4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
1SO8A 3V80A 4DCJA 1X1RA 5IM5A 4AG6A 2QJFA 4P7FA 4RZSA 2FPIB 5G41A 3IUMA 2WHPA 1I9CA 3K1AA 3OF2A 1HH4A 1XZGA 4OOIA 1RI5A 5JVTA 2V7GA 4OYLA 4RXUA 4V0NA 3DSRA 5DCLA 1O89A 1H2YA 4X7RA 4N65A 1SEPA 2QL5A 3ILXA 4HS4A 4Z5XA 1K78B 4UV8A 3ESAA 2DCEA 1U8UA 2XKKA 3BRQA 4K2HA 1SXQA 1OMIA 5D1NA 3PHJA 1PT9A 1N3BA 1E3LA 2OLJA 1SPXA 4RVGA 4M8NE 1KETA 5LBUA 3FIUA 2QL9A 2P6SA 1R64A 4CL0A 4UTXA 5EJIA 1L5HA 5EE5B 4JC0A 5CB6A 2YS9A 2HQNA 1M5TA 1OFUX 1XT6A 3OUTA 4BBAA 4E2YA 1U0SY 3BMQB 4RB2C 2XEDA 1NK3P 4Y2SA 3PFHA 5ALYA 1DQUA 3ESRA 2OB1A 3O8GA 3LHSA 1ORDA 2IFTA 3JQ8B 1Z74A 3HKCA 3HZRA 3TXXA 2HLDD 5BPDA 1R4ZA 3WDMA 1WH5A 4YLYA 4KO1S 1K06A 4CCYB 2RHGB 3IOEA 1OXMA 1PCXA 1RPAA 3U3MA 2ZPUA 1R00A 1S1MA 4MAMA 1DAIA 3PNKA 2HBQA 2XOXA 4BYGA 3WLJA 2QD3A 1HSTA 1FSSA 5ES3A 2ACVA 4XL9A 4D3XA 1HOMA 4RCVA 3E0QA 5J5CA 2VF5X 4QREA 3V55A 4AD8A 3EVGA 1DC5A 1P7IA 5HKAA 4XZ3A 4AXBA 1S2LA 3TFOA 2J9YB 2C97A 4MZXA 1ICIA 5J4KA 1U2TA 5HDNA 2I6QA 2ZE8A 1Y7HA 3BFJA 1HDOA 3D1JA 3K1NA 1IV6A 1QZXA 2BGMA 3T3EA 5DUKA 1XIVA 2I2AA 3R6LA 4W4TA 3C2QA 3GR6A 4RTOA 4Z9FA 2FWMX 2PJZA 3MT7A 1TRHA 1TUBA 4Q9LA 4B3RB 4LZPA 2VPTA 1EB9A 4JDPA 2C9CA 1U5CA 2CL7X 1WXDA 1W47A 5H59A 3ZWXA 3WHPA 1KU0A 1T6BY 4NBNA 2JCVA 4C7XA 2ZFWA 2Q2WA 4QLBA 4S1WA 3ZGLA 3I4PA 4ARBA 1V6CA 2NYXA 2GQQA 5CFOA 2A7XA 5JH7F 5IT9K 2YN4A 5BV1A 3EEOA 1YJAA 3RSZA 1DIOB 4TTJA 2IT1A 2HH9A 2QM3A 2DOFA 2CDCA 4E21A 1ORVA 1H6AA 2PRIA 1I9GA 3KOWA 3UXEA 4D9GA 2ADUA 3A2MA 1E3PA 5CA1B 1J0DA 1ZYUA 3WK7A 1JQ5A 4EPVA 3H17A 3KSZO 3UGKA 4L5BA 1EX6A 1JT6A 4E11A 1P1JA 5HOOA 3OQBA 1LDBA 4YJGB 2GZWA 2FMUA 5AT1A 1OXVA 2H6BA 3HJNA 4C6SA 3FDYA 1JKMA 3UT5B 2GVZC 1VA4A 1SM4A 2O2DA 4N8DA 1KEPA 3CCJI 2Z6QA 5HBRA 5F7OA 1SXJC 5LSAA 2C5GA 1Z6RA 5LCXA 4F3QA 4LF8B 2WMNB 2QCOA 1NBMD 1XHLA 3B1XA 4RY8A 1E2KA 3QVTA 1EESA 5LHIA 1SVIA 5I4IA 4Q24A 2I8DA 1GITA 1KO7A 2I2CA 3LBIA 2GUWA 4MS3A 3KSAC 2Q5CA 3TWOA 4XQEA 4LXQA 1UBCA 5DVZA 1U1IA 1FEXA 2VDKB 1XEFA 1H0SA 3A9WA 2QJRA 2L9RA 1XSDA 3ZU4A 5E95A 2XNKA 3TO6A 5T8KC 2CUTA 2ZZKA 3EOBI 5MF6A 1QPIA 3OVMA 1ZWLA 1LE8A 1JEYA 5L4LA 3NIGB 2YMQA 3ZX4A 2C8KA 3GT7A 4KLNA 2VHZA 2PLYA 4PANA 2ZI4A 3B1VA 4RKRA 1JJ6C 1XX6A 1SC6A 3ROGA 3KJGA 2IIQA 1ESNA 3WK4A 1RR7A 3HDJA 1OXBB 4BNFA 1I7NA 3B7WA 2F3TA 4BMNA 4QUKA 3FAKA 2PFBA 3IE0A 1TECE 4ZDJA 4Q3EA 2BVLA 3K0CC 1KZGB 4Y2HA 2X5OA 4IIYA 2NUTA 3VO8A 3C70A 2VKDA 1SIOA 5JMTA 1OBVA 1BN7A 1R5JA 2ODEA 4AY6A 1M2HA 1RJEA 1GKUB 1U80A 3QF4A 1JHHA 1PF7E 4LC1A 2LE0A 3ITKA 4JROA 2XCSB 4O4IA 1AWCA 3TLEA 4H9GA 3GLGA 1NUSA 3L7MA 1WQ2A 2I2BA 1B4AA 1C41A 3ZJVA 1A5BB 4CTMA 2J4DA 4P4NA 3FPEA 4XLLA 5I01A 1IJEA 3VYSB 4PF1A 4FYJA 3W1VA 1PIWA 3A1WA 4C88A 2AUMA 3UKOA 2BVNA 4GMGA 1L4LA 1SC3A 2K4MA 4QAJA 1C9YA 4E5KA 4B4CA 1ULUA 1RZUA 2GR9A 4JOSA 1ON1A 2O5RA 3UJHA 1ZXLA 2DBYA 2WYUA 3H1PA 2DVMA 3TLAA 2YHAA 1EG2A 3TO5A 4LSMA 3O7MA 1TB4A 4DIKA 3E3VA 2F5CA 2C99A 2Z4SA 5CT6A 1PVEA 2CMKA 3BAFA 2V45A 2AJ8A 5I5GA 3TTUA 5HGXA 5BRAA 2EZTA 1HNZB 4BGVA 3VO2A 3H8JA 5JNVA 5G3ZA 3ZIAA 3EG9A 3TD2A 1VHTA 4R1TA 2K2WA 4Z1MD 3GMTA 4DUPA 5I3ZA 2XJ9A 2DPXA 4BQEA 1FRFS 4IOCF 2FLVA 5G53C 1PT6A 4ZALA 1CY7A 3BD9A 2F1KA 4J91A 4NBKA 2P68A 3OZWA 3SX4A 1U3DA 4C4AA 1EVZA 1L8OA 2UU9B 3PFKA 2IF2A 4U0JA 3AVWA 4BO9A 4RA2A 4H7DA 2HCRA 3VU9B 1EGAA 1YRQA 2NZJA 2VWHA 2FEAA 4MW4A 1NLYA 3C2BA 2XMSA 5KHDA 4Q9JA 1W73A 4QT4A 2LNBA 4D81A 3VSCA 2BBYA 3IIJA 4PZLA 4U0YA 2FRDC 4EHJA 1JDTA 2E55A 5FA8A 1PL7A 1W5SA 2BDTA 3CLSD 5JSYA 2HIAA 4QTRA 3W9BA 1M1NA 4IH9A 3T35A 3ROFA 4EK9A 4I6ZA 2IUFA 4QDKA 1BD3A 5SYAA 1JR4A 1XKLA 1J2XA 4WK4B 4ZV7A 4L27A 3A58B 2JAOA 3O4IA 4CIDA 1D5YA 4OBWA 4RSRA 5J8CA 1SQ0A 2XXBA 3VR5A 1D4AA 1YQUA 4LSZA 3D3WB 4G5HA 3WDKA 1FUKA 2QTVA 3DL7A 1U5BB 2AG1A 4EB3A 4RE5A 2HMAA 4OBBA 1ODKA 4XM2A 1XDWA 4XOPA 3H5NA 2ZAIA 4PSCA 1EDEA 2BHRA 2HJVA 3ZLVA 3E5NA 1L6IA 3FZNA 3H1CA 5G4LA 4B46A 4FISA 4OXKA 4YECA 2N8GA 4BN4A 1Z6TA 4D26A 5CH5A 3TO9A 1LA2A 4MEBA 1JEQB 3OIUA 2WNIA 5KOHA 4HWPA 2MMGA 2WVGA 1A1VA 4HDUA 2APJA 1ZGHA 3ZWWA 2W2QA 2WTUA 4IL6C 2QZPA 1WU7A 2VT2A 1CW2B 1CJBA 2VL7A 4E6PA 3C6KA 1HBXG 4XB2A 1AGPA 3ZQJA 1YBHA 1QGOA 2L5QA 2C57A 1Z38A 2PSEA 3E9CA 2IPXA 2R4UA 3LLMA 3Q0TA 4M3FA 4BIMA 3BMOB 2PRSA 1B8IB 3I09A 2L0KA 2XF8A 5TSDA 1GAEO 5DM6F 1ZZGA 2JGDA 3IAHA 5FI0B 1P72A 4CMCA 2KRFA 2E37A 2O0MA 1PQPA 3F67A 1VG1A 1XMSA 3LPDA 1NMQA 2VRCA 4Z86A 3PEEA 1Z39A 3DL4A 4EVRA 4RTQA 1ZOPA 2IEAA 1QDLB 1OJLA 3CFYA 2QZ9A 4I9GA 1IWPB 2HO5A 3ZBTA 1YT5A 5FH9A 3U2RA 1J9IA 3I9NA 1NQUA 3PXAA 2NSLA 2DPHA 1K9VF 2BGKA 3Q5GA 5F76A 2HRDA 2A0YA 5CLJA 4NWIA 1XSEA 2Y4OA 2O52A 2CHUA 2NXEA 4NAVA 4R1PA 1NFFA 1FRNA 3ZUGA 4WOJA 4M9XA 4NBTA 2J30A 2RB5A 1TWCJ 5IPFA 1XWIA 5FTNA 4XAQA 3NWSA 2C3UA 1JIXA 5F35A 4GDMA 3DMGA 2OQGA 5KDLA 4M0MA 3DKKA 1IDYA 3P9NA 3LNTA 3TR6A 3O21A 1EVQA 1CUFA 2J48A 1T9ZA 4Q15A 1GXSB 5A0TA 3JWIA 5I9SA 3UJ3X 4N0MA 3ELUA 4YB8A 1UJMA 2G8NA 4RZIA 3UGQA 2GEJA 5IMBA 3O74A 1A76A 2J6CA 5C8DA 2XRMA 3ZS8A 4MKFA 1JKOC 2IPAB 2J3IA 4L9TA 4UNOA 1NW3A 3ADPA 1NXSA 1H2RS 1J42A 3G2IA 1E6EA 1E2QA 3AR5A 4XOTA 4RFSB 3GG2A 2KM1A 1GU0A 1ZELA 4C08A 1FOKA 4RAGA 2VRBA 4PLVA 3VHXB 1UP4A 4KUGA 1OIWA 1IJWC 5TGTA 3I32A 3AXTA 1XZIA 3DF8A 1QGAA 2E1MB 2B92A 2EERA 4BASA 2M30A 1XVAA 4HEA2 3RSCA 3L6OO 3MWJA 3SYNA 3EF1A 3T5MA 2P9EA 2PUBA 2CV1A 1V26A 4UPEA 2R7MA 4MDEA 4B8YA 1CS0A 4D4IA 1RKXA 5D5XB 2BZTA 1KYYA 4UULA 4RJIA 3QKRB 4GYIA 1OCTC 1WZEA 4ZTBA 2XB6A 3BXPA 2FSIA 1CFZA 1JGGA 1P1KA 1IQUA 1JUDA 4KXQA 2BI4A 5LDHA 4B6PA 1EIWA 1T8RA 2ZG6A 1HUQA 9ABPA 4QBKA 4HSGA 1GP2A 1SKUA 5DOVA 3I5YA 1GN8A 3CXUA 3OTGA 4G0MA 3L77A 4KQ1A 3N97A 2AQEA 3M6XA 2VQLA 4TPKA 1PGNA 2WG0A 4BOYA 2F1RA 1Z25A 1PJAA 1J8DA 2J6BA 3RUEA 4C6TA 2V4UA 4I6JA 4A0QA 1FZTA 2OCCH 3PNTA 4FIZA 5K0GA 4YROA 5J1RA 3SFTA 3VBEA 4HW0A 2Q2VA 3FBIB 1FVFA 5DXAA 1GU1A 2GTPA 5K1YA 2HC9A 3U61B 3VR4D 2IS1A 4EYOA 4U7HA 5F4ZA 2P8SA 3TMOA 5EXXA 4LWOA 1D8JA 2XIQA 1SBYA 3IB6A 4JX8A 3IS3A 1CDDA 2QPAA 2BGWA 3PI7A 4MIEA 1MVLA 3PUHA 1QVRA 2QTHA 1HKUA 3LOPA 1KP2A 1EVIA 2FD5A 4FS8A 4J01A 5T64A 5CBPA 3OOPA 3WTVC 3OR1C 1ST3A 1Z22A 3RSQA 2O5CA 3QJGA 3ABMH 5B2ZA 4ZYLA 3C3EA 5EN4A 1OASA 4RWZA 4HB0A 2O23A 3HVJA 1VHLA 3JQGB 4XLPF 3CZ6A 3REFA 1NVMB 3FNQA 1HZJA 5IZCC 1UXIA 4MJLA 1XTJA 3O2QB 3IIEA 3FMVA 1PJLA 2GK4A 2EFHB 2ZWIA 1AF7A 2VR1A 2F1IA 1KP3A 3PR1A 2NMVA 1BJZA 1YUNA 3ZCQA 3N0RA 1WQ4A 3TGNA 1OA0A 2G06A 4NYIQ 1YU9A 2UUAB 4RVNA 2LV8A 4EL5A 3SIXA 1AB6A 4MA5A 3SJBA 1PLKA 3L4SO 2W84A 3RAJA 3UMBA 2BOVA 3HY3A 3CX3A 2JCXA 5IYCJ 3KHUA 2A94A 3E23A 1OTXA 2D6FA 3I3OA 3CWCA 1TMKA 3EUKL 4OIQF 3DFKA 2DUUA 3I6MA 4NFLA 4IY1A 2Z5UA 5DV9A 2DOKA 3O2JA 2SECE 4B73A 5M3MJ 3ONWA 3ZVMA 1Z6QA 1Y8CA 4JUCA 4UVHA 4KPEC 5IF3A 3W3CA 1YRAA 4O1MA 721PA 1DIHA 2QAJA 2GJ8A 3KDSE 4WXPA 2UZ1A 5B3JA 4DREA 3AV0B 5E3MA 2AN5A 1Q57A 2ZYUX 3SFZA 2FFJA 1QH1B 4DQVA 4JQYA 4Y9UA 2C82A 4HAVA 3RHTA 1O3SA 1CUXA 1UFQA 3U16A 1T10A 3GYHX 4KG7A 1PUEE 4CU2A 1QS0A 2VP5A 4IZ6A 2J3JA 2A88A 4JR0A 5COQA 1HPLA 4MIYA 4R8MA 3ZVLA 2GBLA 1C1DA 3RTAA 1H66A 4MIKA 1GNLA 1GSHA 1JHPA 2X1MA 1N0HA 4KT5C 1KJYA 1UP6A 1V2HE 1UZLA 3DM9B 2YV2A 4IJ5A 3WYFA 5KNCD 4J2HA 2FZEA 3ZGNA 4NE2A 3HDHA 4PLPA 2YR2A 1D2HA 4DLRA 2JD2A 3Q98A 3L2CA 1XCOA 1FP4B 1KJWA 1N0VC 4I4LA 4AM3A 1AKRA 1UMDA 5H83A 3BXEA 3M83A 5DF1A 1G7TA 3EA5A 2CUEA 3EUHA 3SZ3A 3II6X 4R3WA 1AXEA 3B48A 2AN3A 1DO0A 1I3CA 4L75A 5B4TA 1SC1A 4HRXA 2X41A 1CR4A 4ZI7A 4HNTA 1VSQA 5DM60 5FOVA 1B6SA 2EGUA 3OUZA 4IKPA 1YDEA 2WT8A 3OC0A 3I59B 5LP6F 3D1VA 1GGJA 1Q1GA 3WLSA 4BLUA 3AR2A 4FBMA 5AIPA 1JRLA 4LSGA 2YN2A 4NJEB 3DKWA 1JLKA 3BH6A 5JMPA 3PC2A 3VVMA 1FMTA 3UM9A 4BRZA 5KJ6A 3EC7A 4AKGA 2IOFA 1RDFA 3IKLA 2H0AA 1U7UA 5EIBD 3BXXA 4WN9B 3I04A 5JSUA 3HPQA 4JQCA 2FQYA 5JLAA 5I9LA 5AOAA 2HU5A 2ET6A 4Y1FA 1A31A 2ZJ3A 1VYTA 3PIRA 3H9JA 3MOSA 2HI0A 4UHBA 1DELA 3JYQA 1Z67A 4Q02A 5LDGA 1G5HA 3WQHA 1NC1A 2VJNA 4ETMA 4F4UA 3MT9A 4KQFA 1QB7A 1HTWA 4JZYA 1IEXA 3D9QX 5IOZA 2V9VA 3OZ7A 1IAWA 4IXWA 1II8B 3QU7A 2XMBA 1JXMA 3Q85A 1K4KA 2X2FA 3LZCA 2F67A 4H7FA 2VJYA 3AL0C 1VMAA 4I8IA 1BN6A 5FLXK 2JI9A 3DD1A 1OXXK 4AF6A 2VF4X 4EG0A 1FFXB 2LFBA 2RKOA 4CMIB 2VPQA 3BJ6A 2IEBA 5L3DA 1LRJA 1H2AS 4LE0A 4OOEA 3TDKA 3K4CA 1C7EA 3N0WA 3VWBA 3CY6A 1Y6FA 4N3GA 2YY5A 2X42A 4H4DA 2XTNA 2Z33A 2E89A 3JYPA 3UH0A 1VQ7I 3HL2A 1WPXA 1LEAA 1VL2A 2DHQA 1U0OC 3WKBA 2FQ4A 4B2YA 3T95A 4LF4B 2Y1CA 3I39X 3LUHA 4O8CA 4BRUA 1OAOA 1P5HA 2O8BA 3S3NA 3AHFA 1NHWA 3WFIA 2QI9F 1NI4B 5J3LA 1FVOA 3I2YX 3CLVA 2M98A 2K9SA 5KNBD 3RUFA 1VQMI 2WWYA 3DP9A 4XCXA 3ZCOA 4FZ3A 3FGOA 3DYBA 1MGPA 2KMLA 4DE5A 2UZIR 4HXGA 2EF1A 2IU6A 3IMEA 4HVAA 3SC2B 4LBWA 1TK2A 1E1DA 3BZWA 3QPBA 3W3ZB 3JASB 3ROTA 4ZCRA 5BOSA 3KKKA 5HJ7A 2JJQA 5T3UA 2RJ3A 1YIJI 5E8RA 3GFBA 4BQSA 1NX9A 3EGCA 4HB4A 4CM5A 1OHHA 4EY5A 4AQ7A 5CAEB 1SG9A 1PJBA 3ENNA 1JKJA 1RRFA 4GRIA 1L8AA 1WJ5A 4YIKA 1XZHA 4PZYA 3H4VA 4M3EA 4BTLA 1SULA 1Y37A 4YLEA 3L1KA 3NFYA 2O1WA 2L17A 3QPTA 4F9FA 1LDDA 2MYSA 2OZLA 3CVYA 4ZOLA 4H18A 4M3DA 1TIPA 3DDUA 1U5TC 2E35A 3L7JA 5KYXA 2EQ5A 2PGIA 4QXPA 2X7HA 4TVKA 4FFDA 3ELYA 1K3TA 2Y92A 5K05A 3CLUC 5EJ9A 3JPWA 1ONBA 5DLPA 1SKAA 3R5JA 3CT6A 1LU9A 1ZG1A 1L3BA 4ZP1A 2OBBA 1TQ8A 3EF0A 3RO7A 1BQ3A 2YHUA 1BXRA 5ALUA 2RHTA 3IVRA 4R2JA 2RB4A 1DQPA 3TB6A 2PT9A 2Q0QA 3FYUC 1MJGA 2Q0SA 1P45A 4MW7A 3MZYA 3O9VA 4NDZA 3V3KA 1XEAA 4OXNA 1OGIA 3GTJJ 4B81A 3FPKA 5T41A 1VFCA 4P34A 4HDNB 4UHEA 1JVNA 2OZ6A 1ZM2A 4DHWA 1NASA 1TLTA 2B37A 4FHFA 1KIFA 4MQFB 2W4QA 4FR0A 2EV0A 1TYAE 3PX3A 2FX2A 4A2PA 1ZVQA 2B8TA 3AP2A 1M2GA 3C3PA 3MJ4A 3AHHA 3PR2B 1V3TA 2H1CA 4AJOA 3DYIA 1LJ9A 1EFCA 3QKSA 3GW2A 5EQFA 3QYFA 2GK3A 2CRGA 5FBQB 3T8RA 3I0ZA 3QP5A 4E51A 4MPJA 4D3DA 5LQNA 3FXRA 5E8IA 3IAM2 2QUKA 4HMOA 3W5AA 1Z13A 1RZVA 2YJ4A 4URWR 4L6CA 1OYWA 1WVGA 3VR4H 3LHFA 2GAAA 2PL1A 5B3AA 1CJCA 1EJ9A 4K6CA 5JC1A 3CIFA 4XD7A 5CB4B 1BRMA 2IYAA 1SR8A 3D02A 5EHZA 5JDIC 1YZHA 3IMFA 3X3HA 2FP4A 3JQFC 2XPCA 4HLCA 1IV8A 3GLTA 1K63A 3PXUA 3SVTA 1H69A 4B2LA 3R3VA 3G17A 3ZE6A 1ZBDA 1K6EA 4MHOA 1F6DA 4UNPA 4HWOA 3EETA 3G89A 3EUAA 4QUIA 2QMEA 3PXGA 4HO1X 1J5PA 1N0UA 1QYVA 2EU8A 3CRQA 3M8KA 3NAZA 1JSZA 1FSGA 2HN9A 1NN1A 1GQRA 5E4TA 2XIGA 3N0TA 1HETA 2OECA 1JVSA 2QT9A 4NZNA 4JR2A 3K3PA 4L9AA 4HKTA 3QVGA 4OAZA 4YDHB 5FBRB 4MV7A 1NMZA 3IBFA 3W5BA 2GZAA 2YFYA 4BGEA 1OB5A 4A0ZA 2NUAA 2WICA 1CS4C 4BYMA 1SCBA 2PUEA 3SHVA 5F33A 3NEUA 2PUGA 3DOUA 4TN5A 1Y63A 2HZTA 4RLSA 2ZR8A 3RKSA 1Z4NA 5DTQA 1EGMB 4BO0A 1ZCJA 2MFZA 3R41A 3N2NA 3ZE1B 3GXOA 4CI9A 4WFIA 2WU1A 4M1EA 4OVKA 4ZC8A 3IGFA 1B14A 4L6IA 2P9TA 2XB5A 4PGGA 5J47A 1P5RA 2KRHA 4LK1F 2ZSUA 3EQLF 2J3EA 3TL3A 2QUHA 1RXSA 5I7FA 1SK8A 3LQ2A 1NU8A 1SOWA 4L8WB 3HTSB 2V74B 1LH0A 2JFZA 4EMUA 4F93B 5CVEA 5F21A 4KFRA 4N3AA 3C3JA 5BNIA 1LI4A 5LZ4A 4F11A 3KE9A 3UG6A 1ZK2A 4DMCA 5HOQA 4HDAA 2F5EA 2XYQA 1P3Y1 5K8JB 1AZLA 4GGMX 1X38A 5LIPA 1KARA 3GJQA 3OJLA 4BNDB 3ZJ4A 1O4XA 4JR1A 2EVWX 1RW4A 2YNMD 3TRJA 3RV4A 5T67A 5KNCH 2R47A 5CA0B 3PF9A 1ENOA 2PX4A 4BO3A 3D8UA 1AO0A 2HRRA 3AUKA 4C7JA 4WZBB 2ZTVA 2ZI9A 1MBGA 3H0GJ 2NV0A 2AH5A 4JNKA 4F12A 3LA8A 3DUWA 1TQPA 2DSNA 2R6R1 4CHTA 3IDZA 3THXB 3ZHYA 1DEHA 3CC2I 3AI3A 4PFSA 5DNWA 2PMFA 1NYLA 2I3GA 5JJ5A 3KQQA 1U8TA 3X1XA 5FLXZ 3N2YA 5AKZA 3JSXA 3K4LA 1FYFA 5JSQA 5A6SB 4XLFA 3O8OB 4R6WA 3V3TA 1N9GA 2WU3A 5TF4A 1R4MA 1IXCA 1QAQA 2P5TB 3TE7A 3OYLA 4DIDA 4CO8A 3R9KA 2WJHA 2B1JA 4KQHA 5BYJA 1P4XA 1W87A 4CQJA 2ZYIA 1KJIA 3FSGA 3GK3A 4D3FA 1CZRA 4PZCA 5FWDA 3S1NJ 4PXSA 3AV3A 2A5DA 2WSYB 1HNXB 3QLEA 4X8OA 5MGBA 3COWA 4OU0A 4KXNA 2WWVD 4BX8A 4HV5A 1W9HA 4D4LA 4I2NA 1ISHA 2ZUVA 2NXCA 1WMSA 3OTQA 4IIJA 3UVEA 5B7QA 5KVRA 1GVJA 1Y4DE 3AEQB 1MOSA 3F72A 1CE8A 1ZRHA 4CBVA 3ICWA 3DV8A 4JJGA 4BECA 4F7ZA 2M1ZA 2JGLA 4KSBA 1Q0TA 1NW4A 4I9UA 4ND2A 1LEHA 2XIJA 2IDMA 4BQPA 1NT2A 2F8SA 4DLWA 3KZYA 1Z82A 3N58A 2CXOA 3Q8LA 1U0NA 3FFXA 4FFOA 5JZVA 4NE7A 1QZEA 3EWAA 4OXXA 1NN0A 4UHHA 2VCHA 5K8VA 3GY0A 2DJ5A 1JB1A 3KT8A 2D5VA 3D8HA 3UHOA 3JAKA 3WMXA 2HSJA 3C3CA 2A9JA 4E88A 1EKEA 2DFFA 4U7TB 1AH2A 5A02A 1W76A 3G0GA 2WU8A 4DCTA 3PFCA 5KWEA 1A7UA 2OO5A 5IRCD 2ME0A 4BFYA 1P4JA 4QNMA 1H22A 2YW2A 4PX2A 1U0JA 4F6RB 3OJFA 4OQ4A 4RY2A 1YZKA 2WHYA 4XE5A 4BP3A 3PO2J 4LBZA 5AJWA 1OYIA 3KXKA 4H59A 5CGZA 1F2TB 2HHHB 4LZLA 3QUTA 3BJMA 1MX3A 3LSHA 2C07A 1FRZA 1SBCA 1XJQA 3DKRA 3N3AC 2MSYA 2HA4A 5DBGA 2ZE6A 4QT0A 2XH8A 121PA 5KNBH 1HO3A 1Z77A 2RAFA 2TMKA 4GQBA 3SVLA 3ZR8X 3EZXA 4ZCQA 2B7LA 5HQJA 1JFFA 4NAUA 1KMMA 1XELA 4BP1A 4DR6B 3DLTA 5ILUA 2HVSA 4QRIA 4ND4A 3CPJB 5JBQA 3DHWC 2HQ5A 1U0LA 1WQ3A 4XUCA 4WF2A 1LPPA 4UM8B 4QU9A 1CNFA 1IQPA 3HCNA 3LI2A 1MC8A 1RJGA 3DOHA 4WHMA 3RJ5A 3FCYA 2EGGA 5I48A 3HXKA 1CUAA 1NXVA 4DV1B 4M4SA 1RE1A 3VTZA 5FPSA 4DY6A 4OIFA 1UZMA 1X87A 5EIEA 3R24A 3N53A 4LHSA 4WECA 1PGPA 3W6NA 2XYRA 2RVCA 5DHFA 2YH2A 3CJTA 3HB7A 4AZWA 3DFFA 3Q0WA 3BRSA 2G8LA 4EUKA 3G8AA 4JLKA 4N6OA 1IK4A 3JSOA 4ZAGA 2OG2A 3ZNQA 1Z3CA 1ECPA 2ZM5A 2AUNA 4QO7A 4CF4A 1N5JA 2TRTA 2AI3A 3S2ZA 4BHBA 4X3CA 2Q6OA 3TGWA 5CJ2A 2VI6A 3CTMA 3EXHA 5J40A 2IYRA 2H09A 4FOPA 1X1QA 4MVXA 4J0EA 3HM5A 4YRDA 2D2XA 2DMNA 3O2NA 1UDBA 4GZ6A 4RVHA 4Z4GA 4O3MA 3CINA 4AUXA 3KL2A 4N5LA 1HEYA 4G1CA 4DC9A 2UXBB 1OBCA 2ID6A 4A6XA 2VQHA 1K6XA 1H0MA 1G3IA 2G1UA 2P7CB 5K4GA 1YQGA 2W1OA 1HI9A 5HQ3B 1TK9A 2V5AA 3WVNA 3RUAA 4IHXA 4LJAA 4QPDA 3ADDA 2JFWA 4W9MC 5A05A 2IS6A 2OT3B 3PLAE 3C7JA 3R77A 1OFGA 1BJRE 1ZRMA 3OYIA 3V8RA 3T7RA 4OGLA 1DLJA 4Q0MA 1HY3A 4ZYYA 3HADA 4HC4A 4CG1A 1GRRA 2PRYA 2WLSA 2FW9A 3AOGA 2BHTA 5ETJA 2VH5R 3GFFA 1U63A 5LLSA 4DARA 1AG9A 2IYXA 2G5PA 2VT7A 4YJDA 1H4QA 1JILA 1NQ5A 3OEED 2ZE7A 3GJTA 3HFSA 4E08A 5H0IA 2ESHA 1TEHA 3A25A 3T5DA 2E87A 1C1XA 3QU2A 2JARA 3ERED 3Q1KA 3WFJA 1MBFA 3SJMA 3TSWA 4II2A 1NUTA 3R23A 4GL2A 2OTJI 4IHSA 4JC5A 1HFKA 2XUPA 4P35A 1NHAA 5BWBA 1P0CA 4Q48A 4D6XA 2P2NA 3B78A 5FOUA 2Y31A 2FDRA 5PGMA 3VOTA 1TD1A 4HGRA 1Z7BA 2JGRA 3V1TC 5IJ0A 1E1YA 1PYOA 4OHOA 1W7PD 4HLUA 4CEHB 5KTSA 3PUBA 2AEJA 1KQNA 1WXXA 4RIHA 1X3LA 3DPSA 3HLTA 5B1HA 3M1LA 5DNEA 2H17A 1BCSB 5A7GA 1O6FA 2XVZA 1B4DA 1ORTA 3L82B 2DKNA 3HCAA 4BQQA 1NJFA 5CYGA 1O2DA 1JKPC 3AYXB 4CIAA 2J7PD 3BIJA 4YAWA 2HRCA 2EG9A 4A8JC 3F9RA 5LJLA 1LDJA 5KAPA 3DLBA 2CXHA 4R2LA 4QGHA 3NX4A 4FFRA 1J09A 1VMDA 4L16A 4BQIA 2P6UA 2A92A 1JQLB 2DA2A 5AW7A 1FEZA 3U5ZB 4I9FA 4BZWA 4JX9A 1KI9A 1Q0QA 2PZJA 4UNRA 4LF6B 4PWZA 3UMMA 2PZFA 3F3SA 4LFBB 3TO7A 2F8LA 3NCHA 3U4GA 2HXGA 3UJBA 3KETA 4FMDF 3TQHA 5JD6A 1NV8A 3OHPA 1X2EA 3QYPA 1JSCA 4MHGA 5DTJA 2EZIA 3DEJA 4W7HA 2R6ZA 1CV2A 5F04A 2IWRA 2HZBA 3PTZA 4XYLA 1XZPA 2D2FA 5DXFA 2A69F 1MVOA 5JRZA 1P2UA 3SWWA 2X6XA 3PWSA 1ZVMA 2FPOA 2QN2A 4ZAVA 4DA8A 1Z5WA 4Q9NA 1BL0A 2Z0MA 1YFJA 4R8RA 2E9SA 4AP5A 4K05A 2GO7A 3QKIA 1CJKC 5CVRA 5FD8A 5FNZA 3LRPA 3R7LA 4Z3KA 2BSAA 5HUJA 3ZGZA 2MW8A 2ZDGA 4QFMA 1FS5A 3U80A 4L57A 3Q5DA 3O8HA 4XOUA 1G8XA 3AEYA 2CLSA 2GHIA 1CR1A 1L5GB 4GKVA 2KDZA 1K4MA 3A1VA 4GLBA 2HMVA 1TNSA 3R3YA 3D31A 2BKEA 1VZ0A 2CCJA 1R9MA 4KIGA 3A4NA 4ASNA 4M1OA 1QVTA 3FXOA 3I5UA 1QGYA 5BSVA 4KREA 3C1AA 3LMKA 2ONJA 3V34A 1K6JA 1RVV1 2XGCA 2RN7A 3TZ6A 4ARVA 2KJCA 1QLWA 4G23A 1Z17A 2NVUB 4NEHB 3Q1LA 5EWMA 4LOCA 1JHVA 2IIBA 1UODA 3O4VA 4N0QA 4OB7A 2IS2A 3NGMA 3TFQA 2VDOB 3GRCA 1PYDA 3CPHA 3SYRA 5BWOA 3H5LA 1AU7A 2A78A 2A33A 3B6MA 3GEBA 4MKZA 4AF7A 3LGAA 2LRDA 2EBWA 4M36A 4R7GA 1B76A 1RM0A 2CLCX 5TIIA 1QF7A 4LB6B 4QG3A 4E5NA 3TG2A 4FM9A 3C97A 1F8FA 5JSKA 3OT1B 3M7IA 2BY4A 5K7FA 1BGWA 5BV7A 1OISA 4YUZA 3SBEA 3Q3EA 1YGYA 2HJRA 1JTEA 5YASA 2I4MA 2W6JD 1D1AA 3GBSA 2CZQA 4EO4A 3W7VA 3NT4A 4JB3A 2HL6A 3VNBA 1GG5A 5K8LA 1ZD2P 2DT8A 1ZREA 3U7QB 4G5FA 1M2NA 5F7ZA 2CYAA 5EMNA 3M1IA 4DV3B 3DAPA 1HDZA 2FPUA 3ZZUA 1G4UR 2W8BA 4JLVA 1LS6A 3LOCA 3F97A 4IGAA 1ACLA 1SKMA 5HKBA 3OTOB 4DJJA 2PJPA 1BXZA 4I8DA 4Q9IA 4MITA 3I52A 1SUAA 3KBBA 1FBTA 2X13A 3Q9LA 4DV6B 3V1MA 5KX5B 5IANA 3GTQJ 4ZYGA 4FYIA 1F51E 4ZZ2A 2ZVDA 2C2HA 3BE8A 3X1ZA 2LTPA 2Q9CA 5J2UF 3TTXA 1PT5A 2IUYA 3V42A 3HHGA 3L0BA 4E12A 3LV8A 4ND8A 3G7UA 5DTMA 3FNIA 3GLUA 2VRNA 3A9SA 3FOZA 1YE8A 3CCMI 1X3UA 2VHJA 1NW7A 3ZWDA 5DFAA 5ECDA 3RK0A 1PWXA 1POXA 4G1EB 1TXGA 1N8TA 3TDMA 4MCHA 4B3XA 1EDOA 3HG7A 2C8JA 3EE6A 2FN3A 3F6BX 4EFMA 1JJIA 2Y9MB 3W0LB 1I33A 3DEUA 3DH0A 2ZBRA 5L9AA 3MTIA 1RUNA 4BGUA 2ZVPX 1GTJ1 1DXHA 1W29A 3OOSA 3TKAA 4ZCMA 1QBGA 5FNVA 3NW9A 1CETA 5EAIA 2FU4A 2BYTA 3AHJA 2A4MA 6PAXA 5FF9A 4FR2A 5B1AH 1USVA 2YVUA 3TNLA 2OUKA 1LF0A 1Y9EA 5AI4A 4TMYA 4DV5B 3I9FA 3RI4A 2ODQA 3KKEA 3BFVA 4C01A 2PMUA 5B3JC 3QYAA 4ME6A 1FMFA 1CG6A 2ZITA 3P2YA 1Y8RB 3ZQIA 1R10A 2XA2A 1QHEA 5E79C 4K28A 3ABUA 1W36C 4ZAWA 2ZS8A 4Z8YA 2GEDA 3P2IA 4WBXC 4KOEC 4RD0A 3FTQA 5CURA 3B38A 2YJTD 3ZZNA 2UZ4A 2GBLC 1RAGA 1E5VA 2BFBB 5F77A 5LMZA 1WULS 3ESZA 2AMYA 1PTJA 2VSQA 2Z2SB 5JYDA 4EKGA 1EPUA 4Q01A 2NRAC 1SN7A 1JXQA 3S2FA 3GBGA 4N9WA 3S4YA 1LNWA 4MR7A 2R7NA 3DKPA 5BVHB 2Z3YA 4QDOA 1SC9A 3TTWA 1Y6GA 2J0VA 2UVPA 4R2WA 2Q3FA 1MOPA 2LK2A 4Y3OA 3OY7A 2DLNA 2WIFA 1TQMA 3EUHC 5JRDS 1ZJ5A 1FMJA 3DGFC 3G0IA 2DULA 5EINA 4PONA 4HATA 1VIDA 3V7NA 4XRSG 3OH8A 1XTVA 1R22A 4YMLA 1T36B 2AS5F 1CUBA 1ZR2A 1K4SA 2D8MA 5EWLA 2A6EF 4JVOA 1US8B 2COUA 3WGTA 4EA6A 1GZDA 2SCUA 2NNYA 2JAQA 2CFXA 5GZ6A 2ZAYA 1BBYA 2N3ZA 1V1MB 3VOBA 2VQSA 2YXLA 3GCWA 3RIHA 1Y3FE 3P45A 5TT0A 2LVSA 4BBJA 1BOOA 3TPZA 3CUKA 4IQGA 1KQ9A 5D5UB 1OGYA 1R9TJ 2DKFA 2ZSJA 2QAGA 1VA5A 1EK0A 3I0TA 1GARA 1P2GA 1L5SA 2IJLA 2FR8A 1C7RA 4RY9A 1J06A 3UV3A 1BMDA 2A9OA 2FWBA 2PJUA 5K3EA 4A27A 1DGWY 3H83A 2TECE 1DEAA 3W3AD 3RZDJ 3OTIA 1U2GC 3T1BA 2R60A 3KUDA 4EL0A 1ZRNA 3DOOA 2WTEA 3D43A 1YCHA 2ZR0A 2HGSA 4EJVA 1G63A 3LLUA 3C41J 2KPMA 4HDOB 1ADCA 3OLYA 1RCUA 2IPOA 3BS4A 2CJWB 3LQYA 1ZRDA 1ZESA 2BW3B 3IXLA 3IR7A 1K08A 3HKDA 1EQUA 2VNHA 1AN9A 4PPFA 3IXQA 4RAQA 1G4DA 1DFHA 1UMBA 1YOVB 4ETWA 4PLZA 3FUTA 4DKXA 2FFQA 2J3HA 2XDYA 1FX1A 1DJNA 4XDHA 3IDFA 4R2KA 2QNBA 1OAOC 3L7AA 1KI3A 4Z3DA 4KXXA 3CMAI 4DBZA 2VAVA 4Z4QA 4FI3F 1PQ4A 3FKQA 2A59A 2BD0A 2HB6A 3V7WA 3H2JA 4X1KA 4H17A 4JJZA 1XNRB 3QPWA 1JUPA 1Q7RA 3BXZA 1CUDA 4BLVA 4ENUA 4IRUB 4D3ZA 5IT4A 4XM1A 2VDWB 2N9UA 4ZPJA 4MHTA 2I71A 3BZ6A 3TLJA 2FW8A 3DDHA 3MVEA 5F7XA 1EA3A 4F2DA 3LGSA 4PR3A 5EG0B 1J0EA 4BLSA 1RYYA 1YX5A 2FPPB 2K9LA 1LLCA 1KEVA 5CDTA 2OD2A 5JI3E 4JU8A 2AFIE 5LU9A 1X58A 5D4SA 1YYVA 3DKYA 2XDWA 4H7JA 5REQA 5CNIA 1D1TA 5KPJA 1T33A 1UZUA 1IUNA 5A2QK 2BE5F 1G60A 3H5VA 4Q18A 3U81A 2IEIA 3HOWJ 3I01A 1PR4A 3R0IA 3V8JA 1PZFA 2HS5A 3W7BA 2B1RA 4G12A 1DXYA 4URZR 5EZHA 1JWAB 3O03A 5J4VA 1ABFA 3KLNA 1D7AA 4D9IA 5FFNA 1H4TA 5B1SA 7ADHA 2HIMA 5I8WA 2BEUB 1TZMA 4A0RA 2YYYA 4ZU6X 1L7QA 2HJ9A 1QHHD 3AF2A 2VBWA 3N8GA 1QAOA 4JT2A 3OAAA 2C58A 3CUSA 5BV0A 2IYLD 2OO7A 4QZVA 3HPRA 2L82A 4MNTA 2FCRA 3GRPA 1A9YA 4XDYA 2CD7A 3F3KA 1NVVR 4K2EA 1NW8A 4MVWA 2YHIB 3TW7A 1U7TA 2EIMH 4JLUA 1GZHB 2KB0A 3PGMA 4CA0A 4FQ5A 4UUOA 2RGUA 3BHJA 4ZRDA 1CLUA 4F5WA 5JXJA 5CXXA 2AXEA 2R1TB 1MB2A 3P27A 2HK7A 4GBGA 3TVYA 1MH3A 4OQNA 2HDDA 5CDYA 1KJ8A 3KD3A 1UR5A 2H0RA 2BFWA 2ZRNA 4B47A 3Q10A 3S2WA 5LDDC 1WU8A 4YONB 3CR8A 3OFND 3UMVA 4EI2A 1ZKDA 5FI1B 4QEZA 3PIDA 3K0LA 2TS1A 3KTDA 2Q46A 1N2CB 1EJ0A 1GL7A 1BFUA 2P69A 2H7XA 1EJ2A 4EF5A 3HDYA 3NDPA 2QYOA 3H9GA 3C6BA 3ONEA 3UOGA 3PGKA 1EGVB 3PPXA 2OESA 2P9QA 2FX3A 2JVKA 2ZOSA 4G09A 3KP5A 2NUPB 4JGGA 2DDBA 1E2LA 1KZYC 1IXSB 5MHTA 1ULHA 4QIHA 3ENWA 2QDKA 4OD0A 1H3NA 2AO9A 3UICA 2Q3DA 1VG8A 2J87A 3RRYA 3NZEA 4MFEA 3WWCA 1EGHA 5DS9A 1ONVA 5FUVA 1G8JA 1E9VA 1YC2A 3VPBA 2A9VA 4JX6A 3Q3HA 4CFZA 2OQVA 2VP9A 4N6NA 3ADOA 3VSLA 4MLZA 3QOYA 3HYRA 1ZLYA 3FSJX 1Z5UA 2JATA 2CZGA 2C88A 3CX8A 2YUIA 2ZTMA 3GDGA 3T1NA 4EGQA 3L7DA 3A6DA 1QRYA 3S3TA 3DQPA 4UXHA 2Y30A 4IKEA 2AFHE 4BBSJ 4UFOA 1KRWA 1I3QJ 3IOMA 4LXUA 1WZUA 4AWXB 2A9FA 3KP2A 1T9GR 4L4ZA 4NH0A 2P2GA 4PGFA 4UW9A 1SKYE 1I14A 4EM2A 1EX1A 1AGNA 3V2HA 3K2BA 3DUFB 4KMSA 4BLTA 1FQKA 1TEVA 3QTLA 2NQ2C 3DZFA 1JTYA 1Y8ZA 4YDRA 1QYXA 2DOEA 2VQGA 1QQBA 1CQTA 2Y2VA 4B3BA 2R84A 3NBAA 2LY1A 4ZZ1A 4HAXA 1KZ4A 1QX4A 2OGUA 5LOVA 3WMWA 2ZBFA 5DX8A 4EHFA 4AYWA 1XDUA 4OMCA 3LUGA 1UKCA 3WLAA 3DE7X 1JG4A 1M1YA 1BGVA 4ZAXA 2A5GA 5TQ0B 4QDUA 2VAPA 2FXAA 3EAGA 4HPQA 5CLSA 1G98A 5FAXA 5LYJB 2P4WA 4Q4ZF 1JE0A 3QBDA 1BJKA 4EAQA 4ZQHA 2AN9A 1PFQA 3R20A 4CLRA 1OLXA 3H16A 3AJRA 2EA4A 4G0OA 5K9ZA 1LKZA 3QPVA 2C7BA 4KWHA 5TV2A 3ROMA 3R5HA 2COMA 3RSLA 3D81A 4J2OA 2DHCA 2WDPA 1V9CA 3TZQA 1W0JD 4CCJA 1JFLA 2DMUA 3ANYB 2GJSA 3G0BA 2GPJA 1VPWA 3IVAA 2E1RA 3RSNA 1E79A 3GWGA 5AW8A 4B6FA 2VWGA 1SXGA 3MG9A 1NVDA 5GJVC 3IKVA 4LJ9A 1RLIA 2GD6A 1BE0A 1UANA 3T6KA 5KWIA 4FX5A 3GV0A 3UEOA 4OKSA 4Q3OA 5GQSA 2LRHA 2XNSA 5ESRA 2X58A 3ON5A 2C7GA 1COWD 3GA7A 5HS7A 3SYLA 4G94A 2WI8A 1W0UA 3MHTA 3W9UA 3AC0A 4F3CA 2MG4A 1Q44A 3PNPA 3KL4A 4S1VA 1REQA 3LCJA 2IVFA 4OUDA 2XUAA 3EPZA 4JP3A 1MC1A 3K2AA 1QO0A 4BZQA 4XBFA 1NT4A 3CB4A 2OAP1 3ORFA 1SOUA 3HB5X 4ESJA 2K6GA 1NKVA 5EFZA 3W3AH 5TE9A 5GOZA 2YDYA 2QIPA 5AHXA 3R4KA 1U2PA 1XZEA 1TUEA 2FJUA 3L92A 4BXXJ 1ENPA 3IMGA 1I2DA 1QLJA 4Y17A 4N4AA 3WNCA 1YZUA 5A2QZ 2IE0A 3H5IA 1JR3A 1FSHA 1DKRA 4LRXA 3V00A 4RSHA 5JXGA 821PA 1T5TA 4Q1AA 1JAHA 2VONA 2Z8XA 1SZJG 3CU5A 1GTL1 3QEMB 4ZD6A 2XCTB 2ELKA 1CUVA 3QV1A 2IYTA 3WL7A 4WXEA 2XAFA 1WG8A 2D5AA 3F0CA 1G7RA 1XRLA 4JI5B 3D6TB 5DGCA 3ZNOA 3C2GA 2A6TA 3T0GA 3S15J 1UC8A 3LQKA 1EX7A 1HDIA 2RE8A 4OCZA 5JNLA 3A9RA 3VU1A 4JAVC 5F2NA 1TF2A 1MDMA 2WHEA 1U1GA 3UUWA 3E48A 1DT3A 4F9GA 2G1PA 3KQUA 2XECA 3KKQA 1PKXA 3HN7A 4DLAA 1J5XA 4BZXA 5FT9A 1XNHA 4U2EA 2WILA 4C9YA 1NW9B 2EINH 2Q4TA 2LDXA 2VEOA 2OCDA 1JDUA 2Z2JA 3R44A 1MABA 1CDZA 1V1JA 4PXYA 5BNFA 1T5BA 1EP3B 4ENRA 1PSWA 1DWPA 2QVBA 2PS0A 2A1TS 4PJLA 4UTPA 4DDTA 1T8TA 3EZ7A 4UCXA 1TYDE 5AW1A 3ZMDA 2NO0A 4K87A 2HTFA 1APLC 4FGUA 4XR6A 1ZAOA 1Z26A 4Z7NB 3QOWA 3ANXA 5CHYA 1KAEA 3G0OA 2QU8A 4I50A 2P62A 4XPZA 3P19A 1FDWA 5L3GA 3P0IA 4IHAA 2ZJYA 1CR0A 2MINB 2WHXA 3QA9A 2VQDA 2OENG 2KZGA 1OA1A 3BRCA 4X1EA 4NF2A 3N07A 1NZDA 5LA6A 3G1UA 4PZPA 3A6EA 1BCRA 1WW8A 3P7NA 1WDLA 4M72A 2ZJ4A 1C80A 4GXOA 4DSTA 4ZHQA 1EZ4A 2K2QB 4CICA 3A2KA 1MJBA 4MFDA 1CEYA 4JD5A 3Q3CA 1JIUA 4MNUA 1NW6A 3WIBA 1J8YF 4CYMA 1JI0A 2HSWA 2HDOA 4DZJA 2VSFA 1RC9A 5IVKA 4GSLA 5C4JJ 1G2IA 3ICPA 4ESOA 4FONA 5J59A 1IAVA 4G97A 5AJVB 3H2HA 1QHXA 5CP8A 1BIAA 3OJEA 1YR3A 3R74A 2VBCA 2VTKA 1KSFX 1UXGA 1DPGA 4G9YA 3T38A 2EG5A 4JITA 5CBKA 1HFEL 4OGKA 5DZSA 1I51A 4OMFG 2JLVA 2GB4A 1PUFB 2H8KA 2QG9A 3JQAD 3HA2A 4GMFA 2IOQA 1JFTA 2F4VB 4NLLA 3PPWA 3RIXA 2F59A 3TQTA 4ZYAA 3S1LA 4KQKA 2GFIA 1QHNA 4CG2A 1BIBA 3KZZA 4MV0A 4CRWB 3ZP5A 1S4QA 3Q15C 3UKJA 1CEXA 2F90A 2CY0A 2XHEA 4DSAA 1CT9A 2R5YA 5A62A 4TT3D 3BR6A 1EIZA 1P0FA 4D5GA 2AZTA 1XTUA 1QRAA 4ZVRA 3V2IA 3ER6A 4DTIA 2ZSIB 4NCXA 1M10A 1JAIA 1Y5LA 5ALEA 4ZV4A 1FOXA 3VQTA 1ZP6A 2PEXA 4RM2A 2FWPA 2Q7DA 1V8PA 2GARA 1V16B 2HK8A 3T3PB 3EGIA 4EY8A 4J3FA 5K0LA 1O03A 3KZ1E 1MC4A 2Q5JA 2Y2ZA 4NOJA 5KTRA 4B1FA 1QA6A 2I5UA 1LPBB 4LY6A 1MFPA 4OK3A 5L3EA 1T3HA 4QNNA 4X7PA 2YWCA 3RKYA 4ASUD 4A3IJ 3KEGA 2IIVA 4FFBA 3DO5A 3FJOA 1BHO1 1NTCA 1NVTA 4PO9A 1DBPA 2D13A 2ZRHA 4GMDA 5FYQA 3L5KA 4DXDA 1X1TA 5C46F 4QEDA 5E3NA 4JGIA 3ESYA 5JNRA 4HNAB 3H1GA 4OJTA 3SM9A 3OCXA 2IDKA 1SCAA 2WIJA 1VKHA 1QQAA 4RBNA 3MTBA 1M34A 3HZHA 3DKIA 4A92A 4IV8A 3JALB 3N5KA 5EI5A 3FOFC 4UD6A 3P20A 2MJLA 3PRJA 3OU6A 1FP1D 1O5IA 3NKFA 4L22A 5IJXA 3FR8A 4FLFA 3VZCA 5G1PA 2JAHA 3TM4A 1E3IA 1WEKA 1BN5A 3O8QB 5KOJB 4JX4A 4LISA 1FOEB 2K27A 4E7SA 3J81K 3WWPA 3LUPA 1TF7A 1L7RA 5D7BA 4QYWA 1PLJA 4UUQA 1YJ8A 1BKYA 4RH3A 5JNTA 1HRKA 4PHTA 3AUXA 2IY8A 3KOXA 3E6BA 4KQMA 8ADHA 2XAQA 4G36A 1ZK8A 1R6TA 4CETA 4DMGA 3SLGA 3U9LA 1Q1BA 1RXVA 4CIVA 1GKYA 3H4TA 4LHVA 4BNIA 4LDNA 4JHLA 4RJKA 1LZKA 1WNTA 3S2HJ 3LQQA 1XQVA 3GN1A 1N7JA 4FCWA 4W6ZA 1S2DA 3AY3A 3U9GA 4TMWA 3OYMA 2Q9BA 1WPQA 4QUEA 3R76A 4OHPA 2BM9A 1A9QA 1UJNA 4MSUA 1GA6A 1A8UA 1GV1A 2XV1A 3IUBA 3JYHA 5TPZA 3PA6A 1V6AA 3F8CA 2EJUA 3V48A 4ERNA 4D0SA 1MKMA 3NETA 5C34B 5EXPA 3WR5A 2AV6A 3BIOA 4OSPA 3L93A 4FFMA 2DM6A 3R4VA 1MO5A 4DLTA 5CLGA 2RGYA 3KZXA 1S8OA 3PQJA 2PX9A 5KSPA 5CVJA 1QHIA 4BXOA 1OKRA 4QDZA 3A9UA 4HWGA 5EF6A 2VOJA 1H9CA 4CM3A 1Q16A 2GMWA 1E7YA 1UPCA 3I5MA 5IW8A 3M1EA 3FOBA 5CJJA 5BXYA 4IO0A 4YR7A 3L0ZA 4HY3A 4Y4RA 2MR6A 2XWPA 2PMCA 3G9XA 1EZ1A 3ILHA 1HDXA 5EUCA 2WFLB 3SXUA 3W2EA 3HGTA 3HB1A 3EGOA 4L3VA 4N5HX 1YGPA 1ZTRA 1PGQA 2DY1A 1NKSA 1HC7A 3RTBA 3UCEA 2WY7Q 5C51B 1QP0A 3GARA 2C7OA 3NANA 4YCJA 4H31A 1VE6A 4PYOA 3RAEC 1X2BA 3CJQA 1JG1A 3VXKA 3UR3C 2R6HA 3VYUB 3GG9A 1ZIPA 3J80A 1ZJJA 5GP1A 1ZCBA 1W35A 3O9ZA 1MHTA 3HDTA 5A9SB 1AKMA 3EULA 2E1NA 2XOKD 4H6PA 2W6OA 2Q07A 3OLWA 2Y69H 4BQNA 4ZMBA 4LCJA 2EFEB 2ZJPF 4KO3S 3H2YA 4DHEA 1EVKA 3DFUA 3WYEA 2QKLB 1HYEA 4ESHA 2PKEA 1A5JA 3C48A 5K4HA 2EZLA 2XKAA 4H7EA 1QH8A 3U3DA 3OE4A 3FZYA 3VB2A 3FROA 1X8XA 1RAHA 2YVAA 4KC0A 1RQXA 3R4CA 4BVBA 5TXGA 3KOOA 3IA7A 4BC0A 1AE1A 2YBEA 3QX3A 2A30A 1UKYA 1OBHA 5F08A 5ISMA 2B7BA 5LGTA 2ME6A 3OZVA 4DNCA 2Q8PA 1R8XA 2KP6A 3WICA 3ZQCA 1GRNA 1QOZA 4CQLA 3NHUA 3DVAA 3SEFA 2BBOA 3EIWA 1YRNB 5LQUA 3LWBA 4DYCA 1QIMA 1XTZA 1DDNA 3DTIA 4Y6PA 2O5EA 4W5JA 1KH1A 5DCWA 3WMGA 5JH7B 1E89A 2K7ZA 2D7DA 2QSYA 5C8YF 2JDID 5G02A 4E14A 1SCKA 4OO3A 5A9RA 3G1LA 3I23A 5JCZA 4KZKA 2X8BA 4BNWA 2H9IA 2R7FA 3K53A 3E22B 3GCXA 4YIRX 5JJKA 4GZLA 2G76A 5D51S 3TIIA 1E7QA 1E17A 4NBLA 1K5PA 1F6BA 3PFIA 4PFKA 2V58A 2JS7A 2FEPA 1MJ9A 4OL0A 2R7RA 2H9AA 4L8FA 5BO5A 1U4OA 2I2WA 1Y3CE 1KQOA 2P0WA 3R3SA 2BFNA 4RZXA 4G7OF 2E4WA 4MO9A 4NNJA 4R4JA 1Q0HA 4FOSA 2L7MP 4X60A 5EZYA 4P9UA 4MI3A 4M1ZA 1GN9A 4B6OA 3KR9A 1GDTA 3V5NA 2XC7A 5B7NA 1UC5B 3EIOA 4KVGA 2YX7A 4D7NA 2OBLA 4P58A 1ZQ1A 1PV1A 4QG7A 4US2R 3V4LA 2L7ZA 3PL5A 1XP8A 3M8JA 4P4UA 1WBJB 3SMQA 4HLDA 2PUAA 5U4QA 2GZ2A 3PHLA 4MQ4A 2LDBA 4L76A 3B70A 1HLDA 4RS3A 3CX6A 4O4JA 1C7JA 4IWXA 2YJGA 5ED4A 3W6UA 5TY0A 2VF8A 2I4RA 5EA2A 5A4FS 1BMQA 3QEAZ 1SUPA 5CX1B 4B5KA 1KOJA 2GO1A 4AVYA 2Z1NA 1Z2NX 4NCAA 4KQ9A 3TRIA 3JQ7B 4UMDA 3I64A 4EQ6B 5J43A 1J0CA 2VAXA 4FVTA 4C43A 1NJ1A 1YFKA 3L7OA 4MV6A 1Q50A 2DLCX 2DWQA 1SZCA 3D5QA 3NOOA 5LPNA 2Y0EA 2DR2A 3C4QA 5DUIA 2JJMA 4HVLA 4YRZA 5TARA 3O1JC 5UKDA 3LDFA 2V7BA 2R6CA 2H5EA 1CERA 3D8RA 4Q1FA 4PZUA 2P3SA 5KYKA 4PYRA 4R1SA 4TRNA 3JZIA 4DUGA 2JT1A 2UKDA 3TGPA 1NYQA 5EZ5A 4FQGA 3HE3A 2Q1WA 1LSSA 4IFTA 3TLMA 2Q45A 2CH0A 4NMHA 3HCDA 3O8DA 2XSZD 5M04A 4IOKA 4N5DA 5HFJA 1K61A 1T95A 2VXZA 2D62A 2BBWA 4G0ZA 1SXPA 1I39A 1SBHA 4NRDA 2GYWA 1SD4A 1F8UA 2OXRA 2WTAA 3D7LA 3J81Z 4IP0A 5LNK6 2KSQA 4X84A 1EFRA 3C87A 4TV9F 1A2KC 1F8XA 1O96A 4GHWA 3RYCA 3F8SA 2Q28A 2WD9A 3UC5A 2BCGY 4E7PA 5KNDD 4ZEOA 3OLCX 4YMUA 2OYRA 4IBOA 3WLFA 1HLVA 1Y39A 4UASA 2AG8A 3PHIA 3NR2A 2ODNA 1AK1A 1M1XB 5D8KB 2ABWA 3ASVA 3BWGA 2R1VA 3AUUA 2XRFA 2HV9A 4K81B 1Z8FA 1F0PA 3MLBA 3AG1H 1TJ3A 4CM8B 4X7BA 1U8YA 4P3YA 4BMCA 1YR2A 5AJYA 1DV1A 5HS8A 3DTYA 3AH8A 1MSFC 1QJ4A 4G0PA 3WIVA 2JUCA 4IVPA 2OHIA 3T1TA 1PR6A 3GROA 4RZ2A 4GPAA 1N57A 4DLNA 1PAUA 3V9AA 4RC9A 3I8XA 3MFYA 5JROA 7MHTA 1A2BA 2JLRA 2YWDA 1K8ZB 1JJ7A 4X85A 3WGKA 4TUYA 4GOND 4I4TF 3CO7C 4I1VA 1DZ3A 2O2XA 2XGGA 4JBGA 4KJZA 4OFBA 2Q62A 3ROEA 4X93A 3LYUA 3WGLA 2XVXA 2F1JA 4MKIA 2FJPA 3QG1A 3ASNH 2V7TA 4FQ8A 1GR1A 1OLOA 1XD2B 3DAOA 1S3GA 5CHEA 4IOJA 1I7SB 5C3UA 1CUGA 1NF3A 3H2SA 3G8YA 4A12A 2GAIA 3OYNA 2NM0A 1XMXA 3QPCA 4WSOA 2W2VA 1QVWA 1KAQA 2I9KA 3SC4A 4IYJA 4AJLA 2JJ7A 2B94A 4DMHA 1VCOA 4PX5A 2F2EA 2ZMEA 3KELA 3QWLA 4QHTA 3NVAA 2QGNA 1D0YA 1AMOA 3HXPA 2J4FA 1R0KA 2QRMA 3FPLA 1A2OA 2PMKA 3QU9A 3VC1A 4DYRA 4PYMA 1YS2X 1JPJA 2ZJ5A 3BGIA 4YCBA 2KQUA 4E5VA 1RRCA 2IBMA 5FUQA 4UTZA 4HDKA 1BVYF 1Z4MA 2M2EA 1I4WA 4E7OA 3TQSA 2WKRA 4M1TA 3P0EA 1CX9B 4GZ3A 2O0YA 3L6DA 4IDNA 2IP4A 2G7MC 2W6NA 3DAHA 4WD3A 1YRYE 4C7VA 2CHFA 1KGDA 2JBHA 3ZLJA 1G3SA 4JSRA 1ID8A 2HT6A 3HSRA 3PQ7A 3RTDA 1EFPB 4C0AC 3P96A 1I4TD 1QOQB 2O2ZA 3R9WA 4O2RA 3N87A 1W48A 4DBLC 5EJ2A 4LOHA 2VN2A 5EKTA 4P83A 4X91A 2WKQA 4UXNA 1W88B 2DHRA 3RFFA 4HSRA 5K01A 4R8KA 2QRPA 3FXUA 5AM5A 1TM2A 4FPXA 2FDXA 1EXDA 1AKHB 4LWZA 4D79A 4NYMQ 1YUBA 4Q19A 1G6NA 4KEAA 4MMXB 4ZH4F 4B6GA 1BMFA 4D3YA 1RRVA 2K85A 3CM0A 4CZCA 3KIPA 1DEXA 3E9RA 2WAYA 1ETYA 2X1EA 1R9GA 1TNTA 1JI8A 2W2KB 3C7DB 4C4YA 1SXJE 5AXAA 3NRCA 3IC7A 4IOLA 3VDNB 4N0DA 4QOIA 4AIKA 2AGVA 3MWGA 4ER3A 1H94A 4OKIA 3SSAA 2ZSBA 5HFAA 1GYQA 3QPHA 1PEAA 2CWEA 4RLFA 2NU7A 4GI7A 2VHWA 3WOVA 4RJLA 4U63A 1EWYA 1N1DA 1XCLA 4BNNA 1CNEA 1TBXA 4G2NA 2D2VA 5CK5A 3WNZA 4QHSA 1CU1A 2DPYA 2E2WA 4UAUA 5JCOA 4IQFA 4PX3A 2AF4C 2H51A 3BSWA 3EVFA 4P33A 3GLHE 3IQEA 1HCRA 1MTZA 3C98A 1GFZA 3KXLA 2L42A 4C6HA 3PGA1 5IG2A 1VQ1A 2WB4A 3Q8WA 3ZN0A 1WXQA 3TS1A 2AYXA 3G5LA 2XWBF 1UT5A 3GLSA 4EF6A 4O29A 3LFKA 1AT1A 3DLIA 5HK8A 4MYRA 2F9LA 5EWJA 1I6HJ 4TLEA 3BE6A 1J0XO 1JLLB 4Q12A 3T0FA 3H7IA 1KZHA 4BEBA 4IDGA 1NXOA 2ID3A 3CZ9A 3PNBA 1ZOLA 2VJIA 3I2KA 5FO0A 5A4IS 1KEWA 3FBWA 1RJ9B 1WHTB 2PUJA 4G1MB 3O8NA 3ZCSA 2I8LA 4NMXB 1T9HA 2Y75A 3A2LA 1G6KA 1F36A 4LY9A 2IPNA 4QEKA 5F2OA 1XMOB 9LDTA 3EMVA 1ZD3A 1W5FA 2OZEA 1FY7A 4FDMA 4IPAA 4EJSA 1OWMA 5AW5A 4HAWA 4BY1J 3S16J 2Q0OA 2C3OA 2GLTA 1X0VA 2C3YA 4TT8A 3T4EA 2FWJA 4XM3A 1JHDA 1UBOS 4YJFA 1TW3A 4TXHA 3KKPA 5FL7D 3A6JA 2JF0A 2ZRDA 4LJ7A 2AE1A 1J39A 4PG4A 4I46A 3TECE 2AG5A 4AZ3B 1FPMA 1XRRA 4YJ2F 3DGEC 1YZQA 3WTXC 1NLUA 3LY8A 3OZEA 4J3NA 4HTFB 4YUAA 3T1QA 4HGQA 4B3IA 1E9FA 3OLVA 3O94A 2CW8A 1OLUB 1T43A 2PVCA 2QZ8A 3O95A 1E9SA 4R1UA 1XPJA 5H16A 2PO5A 5KTKA 1SXHA 3LE8A 4UBNA 5J2TF 4XGQA 4F92B 1Z47A 4BX2A 3VUEA 4V1CA 1Z6GA 2YVKA 3TTTA 1TZLA 3CCLI 1U2DA 3DJFA 1XMPA 1K7FB 2ODBA 1C8BA 5BN4B 5CEFA 3SHFA 4JQOA 3GLXA 2HF8A 1P0PA 1SB9A 1XD7A 3MS7A 4O0MA 3NDRA 1MHPA 1W7PB 3KG2A 5FKKA 2JAUA 2CVOA 3UV6A 3D3EA 2ZUTA 3HEAA 4IJWA 1AKWA 2ZSEA 5BNTA 3D1NI 3LQRA 1FF9A 2BN4A 1DQZA 4BY9E 3WNDA 2GIZA 2KJBA 4BU1A 1E2UA 4F8EA 2GM5A 4OQDA 1X3ZB 4M9UA 1TJPB 4RGXA 4PR0A 2L9VA 1ZUWA 4UBJA 2PD3A 5A9TA 2Q27A 5ELXA 5TLSA 3TLGA 1Y5RA 4RBOA 3RWMB 5DIFA 2GPAA 1ORIA 1WHSB 4LYYA 1KYWA 3M49A 4ATNA 5HJEA 4ZAFA 4G6QA 5I4BA 4GGGA 3ABQB 1X1EA 2JVIA 3SJCA 2RK3A 4GVLA 4LE2A 1JZQA 3JRNA 4MR8B 3F98A 1BC8C 1JG7A 4J0JA 1G3YA 4S04A 3OZUA 2PQ6A 4IUCS 2GAJA 3V4SA 1Z0JA 1UHSA 4RMIA 3QVJA 1LLUA 2ZAGA 4IIXA 1LRLA 5AKHA 1MJFA 2JFVA 3H04A 1I4DD 5KNDH 3OQ6A 4AT1A 3D3NA 1RHJA 4Y98A 1YL6A 2D1QA 4BVJA 4GNKA 1Z5VA 2B6NA 3ZN1A 2C8LA 3PPVA 2IHKA 2PHZA 4C78A 3P4XA 3AKZA 1EP9A 4BQOA 4BMXA 3KT3A 3BGWA 3GQBB 5GGXA 4QJ3A 5L8VA 5EJ8A 1X4PA 1RP7A 4HXYA 4RORA 4HUTA 1V1RB 1CQJA 4HYQA 3WK8A 3FDZA 3Q7PA 1D0SA 5GADJ 3TUZC 1JF8A 4BPRA 2JHCA 2YV3A 2NNNA 2FFAA 3BCAA 5EJFA 1G5IA 1BOAA 5HQTA 1KY4A 5F1PA 1E5QA 4AMUA 4RA6A 2GDZA 2ASVA 4ZYZA 3I4LA 1TTTA 1V54H 3OJWA 1VQ5I 3F4LA 4PE5B 4L9NA 1QBJA 5H8WA 3ILSA 4GKKB 2P6TA 4UV9A 2Y77A 5H80A 3MRSA 3R8FA 3KSDO 5B7GA 5JVDF 3FF5A 4J16A 4WOBA 4XICA 3EJWA 2BGRA 4ZJZA 2QROA 4D0PA 2Z8ZA 2LREA 1ZMTA 1BYIA 5LP6B 1C3XA 4A2QA 4FZ5A 4TTIA 1FQJA 1BZYA 2XAAA 2EBHX 3CLRD 3E58A 3RFXA 4QL3A 2C92A 3G2OA 2I34A 5CDGA 3HBAA 1M0WA 5T4BA 5DN6D 3TNYA 1XOIA 1BXKA 1MORA 4K2AA 2CLOB 1O0BA 4LXGA 2E82A 3O2SB 1Z8HA 2L9NA 1FFDA 5EQTA 3NPMA 2OC4A 4TYWA 4XN3A 4I5FA 4GRDA 1LBSA 2JLCA 2Z30A 4MMZB 5C31A 1OC4A 1ITZA 4HRYA 2ZI5A 2EW1A 4YAFA 4C4PA 3NVKI 4CV1A 2AS0A 1UPBA 2DC1A 1R4NA 1I10A 1P29A 1ZJWA 3V2UA 5CCBA 3RI3A 4C2TA 3F6SA 4P80A 3N6VA 1T2AA 2J3LA 1YS9A 1V4BA 1W4ZA 1H8ED 1GXPA 1NVXQ 2GN9A 3KQMA 3EQ9A 4DBVO 4PW0A 1M6HA 5CDHA 4Q4AB 5GY7A 1B43A 3KUKA 3ENZA 2ZS7A 1E8DA 1KU9A 3BTLA 1L0OC 4FQ7A 2BEWA 2RBEA 3O3NB 2PUHA 4NV0A 2RHOA 2YWEA 4EUHA 3IT0A 1IAQA 4HZIA 4FETA 2WG1A 4DABA 5DISB 4L0ZB 1M1UA 2PKQP 1M7BA 1V11A 4WFKA 2C4VA 5P21A 1C9NA 3JREA 3AY7A 3HI4A 3SF8B 1L8QA 4X1YA 4PIPA 4G26A 1S0UA 5GADl 4OGWA 4NEGA 3DU6A 4OXYA 2DPDA 1UOEA 2MBFA 2CVPA 4K1XA 3ZDZB 4R9RA 4AWBA 3ONQA 2G0TA 2I2DA 2GD2A 3H11B 3FBGA 2I8CA 4RAFA 4YO7A 3MFQA 1WCIA 1FNDA 4K9OA 1H5NA 5C0OE 3FXMA 1IDZA 4B1RA 1JDZA 2BMEA 5GMOA 1NSFA 1MNDA 3R75A 2PANA 3FXQA 1NF2A 4L08A 1UBKS 2ZUDA 5JXHA 2FPXA 2K86A 1DB3A 6LDHA 4M8KA 1N0IA 3TLYA 4N49A 3VPDA 1G9SA 3KQWA 3KKZA 2QA4I 3SEZA 5AUPB 2P7VB 3AFGA 4POAA 4O2AA 1SBQA 1SUFA 1VFPA 1DOAA 1E9AA 1Y6QA 2IZ5A 3VYTB 2V98A 2J09A 4K9MA 4V0RA 5LC1A 3O5AA 2O3FA 1H85A 1XJCA 2I7TA 3HOVJ 2OL4A 3TOZA 2ESRA 5A4JA 2EYUA 1NATA 3R60A 4CT0A 1WB5A 1FDSA 3WLIA 1DARA 1JH9A 4L3OA 4YP5A 3FMQA 1CUIA 3OEWA 2BISA 2QN1A 4Y13A 3ZW8A 5A2GA 2EAUA 3GMEA 4O4HA 5CW1A 4A6PA 2RHMA 5TMBA 3KCNA 1SRQA 1TCCA 1D2GA 1Q0PA 2JK3A 1YL5A 4KIUA 2EL9A 3SVZA 2DB3A 3G2LA 2K87A 4FW8A 3GTGJ 1CJMA 3KEQA 3IOYA 2YZMA 3F9CA 1E9BA 4OX9Y 2EWNA 2IF0A 3U56A 2X3UA 4RVCA 2V0CA 1E5DA 1II0A 3KB8A 2PMBA 2J5BA 3IERA 3T3IA 3GEMA 4OQXA 2C3PA 2H4FA 3AF4A 3V1UA 1WSUA 1VQ4I 2R5ZA 2HF2A 5IK2D 2ZUFA 3GFLA 2O2YA 1KTVA 1D1SA 3KIOA 3P0FA 5DASA 5KWJA 1ZICA 1KEEB 2Z6VA 3ID6C 1XZNA 1VGQA 2GJAA 4KK4A 4M8LA 2DTEA 3Q3GE 3CISA 3GO5A 4W5OA 4MUKA 3WWEA 3DAFA 1A82A 5BMVF 4X1IB 4RDUA 3DEHA 2Q5IA 1X80A 3F71A 3NT5A 2WWIA 3UK6A 1ENHA 2GBPA 1JDBC 1ZISA 4TGLA 2VFAA 4ETNA 3EEFA 2E4YA 2Y4NA 3EPRA 3G9UA 1KZ9A 3SXPA 4JJ4A 2ON6A 3THYA 2RCYA 3ABOB 4IX1A 5DCFA 1G4HA 4OJMX 1FUEA 4PFPA 4G7HF 1F4VA 4CM9D 2IYQA 3DWGA 3HLYA 1QK4A 2QSFX 1QX3A 2YWXA 3WKEA 1DAHA 3OZXA 1KWGA 3F96A 1JWLA 2WMDA 3V46A 2CS3A 4JA2A 4MQEA 4E03A 4GRAA 5BOXA 2C20A 4KW7A 2HTJA 4DJFC 3MCVA 2O9JA 3PDCA 2HSZA 4P1ZA 3SKXA 3RR2A 1DRVA 1ZITA 2QMZA 4BQAA 3F8BA 2OGTA 5AHRA 3AF5A 1FYMA 5DX0A 3ZOZA 3VZQA 4A82A 5J5AA 2QLNA 2LIPA 3L8CA 4Y33A 2GZ3A 1IG3A 4I9NA 2F5VA 1ZUD1 2ES4A 3LVBA 3LFHA 1Z4QA 3KTAA 1NW5A 3T15A 4EHDA 3RVDA 10MHA 2YOFA 5F73A 4ZU3A 3KZOA 2R5WA 1YQXA 2PJDA 3JY6A 3UAYA 1V25A 3LC7O 3WJ7A 1GL3A 4B44A 4HZFA 3K35A 2I2FA 4BUCA 3D7RA 3DEZA 3ZGOA 1GUAA 4QUGA 5CXQA 4CKWA 1BI1A 1QZ3A 3WQBA 4DQ2A 1IF1A 3V7CA 1BVHA 2WINI 1XNGA 1HTTA 3AVQA 3LLVA 5L95A 2OCAA 2CJJA 2XPWA 1EUDA 3U2QA 5E3LA 2A8YA 1FS6A 3ML1A 3TB4A 4G6DA 2NV2B 2AWNA 1D5CA 2HD4A 1J22A 1JHMA 2NS7A 3TVDA 3WGVA 4QFCA 4OI4A 5D3KA 4F46A 2Z2KA 3N6XA 4YP0A 4F04A 5JANA 1L0BA 3CBGA 2VI5A 2CB0A 2IUSA 3RSFA 2NAPA 3SZMA 5KQSA 3RSSA 3MZHA 1YS7A 2CLHB 4GCVA 4E3ZA 1O3YA 4N3BA 5CT4A 2G04A 5FWXA 1QHHB 3B3QA 4EHHA 2HPMA 1HT0A 3IBTA 3AGPA 1MVNA 3FCCA 2X9NA 2W2TA 1U9YA 3G0CA 3ECSA 3UO8B 3D2LA 5BPFA 1LQTA 4L5EA 4XKWA 1W85A 2DT5A 3WMEA 4OYRA 1NI5A 1YKGA 1CKEA 1OLSB 2B98A 2XDQA 4AUNA 5AVSA 2I1QA 2UYOA 4INZA 3K0FA 5JYEA 3EMKA 2PH7A 2ZT7A 5TJJA 3ELKA 4KLAA 2ELHA 2PR2A 4LAFA 2YWFA 3U13A 4RIIA 2Q6IA 1A9XA 4WKCA 3F47A 4F38A 4XIGS 2PRZA 1OB2A 5FD6A 1H9BA 1HFJA 5DHAA 4P92A 4U8GA 2XMGA 2AHRA 4OHFA 2Y66A 5KWVA 1B42A 2A6PA 5B2EA 5HVQC 1H23A 2E7XA 5G0VA 3A03A 5F1KA 1JA1A 2JKYA 5J1TB 1OLTA 1UPXA 1FQOA 1FNNA 3ZE2B 2HBZA 2RKBA 2QMUA 2A3NA 1ILEA 4FWIB 4G1VA 3LT0A 4E7LA 4WT7A 5LB2A 1RMTA 2BGTA 4AKIA 5BYKA 3DEIA 1RP1A 1E0KA 1PG5A 2VZ8A 1IN6A 2EV5A 4E33A 2F6CA 3O4GA 2HA2A 1GV0A 4J7XA 2IU4A 4ZT5A 2DODA 1H2FA 4YUXA 4CDGA 4DNQA 1LB1B 3Q5FA 2FW6A 2ZREA 1NVKA 3BORA 2GN6A 1WW3A 4CQMA 1QVVA 3AFNA 3HL4A 1TKAA 4M9SA 5GM1A 2FZ5A 3HGGA 5BRJA 4PGAA 4P5PA 5IBRA 3WK9A 1MU0A 1C81A 3KAJA 2AKEA 2GEFA 5LGNA 4V0KA 3EFOA 4D9MA 4QVIA 2LW7A 4B7AA 1GG9A 2GM4A 2CXXA 1YB5A 3UYKA 3ORHA 5FBVB 1J90A 1E0DA 1G3TA 4YJ3F 3HTXA 2DMTA 3U4AA 2VATA 4HJXA 2ORED 3DXXA 5AJHA 2D0IA 1WD7A 3GEHA 3UMRA 2QSGX 3DZGA 4Y1RB 2DT7B 4LBYA 3DZDA 3KLMX 4ZKDA 2UXCB 2XCOA 3VRHA 5F3WB 4E7KA 5LQAA 1T1GA 1ZSVA 4M7RA 1DP4A 2OO5C 4AJHA 1P0MA 2ZJRF 3S3OA 1ZGGA 5BN3B 1NONA 1RYNA 4FS3A 3FPGA 4CIBA 4W9NA 1C30B 3CC4I 3RS7A 3VHRA 3TAXA 1ODFA 4NECA 2O19A 1IIRA 3IUNA 1I1HA 4QGBA 3RUCA 3MUEA 1XS9A 4H6WA 5JXIA 2Q4DA 3O3CA 5CD1A 1Z4OA 4NOLA 1C3EA 4KUMA 5JZMA 3DKXA 1PE0A 1E99A 1IQRA 1QWSA 3M81A 1APBA 3BDIA 4RXTA 2E5FA 4J7AA 1SH7A 3JAWA 5IYZB 3JYNA 4HNSA 2RC5A 3OCVA 1T1RA 3K0KA 5IJZA 3RPQA 5BR4A 5IJ9A 4FDAA 3FIWA 1BD4A 1MRNA 2QW8A 1LDGA 2Q3EA 4GQIA 1RIFA 5IXJA 1VJRA 2QQ0A 2GESA 1KDRA 3ZMUA 2I66A 4N47A 1SMKA 5DNDA 4B6EA 2J3MA 2RGNA 5K3CA 1Y6RA 3G1OA 3OCCA 3FX3A 5AVZA 5E18F 2VTBB 4E30A 4DNFA 4RF4A 5A06A 3VGPA 3MGAA 3SGLA 3RS0A 4EFKA 5FP0A 2L4AA 4I19A 1QE3A 4RKWA 4Q4JA 2FN7A 3ZNNA 2LBFB 3GJXC 3H9BA 1C4KA 1ZIOA 1YCDA 1KDOA 3CR3C 4C7OA 3CF6R 2BSQA 2IYYA 1HXHA 2E7WA 3L2QA 1D4OA 1JIIA 1P4RA 3T1OA 4AQDA 4CYDA 4QHYA 1KA8A 1V3UA 5KYUB 1GPLA 4FB4A 1KOLA 1P31A 2B0CA 2G17A 3HI6A 2GCEA 1K8YB 4L4SA 2Q2NA 2BFDA 2A68F 2DJIA 3DL0A 3MF4A 3OLXA 2HREA 3ZWOA 4R71A 2L2OA 4WVFA 3ZE9A 1T0HB 2Y2UA 3HUTA 4TMFA 3ZY4A 3EXHC 4RK7A 4TWRA 2ONCA 3S8MA 3M4JA 3C1DA 3K5IA 3MOIA 2FA9A 3AZOA 5CPFA 1PN3A 2H3HA 3DCFA 4C05A 3LH5A 2V6FA 3CMCO 2NZ2A 3ET5A 1K5DA 3WP1B 1FTGA 2IIPA 3MPOA 4HEA6 3VR3A 4JL5A 4O08A 3K30A 4CKBB 4MVJA 4NAHA 2ZMEC 3I9LA 1KFCB 1BI2A 4ENSA 2XMPA 1V45E 2VDQB 2OCPA 1GY8A 3BILA 4IJUA 3WV5A 2CG4A 2J9FB 1SVWA 3AR3A 1EKXA 4EY3A 4Q47A 3CN9A 3JATA 1BVRA 2VHCA 1UELB 1ZH0A 1I3KA 1Q6ZA 4NCKA 1RC0A 1FDUA 3RVJA 4P38A 2AR9A 4L7VA 5JPIA 1IY2A 1BO6A 2RI0A 1RLOA 2RG7A 3D6JA 3X2EA 2GCOA 4OHRA 4YTEA 1DRJA 3QTTA 2X2PA 4LRTB 3G0DA 2XAGA 2R93J 1U3TA 2B6HA 2R8OA 4YT4A 4XOIA 1YQEA 3ZTYA 3HXOA 3I5XA 1NG6A 4MUXA 3LY9A 1E3WB 3S17J 4YT2A 4FT2A 1CUJA 4RZQA 1GHCA 2DPLA 1KXJA 3L6RA 1QBKC 4YR9A 2XUJA 4H7HA 2TMDA 5T4HA 3K72B 4Z8XA 1UADA 2E48A 3HB9A 3KPWA 3O1IC 2BELA 2HLPA 1IHDA 4F72A 2HX1A 4KAJA 4I81A 1SUWA 1NSYA 1JXSA 2O8EB 4I0WB 1QNFA 4FCYA 4EB0A 3EUFA 5IVIA 4HLUC 4RW0A 4AKTA 4I6GA 1WFXA 3O75A 1TLFA 1GNRA 2CLIB 1VQOI 4J4BA 3PS9A 4RNDB 4BKUA 1U7WA 3I8SA 4S2EA 1G2HA 3OZAA 3HYIA 3AESA 3CHYA 2FUNB 1K6IA 2XDAA 3I72A 2P75A 3K9QO 2ZYDA 1YITI 4NICA 2B0LA 3N2KA 4HPWA 4G8XA 1EI9A 3U0BA 4FMDB 5DHUA 3B52X 4PCUA 3U7EB 1T6SA 2BAGA 4MWBA 1W5TA 5JCOC 4L0CA 3HBJA 1O1YA 3CEJA 4XK4A 2O8CB 4FNOA 3IEKA 1VTNC 1J70A 1Q17A 2ZYVX 1LQ2A 3GLFB 2P4EA 3CDHA 3WJ1A 5FPKA 3NHZA 2XAUA 3BT7A 2BZGA 5ALDA 1KSJA 3QXCA 3CNEA 4A2WA 4Q21A 3CC8A 5FWYA 4HTAA 4I55F 4RELA 1GPMA 2DFIA 3DTNA 4OQEA 3NAQA 5IBQA 1M8FA 3BL6A 3IMCA 4L50A 1KMHB 5I5EA 3E6CC 3WE3A 1VSBA 3GTOJ 4PYQA 2CT8A 1TU0A 4B7CA 4ZT6A 2YXDA 1U78A 3HSFA 4WBSA 5FKJA 4CZ2A 1RKUA 5CYFA 1T4MA 4M86A 4X6YA 3LO8A 4RACA 2XAJA 5FKNA 4RPKA 3ZHOA 1Z88A 1A9OA 2QD4A 2QUBA 1Y4SA 1J7JA 5D5VB 4DWVA 1LDEA 1O08A 4B71A 2JLXA 2WWXA 3A11A 3UXMA 1G20B 4L85A 3DBIA 3JVDA 4YRNA 3GLGE 4N5IX 1WUJS 1T15A 3JQAB 3K7EA 3E9NA 3CZCA 4XQ0A 3P9IA 1ZOIA 2BKUA 2F8TA 4UZSA 1QVAA 4PJMA 2HY7A 2JPCA 3N8HA 4EVQA 1SEUA 2XT6A 4YY3B 3L1IA 3PLRA 3L7WA 1ZIDA 2XUIA 4A73A 1AQIA 2C7PA 1UINA 4NQRA 3PSAA 2MR5A 3SXYA 1WOMA 1M6VA 1PD1A 1HSJA 1YACA 3AERA 4AIHA 2IVZA 3O3KA 4DILA 5HXAA 3IAXA 5BQFA 4J6FA 2O07A 3E5XA 3K1ZA 2Q3JA 3HN6A 3KYDA 3J7AO 2DQLA 3I45A 1WXEA 4WOPA 4K9NA 1XZQA 4EY4A 5DRYA 1IOWA 4D7MA 2CVHA 2CJFA 4AJKA 2DFTA 1RXIA 1MBZA 3WYAA 4EJWA 2A5FA 2HQSA 5DT2A 4ZDOA 3B1ZA 4L2IA 1DKUA 1YBMA 1U2DC 3HGMA 5HM8A 5IYBJ 4TL8A 3I76A 1VE1A 2O8XA 1DXOA 1TFUA 1AXRA 5JU6A 2CLDX 3K70C 2D59A 4TKUB 5E9JA 3UHJA 3KJQA 2ZNZA 4OQPA 1NY5A 1TCUA 4JC8A 3DLAA 4FLMA 2QORA 2O4CA 4YVFA 1G2PA 1QRDA 2N42A 4D6PA 1K66A 4IJKA 3TIVA 2ISYA 4MAFA 4WW0A 2VJKA 1HE4A 3N2EA 4E2ZA 5F1RA 3AEUA 2IC5A 5DNUA 3JQ9A 3DYVA 1Y8QA 2X6WA 1FYLA 4DSOA 4EMSA 2XCQA 3AR4A 1RWBA 3KLBA 3RYHB 3KCCA 1OCPA 3WBJA 4FN5A 1NF9A 2ISZA 3BG9A 4B3CA 1WVMA 1JP7A 1FBUA 2UXNA 3U0VA 1G5TA 2OE2A 2HA3A 5D6OA 3NV7A 5K0BA 3THOA 2A58A 3KQLA 5D3ZA 4I01A 2JIZD 2ZJ6A 4OBXA 2X7XA 3IP4B 4P3PA 2DSTA 3DAYA 5EZQA 2QV7A 2V1NA 1Q92A 3HU2A 3MN2A 2Q3CA 4E07A 3CEHA 2VK2A 3UJ6A 2BSXA 2B5OA 3PKIA 3DDZX 2QN9A 3LA3A 4IHWA 4ARZB 1AUXA 5FB2A 5EPOA 4E2XA 2M0CA 3WGOA 1XPOA 1AK2A 4U7FA 3IRVA 2GWRA 4EJUA 3UMFA 5KAMA 4NHJA 7REQA 1KAOA 5HLTA 4PQFA 5B1IA 3IEMA 3E7LA 1Z05A 1WSAA 4W82A 4RDHA 3DPTA 4DQDA 3BRWA 1ISRA 3NXKA 2OAQ1 5IU6A 3DBLB 4K9LA 4OOFA 4P8RA 3T1VA 1EM8B 4UQPA 1KYZA 1QMGA 4KZPA 2AKYA 2WJ6A 3O84A 1XGKA 2ZZNA 3N39C 2Q1ZB 4V0OA 1EE2A 2CHEA 6Q21A 2WJ4A 3K69A 1YA6A 4KICA 2I4NA 1I30A 3NWOA 3IEXA 1BROA 2ZIFA 3Q40A 4IHTA 4D5FA 4HL6A 3INTA 3I42A 4JB0A 3HJBA 1JKXA 5KAIC 1XYGA 2O6GE 4PXAA 5BURA 5CM2Z 2H06A 4YBZA 4N8SA 2ZLBA 5LHGA 4JK1X 5JEDA 5E7JA 1IL0A 1KHTA 2P2ZA 1VPVA 2PFKA 3ZXYA 1IEVA 2XVYA 4M6XA 3PDWA 5FV4A 2WY8Q 1L3LA 1WEHA 4KQEA 1SCUA 2MYPA 3UY4A 1PTJC 3DBHA 2PQ0A 2QVXX 3EZGA 2CDAA 1E4EA 4ZVKA 1N4AA 1EA7A 4YQEA 3L06A 5AP9A 1NMEA 2X40A 4J16C 1J5EB 2HOEA 2N46A 3JD0A 5IT3A 3NVDA 4OATA 4HADA 4M7OA 1G8GA 2AXTC 3QXXA 3INYA 3OU2A 4F86A 5LQCA 2PXXA 3B6IA 3ILYA 4PRZA 1P4GA 1SBTA 2JH8A 3L04A 4ESBA 2WIKA 3SE0A 2VDJA 2GLUA 1X7ZB 2VHTA 2J9GA 3K32A 4F97A 3BERA 3OT4A 1KSHA 3DW1X 4AF8A 3BXOA 3U5TA 5EXDA 1RZ4A 3V33A 4JWKA 2IKSA 3Q8XB 4H7IA 3ZCTA 1GPWB 3ES9A 2O57A 2CBXA 4QPJC 2GN2A 3V1LA 2RGDA 4TS4A 3AG4H