCA 4CQMB 1ILEA 3LOCA 4M3FA 1C41A 1UBCA 3Q9NA 3LS2A 1DWOA 4OYRA 2Y9YA 4FONA 3UK2A 1WJFA 4XR9A 5L95A 2JJ7A 5FLXZ 2OL4A 3VR1A 3ZQLA 1U4SA 1IM2A 4ODIA 5DXAA 4WN3A 4LWOA 3V7YA 3EIXA 2RKWA 4RFLA 4X20A 4F5DA 2ZKLA 2NRAC 4GYIA 4QGAA 3FI9A 2D5LA 1T0JB 4DRXA 3PTAA 4YI3A 1DJLA 2JGJA 4O4HB 3LRXA 3FCSB 3FTQA 2E21A 4P31A 5LIRA 3T54A 1WCYA 3DZFA 3C43A 1PT6A 4ZVSA 5KPDA 3VVBA 1Z0FA 4B5KA 3TO9A 5L3GA 2GOMA 2NTYC 4TYYA 2FR8A 3WKBA 3K1AB 1DQRA 2WYUA 1FY2A 1RPAA 1T5HX 2DA1A 4LHSA 3K9FC 4D7AA 4MINA 2O1WA 2CHQA 4JYBA 2WJVA 2DA3A 2CLIB 4QAQA 4UAUA 2WK1A 3ZIAD 2CVFA 1HE1C 2EIKH 3GTMJ 1A7UA 1AO3A 1H0KA 2PX8A 1JR2A 2WV0A 4PAWA 4S0ZA 3WYCA 1GSAA 4AN0A 1H9CA 2LREA 2XPUA 1Z0JA 2G9WA 5DHAA 3KQQA 3VR2A 1P31A 5L7WA 5FWDA 4D57A 5BV8A 4M9RA 3KPYA 4TV8A 3BD8A 3PR1A 2IE8A 5SZHB 3K05A 1PUFB 1WBJB 2QGFA 3UAXA 3BPXA 4R8KA 3DCFA 4IHVA 1GQFA 3B6AA 1O96B 1OY1A 3A3NA 3S2ZA 1BDBA 1I51A 2FETA 4J3NA 3LC7O 2QMQA 1JYFA 3BDDA 3IA2A 1ISRA 2FP4B 2RGYA 1GG2A 5KYWA 1RXYA 1K61A 1A95A 3DKVA 2RE8A 3VKFA 1DEXA 2KMUA 1Z5NA 4ND8A 3U48A 4AYBA 3X44A 1DBIA 1I5OA 5G0WA 3GJQA 1JAYA 2J3DA 2ZSEA 3EPHA 1XNJA 3HO6A 3EXAA 1RQGA 1PJZA 2GGSA 1Z82A 1EGMB 4JUAA 2I6GA 2R25B 4B46A 4N82A 3R3XA 4DRZA 2AFIB 3OZBA 4IV0A 5C32A 2DU9A 1SQFA 2ARKA 5DBFA 5H20A 4YRCA 1LK0A 1V7ZA 1C3OB 1QF7A 3D1VA 1M2EA 1M5TA 2DP4E 1G21A 1PFKA 3BEDA 3FVQA 3H84A 3LUHA 1UJCA 2NZUG 2PZJA 1MBHA 2YIMA 2WY2D 3T9EA 1L4FA 2HJRA 2J3EA 4DTIA 4ID3A 3HKBB 3KUUA 3J80A 4ENMA 1T6SA 1X58A 1AKHA 1XN4A 2NXWA 5DB4A 3PA8A 4AZ0A 4EUFA 4OAOA 5HR5A 5JVDF 4ZCPA 3O8LA 3OIDA 4MV6A 4YT2A 1I2DA 5AW4A 3MS7A 3V8PA 1U0HC 3GVAA 4B0OA 3SDSA 3WGVA 3BM5A 5CBPB 4FXOA 2NSHA 2AI3A 4YVFA 3HN2A 4LXUA 2ACJA 5ALIA 4FSXA 1DTWA 4P9UA 2PLFA 1K8QA 2VR1A 3NO4A 4MIKA 5JMTA 2JIMA 4TUYF 3BCHA 2X76A 2RGEA 1ZC3A 3DB2A 5BW4A 4DLZA 4IG4A 1VJ5A 1PEYA 1FRFS 2AOWA 2G7ZA 1KAMA 3QOWA 5I9MA 2VE9A 1CJTC 1EFPB 1TJ3A 1C3VA 3EWNA 3IQGX 4AP6A 3C98A 1C4WA 1CK4A 3GPBA 2A5GA 3R6GA 4LVOA 3K94A 4JMPA 1RYNA 1U8YA 4GOLD 3PWKA 4D9KA 1HH4A 4GX5A 1JPUA 3N8NA 1R10A 1S7GA 1BI2A 3NDIA 4GOMD 1PF7E 3I73A 3IPLA 2FGJA 1R1TA 1JSRA 3X1YA 1LBEA 1M2GA 2KB0A 4BLVA 5K8JB 1ATIA 3A6HA 3HBJA 3LC1O 4OF4A 3E15A 2EJTA 2QAGB 4YJFB 2Q2WA 3V8JA 3QP9A 4Z51A 2VQFB 1C8BA 3E9CA 3MWJA 4EG0A 1CFZA 3CR7A 2X3UA 1H9TA 3W8NA 3V42A 1Q92A 3HSKA 1U7DA 1W1IA 3B3JA 2FWIA 5AJXA 4JQZA 2G25A 2LTPA 1UWCA 3OJEA 1QR6A 5J5AA 4DQVA 1LRJA 2C7VA 3FVTA 4I6EA 2BEVA 3I1YA 4AAYA 3TCNA 3HZZA 3CZMA 3GGJA 4A0XA 1Y1RA 2X0NA 3PF8A 4F9EA 2ZB4A 1W7PD 3G8BA 2V6MA 4G24A 2PJRA 4RVNA 4OFZA 2GEKA 1MDBA 4MYSA 3AEQB 3TQTA 3J80Z 4M7PA 4A5MA 4ARSA 3TLGB 1WSDA 1JHQA 1UXJA 1BW9B 2P4HX 3GLXA 4NDNE 2RGAA 3FDFA 5HF6A 1ZM9A 3UHPA 5CLSA 4UREA 1NVTA 2ONZA 4RTPA 1SUEA 4XTCS 4WZAE 1JXAA 4IZOA 5CT9A 1IAQA 1PZXA 1UFRA 1N1MA 5BSKA 4B2IA 3M5PA 2HDCA 4TL8A 5DEOA 5I7HA 4UVHA 4FE3A 1JLRA 2BGKA 2RAFA 3M1YA 4KMOA 1LB1B 1MOSA 1DDOA 4UCWA 3QLJA 5FKLA 4BV8A 5C7OO 1I0LA 1R4MA 1ZRHA 2QE7D 2V26A 1SJ9A 3QKSA 4N0PA 4RVDA 4QU8A 2XQJA 5DI3B 4CE6A 2A7XA 4CKWA 2FQYA 1AMOA 4W1QA 3EBOA 5TMDA 4BFVA 3SYMA 2J07A 3V3TA 4M72A 2CZQA 3PHHA 2CMKA 2HKIA 4FMDF 2XVCA 4YAOA 5DW3A 3JYHA 4JVNA 4ZRMA 2MDTA 2I2DA 1IG3A 2VQGA 2ACVA 1YC5A 1AK9A 1SCKA 2OGTA 3DSRA 3WLSA 5ADWA 4FGLA 4INAA 1JR6A 1FRNA 4KAXA 2HIMA 1V11A 3SBOA 2MSDB 4TL9A 4PLTA 5D84A 2J4DA 5SYNA 2JA2A 2V9KA 5JQGB 3CPJB 4PE5B 3OFNA 4UPVA 4I98B 4D5FA 4B5LA 1KXZA 2HWKA 4KN5A 2SKEA 3IUNA 3WGMA 1MD0A 3GBGA 3U4CA 3JVIA 2IA2A 1J9EA 2GFHA 4ZVKA 2GQQA 4FYJA 2LWIA 5DNCA 5JSQA 1S01A 4WNAB 3R7WB 1KDTA 3H5TA 4CFZA 3MGAA 3G13A 1XQVA 2QTRA 1KPIA 3P5SA 2QMYA 4KPFC 5AVTA 2AG5A 4A8JC 5J4KA 1SHKA 3DWIA 3ESCA 3KNZA 3DEEA 3IRRA 5BN4B 1R36A 4A3BJ 2WDZA 3ONVA 1GKUB 5ULLA 2D6FA 2QVCA 4RGYA 1QPIA 1PFUA 4MMXB 1OFHA 4MKHA 1Q1NA 4UDNA 3E3OA 1D3AA 3RAGA 3KFWX 1A4XA 4EYEA 1HT0A 1G20A 1BH2A 5LQKA 1C9YA 3TQHA 5B58T 4POAA 4CLDA 2D2VA 3SQLA 2OHOA 3OQJA 4PG5A 2YXLA 3ULQB 2BHNA 3AQIA 1DO8A 1CRQA 4HR7A 2XGDA 4YUWA 2O5CA 1QPBA 5G53C 3MMNA 4KHZA 3DKPA 3I4CA 4HX7A 2HTEA 4GOKA 1SD7A 2YUSA 1BI0A 3NWSA 4FISA 2JJ1A 2Y3IA 3L6UA 4DDWA 5BSEA 10MHA 1FVXA 3CUTA 2PU5A 1JU9A 2RHJA 3D4OA 1WXDA 2O7NA 4W7HA 4WUVA 4EPYA 1VPDA 1DC4A 4YLEA 4BFUA 2BR5A 1ZJWA 4GGMX 2F2TA 1M8JA 2VKDA 3QW4B 5EYPB 4CEJB 1I32A 3CEAA 5I45A 1UK6A 4LTDA 1PSDA 4BX9A 1CGPA 2WQ7A 4I2OA 4YPOA 1XX5A 4COKA 5JSUA 3AVTA 3LSYA 1I3CA 3ZXIA 1J8YF 4KFUA 4MOWA 2ZT7A 3G7SA 2YJGA 3UHOA 5A1TA 4UAVA 5KMGA 4XFKA 2CUEA 2VTDA 2W9XA 3ECAA 1GPKA 2I0FA 4AB1A 4LA4A 1IHPA 4LV5B 5TVKA 3ZKWB 5AI8A 1V8FA 2JGIA 3QRFF 2JGLA 3GRPA 4PCUA 4DMLA 2CG4A 3VEPA 1O97D 2ZZNA 3DAGA 5EJMA 1S02A 5UKDA 4AXBA 4EJVA 3BGSA 5E8JA 3W05A 5EUBA 2WE7A 2WIFA 3JYQA 1HXHA 4WXMA 5FBWB 2LNBA 2J5OA 3TNJA 4ZTJA 3FFBA 3IVCA 3NVKI 3LGSA 5DNYB 3QPTA 4K9MA 4BNZA 2Z9OA 2H31A 3NM4A 3C70A 4RWEA 3UG6A 3CCLI 1CDDA 2HF2A 2P3LA 1CE8A 3FF4A 5FWXB 3IBYA 1F06A 4H0FA 5HBRA 4E3ZA 5JAZA 2I6SA 4RZ2A 2CYCA 3WFZA 5F3WB 3K0FB 4Z4EA 2D7JA 1RMTA 3VVCA 3U3ZA 3WISA 1GNSA 3U4DA 5FDFA 1QDLB 1R4NA 2V0GA 2WOOA 3S93A 3HXMA 4KR2A 5DTRA 1KDOA 4GU5A 1OCPA 5E4TA 5IRCD 2V7BA 4WY8A 2Q7DA 4C0BA 1HUQA 3ZCQA 3KM0A 2W11A 4IIFA 1BMQA 4YP0A 1EK2A 5JADA 2FXAA 4OJKA 4MFDA 4NBNA 1Q17A 2VRCA 4DCUA 2RD2A 1WMFA 2R66A 2VLBA 1QRUA 1ZYUA 4EJTA 3ZDDA 4DCPA 3OTOB 2DZDA 1GVDA 2CFRA 3I4LA 3K8ZA 4XB2A 1IUFA 4A2CA 4CR8A 4K3VA 4E7OA 3VO2A 1R4MB 5L3BA 2C77A 4QXRA 1IEVA 1OTYA 1ZPDA 3H1TA 4FPXA 4IDHA 3PU6A 2ZM6B 3OAAA 3L0BA 1DPFA 1SCUB 3NX4A 1GZ7A 1YS1X 3JQQA 5MN4A 2A9QA 2YASA 3D64A 1Z7UA 4JJGA 3A0BC 5AXCA 3ZGYA 3O21A 3P9XA 4BV3A 1YR3A 3O2PE 5EMJA 2P9QA 3UAWA 4KMSA 3SHQA 1BCRB 3CD6I 3GCDA 3QYAA 5I9BA 1TEHA 4EG6A 2O8FB 1BNCA 1NQUA 1WVMA 3BFPA 4CM3A 1TJNA 16PKA 3DMRA 4KQIA 3WDKA 2QQ0A 5U4XA 3EWAA 4CR7A 1FQKA 2I8LA 1BW6A 4FB5A 2FX2A 1XMAA 1ZN8A 2AFRA 2FBKA 3I4MJ 1LI5A 1P45A 1TMOA 1YA4A 2GESA 1X1SA 2MSLA 3M3DA 1TEZA 1K6EA 4EMBA 3V1YA 3L6BA 3JAWB 4AU7A 1N2EA 1KEVA 1QK5A 3NHZA 1VG0B 3QPDA 1ZVMA 3HB7A 4Z1MD 3LIPA 4EG5A 1H85A 3EUEA 1R5BA 3IVAA 4QU5A 3QPVA 2JVKA 5IYDJ 2ZJ0A 1ZG3A 3T35A 4YYZA 3ROMA 1XRSB 3VR6D 5IDXA 2HH9A 3ELKA 1YB6A 1HA8A 1IY8A 4K6CA 3QH4A 2W0MA 3QTTA 1E2UA 4YCJA 3W7VA 4M6YA 3WHPA 2O4CA 4GF5A 4HDNA 1CUAA 4YACA 3ONQA 1R9NA 1XWWA 3A8TA 3RSOA 1S2NA 3SAJA 2A68F 3TLGA 3DV2A 3EMBA 1Z36A 4C1BA 1BD4A 1K6IA 2PYZA 2DT5A 3OP4A 3K70C 3TUJC 1Z0XA 3KD3A 2JCVA 4DMKA 1YB2A 1XMPA 4F2HA 3ZPXA 1DCFA 3Q87B 5HZHA 1I1OA 2PUDA 1SPXA 2QJOA 3DP7A 3OJOA 3MCWA 3MTQA 1YMUA 3SLKA 2A5WA 2K85A 3OKCA 5LZ2A 3IV6A 3AFIA 1FJGB 4RZUA 2XADA 3LKDA 3EEQA 3QVSA 3G0CA 3H8WA 3HKZN 4KN6A 2Z43A 1UBKS 4GLLA 1D1CA 1WUKS 5JXGA 3U17A 3H2BA 2I1LA 5MDHA 1MC1A 3QXSA 1T9KA 1OISA 3VAYA 1NKVA 3MERA 1EQ2A 1U9IC 3FKSD 5EKUA 4BPBA 3UYKA 2L01A 4WI1A 2YY6A 1UPUA 3UTDA 4CLOB 5C9ZA 3CCMI 2W6JA 1V43A 4EY6A 1GUYA 4KQMA 4Z8XA 1GHCA 1L7BA 1Y9JA 3ACCA 4GPD1 1FNCA 1DWPA 4Y6GB 2NO7A 3QMWA 3EXIB 3M5WA 2JFHA 4AD8A 3RRMA 4G09A 4PHGA 3LOUA 2PTGA 2ESHA 2FMYA 2K3PA 3JALB 1KIMA 2JLBA 4I4NA 1VI6A 3THXB 5ALKA 3G0IA 4QM7A 3X1MA 3JQAD 3ADKA 1H6CA 3FMPB 2B35A 3HGQA 1Z25A 4KBFA 1N2XA 4I1RA 2BKUA 2E55A 5D7BA 5A3VA 3RFUA 1RZ4A 1WI9A 2C2WA 1ECBA 2VZEA 2JCSA 3CU5A 1IFXA 4H7DA 4P4LA 2DFNA 1C0PA 5GOZA 3V8NA 3PTZA 3MOSA 5KNBA 2GZRA 5IU6A 2IGNA 2ZT5A 1JQKA 3OYJA 1FFCA 4MYTA 4R01A 4MMYB 1SZPA 4E51A 3CCYA 2J9YB 5F5LA 3KOWA 1AXGA 4JWTA 1EV7A 4J1SA 2L7KA 4WFKA 1YC2A 4CFYA 3E23A 4FYVA 4PAQA 3ZBUA 5KCMA 4CUZA 3NHSA 5EIAA 3EMVA 4JQFA 3GTKJ 1KEEB 3UNGC 1LTHR 4DNCA 1CZKA 4YRVA 2O3QA 4P5DA 3OUTA 4BEWA 1J8DA 5IUNC 3DF7A 3HVRA 3C1TA 4XUDA 2YJZA 1UF9A 1XCLA 2ZK7A 4TVBA 1XZ8A 3T3NA 4B47A 3P0RA 1BVRA 1J5XA 1XAHA 3K9CA 4HDRB 4WIAA 4YJDA 3SSNA 3ZWNA 4RAGA 2GK6A 2ZMEC 3BXGA 4QDJA 1J21A 5DHQA 3OS2A 2VNSA 2E2HJ 1TVKA 4MVJE 3TTVA 2Q4DA 3V4OA 5K45A 3RJPA 2R8YA 3A26A 3BK7A 3OJLA 1M5UA 4HRYA 4KQ1A 1C9KA 1FYDA 2XE6A 4M22A 1WHUA 2GM3A 2C1EA 3HFRA 1K68A 1RAEA 3L7NA 4RNDB 3T61A 3GPDG 3L07A 1GTVA 1QHEA 3OEHA 3CNLA 4B3AA 4J00A 1XL0A 1ZEJA 5DM7F 3NBYC 3QTLA 4KUEA 1NYQA 4EO4A 2H2AA 1LFUP 1CJBA 1DV2A 1ZX1A 5E3OA 4LZPA 4ALLA 4KK3A 3LT0A 3KIPA 3ZDFA 3BIXA 5CX1A 1GPH1 2XMQA 3G17A 5IASA 4J03A 4DV6B 1E60A 1G3QA 1TF5A 3I04M 2I03A 3E5QA 2QN9A 5HS4A 1E1QA 2Z9DA 2IHKA 2HQAA 3QGMA 4ALIA 3KAQA 1C7EA 1H0RA 1SCNE 1FEZA 2B25A 1S3IA 3M8KA 3O75A 4NABA 4Q7LA 5FTLA 4PTLA 4W8OA 5JHUA 1H22A 4INOA 1J09A 4HATA 4I09A 5JQGA 1VJ0A 2LCQA 3OOUA 4KE8A 4RTQA 1E59A 1PZNA 2I3ZA 2IXFA 3PNVA 2AYZA 4DVJA 3CPHA 5IS2A 2X0DA 1Q2UA 1TQ8A 3GPCA 2R4UA 4QDOA 3DUFB 4RGSA 3I1IA 5B36A 1MCZA 2E1OA 2BGRA 3NXKA 2WZBA 2FV8A 3DTIA 1CQIB 2RK3A 1P73A 2ZVQX 2ZYVX 3JQFC 5K3CA 2OG2A 3HJUA 3IR6A 3SK0A 1J9GA 5KTPA 4QQKA 4OQXA 1ZNWA 3KKPA 2NPFA 2D1YA 1LE8B 3I2FA 3CCQI 1FJHA 1JALA 3GJZA 5FULA 2J9RA 4AJIA 3BEOA 2QDKA 5D5VB 3KP3A 1S8FA 3IAXA 1ZRNA 3KZNA 4GLOA 4QGBA 1BU5A 1WHTB 2Z56A 5F9FA 4GNKA 2CXUA 2ZJQF 1Q11A 3SYRA 5I8WA 2GPBA 1W44A 4AWAA 1MBGA 5H9WA 2A59A 1LY1A 4AF6A 4J91A 3UATA 4Q05A 3ML6A 2QUHA 1L4KA 4K2EA 4MQFB 3QITA 4HGYA 4E09A 4B0PA 4IJUA 1SUSA 4DQDA 3JQ6A 3WLAA 2AG8A 3F47A 1WBDA 4L8YA 1F48A 1P39A 2WT9A 4R6XA 4MPJA 4I6ZA 4I3FA 5G0VA 2DQKA 3LXMA 3NARA 3GTGJ 1JIJA 3F74A 3PP8A 4NH4A 1NG9A 2ZTMA 1JI3A 5ENVA 4MRAA 2BM1A 3LVBA 4YRPA 4M7WA 1LFDB 1MHPA 4B3XA 4XKVA 1U7WA 1UPCA 2GJSA 1EFDN 1MVLA 1N3LA 1E1CA 2VJMA 3A0UA 1GGVA 4Y6OA 2VHXA 5J23A 2PO5A 4KN9S 1TECE 4AIIA 2CU7A 1L5ZA 1W94A 2H5LA 4KZPA 5BW5A 1JTVA 1KRWA 1RI5A 3WMFA 1BW9A 1Y48E 5DGXA 2UXDB 2UUPA 4RDXA 3QPLA 1D1QA 2VF5X 2P9BA 1EFHA 2IGKA 5TARA 3M89A 4HJXA 4WKPA 2JNWA 2IELA 3OCVA 3C5VA 3L7DA 2JVGA 3NU1A 1ID8A 4ZU3A 2RMKA 1GDHA 3BJOA 4XLHA 1I5ZA 1HLVA 2YWHA 2VDKB 2WTEA 1A5AB 1PG0A 2XOEA 2ZWAA 4QNRA 3KFVA 4YN3A 3SNKA 1JSXA 3U37A 2LSOA 1USSA 5C52B 1XEWY 3WK5A 4UXNA 5GP9A 4FB4A 2FQQA 5AW2A 4RHCA 2I5UA 3CLUC 3KXLA 3FF5A 4S3MA 5JVTA 2YZKA 1QGDA 4PONA 4P38A 1NU8A 2AK3A 4HLYA 4QEDA 4XGKA 4B7ZA 3Q8KA 1BDIA 1XROA 3CZCA 4PG6A 2ZWVA 1U0SY 3BS4A 4ARBA 3BE4A 4TKUB 2GN4A 2MOKA 2X5OA 4WW0A 1SU8A 2QQ8A 5JVDA 3W2FA 1LFAA 4FE7A 1G7TA 4Y0NA 1Z4OA 4BC1A 5FBVB 1UWLA 5HQ3A 7AT1A 3FBWA 4GXNA 3R40A 4PFKA 2LK2A 1CRLA 2HU5A 2QD5A 3RSFA 4A6EA 5DUIA 1IWBB 1P61B 1US8A 4LXQA 2R44A 1G98A 2XVMA 3KZ1E 3H16A 1YJXA 2JCGA 1G21B 3VVMA 1ST3A 3DE2X 4QLOA 5HGJA 1L3CA 5DYGA 1G18A 4HQMA 5BPHA 3TLYA 4IINA 5BPIA 2X58A 4ASUA 3H7AA 4E1BA 1DP3A 4JI6B 3ERCA 4MUAA 3H97A 2OQGA 3EGVA 3E53A 5K8VA 4W6ZA 1BQEA 2NZJA 4RYDA 1KA8A 5KK1A 1JKIA 4PU0A 4ZOAA 3AR9A 1KIAA 4DIDA 2IPMA 3BK2A 3GELA 5FJJA 4CDNA 5EGOA 3DDWA 5DSZA 1NM5A 4B81A 3OE7D 1T10A 2EKPA 2IYNA 2IF0A 2O1EA 1XD7A 5E7QA 4OQYA 1A9PA 6CHYA 3FNHA 3BR3A 1RM5A 3P2IA 4BLQA 4N3BA 3ZYCA 4JBXA 4O59O 3SBXA 1Q84A 4B85A 1E0KA 3FIUA 2VT2A 1FZQA 4TROA 4CCYB 3GTOJ 3OQMA 2PUHA 1ZIPA 4KN8A 1IM5A 2EIMH 1KI4A 4IJWA 4BU2A 1T4CA 4JP2A 5JJBA 1E3PA 3M1EA 3NWPA 2FZCA 5E3HA 2B5VA 3U1KA 1ZOLA 3BXZA 2PZAA 2O1XA 3OTGA 4MR9B 1DEOA 1QAOA 1V5IA 5E6UB 4EF6A 5JIBA 2XDWA 2YKGA 1D1AA 2YX1A 5AK6A 4DV7B 2BEUB 1TAUA 2Z9CA 3ZJTA 4YRSA 3PSFA 4XUEA 4AP9A 3SI7A 1Q0ZA 3O3MB 3TAXA 5ALMA 5JTTA 4H7FA 2J3MA 4Q7KA 1FXSA 6GPBA 1J59A 1Q1QA 1T0HB 3KQMA 5HMLA 2BFBB 2VZ8A 2CY0A 5TPWA 5CXSA 2OO5A 1XLVA 2G80A 2VJCA 2ZBRA 2EJWA 3FMGA 1O3TA 5JY6A 3HDVA 1YDEA 3UVEA 3FPKA 2X0LA 1VDZA 5AW1A 2WB2A 3RADC 4PFPA 3BA1A 1ZELA 4TWBA 5JSZA 1P4XA 3BICA 3W6NA 4B87A 1JKJB 3QU7A 5FKOA 3M6UA 4ZAFA 2FW1A 2XJ4A 3RAPR 3N74A 3OE1A 4P3YA 5IKMA 3QVUA 3V4SA 5DNVA 4ZCQA 3USES 3ZV7A 3TQFA 1AUQA 2GBFA 3NGMA 4BFSA 1QKJA 3SYKA 4M3GA 1OTHA 1VA5A 5DTDA 3QFRA 3DOEA 4EMSA 3C3KA 4WHMA 1KMIY 3WS7A 3ZYZA 1VRCA 2QP4A 2H65A 4C0KA 2X40A 3LYLA 1IRZA 3PEEA 4EKIA 4AIJA 2W6CX 2DN0A 2EX0A 2R8BA 5LQCA 3KJIA 4HGRA 3WHLA 3C18A 3O94A 2ZRPA 2NVXJ 1P3DA 4CMJA 2WU8A 3QMPA 2VUIB 1QB7A 4FFPA 1U4NA 5FRDA 1ZQ9A 3RS7A 4PPQA 1BE0A 3WDLA 2R5ZB 2HFJA 1GXQA 1M83A 4PBTA 4L3OA 4O1HA 3C3JA 1QWSA 2L4AA 1VM6A 3G2OA 2AW5A 3O1HB 4LBVA 4OOFA 4J0EA 1KIFA 1D5WA 3K4LA 3FPEA 4WSOA 1RP1A 2ZRBA 4ZARA 4D7MA 3B6EA 1M8GA 2F4OB 1ZD1A 1YDGA 3KQYA 5T4BA 4OMZA 2AXPA 2HFKA 2X9VA 4WLFA 3L6EA 1YIOA 3MXTA 1O4XA 2CLEB 3AY0A 4YRLA 5IAKA 4A2WA 1TCCA 1RZ3A 5DM0A 1PAUA 3RYHB 4UY8I 3IO3A 1KYQA 1QR2A 3QELA 2C2YA 3WMXA 2PFSA 3GJ8A 2D74A 3LMMA 2V58A 3N58A 4NE7A 3IHTA 2DI3A 4G23A 4E11A 5JDIA 5K0BA 5AH0A 3FWKA 2O8EB 2B34A 3S3MA 4MQLA 2AOTA 2GS9A 4DGSA 2EGUA 4DNPA 1FRVA 3SLGA 4KOAA 4IWNA 3ML1A 2VJMB 3D3QA 1Y4UA 1YBHA 3B1JA 1U28C 1ZRDA 1D07A 2RHWA 3K7AJ 2Z8XA 3G3EA 4XJTA 3WGTA 5F12A 1K4SA 2LMDA 1FVFA 4HNSA 4KE9A 4LS3A 4QX6A 3WX0A 2FMFA 3I64A 1L3IA 1A9YA 1ZICA 3DNPA 3PBKA 5B1SA 4EG8A 3CWZA 1D7AA 4CCMA 2WPNA 3P9YA 3KYIB 4NJEB 3ZS8A 2XCSB 4PHFA 3C3AA 1STOA 5EGSA 3HTSB 2HOQA 3EXEA 5CA1F 3H9BA 4FX0A 1UWKA 3WBKA 1DAMA 2O3TA 4H35A 4MV3A 4ECAA 3HLKA 1N6RA 1N7JA 1XNGA 2VH2A 1KJ9A 3DEHA 3M34A 3MMPA 4QOSA 4YGXB 4JK3A 1FTGA 1YASA 4B7CA 2WU1A 4J1TC 1R49A 5BS6A 2UZIR 4Y2QA 3HK2A 1E1RA 2W37A 1PDVA 4NJMB 5D3ZA 4D4MA 3RJTA 4LFUA 4G36A 1J2YA 3ZD6A 4E07A 2J3JA 4JLWA 2PSFA 4EJMA 4AKIA 3PPYA 2P6PA 3S16J 4EB6A 4HW0A 5DN6D 2ZJBA 1EE9A 2CE7A 1ZMOA 2ZANA 2QMOA 4NFHA 5JWRA 1VL5A 3TMKA 1XJWA 3FWYA 2WRZA 1ZUD1 2HV8A 7MDHA 3K4MA 1Z26A 1TIKA 4PZLA 1WPQA 1MO5A 4HNAA 3SQMA 4J07A 5DLEA 3DLAA 3SEQA 3L05A 4KA4A 2CHEA 2ZB3A 5IH3A 3RU7A 4Y13A 1VQOI 1G8PA 1WNFA 4JJIA 3OVMA 1XG1A 3FR8A 1P5JA 4O4IB 5E6RA 2BN4A 1YJ9I 3C3BA 4XASA 3RVPA 4B9AA 5AUOB 2CLCX 3DW3X 1MOQA 1T8YA 4JI3B 4ZC3A 3IP5A 4HVLA 3WAJA 2GKOA 4Q37A 3RZOJ 3FBIB 3KZYA 4YH1A 4F3CA 5J4YA 5GONF 1Y4ZA 3DKKA 3ED1A 1DC5A 1GGKA 3J7TA 1U2RA 2DRIA 1TZLA 4F60A 2XIQA 3MD0A 4BECA 3PEYA 3ASZA 4TXMA 1Y8RA 3TE7A 3LRTA 1A72A 1E96A 2N75A 3R44A 3C6KA 3IAUA 5ARCA 4BNWA 1XZQA 1CR1A 5E6SA 1VJCA 2ZIWB 3P2EA 5AUQA 3WGNA 3WBJA 5KYTA 5HHTA 1T25A 5C3UA 4DIKA 1Z6XA 2XX3A 3W1EA 4MIYA 3FGZA 3ZTTA 3HL0A 2I7XA 4MFEA 1DRWA 3UA3A 4ASUD 2X6XA 3E3MA 2LKCA 3OYNA 4Q6WA 1NMQA 3TRIA 2DXIA 1OA0A 3FYSA 1SO8A 3LHSA 3TJZA 4D4IA 2CLSA 4LECA 1H2YA 2ZWPA 4PLFA 4MX8A 2DECA 3TB6A 5A5FA 3U26A 5GY7A 3SZRA 5TV2A 4U0VA 2Q2VA 1R8SA 3F71A 4CQJA 4IWYA 2YFHA 5JEDA 3P0IA 2HUPA 2HMSA 3BCSA 2WF9A 3PZRA 3R3HA 4QOFA 5BOXA 2OQ2A 1XQWA 3BG3A 2X42A 4HQKA 3W6OA 4U1RA 3Q9VA 2G4VA 2AZMA 4FN5A 3JQAA 1Y56A 1MDMA 2D5IA 3QHQA 2B99A 1HDOA 4N8SA 1PSWA 1KQNA 3F3YA 3SXYA 5M5YJ 2PL1A 3HRKA 5H59A 2P90A 3OEEA 2NM0A 1LV7A 3ISTA 1T8PA 1NM5C 2J0VA 4C88A 5JISA 1YZVA 1IG7A 4X45A 4TZ0A 4Y2GA 3BIOA 3NBMA 2FZGA 4A3IJ 1DQUA 3CEJA 3NJ8A 4JYPA 2O0YA 3IH3A 4NE2A 4V3BA 3AVPA 3QF7A 4NFLA 5KAPA 2I4MA 1DOHA 2D0DA 2O3RA 2BEWA 2VYNA 1G55A 1AU7A 3HCRA 3V4PB 3GRKA 5FFMA 4B3IA 1TKAA 2NYRA 2CSUA 5KNLA 2OMEA 3B6CA 2Z33A 4DJAA 2C57A 3H75A 4GO1A 1FB5A 3O8QA 2HZTA 4QPZA 2Z3YA 2PKQP 2Z58A 4W1SA 4F5EA 5IUKC 2XMPA 5C7IO 4ZVMA 2DPDA 1E3TA 3EE6A 1O94A 1OZGA 4NZ9A 2C2HA 4TLMB 1IJFA 2HGCA 2KBEA 2WSSA 4EG3A 3AUSA 1IV6A 1TT5A 2D1VA 1AN0A 1I3OA 4M0LA 3E7DA 3JD3A 3ZPLA 2FDRA 2ZIFA 3QLTA 4DBVO 3GDOA 5TSDA 4DFDA 3DMYA 2QQ5A 4WCFA 3ZGNA 3ICOA 3PGLA 4RAOA 1LCIA 3MJRA 5BWLA 5KHLB 4GKKB 1EM8B 3FK6A 1L4NA 4FHZA 1T36A 4FKBA 4JEUA 3O8BA 5A0FA 1W59A 2OBLA 3NVAA 1DFHA 3VH3A 3K53A 1KO8A 1KPHA 3SIXA 3CKYA 3FN4A 3IBTA 4RVFA 4RTNA 4WJZA 3BJZA 1QH1B 3WTTC 4KU4A 5AKYA 4C22A 1WPKA 3M8FA 1JHXA 1GA4A 1UZUA 3M2PA 3ESAA 1ABEA 3EHEA 1DC8A 4WCFC 3H0GJ 2Q9CA 1NTRA 1MKMA 1XFAA 2C8KA 3B3FA 3H6HA 3HEAA 3OIUA 3QKRA 2EW1A 3MFQA 4AYBN 4FJ0A 3V8MA 2K7ZA 5A02A 4DB2A 3C87A 2E2WA 2XGSA 4IIVA 4I3GA 3AL0B 2WG2A 4TTRA 4AC0A 4DJEC 3OWHA 4MGZR 2WD8A 4OP1A 4QDXA 4WLVA 2YS6A 4EFDA 2WIKA 1GZ5A 4OHWA 5D3KA 3WNBA 1Z63A 2QJFA 4Y9SA 1H9GA 4FHFA 2MR6A 1V4RA 4CICA 5GM2A 2JLUA 3PFIA 3TJRA 1G0NA 3AETB 4K9RA 4LRUA 4H6VA 1U3CA 3KSAC 1CUGA 4LDJA 2A5LA 4EM0B 1NX9A 2HI0A 4KO3S 1J2UA 1OC4A 2PKRA 3LSHA 4K9SA 4DHEA 2CVQA 4TMKA 4AL4A 1HDDC 1IJBA 2PY6A 1E1MA 4MHGA 3L0IB 4QXMA 4L9JA 1K5PA 1X86B 2C8JA 2E89A 2Z2IA 4KBGA 3VPXA 4Z2AA 5C0OE 5LVAA 3FY4A 1EUZA 1Z7EA 1SXJE 3VYSB 4KYTA 4AS2A 3B53X 2ZE8A 1QIEA 4AKGA 2JD0A 1JJVA 1OIVA 1H9BA 1WD7A 2CHGA 4M8NE 1SXPA 1EINA 2FJ0A 3VTKA 5AJTA 1U2TA 1VCHA 4YCCA 4BE2A 3R7LA 1FFXB 5BN3A 2Y71A 2JGEA 1XTQA 4G97A 5JSKA 2VFAA 3LUCA 1V11B 4BJ5C 1WZ2A 2HI3A 1L7NA 3ROPA 1O08A 3VTFA 1RZRD 1J22A 2XCQA 1TQDA 4EPTA 3V48A 1L7MA 4C5AA 4RD0A 1N1EA 3PGA1 3VZRA 3K9TA 3I59B 1SQ0A 5B5SA 1W47A 3HVJA 2ZW9A 3F9RA 1O57A 4XLPF 5IHPA 1JKRC 1QYCA 1B9MA 3LW8A 4WBXC 3L4EA 5G41A 4Z1MA 3VR2D 4EHLA 1U0GA 4MRMB 2AEFA 4HEHA 2NU9A 4XLZA 4CIVA 4A2UA 1ZAKA 4LHZA 1POWA 1UQRA 3NTQA 3GW8A 1RTKA 2JEYA 4HGQA 5A6SB 4GWGA 2XZTA 3LQRA 3Q7TA 4JGGA 4JOBA 5EGNA 2QWWA 5CCBA 4DUGD 2D1HA 1GLNA 1YW7A 1X2EA 2FSUA 4NDZA 4UBLA 5LA6F 1RM4A 2AK2A 2NO0A 5F0FA 2JA5J 4BAGA 3GRFA 4YRNA 1GZDA 1QH9A 3B78A 3R3YA 5JVGF 4IDCA 3W1WA 3IS3A 4YV2A 4LLGF 2CNKA 3C6MA 5I8ZA 2XUIA 1FX0A 1FBQA 4S1WA 4JNCA 1G64A 4XDZA 2AF4C 3NAUA 2OQIA 3FCAA 4L4RA 2C96A 1RQPA 1UUFA 2AFVA 1IY2A 2BI7A 2YIVX 3G6KA 4O4JA 5F78A 2E34A 3UJ9A 4YJKA 4POOA 5EMLA 2ZJOA 2C3UA 1P62B 2H17A 2PZKA 2C9DA 4MUFA 4OK6A 2OUIA 5AMXA 1EJ2A 1Y81A 3JYPA 3OEWA 3RBXA 2AUTA 3NQOA 5EG0B 1B2RA 3ACBA 1O95D 3M6AA 1KYYA 1SUDA 2OVFA 4PLPA 5H9VA 3L7KA 5DLDA 3UWMA 4CT5A 4LMYA 1KAGA 4MWOA 4RD3A 5TE9A 5LDDC 3HKCB 2M45A 2N1MA 2Q6LA 5DOVA 2ODBA 1U5TC 1TK3A 2Y9ZA 3DMTC 3JYLA 4KPGA 1CNMA 4L0CA 4UFOA 3HADA 4DA0A 4E2ZA 3TZHA 5CDTA 1TAQA 4Q9NA 2WYIA 4M1WA 1QXSA 1LJ9A 2DFHA 3OA0A 1U3FA 1HZJA 4HZIA 4YCNA 2O8CA 1J8QA 1VQMI 3AF1A 3E18A 5CJ2A 3UB2A 4BVBA 1OR8A 1SKYE 1VLLA 1XEAA 2RJOA 2QN8A 2A6PA 4AUMA 3T5AA 4JC4A 3QBVA 4BATA 1AGYA 4Z6KA 3AT1A 1GAXA 3E9MA 3BR1A 1T5TA 3GMTA 5T8KC 1ZS9A 3WWDA 4K6HA 4L1KA 1VL0A 5LOVB 4Q03A 1WW2A 3OICA 1V2GA 4L22A 4NMXB 5EP3A 4QWMA 5AW9A 1QX3A 4XI9A 1FE8A 1V41E 1H66A 2AC2A 3ETLA 3DT6A 3LUFA 4A8TA 4TSRA 4X6AJ 4W97A 2VOPA 3WLFA 2O8BA 1WOMA 4KREA 4RO0A 2NXNB 1WUIS 1G8SA 2V7GA 2FEOA 2BFNA 3P94A 3OE7A 1R9TJ 3AJRA 1ATZA 1DELA 2ZRMA 3DULA 3EULA 5DBOA 4LAFA 1XD2A 3M1CA 1MBJA 4S1PA 3TO5A 4COOA 3Q41A 1P0QA 2I4LA 3V1UA 4YRIA 4MB6A 5KQLA 4WH0A 4L15A 1J90A 3PUIA 1SIUA 4K9DA 2KFDA 5GADJ 1IL0A 4LISA 4JQCA 3X2SA 4Z49A 2QZ8A 1UP7A 2KX7A 3K32A 5DHRA 5FOQA 2VQ6A 2YJ3A 5JNSA 1SKQA 1ZKDA 1TAGA 4FDAA 5AI6A 4S05A 3KALA 3PQ2A 1C0LA 3LWFA 3C1AA 3C3CA 3QX8A 3NEJA 4MP8A 3T38A 2YR0A 3S4YA 1XU9A 2WV7A 3P19A 5F7JA 4BHTA 5U1PA 2BW3B 5LZ8A 3Q9UA 1XZGA 3PJFA 4Q82A 3RK1A 4B3TB 1D0IA 5AIQA 2VBWA 3E7PA 3P2KA 2JPCA 4XDHA 3EVCA 4C0AC 4F2PA 2J31A 3W5IA 3QENA 1NBWB 3CP2A 4IVNA 3GZJA 4Q39A 1C0IA 3ZTYA 1E3QA 1PFQA 3IQHX 4DBLE 4GXQA 1XTBA 2VNJA 3O90A 4RH0A 5E38A 1NQTA 2Z04A 5EN4A 5IH7A 3EPKA 1XR3A 1DAOA 5F1PA 1PT7A 1XEFA 1E9EA 4FS3A 3GZTB 4WMLA 4DUYB 3ASVA 5HDGA 3O84A 1LNZA 4G7ZF 4O6JA 2JKZA 4LRWA 3AV0B 3DHWC 4OREX 2WSYB 4WCFB 3VAZA 4J0FA 1I7SB 3ESYA 5FD6A 2P5LC 2ZBGA 3GIWA 3ZS9A 3ZWOA 3TBIA 2GZ1A 5CK4A 4CM1A 1I3KA 1VG9B 4OIQF 1DEKA 1PJ4A 1E9SA 1YV9A 3MTDA 3UWSA 3TDUC 1UAYA 2VQDA 1NLYA 2QZSA 2UVPB 4I5DA 2H8RA 2Q5IA 4YCDA 3B89A 3BZWA 4XD7A 5JFTA 3ELUA 1NW6A 3AFOA 5KC8A 1JQEA 2I71A 2DQYA 3Q8XB 1FTNA 1R0KA 1ZLXA 1FXWF 1OGJA 3AKCA 4WACA 3V4VB 1J2RA 1NPYA 3H35A 4YQYA 4QJ3A 2NPOA 5HF9A 1TRKA 2I4NA 1DU0A 4J2HA 4XLNF 1PWEA 1ZK3A 3S2DJ 4KT6A 1IM8A 2VS1A 1X1CA 1ZIOA 3BWMA 3CJQA 3IVRA 1A35A 3FNIA 5P21A 4CIAA 3LKVA 2Y9MB 2HTFA 3MRVA 2OO5C 4XA8A 3FDJA 3W79A 3PYMA 1HK7A 1KOFA 4ZO8A 4UJ3A 4JBHA 5J1UA 4TUYB 3T9BA 4WV3A 1TBXA 1Z38A 1TZKA 4E5PA 3SEZA 3N2GA 2WEKA 3P4XA 1QVZA 4GLFA 3C1DA 2ZIVB 4Z4GA 2EDAA 4G6TB 1ENYA 4UUBA 1BWQA 3R0VA 3TBFA 2QZZA 3VPGA 5LNK6 4BHCA 4WPGA 1DIBA 1C1XB 5KTMA 2PL9A 2XWJI 5LQNA 2V7XA 2YX7A 4RTJA 2RQPA 3A58B 5LQDA 2VHCA 3LSJA 4EHHA 1K88A 3O4IA 4H3VA 5K4GA 2VDUE 1XS9A 5MN5A 4D1QA 3I56I 2PXXA 5E79C 1NRWA 1DQPA 3VU9A 1J0CA 1IPHA 1GVJA 3P52A 1XTJA 1TZMA 3P7MA 3G1UA 4PK4A 1SHTX 3IV5A 1U78A 2GBLC 5FUVA 1APLC 1U3DA 1JMVA 1MSEC 2P11A 4M1SA 1YS9A 5SV2A 1WJAA 2I1VB 3PIRA 2BMAA 1VE1A 1KWKA 5ESXA 2HNHA 4EKYA 3W5BA 4FOLA 3EGDA 1M2VB 3VH2A 4OAYA 1O5IA 1S2GA 2IOQA 1MB3A 2PUGA 2PYDA 2R7ZJ 2QTZA 4LQLA 2KRFA 1CDOA 1KYXA 1GXSA 1E9AA 2Y2VA 2UXXA 4XM3A 3CZ5A 4PLZA 1GY8A 2JCBA 2VBYA 6AT1A 5JS6A 2G06A 3O4FA 1SZJG 3U44A 3LA8A 3RRJA 1TM3E 4OA5A 1IATA 2FR0A 2DODA 2HHLA 4PEVA 5EZ5A 1CSEE 1G21E 2R00A 3G6WA 3OP1A 4TM8A 4E30A 5H4GA 3CVXA 4HF1A 1YQ9A 3U3RA 2EV5A 1LPMA 1SCUA 2ATEA 4K05A 4MVJP 4AMYA 2J67A 4EW3A 2NYXA 2OZ6A 2FSSA 2JZOA 3W78A 4P0PB 4FCTA 4XRRA 3H2IA 3R77A 4BNLA 3IKTA 1MV5A 3B9BA 3LPCA 1Z77A 2BM8A 1XRNA 4FHGA 4BE9A 5B7PA 1V6CA 4K26A 4TT8A 2FXIA 2IYTA 2VC2B 4F3KA 2G04A 2QT0A 2VYQA 2XF8A 4DLRA 3GLGA 4B3DA 1T8IA 1HURA 4XSVA 4E7IA 3FCCA 1E8DA 3BL5A 1TW2A 1MF7A 2NUTB 2XQGA 4IY1A 3JSAA 2W4MA 4CKCB 2F64A 4LYFA 4Z86A 1WTAA 1RLOA 3WYAA 2Q5EA 5D5WB 4ZJYA 1I1SA 4NJMA 1U1IA 3PRHA 1HNZB 1J4AA 4AVZA 3VR4D 1ORTA 1IOLA 1T8SA 3ETEA 1JEYB 2X7XA 4RWZA 3LVRE 4QT4A 2QM8A 5CVDA 1DEAA 1DLIA 3ZIDA 5LQUA 1ZP6A 3DGFC 3L8DA 2YS7A 1Q1BA 1N4AA 3HRTA 4PSUA 3BQZA 1FDRA 1VOTA 2VDWA 3VUEA 1WDKA 3U9TA 3UMFA 2GIVA 2PSDA 2ZRLA 5KI6A 5EHZA 3UY4A 3DTVA 1CJMA 1TU0A 3K72B 1CQZA 1Z83A 4DB4A 1DKNA 3AFHA 1RUOA 4F2GA 1JGSA 4BNGA 4DLLA 1E5VA 2EQAA 1AS3A 3GAMA 2H94A 5BRJA 3QUBA 3D8SA 3I3OA 4XGNA 2W0SA 4D5CA 1NN3A 2M34A 1RRGA 2A1UA 3NT5A 3M4OJ 4X61A 1RS0A 2BMVA 2G72A 3AMVA 3SFVA 3PIPF 4QGHA 3UJDA 4H27A 3A11A 4DZRA 4ZCIA 4PRZA 5K8LA 1FLVA 2HYGD 4MUMA 4AJ1A 4ALNA 2Q9AA 4JR1A 1LPNA 2GEBA 3T7TA 2VWGA 2X1MA 4H1TA 4HK4A 1DOAA 3KR1A 2L2OA 2WAYA 4ZANA 1XDSA 2V3WA 3WWYA 1GVHA 4JJ4A 5AOAA 3FROA 4EYSA 2K9NA 2PV0A 3QELB 4GPBA 4XKJA 4K2AA 2J0EA 3QKRB 3ZNOA 2VK2A 3GLHB 5IP5A 2AUNA 1LS1A 2RH8A 4ZREA 2ZJ7A 3JZFA 3RRZA 5HQTA 4CUGA 4BJ5A 4GRDA 4JVOA 2OC6A 2J5RA 5HJ5A 2BXZA 3WNVA 5JH7A 1DXHA 1GJRA 3GO4A 2CYAA 3JQFA 4GVXA 2F1KA 5I8PA 2LVBA 1NFRA 3V8EA 2I10A 2MG4A 2FU4A 2O0LA 4CKYA 3UHFA 5JRZA 1FIUA 1GA1A 4L0MA 3CM0A 1IUPA 2ZUWA 3WZ2A 4HOYA 2C0QA 1XKLA 2WJ3A 3OCYA 3X1ZA 4LTMA 1FZTA 4QQFA 4DSUA 5LC1A 3ZLBA 1JDVA 1OBCA 5I7FA 5GZ3A 2FFAA 2JUCA 4UATA 3T5XA 3E82A 2YICA 3IRVA 3L2CA 4JJ6A 1JECA 1UMDB 2RV8A 3D02A 3MWDA 4IVPA 1JBKA 3CNBA 1GPDG 2Q4RA 3CXRA 4J0IA 5DGDA 5H4HA 3TLAA 3SDZA 1ZI6A 1WVRA 1KFBB 3TWOA 1KI7A 1Y1TA 1E3WB 2P77A 4C2AA 3BTOA 4UUSB 4PGHA 4M76B 3W2AA 1XA4A 4HNGA 1QF9A 2QUBA 5HDNA 3PDWA 1NLFA 4HEQA 5FT9A 4OP2A 3SHVA 4AJHA 1P4JA 3FMOB 5D8KB 5IVKA 1NBHA 3C39A 3KUDA 5CR9A 3AHHA 3ZV3A 1MMGA 3A3KA 2ZB7A 1WVIA 3QPWA 1NUHA 1S3FA 3EX7C 4BDSA 4UV8A 3KJFA 3LYHA 3VI3B 3CCUI 3BRWD 3JQGB 2IH5A 2EARA 2XIGA 2G6TA 2Q9BA 4XVUA 3QVLA 4C29A 4HEA6 5A71A 3A4NA 4KL8S 5K7FA 1GYQA 1Y5NA 3UWOA 1ONSA 3LL4A 1ONOA 3H3FA 3N0WA 5E7IA 4F96A 1E7MA 3RV4A 3I55I 2IE0A 1YJNI 4HGNA 2YHUA 3DXXA 3R5XA 2ZMEA 1YFHA 3NYRA 5BN4A 1WWXA 4G0OA 2OVBA 3FBTA 2GA1A 5M5XJ 3T3GA 2Q6IA 1XAIA 3DS8A 2BD0A 4ZYWA 3MZYA 3OYGA 1RJDA 4CMEC 3GJ3A 1CZRA 4N6NA 3K6SA 4IHTA 3B6MA 1OYVA 3NBUA 4MTCA 2IA5A 3I32A 4C3OB 5BUSA 2O2HA 4MWSA 2Y1DA 1X92A 3DA8A 1WXGA 2RNJA 3OS1A 3OFKA 4L5CA 3W04A 3W3ZB 3JR3A 4RLQA 3H86A 4GDMA 5A5DA 1IY0A 4U9UA 5KYVA 2RKOA 1VIMA 4XSGA 3BCAA 3F5SA 3TN7A 5JPDA 2B1IA 1FYFA 1ZESA 2IDJA 3PK0A 3ZUPA 4D8WA 3D81A 2IH2A 5DFAA 1R0SA 3FSGA 5NULA 4GGOA 4WFQA 1BH6A 4EM1A 3FUVA 4U2FA 4C7BA 2W2NA 4EPXA 4X85A 3OYIA 4MA5A 2XVZA 2H2FA 3HHEA 5AHWA 4F55A 4RE5A 5B3JC 4JV5B 2WZQA 2VPQA 2D5VA 5B2EA 2QSHX 4OXXA 4FR5A 2R86A 1YHQI 1L8XA 2AXNA 2O5VA 1GRNA 3O9MA 4S35A 4BRUA 4EARA 3ICEA 3IXMA 4E0BA 1EUCB 1KU6A 1RQXA 4LLNA 3IJRA 1R7JA 1ETQA 2DMQA 2I8CA 2OWDA 2XECA 1I4EB 5T4EA 4AS3A 2C42A 4LBWA 5AVUA 1JHHA 1D8KA 2JT1A 1TP4A 2X2PA 2NZ2A 3DWEX 2FPWA 3DZBA 2KZVA 3HGTA 3ULKA 3QOYA 2UUZA 3UH0A 3LQ2A 4QPJC 3UF0A 1AUXA 2Z1NA 2BY1A 3KEOA 1Z2CA 1R5ID 5B12A 1SEUA 1N5IA 3S1SA 4CZZA 1Q91A 1EJ9A 4D2IA 4CM8A 4RY9A 2P4QA 1DQSA 2C8VA 4RK1A 5IPFA 3N5KA 2IU4A 4CCSA 1RC8A 1QQIA 3GUDA 1SB8A 3P97A 2Y1CA 1DIRA 1HL7A 2F6RA 1FOXA 1CZLA 1I2ZA 3MB5A 4HVTA 2L82A 1U31A 4EQZA 2N0SA 4WBNB 1BA3A 1VMKA 4BNXA 2W6MA 3GUHA 3WGZA 4C89A 1K6YA 1SK9A 4NS4A 2HO4A 3ZJVA 3J7YJ 1NQAO 2OV1A 1R27A 2W2LA 3G5MA 5JLJA 1P17A 5H16A 2AG0A 4QWWA 1YLFA 5K7ZA 2ZBFA 2WJIA 1ISIA 2QGZA 1ODDA 2J48A 4O0MA 3J81A 2FPOA 4YYEA 4D9IA 2WQ6A 4G0WA 1ECPA 3GFVA 3HWRA 4S2EA 2KJCA 3R3VA 5AM4A 1PJ3A 3L1PA 3D4BA 4HRVA 3BR2A 1TADA 2IYLD 5KVCA 1R0ZA 4WKBA 2IH4A 1RBQA 4R41A 2LD4A 3HZHA 5E0OA 1FTQA 5F5NA 5CXQA 1S9DA 1P0CA 4QA9A 2G0AA 3FHTA 1J97A 5C8YF 1D4AA 5F76A 4DA6A 3ZVLA 4Q19A 2ZSHA 4MEXF 3ZW9A 4Q4AB 2N3ZA 1C3LA 5M5WJ 1MJHA 1HEYA 1QG0A 3PFFA 3VDNB 4C01A 3Q8MA 3CNQS 1E4EA 3FNGA 3QE4A 4IRUB 3WLMA 4G0UA 9GPBA 3RVMA 5BQ3A 4XWYA 2BGGA 3ZXYA 3MGKA 4N1AA 2YWDA 1U1GA 4RPIA 3MWMA 3ZWDA 3F3MA 1K3TA 5FXMA 3UAYA 2PIDA 4PYIA 3O6BB 3CUVA 1U4OA 2FD5A 3V2IA 1OWLA 4N5HX 3WE2A 4HPQA 2D5CA 2MFZA 4F72A 3LPLA 3ZQCA 2PXAA 5J8CA 5DYIA 3VJLA 4F4IA 3TKYA 2ONJA 5CB8A 4Q3NA 4ZDPA 2BTQB 3FYDA 1OYYA 1P6UA 1DL5A 1LDMA 3DMHA 2FOWA 2BBOA 2Y67A 3LNTA 3ND7A 3R41A 4RBNA 3R76A 2EZ8A 2DBZA 4CHTA 2X6WA 2VONA 2EZKA 2ODQA 2PAFA 4FGJA 3TAHA 3BL8A 2M9HA 2D2WA 3E9YA 3E6MA 1RWKA 3OPVA 2HYIC 2HXSA 1QORA 4LY9A 5FBZA