4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
4G2TA 3T3OA 1B2RA 3AHJA 3K5WA 5H9VA 1LFPA 5JDIC 1KKMA 3E8SA 4ZICA 3TQNA 3SVLA 1PFVA 1WJGA 2B25A 2PANA 1OYOA 3ZDAA 3T54A 4EI7A 4RK5A 5BN3A 2QRVB 3W79A 2V9ZA 3HYNA 4BU2A 1OXMA 1TO1E 3B1VA 3OLVA 3MAJA 4MCHA 4EMBA 3EYIA 4FT4A 3OFVA 3ZGOA 1IN1A 3SJUA 1A8IA 5FTKA 4EFLA 1AKHB 4LE0A 3OQIB 3ZVKA 1WXGA 2G8LA 3HU5A 3KKQA 3ZXSA 1VQNI 1PTKA 5JYBA 4JP3A 1EFRA 4Z0NA 2P7VB 3BG7A 4YHBA 4X00A 2AHOA 4MW1A 3N6XA 3ASVA 1I1GA 1EDEA 3K5PA 3P9ZA 2LZ0A 4C3JJ 5D5HA 2COBA 3FMSA 4B6SA 1QOZA 3QELB 3WYBA 3OO0A 3M3DA 1KU6A 1RJFA 4NZNA 4R8SA 4I7HA 4CL8A 2YWRA 1LDBA 3LNCA 3K10A 3O92A 1F60A 5L53A 2F55A 3P7MA 3M9WA 3PUIA 4RK0A 1GTSA 3E84A 3KJZA 2ZLBA 3GHYA 1G4DA 2YWGA 3OECA 2OXIA 2DDBA 2O0LA 4IIYA 4ZMRA 5H9WA 3L7WA 4OXIA 1K4MA 2IV2X 4MPPA 2XVYA 1B0PA 4EUFA 5I8ZA 3KO8A 2NVOA 5HCNA 5KYWB 4PIVA 3R3HA 3CVUA 4YJHA 1TO6A 3GJ0A 4G5YA 3LH5A 4QDZA 2IT1A 3F8WA 5FQOA 1ZWLA 1LS1A 1D0VA 5FKKA 1MAHA 3FR8A 4ZZIA 4JR0A 4YREA 2OD7A 5BOVA 4OQZA 1OLXB 1RYYA 4WOKA 4DRXB 5AW0A 5HX7A 1REPC 2Q21A 5LM3A 2CGPA 2JHPA 2OV4A 3B89A 3TIFA 4AO8A 3H0CA 5HFJA 3FIWA 1HZZC 3LBHA 3V8QA 3B5IA 3VU8A 1OCPA 1LI4A 3LHKA 2BZGA 1Y4DE 5I9LA 2VQEB 4FQGA 4U0KA 4XYBA 4ZZ0A 1A1SA 2GZ2A 1NURA 1N78A 2CFCA 1J59A 3QJ5A 4KHZA 3UUGA 5LLSA 5C7IO 5K9ZA 2MYTA 4YV0A 1DG1G 3GRAA 1K4TA 3NCHA 3W5UA 4LF8B 2FLWA 1BMTA 1J4AA 2ZMEB 4KFUA 3C8HA 3LCRA 3IP1A 3BD7A 4ZIRB 2QB5A 3PI7A 3HJFA 1MX9A 2A9VA 2VF2A 2FQ4A 1HA3A 4MOWA 4BFZA 4ZZ3A 3PHBE 3WA6A 5JIBA 1L4LA 2OM6A 5FHRA 1ICEA 3GP5A 3JPYA 4QWQA 4F0JA 2Q1ZB 1UP7A 2P75A 3S16J 3BTSA 5HOOA 4GNRA 2YJ5A 4R3UC 4RK4A 2DOKA 4LNHA 5DHRA 5JS8A 2FUNB 4FR0A 4O08A 4D80A 2DPMA 3O38A 1A4RA 1U3TA 5D4SA 4RH0A 5DGTA 3Q9SA 1TMKA 3U62A 4EGFA 5GAEJ 2FK7A 3IAHA 4XVHA 1O08A 1M5UA 3OQ6A 5HR5A 1QE3A 3IVGA 1KI2A 4P80A 5FI0B 1P2FA 1PJBA 2Z16A 2VAMA 2YHUA 3BHIA 3L7NA 3LHSA 4KXVA 5H68A 2OBMA 2GEVA 4IKPA 2I2AA 1ZRSA 3RIHA 4F2GA 4GKJB 3BMNA 4U7FA 4OHWA 4BAGA 3QYBA 5CIWA 2I8DA 4LNUA 1BOOA 2JLQA 5B1SA 4KIUA 3VR3A 1DDIA 3R4KA 4HEA6 2GHRA 3AIIA 3K1AB 1H5NA 3LA3A 3FZQA 5DHTA 2VRNA 1WXDA 3NYIA 3TE6A 4EY8A 4IINA 2PE5A 3OY9A 3Q3JB 2OZ6A 1U11A 1Y5IA 2YHIA 3AP1A 2ZSEA 3N28A 2BBYA 3WQRA 3HBJA 2V65A 3UNGC 2P4EA 3O2SB 2DFTA 4TM8A 4WINA 4LKRA 4JX4A 4D0RA 1WIWA 5G1OA 1EAYA 1QHIA 3I9JA 3QE0A 4KQCA 5L3QA 1U8RA 2GETA 5FQNA 4K9RA 4IM7A 3V46A 1M1NA 4W9NC 1HF3A 2EQBA 4JVNA 3RVJA 1GL6A 1U6IA 3JWHA 1VG0B 3IQXA 4CUKA 1F3OA 3B6CA 2P40A 4MWBA 4ANFA 1A4XA 5IVHA 3TSZA 1GA6A 3LQ1A 1N6OA 3PVZA 3NIBA 1HG1A 3EWIA 1B14A 2QGZA 3GFVA 1D8TA 1DARA 2EFYA 3TNFA 4DNPA 1JJ8C 5C51B 2R87A 2D5BA 3MGAA 4FYIA 3QA9A 1KHHA 2CLLB 3E3AA 4JCCA 3VR5A 3IAS2 5I7SA 1PI3A 3BD8A 3K2BA 4M3GA 3H0DA 1DXHA 1HK7A 1APLC 1GGHA 2FEKA 2ZAGA 2B20A 3GEGA 4PX3A 3RVLA 4X8OA 1DTWA 2H2DA 1GT0C 3K0BA 4JAVC 4QGFA 1XF1A 3QXXA 3BUSA 1NUUA 2QBYB 1K68A 2B3TA 2CVQA 2VUHB 3ORFA 1UJ4A 3DDSA 4V3CA 4CCYB 5JSFA 1X7XA 4WLOA 2HZTA 5KSYA 3LBYA 4KPFC 3ZZNA 3P26A 1ARZA 3RQIA 1R6BX 1IOLA 3DDOA 2JRLA 4CVNA 1WVMA 2JJ1A 4HWTA 4O33A 1WKMA 1DDGA 1OFVA 2ZB8A 3UT5B 3I0TA 3BMQA 4HZFA 5YASA 1C5KA 1EWRA 2WBLC 2XMQA 1QHEA 4QPPA 1MGPA 3S4YA 3VI4B 3VAYA 2XCRB 3PXEA 3Q5GA 2B36A 5DNVA 1O94D 1P7PA 2W8ZA 2IA1A 1IV6A 3G49A 2BGIA 3V4ZA 4IJAA 3CCJI 3IAAA 3L7YA 4R1OA 4X54A 5I45A 5B57C 2ZQZA 1KWGA 5JVGF 1JAZA 2HRRA 3LE8A 2G06A 1BW9A 2I22A 2JASA 3MTJA 1ZOIA 3LRTA 5I5GA 2ZE6A 1FSHA 4GNKA 2IZ5A 2HA5A 3QKRB 1U7OA 5GTHC 5GPBA 3HRHA 4CMAA 4EB0A 4MZDA 5BV0A 3VOAA 1Z5WA 5AM0A 4QTTB 1KZYC 2OPBA 2P1DA 1YFZA 4DY4A 2V7EA 3GLIE 3LSGA 3RRXA 4ZTJA 3ZHUA 3HPQA 4CRWB 1ZREA 3FWKA 2Q8QA 4HWRA 2C98A 1E7QA 3EDMA 4ZPXA 4XDHA 3ZWPA 1VQ7I 3UN1A 1TQMA 2G1AA 3LFTA 1E2PA 1BR1A 4FZJA 4PAGA 1MSFC 3UGTA 5LQJA 3AG1H 4M76B 1F2DA 1YTLA 2A5YB 4JJFA 4A5NA 4XIGS 2MJLA 3OEHD 4DLSA 5ITZB 4UUVA 3E6MA 2JIOA 1RI2A 4ZK2A 4UNRA 4AMBA 1USTA 2OPTA 2QSJA 3HK2A 3C5HA 1ZMOA 4D6PA 4GUAA 4HAZA 3AJRA 4PBSA 4HP8A 3SYKA 1IY1A 2ODAA 3Q2OA 2FY8A 521PA 4DGQA 2IH2A 5TMEA 1NLFA 2EGHA 1XKQA 1DSSG 3EA5A 1U9NA 4GI5A 4FILA 3VV3A 1S7CA 2O3FA 2UZ4A 4EYKA 1P91A 3UH1A 2JFFA 2EJUA 3EZ7A 2OC4A 4WJKB 3QX3A 2WTMA 5JLWA 1SC9A 1K06A 1UC5B 1KZGB 2ISYA 1U8TA 1YTYA 3EUEA 4EHJA 3CB4A 3ESAA 1VTNC 1B8IA 2A1IA 2DMUA 2JL1A 5LGTA 3E3LA 5F5XA 4RUKA 1E92A 4GXNA 4CI0B 1WF3A 2FPIB 3KM0A 4LTDA 3DLHA 4OX9B 5ERIA 1GUUA 1KBOA 3PLAE 2R3SA 2GAOA 2V6MA 1DT5A 2YYSA 4D99A 3DLIA 1D0XA 1EGMB 4RJIA 3W6KB 5IEJA 1LFDB 4BS9A 2ZKIA 3JAMK 4L76A 1VJRA 4POOA 1FXWF 2P67A 1SZPA 1ZBQA 3VSKA 2GGSA 4BH9A 1T2VA 2J4FA 4HLUC 5HPYB 1B8PA 4D7MA 1GGKA 5F27A 3OOHA 3WGUA 2BMAA 2GHIA 5JRDS 4R1SA 2QTHA 5EN4A 3AFGA 4IDOA 3P9RA 2DULA 3T0IA 4INPA 3BIJA 3N8HA 5MHTA 3P96A 3O5AA 3C3AA 5BN5A 3DKVA 2BXZA 3S2HJ 1JDUA 2C29D 4WXEA 2VPRA 4M9RA 3Q0WA 1DHRA 5DBEX 4BBPA 3S8MA 3ADPA 1KZ4A 3OLXA 4R8RA 4IUDS 4WOCA 3MIIA 1VDZA 1ZL0A 2FWBA 4YP9A 1GLNA 2GBYA 1D07A 3D0KA 3JRWA 4JB2A 4KWHA 5FUWA 1TF7A 1RMQA 1SVSA 3JW8A 1H0HA 5CJ9A 4ZZDA 1X7ZA 3BMXA 4J0QA 3ICVA 4RHFA 4X7PA 2ZXWH 4BY1J 4LCJA 4ND6A 1AUPA 5FBZA 3T7AA 5D8DA 3WWZA 2O1XA 2ZPUA 5TS2A 1K6JA 1BQ4A 3C8MA 3OYCA 5KZMB 5EWMA 4RLSA 3FKSA 3WB1A 3BH6A 1MOSA 3MBIA 3NEJA 4U9HS 5IC6A 4BJ6A 4K0KB 5JG7A 2RJ3A 1JE0A 1RLMA 2XVAA 3EISA 4FLFA 2LW7A 4RVGA 4HDNA 4F6RA 1IRGA 1PVOA 2P35A 3NDIA 5JANA 2FQ1A 1H9AA 2EJVA 1J75A 3EETA 2WPNA 3EZLA 2ZUEA 4LYJA 3FXJA 1CZHA 2DFEA 2HRDA 4L5IA 4P7BA 4RHEA 5DGXA 1V1MB 2P4WA 3GJ7A 4MQBA 2X3FA 3PQ5A 4HLCA 4C2AA 1RLJA 5IVIA 3A4CA 4YJ3A 4MV6A 3RUAA 3JRIA 3ZWQA 3HNRA 3LSRA 2KRCA 3L4JA 3RVKA 1LDJA 1NG1A 1OXUA 2R6CA 2JKVA 3K0CA 3OICA 2MINA 3BORA 1R1UA 2PMUA 2CCJA 3MTIA 5CA1F 2NU9B 5BURA 4LXHA 3E3NA 1JH8A 4GR4A 3K0AB 2ZO4A 2QLTA 4JC8A 4KXLA 1G7TA 1Q7BA 1RM0A 2YWBA 3L1KA 4DLKA 4G0QA 2WTNA 1CUFA 2WF9A 3R74A 5BWCA 2Z8YA 4HH4A 1NHWA 3ZWKA 2WQ7A 2OBFA 3H0EA 5B2FA 1KDRA 3FXOA 1JT0A 3AY7A 2FUG1 3F6SA 3FGOA 3OOYA 1BC5A 4IF6A 4WZAA 5DNWA 5I4BA 3MZ0A 5FLXZ 2DBBA 4RD6A 1UXKA 5JW6A 2IA2A 2AUNA 3JRFA 2WC2A 4HSGA 2FWAA 4EKNB 7GPBA 1XLWA 2X23A 1ISGA 3BFXA 4TZKA 2QUAA 3GCZA 4YWJA 1FRZA 4ZO6A 1QO7A 3CVJA 1L5VA 4PJMA 4JYBA 3ZY4A 2C4KA 4ER5A 2PLRA 1CZNA 4YRBA 2NP6A 4UVHA 4CM9A 4DMMA 3IMCA 1QG6A 3DFFA 1TMGE 3K7EA 4Y1FA 4ZVMA 1CY2A 3N0XA 3C6ZA 4LE2A 3RE1A 1XZPA 4ZEMA 1JIJA 3I2YX 4LAFA 3MS4A 5BWMA 4ZGBA 5B6PA 4N40A 5IC5A 2X9DA 2JAWA 4KSCA 4Y2YA 2JIBA 1AGYA 3KOYA 3CZ6A 4I5EA 1ZRDA 3X1KA 1GG2A 3ONNA 4NBWA 4GYYA 1MDMA 4UPDA 3HYIA 121PA 1DUXC 1U2GA 1RAEA 2AOUA 4BC1A 4BWYA 1XDBA 3U3ZA 1Y8ZA 5AUQA 1UBNA 2ID8A 3IQFA 1WU7A 2O8NA 2OXFA 3P5JA 1JLMA 1SOAA 2QLBA 4JUFA 4Q4HA 4X84A 4BNMA 3E18A 3KZZA 3ZQJA 3C16C 5CVRA 3I2GA 4V38A 2KL4A 4RTNA 3BJZA 2JLAA 1Q21A 1U9ZA 3ADOA 3EPPA 3BTJA 1J39A 4LFBB 4FGWA 4HAUA 1TM3E 3EZYA 3KP4A 4W8HA 4CXMA 4G81A 4XB6B 4EEKA 2X51A 2PGJA 5JARA 1P6UA 2O2IA 3AO0B 1N8TA 3HY6A 3SZPA 1JMKC 2X5JO 1Y8RB 3KDAA 4LQCA 4LYYA 4X24A 5D2CA 1L8AA 1IHUA 3VR2D 4XSZF 4BUJA 1P81A 4LOAA 2E2IJ 1SD2A 1LDGA 2R11A 4DGSA 2CU7A 3W3AA 2VZEA 4WVFA 1OVGA 1ULTA 3BL8A 3OJCA 1THTA 3Q40A 3WMGA 4OKNA 4KR9A 4Q1VA 5J58A 5JVDA 5C31A 1JEQA 1Y6ZA 4FHFA 4ZK6A 2VKVA 1NH3A 2PUTA 3F5QA 1FYVA 1SWWA 1Y89A 3QI2A 4JBXA 5DT9A 2GESA 3TMKA 5KX5A 3SHFA 4NV0A 2X7HA 2E1MB 1H4TA 1DJPA 3D1VA 4E5NA 5KVCA 4A6EA 2A5LA 4IHJA 1WZIA 3T5GA 5F6FA 1XLUA 2QA5A 4P81A 3UY4A 5C5EA 1NT2A 3PV0A 4MGHA 5F3RA 4CDGA 5IDYA 5DNYB 3K70D 4ZHQA 4CFYA 1J00A 4X60A 2I6FA 3U5ZB 2AMLA 4AU1A 4HDMB 1P80A 4BV9A 4XB2A 2EV5A 3P19A 1UBSB 4K2AA 1QB7A 3LPLA 4J4TA 4UVBA 4ZVQA 2PX4A 1W5SA 2M6LA 4AWAA 3NHJA 2VUIB 4EHDA 5A1TA 4X0EA 3PXDA 5CVTA 2GFIA 1F4LA 4GLJA 2VJBA 3OF3A 3U3MA 3G7NA 3BTVA 3L4SO 2P7CB 3OURA 2V1DA 3QI7A 5HGXA 2EFGA 4MYDA 4DA8A 3SIRA 2KJCA 3COWA 2NRAC 3DM9B 5CIYA 1F8UA 1GPWB 1OCRH 3TIVA 3K0EA 3BCHA 4BDSA 3MXOA 2GRAA 2FQ3A 1YHQI 3JQBA 3F6CA 4XUGB 1MNDA 3V7SA 3IAM1 2HLDD 5HW0A 5KYKA 4DL9A 3KQPA 5DNUA 4KFTA 1YRNB 3F3XA 2P91A 5CRIA 5G0TA 2ODWA 4P3NA 5FNVA 1ISFA 1IWBB 3HU2A 1S2IA 3ZWCA 1XZDA 3CIFA 4CM7A 2PL3A 3B51X 3ZQQA 4AY2A 1N2GA 1ZM9A 1RPWA 2IKSA 3CMMA 1NSYA 2AG6A 2EJWA 3LSYA 3NWSA 1YQ9A 3OPNA 5DP2A 3R9IA 4U02A 3TRIA 3O8NA 4X9XA 1V96A 3BH7A 3B6MA 2K7ZA 3I2IA 3A7EA 3OIYA 4E5MA 3DCJA 2XUBA 4LJAA 2O2YA 2P2CA 2O20A 1QIDA 4XAQA 4P3YA 1W7AA 5CG1A 1W7PB 4G37A 4CIVA 1JG7A 4E31A 3MSXA 5C8ZA 4UBJA 1P61B 3NYWA 4ENTA 4LY3A 4PLZA 1CR2A 2JATA 4D3XA 2H1IA 2WVGA 2QJOA 1A4UA 4FI3F 4GPEA 4IDBA 1GWNA 2YVQA 3V2IA 2AMFA 3B7PA 2DE0X 3I5MA 4RAQA 5JFGA 2VQSA 1WHSA 2IDKA 3ED1A 3LWFA 2CZQA 2YQ4A 1M1YA 3NBKA 4C4SA 4NHJA 1XMVA 2HDOA 3BJIC 4RANA 4B4KA 1XN7A 4I0AA 4D46A 4EHAA 3NMUF 3S44A 3VI3B 3RKSA 4CHGA 2N1MA 1E3SA 4FINA 1V5WA 2GAIA 3HCDA 4E33A 4H18A 3CF6R 4DJTA 5B12A 4IXNA 1NG6A 3I71A 1FOYA 1EZZA 2ACEA 2MSNA 1TIBA 2FFAA 2V5UA 1XTPA 2ZIVB 4QGBA 5AHWA 4LSGA 4DW6A 3CKKA 4WK4B 2Y0PA 4YPFA 4KQJA 3RRNA 3DE2X 4HO1X 3FX2A 2K2QB 4I3HA 3FOBA 3G1WA 3WLFA 4TS3A 2VJAA 1EFVA 1F14A 2ZIFA 3IUSA 4YAFA 4A3GJ 3CZPA 3EMKA 5ALDA 1GNTA 3OL3A 1X7HA 2PIAA 2CQQA 4PSXA 4IHWA 2C0QA 2VF8A 3A06A 3KXKA 2G5TA 4G24A 4XYGA 3D5RC 4A6DA 2GXAA 2J1LA 2QRGA 4KP7A 3JR9A 4YX9A 3MZHA 1DELA 1QKJA 2HJ9A 1KQNA 4E5UA 1S96A 3FN4A 1JFFB 5CFZA 3C8ZA 5BN1A 1W36C 1Q92A 1U3CA 2KBFA 3MGKA 4G4SP 3CF2A 1ANKA 3CUEF 3A4MA 4GVPA 4JDPA 4NBLA 4QYXA 1N36B 2P78A 3JAKA 1D2NA 3ZV7A 4OGKA 5T5QA 1PS9A 1JFSA 2WYOA 2IUEA 1TVMA 3BZCA 2QM0A 3I76A 4OQXA 4CT0A 2C58A 2WMDA 3WHPA 3ROKA 1I4WA 4FS8A 1JDBB 3G13A 3C2GA 3MMPA 4P3OA 3LZCA 1W0KA 4S1OA 2CFTA 1ACJA 4EJ2A 4A0YA 1LS6A 4JJ4A 3W5JA 5LMUB 1P9QC 3LLSA 2YTZA 1JE8A 3H3JA 3IILA 1YZVA 4Q4HB 3PJFA 2Q50A 4X41A 1B8VA 5DEOA 5KI6A 5LDHA 5KCZA 4PW0A 1R36A 2GEBA 4PWZA 1KDVA 1J42A 2WB2A 2HEGA 1CUAA 1XRRA 1O6CA 2ZFUA 1S0UA 2DKNA 1OX6A 3QX9A 4TL9A 3ZGZA 3NT2A 3OX3A 2F8MA 3UA4A 4LTNA 1N6IA 4R2WA 4LOLA 2BFBB 1SRRA 5E8RA 4B48A 5C1DA 3BHJA 3FOCA 5IN5A 4CMEA 2I1QA 1QFYA 1O54A 2QUFA 1QH9A 1XZFA 2EYUA 2IVZA 3GG9A 3K2QA 2P5VA 3HOXJ 1WL8A 4X7RA 2OTCA 3WA7A 1O3YA 1QQAA 4LF9B 4YROA 1R4MB 4FISA 3PUJA 4GOOD 5E20A 1ETQA 1PGJA 2YWHA 1PLLA 3ZMSA 4IQFA 3KOWA 1K9SA 2O2ZA 4EAAA 4US2R 4HQ0A 3EF0A 4ENPA 4MEYF 1O0CA 2R5YA 5LMNB 4IOKA 4P92A 2O8EB 1ZCFA 3BQYA 4JBGA 5L3RA 1KO4A 2A2ZA 4E0BA 3BIXA 3EEYA 3FLAA 3F46A 2IZ0A 4ND2A 4TYMA 1NR5A 5I9MA 3PSFA 4XLTA 2AI2A 3PPXA 1KJWA 1E5TA 4Y3OA 1IF1A 3R7SA 3U48A 3PT5A 1IH8A 1VC2A 1ORIA 4WY8A 2BEUB 3LU1A 5FYDA 4LK0F 5KSPA 3HOVJ 5ICSA 1XJQA 4RTRA 4YCMA 2GAJA 1Z6YA 5AONA 5FTNA 3GWZA 5DM6F 2VLAA 5IT9K 1CXZA 4J7AA 3P0JA 4LK1F 2HDHA 2R60A 3QM1A 3R2JA 1KAOA 1OW3B 3DDHA 1E3MA 1G8YA 1ZINA 5B1DA 4MVYA 1D0IA 4EL0A 5DDGA 3C5WP 5JCPA 4C1BA 2H5JA 5JECA 4AT1A 5KQGA 1Z0ZA 3F4LA 3HY3A 4WKNA 4RCVA 1FT9A 5DK4A 2QX6A 3C3CA 4JK1X 1HYQA 5E3IA 4B7AA 5HKKD 4XOPA 1XHEA 1UIMA 1WGXA 1VQ4I 1YQUA 5CQEA 2E34A 1A5SB 1NP6A 1BWQA 2HA6A 2QD1A 3GAMA 3GH3A 3OT1B 4BBSJ 2P6MA 4JSRA 2VWQA 2KLOA 4MR9A 4NOKA 1G18A 1HDOA 2CMKA 2LDBA 5ENVA 2I1LA 1NPTO 3NM6B 2YY5A 4ZJYA 4DG5A 2PUEA 3HZRA 4TZTA 1VQPI 1FLAA 4H7HA 5GV8A 4ETSA 4YYEA 5IAAA 3RYFA 3W4IA 3AESB 1OYWA 5IEBA 3TNYA 1DDNA 5KAPA 2EBUA 5CJ2A 1X80B 4GX1A 4X5OA 1O94A 1MGTA 2PN1A 1BH2A 1W1IA 3E9EA 1Q12A 1T9GR 3OCVA 4RMIA 3EQ9A 1QDUA 4P93A 4XOTA 1NVTA 2VSFA 3R3UA 2PZGA 3RS0A 4UAVA 3REFA 1IN5A 1JG3A 3W2IA 3EN0A 1HOTA 3WY9A 3J81A 2ZJRF 3PNPA 4LJRA 1ZRCA 2WLSA 2G5PA 1VHLA 3ANTA 3I32A 3LUCA 4WKBA 1TAUA 2RV8A 1Q19A 2HEIA 3HI4A 1A04A 3NUGA 4MMXB 4MINA 2XAFA 1FNSA 1Q0HA 2V7XA 3NYQA 5A71A 1C9KA 1KMHB 3WYEA 3LQ2A 2ODNA 4OSOA 4NMMA 4WN9B 4URXR 2NADA 5JAQA 1KMMA 1QS0B 4AWXB 3J80Z 1OJ7A 1C80A 2SKCA 3Q72A 5KYUB 3GMIA 4M9SA 2WT4A 1QQ5A 1TJYA 2E0IA 1P39A 2EWMA 4I5IA 2JA1A 2XSZD 1B6GA 3BXEA 4JENA 2Q5CA 4XE5A 5HJ7A 4B6EA 5T6BA 1OU4A 1K4SA 2QRZA 1MFZA 4G0VA 4A3IJ 4PQEA 2BGKA 5GQSA 1FJXA 2DBYA 1I5EA 4HA8A 2QYSA 1E7WA 3BWXA 3KWJA 3ROFA 1W49A 3K0FB 4U87A 1EJ9A 4EEXA 3DEJA 4YMGA 3DO8A 3FB1A 4HGNA 5A4DA 1TBXA 3KK0A 4CEJA 2WHXA 3VO8A 1SBCA 4EIWA 2CDCA 4BYGA 2G80A 4NEHB 3OQHA 1Q6ZA 5F77A 4IFIA 4GPTA 2XWSA 3RIXA 1IDYA 2EFDB 2X0JA 4LDQA 3DEUA 2DA3A 1M2FA 4MA4A 1IHYA 3JYNA 1GVJA 1CC1S 4Y2RA 3G85A 4B2PA 1ZI9A 1OLSB 4P5DA 2ZJAA 3OHMA 1T91A 2X77A 5EJGA 4RHYA 3HZZA 5LZ8A 4R0MA 1D6SA 4MCIA 5I7UA 3H1FA 3OHSX 3QVGB 3QLVC 1CY4A 1GR1A 1E79A 1ZKGA 4G12A 1K6EA 2HJRA 2ZRIA 3M2TA 3UMMA 4M6WB 5BXQC 1ZRNA 2GTIA 2ZVQX 3VSBA 1Q6YA 1OHHD 2BSAA 2GQQA 1RYHA 1KETA 1AIPA 4BNZA 5BS6A 2IVMA 3RKQA 5ESRA 3VDNB 2Q8PA 3HBMA 3HRIA 4A8JA 4ERXA 2OVBA 1T8UA 1E2IA 4PJJA 4MRAA 2V9KA 3J81K 5E1DA 3CDLA 3MJFA 4RTLA 2WB1A 4QPZA 3S2SA 4E1VA 4UOEA 4B3SB 2WWGA 4O8CA 2OECA 3HKEA 5TPWB 1ULZA 1FSEA 2HIHA 3MCAA 4DCNA 4DQLA 1NHAA 2XIGA 2OKGA 3KB6A 3GBGA 5TT1A 5MFZA 4ABTA 1W5CC 4ON9A 5FOWA 3MFKA 1CR0A 3QVXA 3L0PA 4N7JA 1E1LA 3ZIAD 1M6YA 4G0OA 1Q16A 1ZY2A 2DFHA 2WUEA 1BTOA 1UMDB 2ZBUA 3OC0A 4JEUA 4LDZA 2Q29A 4XH9B 1YI2I 2JFQA 4QBTA 2N8GA 5H16A 3NV9A 3LHDA 5C8XA 5JQWA 4BYMA 3BDAA 2OCYC 1O7FA 1F6DA 1FXWA 4BLRA 3FCAA 3JRNA 3GOHA 2QJRA 3BXZA 4BJ6C 4D4KA 5HZMA 3P4YA 4CMBA 4MLZA 5JWOA 1T0JB 2B69A 1V9LA 4U7BA 3VPDA 2C9YA 3K4CA 1QP7A 2RNJA 3H5VA 3AG4H 1DC7A 4ZVRA 1CS4C 3CJQB 2FMKA 2W7NA 2GYWA 2AXTC 4UUQA 2ADOA 4YI3A 4WBNA 3OJFA 3VU3A 1KVUA 2CE2X 4G94A 2PXXA 1PUEE 1SHZA 1NN5A 1T36A 1QR6A 4DXDA 1AF7A 3E6DA 1IULA 1JKJA 4HAYA 2AOVA 1TB4A 4PYIA 5BN3B 3W3CA 2ZJ8A 3DWLE 3HWWA 1MZPA 2WJGA 1EFVB 1TLFA 3HMKA 1NASA 2CFXA 1XD2B 4G25A 2HHLA 2OSBA 2ASVA 1GM5A 2BOLA 1Y5LA 3QV2A 3WLTA 3L6UA 1H1TA 4MTEA 2ACKA 2CD7A 2ODEA 3F90A 1I9CA 2WM2A 4K6OA 5T4EA 3I8XA 5CDSA 3I04A 1RI5A 4IYRA 5DHFA 4KICA 4PSAA 2KJBA 1R0RE 1BQEA 2DJNA 1ZOOA 2K4BA 1U2WA 2DYRH 1H5QA 1PGPA 2CMHA 3AR2A 1NMQA 4GMGA 4HYYA 4KWIA 4PPYA 3NIWA 2IYLD 3K1NA 4ASNA 4QTXA 4CKBB 5G4LA 2W84A 1Q7EA 1TADA 4N6OA 2E71A 4A0SA 4ZHSA 3D6TB 4J49A 5HKKA 1PG5A 3ZQCA 4LSMA 3ZTTA 1DXOA 3USZA 4BO8A 2OQGA 3RZOJ 4HXGA 5JQGA 3AKDA 2R85A 4HLDA 4HF2A 2IW3A 3PRHA 2GDJA 4AB1A 1DJMA 1Q2UA 4LB6B 4KQ2A 1XWFA 3C48A 2IU6A 1IWOA 1HL7A 2BMWA 2H3EA 1TM2A 3HJHA 3O94A 3QBJA 4YRQA 5GMOA 1S7OA 1ZQ1A 4X44A 1JQDA 4Q37A 4UBIA 2WY2D 2WSSA 4GBMA 3SY8A 4CTJA 2VEOA 5JT1A 3S7TA 1R15A 4EA9A 1IEQA 2IYQA 1A96A 2VFAA 3ESYA 3KZOA 2H1FA 4H7JA 4MQUA 1DBQA 1I6LA 1VTKA 1YC2A 3BDIA 4MUJA 4Y98A 4EBBA 3LA8A 4RVNA 5CCEA 4FE4A 4NB5A 2OCIA 1R5GA 2WMOB 2Z2KA 3FGZA 3KOXA 4RAOA 4IV8A 3B1WA 4IL5A 3F3YA 4ME6A 4C0SA 2IXEA 1XEFA 2HJVA 1JHXA 2X1MA 2V1NA 4CCMA 1K8QA 2RGYA 4MFEA 2WSBA 2FSPA 3CH4B 1E5QA 3DCYA 2WV1A 2O7OA 2BRUA 4TV9F 1UJNA 5FOUA 3F71A 4BRWA 4EK9A 1YR1A 3PDUA 1S02A 3SC4A 4X3OA 2GS9A 2QX9A 4JLWA 1U7XA 2QAGA 4Z1MA 1R8YA 4C43A 3LX5A 3CZQA 2Q9CA 4LWZA 5D00A 5KYUA 3RSOA 1QK5A 5CYGA 3PFHA 3TUZC 2SHKA 1K3TA 1KK0A 2PS1A 4TSFD 4BLTA 4AQ7A 3AF2A 3KFLA 3KR1A 1JH9A 5BN4B 4JP2A 1RKVA 1SXJE 4P0TA 3M6XA 2IW1A 5L4LA 3K70C 1TKRA 1YZQA 5J4HA 2JC3A 2NO9A 4LS3A 2GARA 3QG1A 2Y92A 5CB8A 2BHYA 5B1BH 1DC8A 3TOCA 1F7UA 1LBIA 4E2ZA 5JD5A 2NMVA 1COWD 3I42A 3QMMA 2LNBA 3Q8XB 2AXLA 3DBHB 1PKEA 1XVVA 1KO8A 1EE9A 1XAHA 2IUFA 4L4YA 2AFRA 4WCFC 3G2QA 3UG7A 2ZCVA 3K2IA 3TDKA 4F55A 2YZ2A 1GXSA 1N8KA 2J31A 4LJLA 4JI1B 2H2AA 4CLOA 5IAKA 5JTUA 1GCGA 3VR4D 3ZVLA 1UKEA 1YRLA 3E7WA 1QHXA 3WBKA 3WK4A 4ZOLA 5EMLA 3H1BA 1EVLA 4JXJA 5TEVA 1WV0A 1U9OA 4J0GA 2E1NA 1WQ3A 4HQOA 1YI8A 1QHGA 3BAZA 3UB2A 2W6IA 5KX5F 5HE9A 3A6FA 2CVHA 1EWTA 1I6XA 1STOA 1TK3A 1VCOA 2DUNA 2MYPA 1ETUA 1XXHE 3BF7A 3NX4A 4I6GA 3PTZA 4RSRA 3TGPA 1X92A 1RAGA 4JT9A 1QRYA 2ZTSA 5BNGA 3ESDA 4ZAZA 1QGDA 4V2UA 2R6R1 5G0SA 2X4GA 3DBRA 5AVXA 2GBLA 4C4ZA 3QUSA 3C7AA 2IU3A 1GITA 4NS1A 1DEHA 4ZYWA 5JEEA 4Y6OA 3D4IA 5AKEA 1WI3A 3RKWA 3KJXA 4R9SA 3W5IA 4H6VA 4J0KA 1W7PD 2P5KA 1FQJA 4MUGA 3A36A 3T4UA 5FLXA 3ECSA 1F43A 3V4VB 2G7UA 4N76A 2DRIA 2HBRA 2QE6A 1NMSA 3MJDA 2HDWA 1OAOA 3DVAB 5DULA 1F0PA 2WFZA 5DX8A 4FSXA 5E38A 1UB9A 1N4DA 1VG8A 2R5YB 1HDGO 3NALA 4JC0A 4BY9E 3U1KA 4ARZA 1JQAA 3WLPA 2F8TA 1H3FA 3I4PA 4ID9A 3QFRA 4AX8A 4JYZA 3M6FA 4C9BA 4E7ZA 3KUUA 4YI5A 2P9YA 3BWBA 1JPUA 2ZJ3A 1E8DA 5TE9A 4ND1A 4HNAB 1U3EM 3ZDXB 2YPRA 2YX4A 4U88A 4EWLA 4NBSA 1ZMTA 1IRXA 4X1KA 3VOBA 1N7HA 5REQA 2QT1A 3KDPA 1SVUA 2E82A 2HRBA 3WLEA 1WSBA 3ZZTA 1IM5A 1ZJWA 2HQ5A 2R1VB 3QG5A 1EP3B 4H1UA 1JHOA 4BKUA 5HZGA 2FV8A 3NH6A 3SXUB 5FNZA 2NVUA 2QMOA 4H7DA 1POGA 1E1KA 4M7OA 4LX8A 5A5FA 5J5CA 4YCBA 5JMOA 1B1BA 4F4CA 1OFGA 2OXEA 2EJBA 4J0IA 4J07A 4AC9A 5L4SA 4UUSA 3ET5A 4QULA 1Q0PA 2FQWA 2SCUB 1OKRA 1G5HA 3LQQA 2JRTA 5DUIA 1HSTA 3C1AA 3WLOA 5E3MA 1XPOA 2FP4A 1DTSA 3BD6A 2COEA 4PLFA 5TJJA 3C85A 3R3WA 1EIWA 5CM8B 5K3SA 4UTVA 1G98A 4H31A 3S1MJ 1J97A 3H3UA 2QRNA 4RD4A 3UJ8A 3SEQA 4GP6A 4X66B 4YH1A 3K70B 3ZDEA 1PEDA 2FB9A 4XDYA 2M98A 4QBKA 4DNQA 2YX1A 3RS9A 5HIMA 4DN6A 3E8XA 2XNKA 3ZCSA 4C08A 2A5DA 4D9JA 2ZJYA 4XLCA 4P38A 3WKBA 3L0YA 4BO0A 4F8EA 2VP5A 4HGPA 1WDLA 5A2QA 1TEZA 4MRSA 3OJ0A 4Q21A 4XUDA 2YY6A 1LPMA 2WAAA 3A9SA 3G17A 3CR7A 3VTZA 1EK2A 4BL0B 3KB1A 4ARSA 4NONA 5AVUA 3ESZA 1IZ1A 2R5FA 3HR4A 5JXHA 3L04A 4ZVUA 1LLUA 1RDFA 2UZ1A 2NPOA 4BO9A 4WK8F 3RB8A 1R0CA 5THKA 4DRXA 2ZREA 3KUCA 1VL5A 5BR8B 3BJRA 3W8FA 4PO8A 4BE2A 4FX2A 9GPBA 1A50B 2E60A 2V4MA 4OREX 5JMWA 1L5YA 3X1JA 5AIQA 3IR7A 3G8BA 5DTJA 1S5LC 4AWXA 1V5GA 3WYDA 2HTEA 2QZSA 3ROXA 3EPZA 1F8YA 2GJKA 5D6NA 4ZYZA 1YFKA 1NJGA 4NE2A 1KFCB 3EOAI 4IQ8A 5KYWA 1NXXA 3RPQA 5LFAA 3V6LA 1IJFA 2PRZA 4DQ2A 3GARA 2VHJA 3QVSA 4OKSA 4UU7A 1GZ6A 4WV3A 4EB6A 1FDIA 4YUAA 3JALB 1FNNA 4JS0A 4TOIA 3G2LA 2NNLD 3I59B 3CXRA 3IJEB 3F7OA 4IOCF 2QZ8A 1EYZA 4YGXB 4HW0A 4LB5A 2JH8A 1D2AA 3A0UA 1SN7A 1OH8A 3LMKA 5LOVF 4I2OA 5DLYA 3A27A 3H2IA 2AKAB 2RK3A 3R7AA 5EE1A 3ZHQA 5EIBD 1ZW1A 4URVR 3SDSA 1I4EB 3EAFA 2PZJA 2JFNA 3PG5A 2NUTA 1D9ZA 3H2SA 5BUCA 1YL6A 4B5KA 2FUKA 2C6YA 4HAIA 4XONA 2X3YA 3EARA 4G07A 1V4NA 4BLSA 5IJ0B 3A3YA 1U6KA 2ZG6A 4YRSA 1TL7C 5EZ5A 4C0HA 3BMNB 4ER7A 3BPVA 3RC2A 4GXOA 3HZJA 5LEKA 4NJOA 4EYSA 2VQLA 2WKQA 1DQPA 3DFKA 4R79A 1YITI 2DWPA 4TN5A 4MIOA 1UMBB 2ZRBA 4MQMA 4HY3A 4BTEA 1W2WB 4MP3A 3EXHB 2FXAA 1JHYA 4L3OA 5CXXA 1HTBA 3QEOA 1FYFA 3WV5A 3R5SA 3NOOA 2FSVA 1IHPA 3FPAA 1VZ2A 4Q19A 1JHAA 3O4RA 2J3QA 4CKCB 3I3LA 1AKEA 4CXFA 2ISQA 3DKRA 1FFSA 3R0QA 3LAJA 3ERMA 2H9AA 4AM8A 4KC0A 1JXQA 3SS8A 3WL6A 1N2EA 3AW8A 5EF6A 3OIUA 4YMIA 1E3QA 3IOCA 3NFYA 4HN4B 3LY9A 4L4XA 3GD7A 5CVIA 3OPQA 2IHKA 2PT6A 4GWKA 3DXZA 4JQCA 4BJ5A 3WJAA 3WGTA 2XUKA 4MGRA 3FUTA 4MKRA 5KNBH 1BVRA 4D0NA 3H8WA 3ZMDA 5LP6C 2R8PA 1NVMB 3WGVA 4C2BA 2I55A 2NUAA 4JLNA 4A8TA 1MMAA 1BS1A 1PL0A 3DZKA 5B3SH 4YCCA 1YFJA 3NRJA 3HUDA 4PC3A 3CO7C 2ZJ5A 4BMDA 1CJTC 1E3HA 4QU5A 1PJQA 3OEHA 5ESDA 1BA3A 2FSUA 1LB1B 1UZMA 4JLSA 4DC0A 1W5BA 3DOIA 4EY5A 1E0JA 1Z6AA 2Y71A 3EZGA 2DT7B 1L3BA 5GOTA 4AZ0B 3CR8A 1D8KA 2L9NA 1P17A 1UBJS 4YIFA 4X91A 4BKOA 3CH7A 3OKFA 1WE2A 2XDYA 2LMDA 1O94C 4ON0A 3K9BA 3LCVB 1R23A 3PXXA 1OCCH 3QUCA 2O5EA 4DDVA 2Y75A 5H83A 3AYZB 4A6PA 1HEUA 3ETDA 4MHOA 5D5WB 1S01A 3PQ4A 2W25A 5HSGA 3WGNA 2WPDD 3UUEA 3UCEA 2HRZA 4OGFA 3GFGA 4RA6B 1SGWA 2GD2A 2WAQN 5HODA 1M34A 3FPFA 3GVHA 2G7HA 3IODA 4MUBA 4ESBA 3BKXA 3AIOA 5AOVA 3HN2A 1I2AA 4LGWA 1F4VA 2N42A 2Z9CA 1ZMRA 3GVXA 1TA9A 3MWYW 5ALJA 3T1TA 3ASNH 4H59A 4MMYB 1NMZA 5FFNA 5H3HA 5BXYA 5L3SA 3UJNA 4C7OA 3IAM2 4R4JA 3RG8A 4PPFA 3EGXB 1CG6A 4Q5IA 3GJSA 3KKPA 2I4IA 4L6CA 2WJ6A 4O1IA 3T34A 5A3JA 1CUDA 2O23A 4G36A 1USGA 1X7XB 4D98A 2O2SA 4D0PA 1I32A 3K0FA 1CB7A 1ILEA 4ZCLA 3ZX5A 3R6TA 3V33A 1BG6A 3NJ8A 4GR9A 2XGMA 4JBAA 1JKRC 1CUYA 4BU1A 3Q9LA 4DR5B 3KYCA 3J81k 2R5ZA 2R7ZJ 5J47A 5K5QA 5I51A 5GZ1A 3EZ9A 1BX3A 3RTGA 3FB4A 1GZSA 2BZSA 3OM0A 5K3BA 1JEOA 3AHEA 2HK6A 5I5EA 1P7JA 4KNYA 2BT4A 1T29A 1G8AA 5T4BA 2WK1A 2CJFA 2QXTA 3ZOBA 2NOGA 3LSMA 3W2VA 1HDZA 3QOWA 4QLOA 4P0PB 1RI4A 3PA8A 3BKWA 2FPUA 3GT3A 4JP1A 4BPRA 3K0SA 1MT0A 2VATA 5DTRA 2P9JA 3D8NA 3KLBA 1UL1X 2CXQA 4JB0A 1L4NA 2HIGA 3G7UA 3EXIA 4ENNA 2CL5A 3KSDO 1DBPA 3M8KA 2OU2A 3Q8WA 4M9XA 3GRCA 4UEJA 2ZAIA 3CW2A 3M81A 1XL1A 5FPSA 4C0JA 1VL2A 3DTVA 4ZHQF 3KJHA 3LNTA 4OGLA 4ECAA 1G4HA 1DBRA 1JT2A 3AK4A 4Y2UA 1TD9A 1AKMA 4DZPA 3G2MA 2GLUA 1SG9A 3M9AA 3K16A 4P7JA 3H1EA 1QBJA 4WZAE 2Z4TA 3RVMA 1QDLB 2BAGA 2HMWA 3S8PA 4YR9A 2R0QC 3B6IA 5AW7A 3TM4A 1GOTA 4MYCA 5CCXA 1PDOA 4J90A 4NJEA 1G8KA 5AW5A 3SI7A 2AR9A 2GEFA 3DMRA 4MV1A 3JW4A 2WV7A 1NZJA 4LF7B 5AWFC 4B6QA 4L8FA 1IWPB 1Z08A 2Y9ZA 2C9OA 4LRXA 4GKKB 1JG2A 1I36A 2F1KA 2FUEA 1M5TA 5CA0B 3H35A 1ISJA 4RZQA 1RWPA 1N2SA 2CF6A 3ECOA 3B53X 4NG5A 4QEZA 5EERA 3QPSA 1X3WB 3TZ6A 5C53B 2NP7A 2I65A 2WIBA 1X1RA 1OX4A 5AJVB 1ZCJA 1LE8B 3OAAA 4IH9A 4D4MA 4ZKDA 1QRTA 1G2PA 2UUBB 1GXSB 2IH4A 4A0ZA 2JGLA 5FR2A 3ZZUA 1NJ6A 1FFYA 1QLJA 3H84A 1B8IB 1IEWA 1KPGA 3UCXA 5AUPB 4ZRDA 5C2JB 4UE2A 5IYZF 3GDHA 3I39X 3SLRA 1TT5B 3B73A 1LEHA 4FKBA 4XOUA 3RSLA 5JNTA 1Y98A 4F1JA 4UM8B 3VISA 2AFVA 2HFJA 4WDRA 4ZOLB 4PAWA 5ED4A 4UDYX 3HY4A 3Q88A 2IYFA 2QYHA 4MX8A 2XXJA 2H63A 5IAGA 1YWGO 1TTYA 2WF6A 5FKMA 2WWTA 4N18A 5H82A 5CB4F 3IJ5A 1MG5A 1SUEA 3C6KA 1VGVA 1DQUA 3ER8A 5FTMA 4P86A 2FJ0A 2YQ5A 1T0HB 4GM1A 5DH9A 4U1RA 2QMUA 4CHTA 3HB7A 1XVIA 3IAS1 1V5IA 2ZR7A 4E22A 2ZKLA 3A3KA 1Y0UA 2LBPA 2OD2A 3FMGA 3RJ9A 4CZ2A 3ANLA 4E2XA 1DKQA 3HGYA 2Q6IA 3KEGA 3KJIA 3MS2A 4MV7A 4PZLA 1YRNA 1MJ5A 3U3KA 1G20B 1XPRA 4CA0A 2RGXA 3GAFA 4XLFA 1EQUA 2FVXA 3DAYA 3IP9A 3TW8B 4RS8A 1AU7A 5IARA 2DTDA 3MMXA 4BVBA 4EITA 2FPRA 2BGRA 4D45A 2V7GA 1DJQA 1A35A 4QOFA 1Z68A 1S72I 3PWTA 1KVRA 1I7QB 3G2JA 4G67A 1HE1C 2W11A 1JI3A 1ETOA 1V6SA 3CH5A 4P4SA 4BJHB 2PT5A 3OE7A 3I09A 3PUHA 3NP9A 1OWLA 1BX0A 1MDBA 3T1NA 2M2EA 3VTKA 3PC2A 1Y1KE 1YA6A 4D8XA 1FQOA 1LSSA 1U4NA 4QVIA 1QPMA 2AC7A 4WWCA 2P6NA 4HB0A 3PWKA 5E18F 3SQXA 5KUTA 4FX0A 4GX0A 3L6RA 4HBGA 4PXSA 3SAJA 3L2RA 4XCQA 3FCCA 3VPCA 5LVAA 2G67A 3ZQIA 2PTHA 2YWFA 3EGCA 4Q9LA 1XDUA 4AZ0A 3RFCA 3VYRB 2OZEA 1SVOA 4FWIB 1LZLA 2H4HA 3UYLA 1DTWB 2D2IA 3C6XA 3DE1X 4NAVA 4OCZA 3SJBA 4BFSA 4E3WA 4TKVA 2FSFA 3Q5EA 4DQVA 2CJPA 1O5TA 3NFRA 4RBOA 1U7TA 7AT1A 1HDXA 3OFKA 3I92A 1NIPA 1OFCX 1G3YA 2HFKA 4M1YA 3F9RA 1ZCZA 4R1QA 1CR6A 2W70A 1GZDA 2VKEA 2EFHB 3NGLA 5BQXA 1PV1A 1TAGA 2ZRCA 4LJ4A 1BDHA 5CDFA 4R01A 3U3JA 4A7PA 2ZT6A 3LNQA 2ZZKA 3IULA 4M9UA 1USVA 4Z9XA 2FGJA 2XIQA 1SOMA 1TUIA 2X6YA 1EVYA 1CJBA 5DN9A 3TIIA 3ZE9A 4FHTA 1WUHS 4A10A 2GK7A 2PZKA 1VG1A 2CLSA 4AG6A 5HIAA 2RREA 2Q3LA 4S24A 3R9XA 1WCIA 1WZUA 3ABIA 2PT7A 3OFSA 2XUGA 1VECA 3Q3IA 4I50A 3EC2A 4RCYA 4XZ3A 2NVTJ 3LDAA 3GYGA 4M36A 4M53A 4QHTA 2GD0A 2VCHA 4IDQA 4OF4A 3O9MA 1RKWA 5DNAA 3RVRA 4J1TA 1JT9A 2B7CA 1LK5A 3PPIA 1CJVC 4UFOA 3UH0A 3W1EA 1DC3A 2YV1A 1T56A 5DGCA 5K0NA 5D5UB 1E1RD 2BTEA 5G1PA 1QGZA 3ENWA 2WYVA 4ALNA 2DERA 2OYSA 3E97A 1ST3A 1H4QA 3FVWA 1UKAA 3E27A 3WDKA 5B7QA 1ZIOA 4S04A 4GSKA 5I01A 3VJRA 3FTNA 2C20A 3S40A 2ZXIA 2BONA 3WRVA 3SSOA 3G9XA 4GLBA 3KETA 1QONA 4ZDIA 1ETKA 3H9JA 3MTBA 5DEIA 5EHIA 2M32A 5KJ6A 4W1QA 3H9BA 4NCKA 4JJEA 3K8ZA 2C54A 4QAJA 5LNK1 3EQLF 2OQ2A 2H0AA 3OZGA 3Q1KA 2B61A 1W5FA 2QTVA 1NUPA 1RKUA 2XYRA 2X1HA 3FGNA 4KR0A 3WGYA 4B6PA 2NT4A 5BMOA 1XD9A 3Q85A 1Y1QA 3WQSB 1R9JA 4ZMBA 1QTQA 4OGWA 2D8AA 2ESRA 2D54A 4KX5A 2PI0A 2VDNB 2BFBA 2ZYUX 4QATA 5J2TA 1J06A 3TXXA 4LQ4A 3OA0A 2PBZA 2L54A 3PL1A 2VF5X 3T61A 3TOZA 1V45E 1R4NB 1ZLJA 5EJ6A 5HGJA 2D0OB 1ONNA 2VP0A 1QFMA 4INOA 2ZYRA 4J1NA 3QU3A 1GQ2A 2B82A 3HVIA 4DKXA 1NRJB 5ADVA 1IY9A 1A98A 1B26A 1O87A 3H2HA 4A0HA 3S2UA 2XJ9A 3S99A 4ITVA 3ZDDA 1DAEA 4MYRA 1H2XA 5LPNA 2WA2A 1RP1A 1MC8A 4KAAA 3OTQA 3VKWA 2XSJC 1OPCA 5SYNA 1L4MA 5G3YA 3GEPA 2H2FA 4MLDA 3CCFA 3EBOA 3N0VA 4OAOA 3OSZA 5D3MB 5K8CA 1ZNYA 1Q1NA 1E9VA 3DMHA 1KC3A 3B9BA 1X2MA 3IRRA 4C2TA 4ZYVA 4UMDA 2A9OA 2SECE 5BY2A 2XNCA 1AMOA 5L3EA 3K5HA 3U4MA 2YUTA 4K0RA 2FPLA 3AEZA 4DZTA 3HFGA 2AJLI 1U8ZA 2H5IA 2YXPX 2QN3A 1OAOC 4DCCA 2Z2ZA 3C39A 1J1UA 2CZCA 3DXXA 3MJSA 4ENJA 4IJ6A 3WTZA 3BVPA 3FMIA 3VR6D 1YW7A 4AQDA 4F3NA 1HEIA 2OQVA 5H3CA 3D5SC 5HDGA 3FHCB 4N48A 3JYOA 4EGYA 1YBAA 2XNDA 3DWFA 5FUBA 1T3GA 2BR5A 2B6NA 4UCFA 4ZVNA 5E9JA 1MBGA 2EKQA 3ROPA 1GDTA 1KP2A 3TPFA 1GT91 2QRQA 3PP8A 3BTIA 1M0SA 1A7KA 3ZHRA 1X7ZB 1W0UA 4J00A 3S0JA 2PJUA 2RCYA 3I58A 1VJ5A 4IUYA 1ZNXA 4QUEA 1B6AA 1FRVA 1IEXA 5B58C 1EVKA 2E85A 2LY1A 3VB2A 1NONA 4EKYA 1VKZA 3ASZA 3NT4A 4M1MA 2GA1A 2ZJFA 1OLOA 1GAEO 3GH1A 2ZCWA 4NATA 1H6BA 1E6KA 2H16A 4HQEA 2EKBA 1Z4PX 4BECA 4PV7A 1GYPA 4B7CA 2HSZA 4FYVA 4PAQA 4R05A 1UKZA 1AUVA 4FETA 3AFNA 3PC7A 4WF2A 4D7AA 3RUDA 3CY6A 4P3KA 2WY7Q 2JVJA 1NW8A 4ZN6A 1P74A 4RTQA 2AJCA 1EEHA 2PG3A 1OLUA 3E3VA 2VHVA 1MRNA 3F2VA 3N2IA 4K28A 3L6EA 3ZCPA 2PWBA 1SUSA 4MYSA 4PG4A 1KPIA 1Z6XA 4HBZA 1PFKA 4L0MA 3P2JA 3E81A 3M4XA 4PYOA 3DL2A 4AICA 3F9IA 1DRWA 4DCOA 2Q4TA 2GJSA 3HG7A 1P7IA 4J75A 3AI1A 3ASUA 1THMA 3AF1A 5JDCC 3NWOA 3RYHA 2OHOA 3ELBA 5IKEA 4DT1A 4JJ6A 4NE9A 1F1BA 3L1JA 3NW9A 1ZD3A 3QRFF 2G4VA 1WY5A 5J1RA 3H9UA 3FPGA 3PBKA 3H8VA 4I9NA 1TQ2A 2NO5A 1Z4JA 4UAGA 1KSJA 4CM8B 1VF9A 2HTJA 2M9HA 3PGJA 1PAUA 2PUVA 3UAOA 1DP3A 1FC0A 4RSGA 2CW7A 4GECA 4JOMA 4BP3A 2J6BA 1F0YA 4MPRA 1RYBA 2R7RA 2L17A 4HATA 3K9QO 1Z7GA 4OM7A 5GGYA 4LK3A 3A3OA 3BIWA 1KI1A 1U94A 1M75A 5JZ9A 1JKOC 5BVGA 3ZMVA 3UXEA 4XCVA 2DA4A 2IUYA 3LRPA 4IRMA 4ND8B 2IHZA 2UZAA 1I2CA 5FAKA 1DRKA 2AN9A 3E9QA 4KYIB 8OHMA 2F9LA 4US1R 5BNWA 1V1JA 3SCZA 1YMQA 4L95C 5KDDA 4CN9A 2RIRA 5C8DA 5KNCD 1SUBA 1J2TA 3D4LA 2QVCA 4MDFA 3DWEX 3GYBA 1L8XA 4C76A 5DXJA 2YWCA 2JCSA 2HW8A 1QMPA 1D1BA 1UPTA 4CQNA 3K4BA 4P2BA 4QOJA 3WLLA 3PFWO 4CKEB 3L8CA 4P5PA 2Z57A 2IYNA 2IUUA 4DDHA 1NBIA 1CE8B 1SIOA 4EDHA 1KOLA 2PBLA 2ECBA 1JQ3A 1GPAA 3FF1A 2UYGA 1U1CA 4J3NA 3WRWA 5IXSA 4TXNA 3FRJA 3A6HA 5EWJB 1G20A 1ZOSA 1KEEB 3THRA 4XWKA 4ZI7B 3FMQA 2KMUA 3GTKJ 1IG3A 3VSLA 1XGSA 3RHZA 4EATA 3CLSD 1FYLA 4BAUA 3DEFA 3FOZA 1E1CB 4DHEA 3KEFA 1OB5A 1YA8A 2G6BA 5BNFA 3SDZA 4Z49A 1E58A 1HLFA 2I0FA 3S6JA 2C7QA 1MX1A 1QX4A 3HO1A 3MWKA 4JUCA 3K9NA 1XALA 1UXIA 2AB0A 2DMTA 3D6JA 1L7PA 1B1CA 2M34A 4OFWA 1ENYA 1IEVA 1ZD8A 2EX4A 2O6LA 1IHXA 2WHEA 1GSIA 3KT3A 2P3LA 3HFRA 3L1VA 4H7EA 2Q6VA 4UTXA 1TIKA 4BVFA 2QN1A 2O7NA 2GZWA 4EJ6A 3OS1A 4Q7KA 3DT8A 4QFMA 1CB0A 1C1XB 1OFUA 1SCIA 1OB2A 4BP1A 3NVDA 1C0PA 2C59A 2WIKA 5TPZD 4E4HA 4AU7A 1E1MA 1CFJA 3KJEA 3RUPA 1RSZA 4L5JA 3O8OB 3CFYA 3WMFA 1H6CA 3EODA 3KWMA 4MO9A 4YP0A 4IX7A 2K9MA 2G1UA 2EJRA 5CQGA 3B1YA 4I1OA 5JZBA 3R9WA 4XSVA 2D4HA 2CUZA 2YVUA 4KT6A 1THZA 2XT0A 1IQ0A 5FUYA 2GBGA 3IH2A 1U2RA 4TV7A 1K27A 2GM5A 3Q3SA 4DMCA 3NHKA 4Q48A 3AJDA 4DWWA 4ZODA 2K86A 2BKAA 5J2UF 1LPPA 1O1YA 1U7HA 1DC4A 3WGMA 1UKBA 1KK3A 1HM5A 2JFXA 3ILYA 3V4RA 4CM5A 4C3HJ 1DBVO 1QMGA 2YXBA 1ZZEA 1GZ5A 1G41A 1XG5A 2CHEA 3GY0A 3HEMA 1RESA 5B7GA 3EK2A 2CMFA 5FADA 1O6BA 3RYIB 3UB4A 3NC0C 2ZRFA 4GX5A 5EMMA 4JYKA 1IBRA 1M2KA 3AUXA 4J2HA 4HV6A 4AP5A 5K3OA 1NM5A 4KQ6A 1T5DX 1Z38A 3N8GA 1UWVA 4KBGA 4CYCA 2AZMA 1CERA 1WXFA 3FFTA 1WEKA 5KQMA 1YG2A 3PNMA 2OFWA 4MEXF 4UEWA 2EFJA 4GYKA 1BXRA 4DLPA 2CSUA 4BV3A 4AMVA 4IPAA 4E4YA 2R5ZB 2E89A 3ROQA 1NNLA 2H2GA 3IIEA 4QJ5A 2STWA 2GHQA 3NAMA 2WB4A 2R7QA 2NV2B 3RYCA 2A07F 1Y37A 3VH2A 3FXUA 4QLBA 1WJFA 4HHEA 2GD1O 3GLVA 3BZBA 1LNWA 1C3JA 5JH7B 4BFXA 2YYZA 3DZCA 4Q6WA 3UWOA 3VNAA 1WJ5A 4D4GA 3LT4A 1NW7A 3LOQA 3ONDA 3QYFA 1AQUA 3WDMA 1LDDA 2F3RA 3KU4A 2FHPA 3QVOA 3RFTA 2B5OA 3FXMA 2NSDA 5GADJ 2QUHA 2V7VA 3GLLA 1CTQA 2MSEB 4MV9A 4TKVB 3FSJX 4GS5A 4EKDA 4M21A 2HU7A 4QLCU 4EGAA 4B9EA 3KKOA 5AVTA 1WOYA 1XYGA 2JCYA 1EXWA 2C03A 3KTOA 4HRYA 2ZYAA 4YQYA 4KR6A 4WBNB 2OWDA 3VOSA 2IEKA 3DLBA 2J9RA 2H7YA 2MC4A 1BL0A 1NAHA 3KEQA 3S2EA 2J5KA 3G8CA 4ZOBA 4EJ0A 1DQSA 3EW9A 2G07A 5JXJA 2UXBB 1KEPA 2GN9A 1WCMJ 4DBVO 3QVUA 3QIVA 3FPCA 1R4MA 4G9GA 4DADA 2Y0SA 3ODGA 5LBIA 4DNFA 4E2WA 4EB3A 3LIPA 2JFUA 3H5AA 3LM8A 4CEJB 2EBIA 3CCSI 3LOPA 5JATA 3JRGA 1ADCA 1ULBA 2HF9A 2EZHA 1ZH0A 3HHPA 4KQ9A 1IJEA 3NH9A 3MKLA 4C3IJ 4BDTA 4GIBA 4DUYB 4ZU3A 2F6CA 3S1AA 1NXSA 3ZGYA 2I9PA 4C6HA 3DZJA 2AMYA 3BERA 4A0RA 3HKBA 1O3TA 4CIWA 5PNTA 5JCJA 1Q0LA 5ED0A 3IP8A 4GGMX 3FFXA 1A2BA 3OYLA 2BI8A 1JHUA 4ICIA 4RF2A 5BW4A 3PNOA 4OI1A 3QENA 2BZ0A 1KVQA 3B2EA 3HR7A 4LHWA 4Q9HA 1KO7A 1UODA 4L9TA 1AG9A 3WTTC 4EH1A 1C0WA 1U8AA 3IT0A 2H1VA 2XGCA 4BWGA 5L3SB 4JXKA 3PUXA 2RAVA 1RD4A 3C5EA 3DOFA 3VPAA 2PL1A 4PSWA 2IHVA 5K7ZA 1OTHA 1VI6A 2CNNA 3K4PA 1UPFA 3OAAD 3NIGB 1R12A 1P18A 2I71A 3CG0A 4U3JB 3FWEA 3GBSA 3OPXA 3T3PB 4Z3KA 1ZQ3P 2C5EA 1FNMA 2YH2A 2BDTA 4TKLA 4YRIA 2VP9A 2D45A 1IBSA 2HB6A 3C7DB 3H5TA 3OOEA 2AQEA 5BSFA 4JWTA 2YWJA 3RT7A 1TCCA 1Z6RA 3TDMA 3DE5X 5IVPA 3QEBZ 2BKEA 2JI9A 5EMJA 3AVTA 4LC1A 1M54A 3B2NA 3PCXA 3SQWA 2H1RA 5JH7F 3TVDA 4WTOA 3IIMA 3JXEA 1Z7BA 4D8TA 3WGKA 3JS5A 4RVFA 3WSWA 5I7OA 1E2NA 4IIBA 1PR2A 3QOPA 5EWLB 1BE8A 3MA0A 5C1OA 1JVNA 4PQGA 1ONPA 3TQOA 5F7JA 4DEYA 2FF4A 2H1HA 1E69A 1MAVA 2IGKA 1X80A 2G9QA 2J9XB 3F74A 4PLYA 3WQBA 2Z99A 1W73A 4KBYA 2VI5A 3G88A 4ZYGA 3LYHA 1KI7A 5FORA 3LO8A 4GOKA 3VDMA 1JP7A 3I5UA 1IY2A 3LUKA 3W77A 2O8DB 3PSIA 4YACA 1U5BB 4N6GA 5JHGB 3MQ4A 1FP4B 1V9SA 3EGEA 1SMKA 4EECA 4Z54A 1NW6A 3OE4A 4KA4A 1VRCA 3ETGA 1LV7A 4FHGA 1QG4A 3AJAA 4YFXF 5BVHA 4V3BA 1EM6A 5CLGA 5CNMA 3V9AA 5LUAA 4PONA 4TMWA 2X2EA 3Q98A 1NTRA 3I12A 1YS2X 4ZT4A 4YUWA 3FRHA 1B76A 3ETLA 3SJ7A 3C3YA 2BISA 2ZIUB 2BVLA 5KPDA 3COYA 2XBMA 4LZWA 1KE1A 5MGNA 2B1QA 2PBFA 2WZBA 4YS6A 3ZD9A 4QRDA 4TWAA 4DA4A 3FTCA 1W4MA 1C4XA 1TKAA 1YOBA 2JGRA 1T9GS 4LFCB 1UEIA 1Y4SA 5CVVA 4Y4RA 1VLMA 1YJBA 3UQYS 4BLVA 3CUTA 4D9HA 4CGYA 1YVEI 4MGIR 2H7XA 4FFNA 5GAGJ 2ESNA 5EY5B 4BDYA 1MHTA 5IDWA 2EARA 5AW8A 1AKQA 3JWJA 3Q0VA 3F22A 1WG8A 1UBKS 3QU4A 4XWYA 1YCDA 2WJZB 4OHMA 1D3YA 2I34A 3DE3X 3P0IA 2C31A 4FHEA 4EI9A 2CWWA 4AUXA 4B3XA 2R66A 2X22A 5JFOA 1Y5MA 4C20A 2HXYA 4EKIA 5JAMA 2YV2A 4Q34A 3ZW9A 1DQZA 1ZVQA 2JW5A 3I9V2 2W4IA 3DBIA 2PEXA 1K08A 1H89C 5DT2A 1II0A 1LQTA 3SLKA 4EABA 4RA2A 3CPSA 4PLWA 1DI0A 3I55I 1YHZA 5FO5A 4BNIA 4C04A 2PD4A 4I4NA 2JVIA 3R61A 1Y9EA 3IO5A 3ZQGA 4O2LA 1WHTA 3GX4X 2HCJB 2XITA 1P7WA 1Y7IA 3CVOA 4F38A 4DR4B 1TQHA 2GXQA 1KMQA 4OMFG 4BIMA 2C04A 4DUGA 1QP4A 3GLUA 2ATEA 3U17A 1GCIA 1SC7A 3L8ZA 1B3BA 2PMDA 4FWBA 2OESA 2DQYA 2ET6A 1F0KA 2HPZA 3FJOA 3BCAA 2FNPA 5B55A 3GIDA 1IXZA 2NXEA 4PQYA 1ZK0A 4EYQA 1NQUA 3A01B 2SICE 3A02A 1C8VB 1AY0A 1GTVA 1L7NA 2XLCA 1CDZA 5JPCA 5DM1A 3AM1A 2J9ZB 3OO1A 4PRZA 2DUJA 4XVQA 1Z17A 1JVBA 1OMIA 3N2ZB 5BOSB 2GLTA 9LDBA 2NS8A 2G8NA 3IBSA 4QBIA 4CIYA 2ATXA 1BDBA 3CBGA 3THWA 1UBFA 4OFXA 4QGSA 1VNDA 4FCYA 1ITYA 4D8VA 5FKJA 3FXKA 1QQ7A 4OAZA 4BE1A 2CXPA 3E6AA 1VZ0A 3FMOB 1ZN2A 3G79A 2DMPA 2XEXA 4N5IX 1T95A 2GZHA 2PMFA 3EAQA 2R4TA 3L43A 4HN2A 4JVLA 2OV6A 2I6SA 1KRXA 2BPOA 1XCVA 2X6OA 3FXRA 3V8BA 4EA8A 2OO7A 3RSNA 1BAPA 3FDJA 4HLQB 4MYTA 4POAA 1S6YA 1MMFB 2H1SA 1GGNA 3DHNA 1UFVA 2W2OA 3JVIA 3JREA 2AG0A 4H7FA 2B2NA 1JLRA 1VHQA 1D1AA 1YH3A 1FP7A 2W6MA 3PDIA 4L75A 4NMHA 1XU7A 4PYNA 4QDOA 2PFKA 4TMFA 3ABZA 5KYGA 3T1YB 2BY1A 1JIKA 2B8NA 2HUNA 3D59A 4HB3A 4HUQB 2IWHA 2CEKA 1U9IC 3FM5A 1NQOA 1U5TB 4MLOA 1W6RA 2EV9A 3GA0A 1ADFA 5EQTA 4M6VA 2WSIA 5EXDA 4YHHB 4L0YB 4DMGA 4OSPA 2G0EA 2QKMB 3RRZA 1PJCA 3G5TA 4I5FA 2FE1A 1V26A 4NMXB 3RODA 1VLLA 3PGKA 4BNHA 5KQPA 1M74A 2GWRA 5T4HA 3OJEA 3BAFA 4RA9A 9MHTA 2G4CA 5JZSA 4Q15A 1YACA 2CKMA 4BO4A 2QD2A 4ZDLA 1GKKA 2GCOA 4I66A 4IBOA 2ZUSA 4DV1B 1DPRA 3I72A 3CVWA 1R10A 1KHTA 2DT6A 3FCOA 1LWOA 3A26A 2AQFA 1VG9B 1STZA 3O2JA 5C81A 5JJCA 1QA6A 1TLHB 5SV2A 1TX4B 2Z6UA 1M33A 4KLAA 3NPMA 3FTQA 1VP9A 1M2VB 4FNGA 2ZJ7A 3HSKA 5A04A 3MF4A 4IQJA 1W4AA 3K73O 1MC1A 4M54A 4L22A 4O4LF 3F21A 1B74A 4M83A 4P3PA 4UU1A 3S68A 3VR3D 3U4QB 4G4GA 4IDCA 2YKGA 2G25A 3WYNA 3TB6A 1TQ4A 2LKDA 2ZI4A 3CX7A 1JT6A 3HGQA 3K96A 1RWMA 3QVKA 3R6WA 3M2PA 4Y2VA 3WOHA 3ZI7A 5KVVA 3EVCA 1KRWA 4BC0A 3OOPA 4ARVA 5WRFA 3IV9A 4HWOA 4WCFB 2I67A 5M04A 2WJIA 2EQRA 1Y1PA 1B8UA 1EA3A 2QZJA 3JVUA 1G55A 2L19A 2ZJBA 2F43B 3NTUA 4HQLA 2J4DA 3FFAA 1ODFA 5HJ2A 4CFZA 5ELXA 1VBNA 4MWOA 4RIFA 5JNUA 3MJEA 1BRMA 1TYEB 2L7FP 2HF7A 1QO0D 3E58A 4L57A 5THXA 3LTNC 5COAA 4AROA 2BJVA 4D6YA 2CYAA 4YP1A 1XMQB 4HC4A 4CLDA 4Y9SA 2QS9A 1IBCA 1OBOA 2RGVA 1ZVVA 3WC4A 2VPQA 4MS1A 4H1TA 4TS4A 2RGNA 3FISA 3O03A 1C8BA 4K9PA 3NAZA 4RL6A 1XMPA 4C7KA 4DCTA 1P4WA 1VRVA 3CC7I 1EEXB 3IQGX 1YIJI 1TEVA 2AQIA 2NPFA 4BO6A 3EJ6A 1J33A 3QEMB 1KMIY 1HDIA 4MW0A 3CEJA 4IRGA 4ZZLA 1PP4A 2OB2A 4KRXA 4U00A 3HUGB 4L8YA 2UZKA 1OBHA 1MB2A 1UJ2A 2MYNA 3I45A 3TAUA 2QX7A 3LF1A 2N46A 5EE0A 1NVFA 3L7KA 4ZYEA 1TK9A 2D1FA 2Y2UA 3INTA 1JAXA 1UDXA 2WLTA 4LDPA 3GJ3A 4NSNA 1MEOA 5AJZA 3HA5A 5FRDA 3Q2KA 3RUEA 1VIYA 4AN0A 3PHHA 3OJXA 5KKAA 4WOJA 1N6PA 1BJAA 1HETA 1XVAA 2ZB2A 1CZUA 5FP0A 4Z4EA 3AFHA 1QP8A 2HL6A 1L5NA 1WMFA 2GM9A 3MWJA 3DAOA 2XUAA 2JAQA 2AA3A 4XGQA 2NUAB 4BVLA 4RD0A 2R68A 3THYB 3IQWA 4MS4B 1YNOA 5FLKA 5LKRA 3BWMA 3DHYA 5KOJA 3IC5A 3X2EA 4CMGA 4Y6LA 3GEZA 2ME0A 1SZCA 3L8MA 4J0DA 1TT7A 4IFEA 3H17A 4KE7A 2QY9A 4R54A 1GNSA 2OCXA 1SUCA 2P4HX 1W9MA 3MUFA 5IPFA 2CSXA 1U9JA 1ZRFA 2WTEA 3RS4A 5E1MA 1TU0A 3P2OA 3RYRA 1M1YB 3RU3A 3PD0A 4BBRJ 4PDKA 1U99A 2PVSA 1E2QA 1HYEA 1TWGJ 1E1NA 3BL6A 3EXHC 1PR5A 5K7SA 1BC7C 2HT1A 2VDWB 1TWCJ 2HPAA 5J3JA 2PKQO 1KI9A 2IRFG 1XTVA 3NORA 3EPKA 2OCAA 2O59A 4RVDA 1FSSA 1XD8A 2C92A 3JX9A 9ABPA 3K71B 1SFEA 4XJTA 5FBRB 4Q9KA 2KQUA 2CXTA 3ECCA 1Z6TA 4ASUA 2MYSA 4EJSC 2XT9A 2GILA 4W5OA 1MXHA 2UUCB 4DW8A 2HSDA 1P7CA 4NJEB 4INAA 3PZBA 3ZVRA 5E3OA 4H6WA 3S1AB 5I7FA 1NXQA 3KQLA 1K63A 3Q12A 2C2KA 3X1WA 1J9GA 2FPIA 5E3NA 3WRYA 5BT8A 4AG5A 1GFSA 3KHUA 3INNA 4N9QA 1R3UA 3X2FA 2BY0A 4AG3A 4WESA 3RDPA 3L8GA 1P75A 4MV4A 2OOSA 4CODB 4TM7A 4EG3A 2PKWA 3H5IA 6ABPA 2EV6A 4ESFA 1ZHOA 1Z62A 4RAGA 4P7GA 4TLEA 4KQ1A 4DLBA 3W2AA 4GW3A 1B42A 2AI1A 4FJ2A 4IHAA 4BXOA 2CXSA 1QIMA 2ZXJA 1GEGA 3L41A 4MICA 3KQYA 2JIZD 1M10A 2X86A 3QJYA 3QQAA 3FOWA 2VTBA 1EHCA 1T2AA 3X2SA 3T3DA 4J01A 5DNDA 4EUSA 4HQMA 1QVRA 2JFZA 2ECKA 4DCVA 1PHPA 1FDRA 1PF7E 1R0LA 2EG9A 4FC7A 4HRAA 1E1DA 4B44A 2AQ8A 5JJKA 4H6XA 3W06A 4DM3A 1G0NA 4E03A 5JHUA 3B6EA 5A9SB 3TO9A 1PR9A 2PL5A 1HO3A 1TC2A 1QYXA 1E4YA 2A92A 2GUGA 2HHJA 2XTAA 3TEDA 2O03A 2DMRA 4OP3A 4W99A 3DB1A 5D1NA 1DWOA 4MTCA 2IDZA 4EGQA 3PPWA 3G5AA 1BXGA 2X19A 4ZT5A 2AT1A 2B5WA 2WZDA 3WLNA 4DIFA 1GILA 3FSEA 3OUTA 5I7HA 1KI3A 3ORQA 3ZCQA 4JX8A 4D81A 3BR6A 5JDIA 4L72A 1X1DA 1MIHA 4DCMA 2I10A 1UBEA 1GZ3A 1I30A 4G0XA 4HKTA 1H93A 2P2DA 2FOLA 4KH0A 3BHNA 1MO6A 5KAMA 3DE4X 2I99A 1G291 2ES4A 4EI2A 4YBZA 3CZAA 2CUJA 1W5TA 3PENA 2HT6A 5A2QK 5GGXA 4KQGA 1QYCA 3DTVD 2POQX 3GDFA 4TPKA 3ZBQA 4PCQA 3MFYA 1G66A 3ULKA 1V3QE 2F62A 2XOKD 2O8EA 2XYVA 4ML3A 2KIUA 4IHSA 5JSZB 3C2QA 3IBFA 3RYTC 1OV6A 4F3RA 1VYHA 2OCEA 2O6HA 2VH2A 1CEQA 1GYQA 1YD7A 2WF8A 3BJAA 2ZATA 3UOGA 4C4RA 5DBIA 1KGSA 2HZDA 3SS9X 2QJTA 5IYDJ 1PD0A 1RAHA 2GZSA 4A15A 1NR1A 1QUFA 1U0HC 2WJ4A 3OG9A 1M2EA 4NBKA 4UTOA 5C80A 1U0LA 1T9KA 1IJBA 1X42A 4ZEVA 2Q4EA 3TQSA 4F56A 5LN1A 2P1ZA 4FLMA 3CCCA 2OXTA 2PMZA 2KS6A 5DHAA 3ZK8A 3ZZ1A 3LY8A 4JWKA 1SXPA 5EZYB 2OXRA 3KU1A 5E2IA 1QPBA 3DEZA 3TBFA 1K83J 1USIA 3A4VA 5A5EA 1T5OA 3NKLA 2VT3A 3H2ZA 1E18A 2Y6UA 3IP4B 4ZIRA 5DLPA 5CVUA 1XBTA 1T0FA 4OI0A 3WVNA 1FZQA 3MD9A 4P98A 3GLGE 1XTTA 1OI4A 3R6SA 1NVKA 1XWWA 3ND5A 4DLRA 4DHWA 1ZR4A 1W94A 3AEQA 1XYVA 3AUKA 4AS1A 4BNUA 4XM0A 5IJAA 4Q3AA 2DFDA 2REQB 3D64A 3OZXA 2GPBA 3HGMA 5T3UA 3M3YJ 3MAAC 2VDOB 2R2AA 4OLAA 1H9CA 5CIQA 1JW9B 1TYDE 1JLLB 2BUBA 4AYXA 2YL2A 1QQBA 2AX4A 4MO2A 5H1YA 3T8RA 4LF6B 1UFQA 3F7MA 5I4KA 3K9LA 4EJSA 2DBVO 2E9SA 4M0KA 1AUOA 1AQNA 4DAOA 3R0JA 1J70A 4B6OA 2WOJA 3NANA 4M0UA 4NCXA 3SDBA 3K30A 4B84A 1R7JA 3EXHA 3C3EA 3GRPA 4UW9A 1OR8A 2JIQA 1BMFD 2HQNA 3KYCB 3Q4GA 5D5QA 1VPWA 5SZHB 5EJ8A 5LWQA 1JR3E 4C4OA 5GPAA 1SVIA 1CUHA 4N4AA 3GJXC 3IEKA 3NP7A 4Q7EA 5BUSA 3NBYC 4ZQEA 4UTPA 3CDIA 1D1PA 2VJLA 4IRHA 5I7WA 5IC4A 2JWTA 1R66A 3RFUA 1P1FA 1WCV1 3VA7A 2Z58A 3OZBA 3CSUA 4GM4A 2OUIA 4F7ZA 5ELMA 5BOSA 4IHXA 1FVOA 1VBMA 1EWVA 2LNDA 2WWYA 2CV2A 5EQFA 2FRXA 4B0OA 4CKXA 4TWIA 3QU2A 5M3BA 2MABA 2YHSA 2XCIA 1TVKB 4EB6B 3CF4A 4XRSG 3WTUC 4BBJA 4DC9A 3OIDA 4OJQA 1X1CA 4K2HA 4PF1A 1ZVMA 4FOTA 1GKLA 2PX3A 4IGKA 4YRRA 1FYDA 3GD5A 3GGPA 1ES9A 3OFJA 1OXTA 5EG5A 3DF7A 4KMFA 1NAIA 2IYUA 1P3DA 4G5XA 1OGIA 4K88A 4C0QC 1YUBA 3FKJA 1FDVA 1X15A 1YVDA 1XXLA 2BC9A 2HXSA 2OM2A 4Q1EA 4WFKA 4MJXA 4OQEA 1VE3A 1SOUA 4FSDA 5AUOB 5JI2E 5AIAA 4DV6B 5NULA 1QJCA 4NYIR 2O61A 1PVDA 5MN4A 5GAHJ 4M6XA 5REQB 4YAOA 2IHNA 2FEAA 1RADA 1K75A 4K46A 4KWCA 1KIFA 1J6UA 4OXRA 4YV7A 1IBKB 1RVV1 2ZE7A 3LT0A 5HFAA 4EX6A 3JD2A 1TUBA 3CCMI 1T1EA 1UXGA 2FFJA 2O0MA 2A8YA 1P60A 2P7HA 2R7MA 2ZBPA 3HCBA 4RGQA 4YP6A 1YXMA 2EKPA 3SGLA 3U4GA 4ND3A 3C4VA 4HV4A 2FPXA 2JPDA 2R6AA 3LWZA 2QSFX 3E3OA 2IJGX 2PK3A 4RA9B 1OVMA 3H1TA 1FE8A 2A78A 5B2EA 3CZ9A 3RTCA 1Z29A 4L0ZB 1EGAA 2YZGA 3P2IA 4N12A 4UVEA 3TJMA 1QCYA 3U60B 3DKWA 1D0YA 5KS2A 4R7ZA 4KGVA 4D8WA 3ZDBA 1M7BA 2XUJA 4DS3A 1ZXXA 1YLFA 1IDOA 4XKWA 2E4WA 2YOGA 2Y2VA 3IUOA 3X0DA 2JIPA 4CDNA 2C2ZA 4WSOA 8ATCA 1RR8C 4WXRA 3K0HA 3VH3A 3I9NA 3HSEA 4NZMA 3FTPA 3ZPLA 1V4BA 1TAHA 4GUDA 3EPJA 2W2NA 4JZYA 2WKWA 4PZAA 4FC6A 1E2JA 3BRQA 5KOJB 3OIOA 4XQFA 3DDCA 3WISA 4CQLA 3A4YA 4O2AF 4A6XA 3NTXA 3IESA 4GR5A 4OQNA 3SSMA 2A4KA 1A76A 3O8LA 3LBAA 4X1YA 5F2NA 2GXSA 3B13B 4M9QA 4URHA 1J2UA 3UA3A 4BEVA 1RYFA 4IXWA 1GGVA 1VFPA 1TI7A 2LC2A 1O9HA 1YU9A 2AWNA 3LUHA 3EXIB 4S1NA 4XM1A 3URKA 3A6LA 3FNFA 4AJ1A 4QKQA 2BCEA 2WE7A 2YMQA 1H2HA 3WV4A 1EUQA 1ZIYA 3C7CB 3PXCX 2OO5A 3RO7A 4F11A 5GTIC 3DPSA 2XOKA 3BOQA 2BLNA 4BQRA 2BZTA 1P33A 2VQDA 3DC7A 2PT9A 2NT3A 3JRDA 1XRQA 2XF7A 1WJAA 1TC1A 3W2WA 1JECA 2YFKA 3F7TA 4OU0A 3H9EO 3K31A 4KIWA 4QUDA 2BDUA 2RHOA 2IY9A 4CEHB 3DV2A 2J08A 2KP6A 4EPYA 1EKEA 4IAOA 3WE3A 2YHAA 3F96A 2RHWA 1OPRA 3B1FA 4WKGA 3TNLA 2ZJOA 1JS1X 5EXEA 1BI2A 3OCZA 3RANA 1E1YA 4BNLA 4XRGA 1M2OA 4MGEA 1BGWA 1JJ6C 1QS0A 1BW5A 2V4ZA 2P9EA 3EIFA 1QLWA 1E3DA 2FUG2 1PZFA 2AWOA 2D0PB 3IUNA 2Z5LA 4PCLA 4RZHA 3DMYA 4ZAVA 1SVLA 1KYTA 4MQEA 4C01A 2KHMA 1G6Q1 1RRGA 1UDWA 1X7WB 3TZQA 5TLSA 1E8MA 5IK2D 3ENQA 1ZK1A 4JI3B 3QWHA 4U6SA 4TRNA 5IH3A 3O8RA 1SELA 2IA0A 3NHWA 2H27A 1WKBA 2A67A 4ZDPA 1U2EA 3DU5A 1QZYA 1U3DA 2K5UA 2VJCA 3MN1A 3S70A 3LQFA 5L45A 3MTGA 4DBRA 1MABA 2CHGA 2ZXEA 3JAKB 1VCMA 4BE4A 2KX7A 4XWAA 4OUDA 4F8YA 2BD0A 4ZI2A 2CQ7A 3V7WA 3WIOA 2A5WA 2P62A 4LHYA 3OX1A 1PDVA 4KTVE 3N7AA 1U2PA 1MQ8B 3CVVA 4E7KA 2ZJ2A 3K4NA 2LWIA 2Z2JA 4FVTA 1B8OA 5FL7A 5TMBA 2Y1DA 1H2ZA 1LX6A 1U4OA 1IAVA 4HMOA 3A11A 1X1AA 1BW9B 2R8EA 2MTBA 4LZPA 3RWOA 2X8BA 1NC3A 2XNDD 3A8TA 3NO4A 2H85A 2V1XA 4PBTA 3RRBA 3LJKA 4EJWA 3FHTA 2GPAA 1VQLI 4YJHB 5I7EA 5KAFC 3PPYA 4V0KA 3LVQE 1IGNA 1ADYA 1WMSA 1JKXA 1XXHB 1F51E 2R00C 3OQJA 3PUYA 4N7RA 5DD4A 5T57A 2EP7A 4UHHA 4DABA 1HNZB 1AOXA 2D2VA 2MMGA 4P53A 4UNQA 1XCJA 1W1WE 2JGKA 1SXIA 2AFHB 2V3CC 4UZSA 5HLIA 3BILA 2PYZA 5ALMA 1H69A 3UF0A 3VV2A 3G0BA 3D5EA 2ERYA 4P8RA 5ALNA 4LHEA 3RHFA 5EJ7A 4DPKA 4DMUB 5TS3A 2VHUA 4QU8A 1HDRA 2FG5A 1BOBA 1VOTA 2PU5A 3GJ8A 3KZKA 1E4OA 4FMDB 5FEUA 5JJBA 1EG2A 4R1HA 3M70A 4A3JJ 4YFVA 5BSTA 3RG2A 3SC2B 4I55B 3AR5A 3L2VA 2J3MA 1DAPA 1E5VA 5LQAA 4ESJA 2AJDA 2JPCA 5BQ3A 3EEFA 3RVBA 3OZDA 3HCPA 4EY6A 1AWCA 4HFRA 3HSYA 5DGDA 1RWNA 2KW5A 3BN3A 3C3WA 2X4HA 1W96A 3ML1A 1I3QJ 1CRZA 3CWQA 3IOBA 3GNTA 4KACA 1O95A 1YS6A 2O19A 2UV1A 1R7RA 4EHNA 1W36B 3RUFA 3VPFA 1MZBA 1C8KA 1EINA 1V48A 2TMGA 3EXFB 5ER9A 3VNRA 3ZWWA 2DM6A 4YXFA 1F38A 1PT8A 1EJBA 3W5DA 2GXGA 1H9BA 2W6QA 3BEOA 4MP8A 4RZSA 2C4TA 1S9DA 1Y9AA 2DC1A 1JXOA 5IAJA 4UTZA 1UCRA 3N59A 5TQVA 3ZE0B 5KAIC 3VKGA 2GVDC 3BSYA 2X2FA 2KWIA 1F4KA 3ORSA 4QIHA 3PUVA 3ANNA 5DCFA 3VU9B 5IDXA 2FFHA 1G3UA 2VNKA 1T1SA 3IUBA 4Y67A 3HABA 1AGXA 2VXCA 2QLFA 3KHSA 1WWKA 2REOA 2YS6A 3LS2A 2VT6A 3N6VA 3NONA 3ZHCA 1GARA 1I7LA 4AD8A 4MHTA 3T7SA 3S15J 4RLHA 3PUBA 3H9CA 4UC0A 4YXWA 1S2DA 3IDQA 3A2KA 1QKIA 2Q0QA 1N77A 4ZVSA 3SHVA 5K03A 3U26A 4DQXA 5J6XA 2HU5A 4LRQA 1LDYA 1I0ZA 2DMNA 3W6PA 2P6RA 3KKZA 3BMCA 2J32A 4LDJA 1PL7A 5BYJA 3WWPA 4AP6A 2ENUA 1XAIA 5F1RA 1L3CA 3AVQA 3MQ2A 5G2OA 1DRVA 4U6QA 1T5IA 4BHCA 4WNYA 2GZRA 3SZTA 2ZSKA 3CNQS 5AK5A 1S7GA 4YK7A 1YF3A 3UWMA 1K78A 5ARDA 4D5EA 5K8JB 2FLVA 1C7FA 1NXVA 1YR3A 3UK7A 3ABLH 2JRMA 1ECCA 4PRYA 1N5IA 1K6MA 4CMEC 2GN6A 3E9MA 3C18A 2FQYA 4TSFA 2PHZA 4RGSA 4AJLA 4X20B 4CM4B 4KLCA 3BQZA 3ZV3A 2BMFA 5K8VA 1GVNB 1KZ9A 1XU4A 1ZM4A 1M2JA 1R1DA 2SKEA 2PD6A 4AIJA 2Y0DA 2YDXA 2YQZA 3MT9A 2ZRPA 3RLIA 2VA8A 3BE4A 1GV0A 2OTJI 1QHFA 1HQKA 2D62A 3QJGA 3ZH2A 3MILA 1TT0A 2ZIEA 2L02A 2H51A 2H09A 5FPHA 1NSFA 2ZC2A 1G3MA 1CPYA 1FSFA 4NJMB 3RH0A 3WAJA 3HLTA 4EMUA 3UW1A 2CHQA 1VLVA 4J1SA 4HVLA 1L7BA 3V48A 5LQDA 3CF5F 1CQXA 4M88A 3TXYA 1V2GA 3T5DA 3FVTA 2UYCA 4BXXJ 5DKFA 3RUIA 3CZMA 1YKGA 4BEWA 2W2LA 3ZE6A 3RVSA 3ITNA 4IIJB 3OOUA 2DBRA 3GAAA 4JLVA 5JAPA 2VOOA 4B47A 5LQMA 4JL8A