4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
b'QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQNA 4BQOA
chains in the Genus database with same CATH superfamily
2AX3A 1TE2A 5FNZA 3U3DA 1L1EA 2CD7A 1H05A 3CJQA 3T3GA 5E3IA 3GFMA 1MORA 2ZJ7A 3EAFA 4C14A 3MWEB 4NAUA 5AW6A 1UADA 5BXYA 2WW8A 4R3WA 4RS8A 1WCIB 3AGPA 3M49A 3WA6A 1Z8FA 3KOZA 4EFDA 5DSZA 1XRRA 2GYVA 3E3AA 2QX6A 4JBHA 3FWYA 1U78A 1K8RA 1SVSA 1NA5A 5FKJA 5JZOA 2XVYA 1IEQA 2O9LA 3P45A 5JWOA 3H1GA 1Y1PA 2MT9A 1ZX1A 4CCMA 3H2BA 4PWZA 3SDZA 5L7WA 1L7QA 3HHEA 5K8CA 4WFKA 3E2MA 3L06A 2IZ7A 2I2AA 1YJQA 1JR3D 5H59A 4MRVA 3R8CA 5K3FB 1QZZA 1XYGA 4OX9Y 1ZIYA 2EH3A 4L0CA 3I4MJ 4MUYA 3DZKA 4Y9SA 3LSRA 1IHUA 1V26A 5DK6A 5CJ9A 4MTDA 4P3PA 3BTJA 3KYCA 3M5CA 4IQ0A 4AVPA 4PYJA 3C48A 1B1CA 5F73A 4TKUB 4RV5A 4LY6A 1ORTA 2R1TB 1SUIA 1S3JA 4ZIRB 3EZXA 1BIFA 2I9KA 5IAKA 3ZNQA 2R7VA 1WHTA 2OCXA 4WKCA 2MLGA 2CFRA 1R7RA 2VXYA 1MGOA 4QPDA 5B1HA 3UC9A 3ASUA 4CKZA 3I53A 2CW0F 1JUPA 4IKOA 2IGBA 3LRTA 1SGWA 3IUSA 1LK5A 2IXFA 5LHIA 2CWDA 3HP4A 4L5YA 4H4EA 3GLKA 3HGMA 3PYXA 3NAQA 4RCZA 3U3RA 3S3OA 1B4AA 5DMHA 1CZKA 1SWVA 4G41A 3D2CA 2WIFA 4CKBA 2R1ZA 1I6WA 3HVUA 4BP9A 1XZ8A 1U1DA 4G85A 2FR8C 4GVLA 1WJFA 2XYRA 1USGA 4G65A 3DMNA 5JSKA 2X0NA 3ABIA 3K2QA 1TAUA 2QZJA 1ZSNA 5IUJC 5H16A 4UNRA 2BXYA 5JTUA 4NCHA 4WGFA 5FUXA 4BV3A 4B46A 2ADMA 1SIUA 4HEA2 4LHYA 3LA7A 4YEDA 2ADOA 1ND6A 1D5VA 1MZPA 4HRAA 4X6AJ 2EWVA 3BMCA 3BL8A 4LZAA 2PX8A 4FP9A 4MIOA 1Y81A 2HKXA 4OFZA 4B2IA 2IU3A 4DZZA 2YZMA 3RHFA 1Z6XA 4JUFA 3REFA 1HE8B 2YY6A 2QT9A 3RYIB 3MUNA 4WASA 4G9YA 2M9MA 3KK0A 4OSPA 4CDMA 3NPAA 4N7BA 5FL7A 4P7KA 5F21A 3GNQA 3T1YB 3GAZA 1R18A 5TJ9A 1IVSA 2D3WA 4W5TA 1SO8A 3UTDA 3URMA 3CR3C 4XFKA 3N3BC 1JEAA 1XXLA 5D3QA 1OA0A 5BSFA 2PLWA 3FNRA 1M5RA 3LWDA 3MJVA 5U4QA 3RDIA 2R6FA 3ZCQA 4TVKA 1JXQA 1W85B 5JJLA 1BIAA 2ORVA 4PVDA 3GGOA 2VRBA 2FSVC 3PPIA 1NSFA 2X1VA 2I76A 1GT91 2PMBA 3QWLA 3L5OA 4TZKA 4J49A 2QM0A 1TYEB 2OFWA 3K4MA 3LT0A 3MMZA 2VJAA 1F8FA 3F7OA 4U7JA 4I4TF 2QVCA 3TLAA 5CIQA 2I99A 1TYBE 1QDLB 4X6YA 1OF1A 1V96A 1J33A 3HMQA 1Y5IA 4DBRA 4DADA 3L07A 2IBTA 1WR8A 3L05A 4ILEA 2BFWA 1ZELA 2GPBA 1E3QA 2CXNA 1RCUA 4Z8XA 4BKQA 2R9VA 3HRUA 2XITA 3IODA 4PHFA 4L4RA 4L1KA 1WMSA 4ZVNA 4PU0A 1ECFA 3PIPF 1WI3A 2DFPA 2BHNA 1M6WA 3I28A 5IDVA 5A9SA 4JBGA 4NS4A 3OYHA 2J9RA 3WDKA 2QYHA 1Q17A 2IWHA 3ZKWB 3KKZA 5D01A 4ZYGA 5BQTA 3M34A 3TL6A 3CGGA 3Q10A 5LQDA 4DOZA 1QIDA 3IH2A 2QJTA 2H27A 5G3ZA 4E12A 4R2JA 4LJAA 3NDJA 3G5AA 4Y2RA 5CURA 2IPLA 2H5EA 3G1WA 1XTKA 2AWNA 1OYYA 2CZGA 2P1RA 4DMUB 1M76A 2QSJA 1X92A 3LOPA 2GN0A 3UAXA 2GYUA 2X8JA 3W3AA 2XAQA 4EY7A 4LQCA 2W2QA 4PLZA 2IIQA 5E1OA 1ZD1A 3HUDA 5DWQA 1FDWA 3F67A 3MS7A 5F1PA 3JQEA 4W1RA 3AL2A 1Q0TA 3IJRA 3DCFA 3N87A 2R62A 4RMNA 5EQJB 1IXYA 2RGRA 1P2UA 4XQ9A 5KDLA 1RNLA 3FPLA 1IJEA 2GWRA 1CIJA 5FBVB 4X9XA 1X2EA 4O8ZA 5JJBA 3GCZA 2ZI5A 1V4RA 4BKMA 1YRNB 4MP8A 2YHIA 1H6BA 4MV0A 4O6VA 4F56A 1TAQA 5TQ2A 3N8KA 2IYYA 3E27A 1JHRA 1C0LA 4MUAA 4DJAA 4UM7A 4DR1B 4LJSA 3SHWA 1C0PA 2W2MA 3DBVO 1CQPA 1NWHA 5EQDA 2GBYA 4ZMBA 2CHVA 1GGNA 2I4TA 1YR2A 4UVIA 5JFOA 4EHAA 1W0TA 4GI5A 1PX2A 4RMIA 4MWDA 2ZSJA 1JEDA 4HJXA 4J0CA 3WDSA 1SK9A 3WRYC 2QVYX 3RKQA 1WUYA 4WERA 2FRHA 3FTCA 3LDHA 2QCOA 1Z7GA 1E99A 1U8BA 1P19A 1XMIA 1J1IA 3VSEA 3HTXA 3CR8A 4EATA 2NSYA 3FG9A 1MC8A 1UK8A 2LKXA 1JU4A 2A0UA 3L6RA 4TTQA 2W4QA 3WRXA 1L6IA 2OPBA 3D02A 4Y9DA 1YI0A 2DLNA 1X1PA 3N2GA 1Q2UA 4EPVA 1WCXA 2ISCA 4TM8A 4L5EA 3CS3A 5D5HA 2R92J 1LY1A 3PHIA 5KSWB 4CCNA 4ZDWA 4KYIB 1O0SA 3FI9A 3I05A 1AB5A 2P3QA 5KAIC 1AXGA 1FS6A 3GW2A 1RIIA 4D7MA 4RD6A 2QQEA 3RUDA 1F3OA 5HVQC 5CK5A 2JIMA 2ZAMA 4KQGA 4P83A 3BLYA 2Y71A 2BGKA 3EVTA 2HR3A 2EBFX 4LXGA 1YKSA 3PDCA 1R0XA 1PJCA 4XUCA 3D7NA 1B8IB 5LPNA 4EY4A 5CB4A 5TC4A 1DRVA 4GBJA 2PNFA 1BSVA 1YA4A 3LPDA 2ZXJA 1K7YA 2J0UA 3D1LA 4OL9A 1H8ED 4BE2A 2OD5A 3MBIA 3AF4A 2EBIA 4I6ZA 4A36A 3DSRA 1NLYA 3D5TA 4GI7A 3I5YA 3F73A 5NLLA 5BNFA 3CNQS 3NNNA 5KNDH 3W4IA 2PMCA 4J7UA 1GV5A 3GIDA 5KVCA 1JA1A 4EY6A 1S8NA 2OCPA 2O7SA 5C8YF 3KUCA 2WLSA 1JFFA 2YHBA 2H9AA 4U7HA 1SQSA 2JCXA 2IHNA 3RKXA 2W37A 3PDUA 2YKGA 2CV2A 4TWIA 2XROA 5JWHA 2DP4E 4FNGA 4OIOF 3ACCA 2G5TA 1CZOA 3B7WA 3FDJA 3C3XA 1W0KD 5JMPA 2FBHA 5H70A 3VQTA 2BE9A 5BW6B 2JQ7A 2DCUA 1YTUA 4LOKA 2QRKA 3QQAA 3AVPA 4ZRMA 1URPA 4LY0A 3R5TA 5H4HA 2XW6A 1U7PA 2VEOA 2YR2A 1E1RA 4UUTA 4AC9A 1B1AA 1Y8QA 1EJ6A 4L57A 3DMHA 4AJ2A 4DUGD 1BH2A 3ENWA 2F3QA 1LDBA 4UTRA 1QB8A 2VSFA 4IVPA 2G5CA 2ZRFA 2ZPAA 5DLYA 3P52A 4DIUA 4WFJA 4DUYB 1E9EA 4G4SO 4QBIA 2VJPA 2WTMA 2EP7A 3RUEA 5EIBC 3A4NA 6Q21A 3AG2H 4GPAA 2I2CA 3L0ZA 2B83A 3SM3A 4N9HA 2HBZA 3REQB 4QDTA 3DWGA 4U3JB 3T7TA 1P4RA 1JG1A 4HDNB 4L4SA 5DXJA 3SXJA 3JX9A 2WD7B 1MJHA 2C5AA 5AKLA 4BB5A 2BKAA 3DHNA 3VDMA 2ATIA 3UFXB 3U3MA 2B9EA 1XPUA 4ZT4A 3H3XA 2IIBA 3K4QA 1I5EA 3D4OA 2FDCA 1PZHA 1OUMA 3HEFA 4U5QA 1OIXA 3BORA 2HLDD 3IV9A 1Y3CE 3TK1A 1LDGA 1L7BA 1T5BA 2HMVA 1D7OA 4YRLA 5DZSA 3WYNA 3FVVA 5CW2A 1DDIA 2DMUA 2XXJA 5JCOA 1TI7A 1D5WA 4NDNE 1MJNA 4A3MJ 1LDDA 4HAIA 2XMGA 3GCXA 1Y8AA 2CLLB 2IBDA 4ZOCA 4PJMA 4RUKA 5LXTA 2ORED 1JL3A 3D43A 4D41A 1EXNA 3HOYJ 2H5JA 3NJ4A 1ZM7A 3EIEA 5JEEA 3K7AJ 1PSZA 3W7BA 1KMIY 4Z5XA 1ZGWA 2Q21A 3K0FA 3W5UA 1Q91A 5DNCA 4K9MA 2W48A 2Y1KA 2E37A 5KHOC 1O97D 5IAOA 4QXOA 1R12A 5AXAA 4A27A 4QUAA 1DJQA 1YT5A 3KJQA 5SY4A 2GF2A 4AB1A 2P4WA 1XJ0A 3ZNNA 2PL1A 2G88A 221PA 3GUCA 4UVEA 3G1OA 2OA0A 4DCPA 3GGGA 2NRAC 1LUAA 2PMKA 2FEOA 3FSGA 4NZNA 2W8BB 4K9SA 4M1KA 3HHHA 3ROQA 3QBTA 2K7ZA 4DLWA 5IF3A 3GY0A 3TL2A 3DV2A 5DE3A 3FWEA 1CJMA 4QT4A 5BSKA 6CHYA 3E22A 4WXHA 4N0PA 3ADOA 3DKPA 4IUYA 3HVJA 4V3CA 3A1VA 4JC0A 2WWGA 2YICA 2ZBEA 3DMTA 2IYAA 1HE5A 4Q4ZF 1VM6A 4TWZA 3IQZA 4QM6A 1ZD9A 4P5PA 3MRTA 1W1WA 2ZB9A 1JTXA 1QKIA 2HMYB 1W44A 4S2UA 1K6YA 5FRNA 1AGXA 2QP4A 1CE8B 5JXJA 3PWSA 1T3HA 5K05A 4YA6A 2Q29A 5C7YA 2QENA 3KLNA 4L72A 2O6LA 2L18A 2ZREA 1BGVA 5JT1A 1NLUA 2XMRA 4NRDA 2BKXA 4B34A 2CK3D 2WU8A 4HR7A 5BR7A 2OHHA 2KM1A 4KIBA 2Q4OA 4XBFA 4EYEA 5DTIA 3DLLF 3CVUA 2ZQZA 4NC9A 4AWXA 2UZ0A 4FD2A 3AR8A 3R0AA 2JFUA 3FETA 2X4GA 4BP1A 2EYQA 4QIWN 3TW8A 4LOCA 3HCEA 3OZSA 2WTUA 5TQVA 2B3TA 3WMXA 4Q3CA 5ENZA 2VQDA 3NV7A 3VYWA 4QASA 3NZEA 2VTDA 3WGYA 4QPCA 5DW0A 3BL6A 5IUNC 1YYVA 4V0SA 2VODA 5L4LA 2F00A 1GAJA 4JJZA 5K6RA 4IZOA 1RQNA 3KTFA 1Y8CA 4JJEA 2VIXA 3OPYI 1A5SB 3KJNA 1ZP6A 2H1HA 4DLVA 3NBFA 1GV2A 1GQSA 1TVCA 3NTXA 2QVOA 1LBTA 4R9NA 1VKHA 2O2SA 2XSZD 1G5IA 3PNLA 4EYKA 4RQUA 5HKKD 4NTZA 2O4UX 2XRMA 3LYAA 3MCWA 4E51A 1QHNA 3SYNA 2CUTA 4DQVA 1PG5A 3OYMA 3PFBA 5EMHA 4LLLA 4V0KA 2WYHA 4M74A 1CR2A 2HLPA 4MNTA 1SKYB 3QF7A 2ZDHA 4LJYA 4DUZB 2QMZA 4KRXA 2HMTA 2FE4A 1I94B 1W52X 1JG3A 3I0NA 3HCOA 4PGHA 3EIQA 1QRSA 4MVJP 1V8OA 2BFDB 1KY4A 4G1MB 2GPTA 4M22A 4A92A 1PV4A 1YULA 5K5EA 3RVKA 3CHYA 1ZHFA 5KX5B 2WDZA 4N4NB 1WMAA 4JOSA 3UHFA 4Z7QB 5EJ5A 3UKOA 3HVHA 4Q21A 3C70A 2A69F 1X7WB 1GADO 1Y0UA 3W2TA 4GEKA 5JI3E 1HMYA 1IVYA 3I55I 4H3VA 4M1WA 4U0YA 3KU4A 1A5ZA 3TBIA 3ZXXA 1O95C 3B1FA 4CV0A 1MH9A 4DA8A 2C5GA 1TM5E 4ZOEA 3OY7A 3U37A 3EIOA 2A0FA 2ECBA 3MKZA 4K2EA 2WPNA 2WQ6A 2CLKB 2QMQA 2HJWA 1XU9A 1KONA 3WR5A 4KUGA 3I4FA 2X86A 2QE7D 4XLCA 3J80Z 1CUAA 3M9AA 1K08A 5KPDA 5I48A 3H9CA 3RSZA 2BEKA 4ZC3A 1MC5A 4RVDA 2PD4A 3DEJA 5FAXA 3TBKA 2QKLB 4M8IA 1V7QA 2PCJA 3AP3A 3VSDA 3HDTA 4IBOA 3U9LA 4DF3A 1QQTA 3V1NA 3QLUC 1SK8A 5FA5A 1UWVA 5I7RA 4TYYA 2EGUA 3WADA 3OEED 2DBVO 4BE4A 1BOOA 3ZD9A 1ZS9A 3A6LA 3O8OA 3N05A 1JSRA 5J2TB 4KLAA 1T10A 1ZJZA 4TRNA 3AERA 4AF7A 4FE4A 4QAQA 1CR4A 2H7CA 2P6OA 5FJJA 2CNKA 4O29A 1VRCA 4Z2YA 3TI7A 3K10A 2YS9A 2WWFA 3EXIA 2DKNA 1II8A 1EA3A 3BTIA 1D6JA 2XSJC 3GEZA 1ZPDA 1GZSA 4I09A 2O3QA 4HAYA 4OHYA 3ZY2A 1PWYE 1U0EA 1WW2A 3DL2A 1D2CA 4X7BA 4IICA 5ALIA 3ML6A 3WZMA 1D8TA 4W1UA 1Q11A 4QPPA 4O4IA 2CXQA 4OYRA 1YJNI 2ZTSA 2NIPA 3L00A 2R3SA 3BD9A 3ET5A 5K8JB 5KYYA 1W4CA 5KYUA 3WI7A 4BNIA 3HKEB 7REQA 2PX6A 1VI6A 4A3BJ 3GRRA 1QBGA 1ENHA 2YFYA 5L45A 4Z0TA 4BXXJ 1Z7UA 1T39A 3QNUA 4F84A 2X76A 3U1BA 1DKRA 2QQBA 2AX4A 4WUTA 1LFPA 4Q82A 3K35A 2WJJA 4MA0A 1E79A 3OEHD 1WM1A 1JHDA 3LAWA 3VPAA 5C8VA 2X13A 1KO8A 3ASNH 3GJ3A 2X3YA 4RBOA 2KW5A 4J4TA 3R6LA 1A2KC 3UJ9A 1JKMA 1D5CA 2FN9A 4U88A 3COVA 5L95A 4D8YA 2JVJA 4ABTA 2YZKA 3AI3A 3WXMA 5EKDA 4N03A 2BJHA 2GD6A 4XRMA 1KWKA 4DJEC 4ZDPA 1VMEA 3MMYB 5EUBA 4MUBA 2QN7A 3VOAA 3JWPA 4JYBA 2V0NA 2A9RA 2CUZA 2V7QA 4UEQA 1UFQA 3I2JA 2ZXHA 1BVUA 5MF6A 1NBME 2QXYA 1IDZA 3FW1A 8AT1A 2AXPA 4IEJA 1UKEA 1PDOA 4MW5A 4FISA 4RGQA 1HTTA 1YH3A 2WJ6A 4XRSA 3R7FA 4I55B 5DGTA 2REBA 2AN5A 3B1VA 1YCHA 3DE5X 1V1MA 4MV5A 2G9ZA 2OECA 4ZQFA 1R6DA 4MXDA 4I6GA 5CNMA 3H1BA 1FK8A 3PDJA 1UJCA 2HT1A 3P5BA 2NG1A 2JJYA 1T3SA 2AD1A 2P5LC 1FJ2A 1VA5A 4L5AA 4DA7A 5F0CA 5ICCA 3TPFA 4KRYA 1KP9A 3NTUA 1RC0A 2Q0HA 1E89A 2W2OA 2A33A 4OHVA 2DU9A 4FFLA 3P9QA 3UGKA 3T8RA 3N5KA 4RKQA 3FGPA 1HT1E 2AZXA 1J90A 3HKBA 2O7NA 4WA7A 1FMFA 5GGYA 1UC8A 1SG6A 4UOZA 3I42A 3NM4A 2YHSA 3MWKA 4PC2A 3KCQA 1VGQA 3EDCA 5CMLA 3HVIA 1V95A 2EGGA 2PWAA 1MO5A 3H11B 1X1DA 3IOMA 3IUJA 3B3QA 5DBEX 1S1MA 3X2FA 3VH1A 5TLSA 3GRUA 4H6PA 3VVMA 5E1MA 3PWKA 2FE1A 4US1R 4QYMA 1ZH2A 3HCWA 5CTAA 2R1UA 3VMMA 5B4UA 4IDEA 3L7JA 5GVSA 3PX7A 5FHRA 5INTA 2D2XA 5DULA 1WZCA 3C0KA 2QQFA 5L53A 3M81A 3G2LA 4KC0A 3O8LA 4UNNA 4REMA 4UPEA 3TL3A 2Q3MA 1WW3A 3B1WA 3C1TA 2ZPUA 4D4IA 1JB1A 3TXAA 4A10A 1CW2B 2QTLA 2EJRA 1JQ5A 5JATA 3LYLA 3NAZA 3L0IB 3AEKB 3D1JA 4UE3S 3IE2A 1DQPA 4OGLA 4ETMA 3LOUA 3OTIA 4NC7A 1OE0A 1V6CA 1WCMJ 2AK2A 1ZH0A 4DYQA 3RT7A 1E63A 3SFIA 3ZMDA 5AM4A 1CLEA 1KGSA 3G2OA 5TB5A 2DFVA 3OFND 2RNGA 3LYHA 3OQIB 5JUWA 3QEKA 3V4GA 5BR1A 4MQUA 1O87A 3TNYA 3RWOA 3OYBA 1G1AA 1CVLA 3EUFA 2XQFA 2H1VA 1QVVA 3R7DA 4X3CA 2REQA 5D7BA 4TL7A 1JJFA 3PFYA 3A28A 3QIAA 3CUQA 2GS9A 2YWEA 3ECSA 2B5WA 5K3SA 1D03A 1YQGA 3VC2A 3UJHA 1QU2A 2QDKA 4MQEB 5KC9A 4W9RA 2HLHA 4G0QA 1AMNA 1WU8A 2AGVA 4G07A 1E6UA 4KLCA 4GR5A 5CBPA 3C7TA 4FU0A 1V7ZA 4BLRA 4P2BA 3E5HA 1Y3IA 3UW3A 5CQGA 5T3YA 3KEMA 4MV8A 4MW1A 2NO9A 1M2WA 2C8JA 2YHIB 2R85A 4X0GA 3MHPA 4U5XA 4AY6A 2G1JA 4S2EA 3UVEA 3EPKA 1GYQA 3GX4X 1FDRA 3A9VA 4KDFA 1LTQA 1SZJG 1ZXBA 3Q4GA 2ZFWA 3MVEA 1STZA 4C0LA 2WNHA 5EXEA 1ZWLA 2C99A 3CC7I 4OF4A 2BUCA 3T1BA 2B6NA 3TO9A 3EC1A 3JQCA 2Q4RA 1E58A 3ROZA 1GD1O 2ZJOA 2IYTA 3IJ5A 3U4DA 4JLOA 1NNEA 4WX9A 2KBFA 2XDYA 2OGZA 2JA5J 4N47A 2GZHA 3FTEA 1NJSA 3UB2A 3LTNC 1OR8A 3FNIA 4TV9F 1FS5A 1GQOA 1XB4A 1QAQA 4QBHA 1E92A 5CH3A 4CT5A 2CB9A 3OKAA 4EABA 4C7KA 2NV6A 2X6YA 2Z98A 3K1YA 4HT3B 1Y4SA 4MX8A 4UNPA 2GAJA 2H2FA 3NIDB 1GQQA 1GNVA 3WAKA 3UHJA 1O5OA 3L8YA 4EEFG 1QB7A 5JECA 2FDRA 4JOMA 1GAEO 2GNOA 2PZKA 4LSWA 3RRFA 1GKUB 4ZOQI 3G73A 4DIMA 1WG8A 3ANSA 1SRQA 4LXTA 1PS8A 3VHQA 2LOOA 4V1CA 1YS4A 1DX4A 4ISBA 3DNPA 4PF1A 1KA8A 2Y77A 4FI3F 2H2GA 4PX3A 4DSAA 1MZBA 4QNRA 5BRAA 4G8BA 1U3VA 3G1LA 5CB4B 4TWRA 1G0NA 3R76A 3F6CA 4J1NA 4BE9A 2BFFB 4A8TA 4A1FA 2J0UB 3PFGA 3EDOA 2YCLA 1EM8A 1R2QA 1Y5RA 2QZPA 3HGTA 4RSMA 3SS9X 5K0CA 1UBHS 2PFGA 2QNIA 3AY0A 4UTZA 2UZ4A 2PSFA 1KO5A 3DFGA 2VTBB 1H42A 2GKGA 5KINB 1TX4B 1W88A 5COBA 4RA6B 2KJBA 1DGWY 1UK9A 4RZQA 3C5HA 5F1RA 2X23A 4XNFA 5B6PA 2P5VA 2R4UA 5JD5A 4HH1A 4W6QA 1A50B 4CYCB 4K0KB 3RC9A 3AR4A 2VJYA 2Q6LA 3ZE2B 2JGJA 4JGIA 3KAKA 4JLDA 4HQFA 2BMAA 1TU4A 1ORIA 2G77B 1FMJA 4WFIA 1BFDA 3QKRA 4BQIA 1HW5A 3OPYB 1T95A 5E3OA 1OFCX 4AFNA 2X0DA 3IKTA 4D43A 3OHPA 1ULAA 2HSWA 1VXRA 4RTKA 3VJLA 1ZIDA 4GOND 2J8ZA 1NW5A 2ZSEA 1KSJA 1MW8X 3IAS1 2Q2OA 4JLPA 3T0FA 4KDPA 1I10A 1GYPA 4US0R 1P74A 1UXIA 2RQQA 1YQQA 1YTLA 3MA0A 1ZWKA 1A9OA 1ZH6A 4JQFA 2Q5JA 2N47A 1ZKGA 3W78A 3SLGA 5U4XA 1P9OA 4YN3A 2J3EA 4AKGA 4IDCA 2RREA 4OQEA 2B0CA 2EZIA 1QO0D 1J8FA 2OQRA 3WTXC 3CCLI 1B6GA 1RFGE 3CUKA 2CH0A 1UBOS 2IA5A 1RJWA 4D98A 4YJGA 1YJAA 2DR3A 1K27A 4ZTBA 3WL8A 1CX9B 4C3UA 1ZAYA 2VF7A 3KT3A 2HK9A 4YXWD 4I50A 1LZLA 5D7NA 4DW8A 4KBYA 4IRHA 4I98B 3WJ7A 2JK3A 1QHSA 2BSAA 1NJ6A 2B37A 5KKNB 4MW7A 5CH5A 2UYGA 4UVGA 3N0XA 3H4MA 2LREA 2F59A 1E3JA 4BAZA 5KTNA 2Q4BA 3SIPA 2DECA 4MIEA 2DZDA 4MP6A 4U6QA 4Q1VA 3G82C 2E5WA 3B5JA 1H4VB 1FRNA 5IW8A 1XD8A 5AVSA 1VLQA 4PV7A 1L3CA 1IATA 4K28A 1JQAA 3RCOA 3JAWA 2JAWA 4FCWA 4HF1A 3OF5A 1IOVA 3K0FB 3QKIA 2AMVA 5DN6D 4UCXA 1YHNA 4HYEA 4JX6A 1FFDA 4AYBA 3TFWA 1HKSA 3DPUA 1KPHA 3LHDA 4KWTA 4WD3A 5T67A 1P0QA 2C3OA 2GFIA 1Q3TA 2R7UA 3R74A 2Y3IA 3QEMB 2A7QA 1SU4A 2JGKA 4GQAA 2HYGD 5C81A 2OO7A 5DD8A 4Z8YA 3HB0A 4EX6A 1IXZA 1EX7A 2GGSA 2WA0A 1SBZA 3IT3A 3UAZA 1WFXA 1O89A 3F3KA 4Z1MA 3RROA 2JT1A 1HLPA 4IPAA 3Q85A 4UMEA 2H0AA 2KMUA 2ZRGA 2V5AA 3M7GA 4EJSA 4LC0A 3MUFA 4F2WA 5JWRA 4FYKA 3AFGA 3LAJA 3AO0B 1GU7A 5KYTA 3OYNA 2JA1A 5IABA 1HFWA 1VI2A 3QEBZ 5IMBA 3WZLA 5AOCA 2J31A 2Z4RA 1J5EB 3ZGVA 2O0JA 4D4JA 1DC7A 3Q3HA 3O6VA 3UJAA 3VKVA 5DISB 2RJ3A 3ZDQA 3LVQE 3KJEA 3CKLA 3ZZNA 3USCS 4HDCA 2FFBA 4WOBA 3INRA 4ETNA 3ZGKA 3DZIA 5AHXA 4RJKA 3LU1A 1NF8A 1NMSA 4R8MA 3ONNA 1R6AA 1XDUA 1Y3DE 4CG2A 3PHHA 1PWHA 3DKVA 1U5TC 2ZRMA 3PPXA 1XIVA 2XR1A 3QP6A 3N3AC 3P94A 1KKLA 4DXAA 3HDJA 2C3PA 3TQTA 4HVTA 1QVAA 3A14A 3DQZA 2NM0A 1VTKA 3F5DA 4JI5B 1T4GA 5LGUA 5GJCA 5DTMA 1KI2A 3M2TA 1ZRFA 1JB9A 3DEFA 2GBPA 5BNWA 3TW8B 2W6ID 1CU1A 4O1MA 3O84A 4OL0A 4ZV4A 2ETHA 2HEIA 2MMCA 5KWEA 4ZJUA 4RPLA 2XCTB 2GD2A 4W97A 2QN2A 5AKHA 2ZSHA 4NL4H 1MEEA 2C9BA 3DOCA 1T1IA 1QP4A 3BSWA 3AB8A 4WX2B 4Y6QA 1YQWA 4F55A 3WL4A 4E03A 3HJRA 4J75A 1X87A 1SWWA 4GZMA 3WLEA 1KO1A 2ECPA 3BCBA 4PC7A 3E97A 1PJBA 2E5FA 4ND5A 1UXHA 2JAUA 2ZWOA 3Q7PA 1RAHA 5AT1A 3RF7A 1VIVA 2V0GA 3JQPA 5ALZA 2XE6A 2JLYA 4BLVA 1RRPA 4N3AA 3U31A 2BHZA 1UT8A 1U9YA 4NE2A 4XD2A 2WZCA 4HNAA 3CNHA 3HCNA 4FB5A 1FX7A 4I1UA 3MINB 4BVEA 1NUUA 1G41A 1H3EA 2NNYA 2NS7A 3V8BA 1H6CA 3EZFA 4EJ6A 1MDFA 4DGWB 1JPJA 3I56I 3NOOA 1OU4A 7GPBA 4AYXA 5CDHA 4WKPA 4W4TA 4FDVA 4WXRA 2VDRB 5JALA 4NEGA 3AR5A 5DNWA 3FSRA 2E6UX 3RIMA 2QM7A 4ZMSA 1HT2E 4CYDA 2ZCVA 2HUPA 3A6EA 1MJAA 1FMVA 5J2UB 2DK8A 2VLBA 1P6RA 3L4EA 1F43A 3IP7A 3NANA 2IQIA 2VL8A 2EHJA 1UZMA 2XXBA 3SSOA 3WNQA 1TECE 1XRNA 4KNWA 1OR7A 4EKIA 3HCDA 3CWCA 3T4UA 4I1IA 1IWBB 2PXCA 3E7LA 3ILXA 1ZRCA 4XLEA 2AJDA 4DBZA 4M88A 2DJNA 5KU1A 3PX2A 4BY7J 2JW5A 2A1TS 4AUXA 4B3GA 4NR0A 3E9RA 4MV1A 2DFKB 4ME6A 1WPGA 1QCZA 4OQDA 5FJ8J 4G1UC 4ZAFA 1ADGA 1UDCA 2AOVA 4YJ3A 5FYQA 3X2QH 3GRVA 1W76A 3DH0A 3KKPA 1XL0A 3C98A 3VDNB 4W5HA 1K7FB 4NK5A 4BPRA 2OZKA 1SD2A 4H7IA 4UB8C 1KL7A 3GEIA 4F1JA 5DTJA 4KODA 3FM5A 3Q0VA 4EYQA 4BNLA 3VMFA 4S1WA 1G42A 5EZ5A 1OT5A 3WL5A 1J1ZA 1K7CA 4AF6A 1CYEA 4UHCA 4FDLA 3AERB 2DHRA 3AY7A 4WHMA 2CNWA 5FI5A 1QNFA 3L7OA 3GTOJ 4B84A 4QNMA 4EWLA 4WFQA 2H1CA 3L09A 3LL4A 3ZGYA 1GGFA 1Y3AA 4C4SA 3M4NA 1II8B 3HKCA 2CJWA 3PUZA 4DCOA 4JY7A 2V5UA 1FSPA 4WNIA 5FR1A 1FNNA 5GONA 1QX3A 3RRBA 1BHO1 1IRGA 3WV5A 4O4IB 2JLCA 5SYNA 4TOIA 2MU1A 5TMDA 1T0FA 5AJHA 4O0LA 1SHZA 2CNDA 4PAWA 2VPXA 3FBNB 2FPRA 1CP3A 3RVRA 3ENZA 2ZUEA 1G0OA 7REQB 4ABZA 1BGXT 3DD5A 2KIQA 3RIEA 4RIEA 1IMOA 3RBVA 1TUGA 1WEKA 3W79A 1M7HA 2VYND 4GYJA 2WAAA 1LF0A 3T3IA 5JZBA 4OIMA 5AONA 1LB1B 2W90A 3ZW7A 1I2DA 1W7PB 4MIKA 4UM9B 4FIZA 2PSJA 2VHWA 1JKFA 5JQGF 5BN1A 3L1VA 4PANA 3AF0A 3LPLA 1CDDA 1VQ7I 3C3CA 4ITUA 4CIVA 2V6IA 5TXGA 4NICA 1GN8A 2DA5A 1CY0A 1OLSB 1OHHD 3RGGA 3W90A 1FU7A 3KQSA 2QYTA 2HWKA 1CUCA 2F1HA 4BRWA 4REQA 3KCNA 4G5FA 2XXAA 3DPTA 1XYYA 1UBLS 3UNGC 5K3OA 1YUNA 4HAVA 1GAXA 1GM5A 2FSUA 3QXSA 3BKWA 1B15A 5B37A 2BI7A 4GL2A 2C4WA 3A1DA 1PIWA 1YA6A 5DTQA 4UMFA 3G2IA 4UVAA 1X80B 4FCCA 4XA8A 2FU4A 3TKLA 4QO7A 3BXFA 5CK4A 1G5QA 2YHUA 2O6HA 2NO0A 3T5TA 3QG5A 4CMIA 4KN8A 2BSQA 2L4AA 3GD7A 3PL1A 1JQJC 1JQKA 1ZN9A 4MRMA 3CONA 2Y0SA 5J5AA 1G6NA 2JBAA 2PRJA 3EVAA 3W7AA 4AJKA 5IAJA 1OPRA 3F9KA 5KTYA 4GE3A 1F7VA 2PBLA 3VOEA 1K6MA 4ESOA 4KVAA 3KUXA 1XRJA 10MHA 1CF7A 3THSA 4L6CA 2F55A 2GXSA 3FMOB 5TMEA 2KLOA 1S7AA 1NU8A 2OD7A 3LA2A 3DDWA 1JG7A 4P4GA 2XA9A 1Z0DA 1JI3A 3OLYA 1JKOC 1ZLYA 3BRSA 2C0PA 3EA5A 3AQ4A 1OSNA 1V5EA 3CO7C 3T9AA 3KV3O 3S1LA 5J43A 1HUQA 4Z2AA 4JYKA 3E5MA 4UTNA 4N54A 2PT5A 2H52A 4CKWA 3OX2A 5KVRA 4P55A 1DI0A 3RDPA 3PHJA 3COSA 4F8EA 3QP5A 1EVZA 3LDGA 5AOBA 4XFJA 1YB2A 4L28A 2YNMD 5FO0A 1WETA 1A96A 3QSGA 3SY8A 2I8CA 2BAGA 2EFNA 2V7TA 1L7PA 1VJRA 2SCUA 2JTVA 4C7VA 2IW1A 4QT0A 2ZUTA 1R1TA 5IKPA 3WTTC 1EBFA 3QE4A 1XZLA 3CINA 1QRUA 3CP2A 1D2RA 2HWUA 3VR6A 2BGJA 1L5HB 1GTG1 1V35A 2FR0A 3WHIA 3X2EA 2G6TA 1FX0B 3PWZA 3ZDEA 3BC8A 2E18A 1Q0PA 1TEHA 1IY0A 2DSTA 4CIYA 3ZCSA 4ZJYA 1XTRA 4LE2A 3SZOA 2JEOA 1ZVKA 3STXA 1I0IA 5EZ6B 4BWFB 4XJTA 3UK7A 5AVJA 3UMSA 4IF4A 5K20A 3IKMB 3HUGA 5DGIA 2DPXA 3ESYA 3LXUX 4EUFA 5SYAA 1ZITA 3VOTA 2X8LA 2OTCA 1YI1A 1PR6A 4PLTA 2R66A 1RHMA 1UM9B 2LV8A 4KN4X 2WINI 5ADHA 3F47A 3L18A 1ZQ1A 2NVXJ 3HBLA 2VNJA 2CL6X 3M3HA 3KALA 5KQSA 2B25A 4MUEA 1NR5A 2UZ3A 3O82A 1KYQA 5BWBA 2VBWA 1Z0XA 1JKJA 4CKCB 2J9ZB 3PJGA 2EG9A 4CIXA 3VR5D 1HLDA 4KT5C 1ZD3A 4RK1A 1UBCA 2QIOA 3BE4A 4UD2A 5A9RA 1JMKC 1WQ4A 4R1SA 2X1MA 3QFSA 3EMVA 2P9GA 2L5QA 4M86A 2VB6A 2DQYA 1VF9A 4HSRA 2REQB 1Z3CA 1NXWA 4QQKA 4EZEA 4BNJA 3CUUA 4IHVA 4M0EA 1IV8A 3CLTD 4U0VA 4K1XA 4Q9NA 1R5BA 3T9FA 1Z2CA 5DUIA 1SCUB 4F2PA 1GUBA 4IVNA 5IOZA 3NYWA 3MF4A 3M33A 1V25A 1QPGA 3LI2A 4PX9A 4ZYTA 2PUCA 3QXGA 1RLMA 4ND6A 3FLBA 3NWPA 3BR6A 4Z3DA 4O63O 4CM3A 3TLGB 2FNPA 2Q5EA 1K7AA 1WCYA 4C2AA 4QU0A 2P4EA 3EN0A 4A5NA 1FMLA 1DQUA 5F0FA 1CC1S 1HH4A 1YVPA 1XEAA 5K2OA 2R5NA 1PJ3A 2PLYA 2ZWAA 2W6JA 3H3JA 3S3TA 1VLZA 4JBIA 4ARCA 2HU7A 4PSDA 1WSAA 2F3PA 5EIOA 2BONA 3H9QA 4AZVA 5DEIA 2BKVA 3U5TA 4B3DA 3N0TA 1LRLA 2IGTA 5F35A 4K2HA 4RHFA 1PGOA 2G76A 3NONA 4M0KA 4O25A 1ADYA 2JEYA 4R81A 4YWHA 5I5GA 2F90A 5LKRA 2VN2A 1YASA 4CMJA 3F23A 1RJFA 3W8RA 4KOAA 3EGVA 1P7VA 3BXHA 4JR1A 1VG1A 2YFKA 4U4AA 1NBIA 4AQ7A 3UCFA 4DM3A 4BE7B 3DL7A 2WZDA 2J6HA 1R4MB 3Q3JB 4BV8A 2BBTA 1TQ2A 4B09A 3ZVKA 1JHAA 1YQAA 1G66A 4UC0A 4OXQA 1JMVA 1JSZA 2VSOA 1QLHA 8ABPA 4KJZA 3ZWMA 4LMRA 3S1RJ 4ZREA 2A7XA 2YIDA 4HXGA 3OICA 2EV9A 5CYFA 1N7HA 4URFA 2XF5A 1ZA2A 4H7EA 1X8JA 2J7KA 3OJ0A 3J7AO 4JJKA 3FUVA 4BNFA 3V3KA 2VONA 3O8BA 1XHLA 3SR0A 2WF8A 3JYHA 1RKVA 5F0HA 5BSGA 2F7SA 4V2IA 1ZK3A 3PRYA 4IV0A 2UZ1A 4F04A 1W9MA 3O21A 1SXHA 3OPQA 4RS4A 4XVCA 1IYZA 3H83A 4G26A 2IK8A 2R2GA 1XEWY 2VXZA 4BFSA 4NQWB 3P2EA 2HPZA 1KDTA 5GIPE 4PQEA 3KXLA 1N9GB 2HD4A 1OY1A 5BV2P 1Q50A 2O7QA 4MR8B 3V34A 3WO0A 3LPNA 4NJOA 4A5OA 3ZY5A 4RD3A 2FWPA 2OE2A 3F6EX 3NRCA 3AG4H 2VQ6A 1Q7RA 3JR7A 3ZHVA 2BH2A 2YZGA 2Q99A 4PN3A 2CQ7A 3MZ0A 4HOYA 3C97A 1E4VA 4L7VA 4I08A 1NZFA 1ENZA 5EG0A 1DOZA 2IPQX 2XNJA 5ULLA 2HEOA 2GTHA 4GZ6A 1USUA 2A86A 1UJ2A 4N49A 4BMYA 4OXKA 1JG2A 1ID8A 1EG2A 1N8NA 5BWMA 4LF8B 4LG3A 4UULA 1DAPA 5ALNA 4QDKA 4H1UA 3ESQA 3S1AA 1W1WE 4M0PA 4M83A 1P3Y1 3P2YA 3FXAA 2P30A 3T1VA 4RELA 1F3LA 1TLTA 3RI4A 1DWUA 2X4LA 5SY6A 3TZQA 2E1OA 5MN5A 4FFPA 4Q3KA 3GUUA 3O3OB 2CK3A 3SQWA 4Y33A 3KQVA 2R86A 3PICA 2I87A 1Q1HA 5A4DA 2Q3BA 3VYTB 3QXXA 2FPIA 3MTDA 1KU3A 5CR9A 8GPBA 3IMFA 1B0AA 1FX1A 2ZROA 1WBJB 2L2QA 4X0EA 3B2EA 4OAOA 2BDTA 4EHLA 4Z86A 1Y6FA 3T95A 5F52A 2V9PA 2UYCA 3IEPA 3I9V2 2FMKA 4AKIA 2O8CA 1Z33A 4N1AA 5T8KC 1TM1E 2MABA 2WF5A 4YASA 2OXCA 4BZZA 4OQYA 1R1DA 4GGPA 4I50B 4IQFA 4B1RA 4FMDF 3TGLA 1ZRHA 3DE7X 4XOTA 3LHKA 4ZHQF 1TWFJ 2RK3A 4IIJF 4K7JA 2VJNA 4LQLA 2JJMA 3KJZA 3BSFA 3HDDA 4Z9XA 3S1MJ 3FLAA 2WYVA 2EINH 1ZXXA 1N36B 4IDGA 2P40A 3EGXA 3IIIA 5K4GA 1SQFA 3OQHA 1XO1A 3VOBA 4LC9A 1VQOI 3OF2A 3T9DA 2IOFA 2JNWA 3BPSA 3EWIA 3UT5B 3JAWB 4XUEA 4HMOA 1BX0A 2C83A 1GIAA 4YMLA 4YLYA 5EERA 4LE1A 1ZEJA 3UJNA 3D7SA 4E5VA 5I8WA 1RVDA 1OGJA 3IT0A 3BOSA 4E88A 4JELA 5CCEA 1KY5A 1B9MA 3VAYA 1T3TA 1E5VA 3EY9A 1DGQA 1CQIA 1U3TA 4I4TA 3WTSC 4GKVA 4LYGA 3M5DA 2QVBA 4V2GA 2WJZB 5HX7A 3DQQA 3AF1A 5K0SA 1TMYA 1T24A 4UEWA 4IMRA 1WPRA 4FGKA 3IHWA 2I80A 2W6NA 2J3QA 3PEVA 1C5KA 5GM1A 3LQ2A 3F3MA 4R2KA 4QQ8A 4KWIA 1DJLA 3HCPA 5CVEA 2QEXI 3LX4A 1OBCA 2RC5A 1GP2A 3NW9A 3HM2A 4J9UE 5AK0A 4J7XA 4LJ6A 2I66A 4PPYA 3JQ6A 3DUWA 4E4HA 2KZGA 1Q22A 1VJ1A 2A2ZA 3D3KA 4M36A 3OECA 4OYLA 4A8HA 3AOEA 2Z2IA 1N2GA 2HSDA 2XZDA 2AVDA 1KC3A 2I0FA 3JY6A 2OWEA 1JE8A 1OZHA 4XWGA 1OX4B 1XMVA 1FSZA 2G63A 5B7GA 3ZHRA 3QOXA 4Q7LA 5LP6B 1ZTRA 3M6MD 1ICEA 5DH9A 4QU9A 5DYYA 5GPBA 4ZVVA 4NFLA 1C0KA 3R8XA 3VSBA 4U7PB 3G0IA 1QPIA 3GJRA 2Q3FA 3O26A 2QRVB 4YIKA 4P0PB 1I0ZA 1RQPA 1SXPA 1LCIA 4C6TB 3C87A 5BN3A 4TM7A 2OQ2A 3SP1A 2OLEA 1AHPA 1B72B 1P6UA 4EW6A 4W8GA 3AV3A 2B7BA 1NR7A 1NN1A 4AO8A 4RKEA 2FWNA 4CHGA 2IYNA 2X19A 2Z43A 4X8LA 3HGGA 3VNAA 2LBFA 4LJ4A 5DW3A 4HWSA 4M89A 4D45A 3LGSA 5FX2A 3KZNA 3ZLUA 5HZGA 4V0MA 2ZZNA 5D6OA 3HY6A 4NQRA 3D3QA 5JFRA 1GGEA 1EH8A 1U0LA 3T54A 2KIUA 2H8GA 3G68A 1SUCA 5F1JA 1NVGA 3KZYA 3TMOA 4Y9RA 2JLUA 4WZAA 4C5AA 4XI9A 5B1SA 5EIHA 2F64A 4HGQA 3AGQA 1WDKA 1XSXA 5FD6A 3TLEA 2C31A 1E4YA 2IYRA 1Z4KA 4DLLA 3IUQA 4A6EA 3W9SA 3T5MA 2RBKA 5BMVF 5K09A 4INJA 4DLKA 2II6A 4JA2A 3AVOA 3K5IA 4JX5A 1BI3A 5FD5A 2CE7A 4HNAB 1DIHA 2MC3A 2QTCA 5DM4A 2RHBA 1F6WA 2ZB7A 3DBRB 3PNMA 1JT0A 5BSVA 1T6NA 2M34A 1H0RA 3ZJVA 3ILYA 1UELB 4M1EA 4UMVA 3TX2A 3O1IC 1A8PA 4IH9A 2ZSIA 1M1NB 1SVNA 3QUQA 3WHBA 4KI0A 1GPYA 2EB7A 2SHKA 4OHWA 4B8ZA 1M2JA 1J1UA 5FPTA 3BH6A 3OZWA 3H6GA 4DCVA 1GPLA 3DV8A 1PEAA 2JDID 3CWQA 3OHSX 5IT5A 4DSTA 3CW2A 2QUFA 2I7XA 1EESA 1D2NA 1YOVB 4N3GA 3NHBA 3QX7A 1I6HJ 4IG9A 1AMUA 2D0PB 4CL8A 5L3ZA 3L6DA 3M82A 2A9VA 3MKYB 4A6DA 4K88A 3I9LA 3UA4A 4LSMA 2NXWA 1U1IA 1JQLB 2ZB4A 2CBXA 4AUKA 4X62B 3PKJA 1G18A 1FNSA 1T2VA 4EYOA 3BSYA 2P9CA 2AJBA 1FP1D 3W6VA 1TVKA 2X4IA 4O4HF 3PJRA 1NI3A 4H31A 4KXMA 4QUEA 1UBMS 3G2PA 2R7KA 4RVHA 1U2GA 3EVDA 1H22A 1LLCA 3GGPA 1SMKA 4CZ2A 3SU8A 4YDRA 5CIWA 3ZZTA 2Z33A 3ZN0A 1EWYA 3QVVA 1KPGA 3UG6A 4RGYA 3E6MA 5C8YA 1JGGA 1X1TA 1SFEA 3UXEA 2D2FA 2F48A 1UP4A 5CEJA 1YR1A 2FF7A 5FPHA 4YFVA 3BIJA 2O03A 5F33A 1OXTA 1J20A 1W6RA 3EC2A 4QHSA 1JIIA 1IHOA 3A6PC 4HPJB 3QVUA 3UY4A 1AUVA 4TT3D 1OCZH 2B1IA 4P34A 2J9XB 3OYEA 4EJMA 1Z9CA 4LYEA 4L6AA 1JHHA 3OZCA 2W0MA 3OL4A 4AVYA 1HK7A 4MS3A 4OGFA 5H7XA 3EHEA 1ZMRA 4DZJA 1E3WB 2CJWB 4MWGA 3OPMA 1JHPA 1C1XA 3DOIA 4WRRA 2A4KA 3CH4B 2PHZA 2H06A 3PPVA 4M3DA 3JWHA 2I67A 1KYXA 2DAPA 2EC5A 4LXUA 1P80A 1DRUA 3QYBA 1ESZA 1ODSA 2DUJA 4NI5A 4C03A 3ZCPA 2NAZA 5H2FC 5KC8A 1CIVA 2XQIA 2O0MA 3WTBA 1YJ5A 1Q20A 2EA4A 3P0EA 4FUQA 2A9FA 1VRWA 3VVBA 4RK4A 1G2PA 1FYEA 1ZI6A 1XX5A 1XLUA 4LI0A 4ACBA 3CJQB 4M0LA 1RXCA 2G0AA 1VJCA 1F8GA 3GVIA 2XCUA 1ZY2A 3RNOA 1JQBA 4X60A 4TWJA 5L3EA 4KFRA 1ETXA 3J80A 2ODQA 3OE1A 2OHGA 4YMHA 1RYDA 4UXIA 2C7PA 4PEVA 3PRJA 1G5TA 1GPWB 3OFNA 2QXTA 2JI6A 3GT4A 3FXKA 1KMCA 2R4QA 2WU1A 3ABTA 2ECKA 3LVFO 5I7SA 1TLHB 2E2IJ 1RCFA 1K5GA 1MOQA 2XXAB 1PEYA 3AXTA 2NTJA 1PNOA 1DU4A 4FFRA 1ZKDA 2H31A 5GGXA 3E6AA 2LGJA 4ZVPA 2VQGA 3EGOA 3DCIA 1G6KA 5IJ0A 3FNQA 4MKRA 4J3NA 4D3YA 5JPCA 2PMZN 3QAHA 3CZQA 2GK4A 4BKPA 4BKRA 1I4DD 1EPUA 3QY9A 3FLMA 2NU8A 1PGJA 1PP7U 1YS7A 3DYVA 4PG4A 2XWPA 3OX1A 3KT8A 4MRMB 5JE8A 4AJIA 2AQEA 4UHFA 1FSFA 3ZEAA 3KZ1E 4RQAA 3KYCB 1NJFA 1W19A 1J8DA 3SIRA 3J7ZI 2KBEA 3E0QA 1CF7B 2JD2A 1I1NA 4FPXA 4DEVA 3KL4A 1OIVA 1WHTB 4OJYA 4U2BA 1ZH4A 3SKXA 1NBOA 3W6JB 1AKUA 3OE5A 2XODA 5I9TA 1DIOB 5HCIA 3WLAA 1SHLA 2QVGA 3NEAA 4RQBA 1YQEA 4DG8A 2Z83A 1Z05A 2GERA 3CF2A 2ZJPF 1IJFA 3OLQA 3VRHA 1QIEA 1CF4A 4KFTA 3R24A 4YELA 4ZTUB 1B8NA 3ITNA 2BFMA 2X6TA 5DNDA 2WPDA 3HXKA 4QRHA 5EJEA 5HCUA 4CKWB 3ZWCA 4CKBB 2ZTVA 1O94D 3RIXA 2GCNA 3C3DA 5KYXA 4ZTZB 4HN4B 3BQYA 2K87A 1XCLA 3PPWA 2GQ0A 2VPIA 4NKRA 1CB7A 3MJDA 3HBNA 1NP6A 1OH8A 4ZZLA 4XGIA 3U1DA 4MI1A 4ZGGA 3QTBA 5LBQA 4N7RA 4MW9A 1R74A 4Y0VA 16PKA 4PXAA 1YDEA 1BR2A 4FINA 3BMCB 3BZWA 2ORIA 5JVGF 3T8YA 4GZ5A 1L8AA 2FN7A 2ARKA 1ZYRF 1O4VA 1GZVA 1MCZA 5KQPA 1YITI 4XYMA 2VWQA 5IYCJ 3L2OB 2D7JA 5GAHJ 2LKPA 2ZI6A 4QDUA 4MPPA 2XB2A 4WY5A 5LD2B 3NYRA 3SKVA 2VH2A 4RA9A 1KDOA 4DM4A 3DFZA 5JXIA 1NVDA 3FYSA 4MQ4A 3QTTA 4LCJA 4CMBA 5J59A 1F9EA 4YLGA 3CZ4A 1W75A 1FOXA 1BYUA 2LKDA 3INTA 1TYAE 1POXA 4LX8A 2AXQA 2QN9A 3ROMA 3N39C 2DQKA 1XSDA 1MQSA 2GRJA 3NJ8A 2ZI4A 4UPVA 4E15A 4BJ6A 3BB1A 2C3MA 3IP1A 4JU9A 1GTZA 1H9BA 1J7KA 3OMLA 3OFVA 4R3NA 1WCWA 3EVBA 5H9VA 5DDIP 4J1SA 3OY2A 3BCSA 1NJ8A 2IYSA 4BEHA 1JLRA 3A3OA 3ENKA 3FCXA 5KNDD 3IOCA 2FU5C 4ZMRA 3TO5A 1GUUA 4RGBA 4B6PA 1SJ9A 2YQZA 4HATA 3UQYS 3EGCA 2O1XA 1BOBA 3OA2A 5HNFA 5CGZA 1ACJA 4E1BA 3TCXB 3RK1A 4Z7OB 4GOLD 4UDYX 4URUR 2VPWA 2NVWA 2H92A 3EIFA 621PA 4IYJA 1ZM4A 2PGXA 4C05A 5EF6A 2J6IA 4FFSA 2Y9ZA 3D6UA 3C8UA 3DZDA 5LBUA 1Y98A 2PBRA 2ETVA 2XB0X 3SFZA 5JIBA 3HN7A 1UF9A 3T5BA 5A9SB 2BP7A 2DAOA 3A4TA 4IX1A 4BO7A 1A9QA 3R6TA 4JI1B 1PL8A 4AJEA 4ZCRA 4OJMX 1XPJA 1N33B 1P75A 5TPZA 1B8OA 2M6LA 3U39A 2OCAA 1WXDA 4AX8A 4WADA 3RYFA 4QGAA 2ZBUA 1S5LC 1G8SA 2XZPA 4R2IA 1CUGA 1KOGA 2OUIA 4DV5B 2PGIA 2HF2A 3GQBA 1UODA 1P1FA 3QJGA 3QWHA 1NPTO 3N28A 5L7YA 4BGIA 1X94A 3ELUA 1XKQA 1R3UA 4UB6C 3OR1C 1QO0A 4NCAA 4WJZA 3KZCA 2X8JB 5CX4A 3U7QA 2OOSA 1JUDA 5JCZA 4B45A 5F51A 5IARA 4O4LF 1U8TA 2J6CA 5I7OA 1R0SA 1FYDA 2P68A 2N1BA 3TOZA 3PD1A 1TNSA 5CEEA 2JJ1A 1RP1A 4J0EA 3ZY3A 4NATA 2LY1A 3IAXA 1JWBB 3D6HA 1CEYA 1ITZA 2YMQA 5DIZA 2NO4A 2FLKA 2AXEA 5IKXA 3LUDA 4IDDA 2XF8A 4DWOA 5TQ2B 1FLVA 2XUDA 3LRPA 5SV2A 1NC3A 2IUSA 1U28C 4OHFA 2P5KA 2QVLA 3UYLA 5JS1A 5BRNA 4DHWA 1T29A 3G2QA 2IGNA 2E1NA 1Y0NA 2QA5A 4MWOA 3HJNA 4DM7A 2Z16A 5TDHA 1YW7A 2XDWA 4LLGF 2CZQA 3FCOA 4DANA 5AIPA 2WAXA 3C3EA 3MOIA 4XLZA 1UIMA 3ZHTA 3SJCA 1EFRA 2X1EA 2ZIZA 2R8ZA 1AS0A 1AUXA 1BEUB 4J0DA 1DL5A 3DT6A 3CLHA 3IC7A 2AJCA 1BJKA 1GRVA 2X6XA 3IAHA 3GJSA 1QHHD 2P0WA 1ESDA 3F8SA 1ECCA 3CIFA 5F2OA 1N1GA 4FMCF 1MVNA 4YQEA 4IZHA 5DYNA 3NNSA 4S1PA 1UOEA 1U1FA 4P7FA 4E14A 2HF8A 3N2GB 4NXNB 5AXBA 4LMPA 4PG6A 3O8RA 3GJ4A 1VQLI 1MC1A 5JAHA 2EARA 3FNGA 4H77A 4DLAA 5ILSA 1YZQA 1KI1A 3TRKA 3WGLA 1VE1A 4D7NA 3R3ZA 1E0KA 2FZLA 4GLBA 4QDJA 2MDTA 2C0CA 4UCFA 1XCMA 4KV9A 4MHSA 5FROA 3BTSA 4FX5A 1E69A 2ZAGA 1SANA 3OWXA 3CNBA 2Q6VA 3AIIA 4L85A 4K6CA 5IDYA 4JJAA 1TZMA 2DO7A 3S2FA 5B1AH 1H1LA 2ZYSA 4JBNA 5JO9A 1QYVA 1A04A 1T9BA 5JXGA 1TIPA 1T2DA 5AD1A 2RK4A 3ZWOA 2CFTA 1IZZA 1HT3A 5KNBD 2IXAA 2JWTA 1CHNA 4TL6A 5F64A 4HMPA 1IBRA 3GJ5A 4HGPA 5JISA 1YBAA 1W5TA 2PEYA 1JFFB 3S5JA 1A5BB 4CKEA 5L3FA 5LEKA 3R0IA 2XNDD 2YY7A 4YREA 5CA0A 4PHCA 1REQA 2EP8A 2YVAA 4FSHA 1T9ZA 4MV7A 1SIWA 3K9TA 1U0FA 2NZVG 3QU5A 3I2YX 3WLOA 1A8IA 2HUNA 3OZ7A 3OT1A 5TS3A 5HNHA 3GH1A 1Q21A 2WYUA 2NS8A 2O8CB 4ZO4A 1YDHA 1CNMA 5FTKA 4M1MA 3G2MA 3LA8A 1Z18A 3KZOA 4LVUA 3A1SA 3JD4A 5H9WA 3D0RA 3L0OA 3CUYA 3JRFA 1MQ9A 4DIBA 3KKQA 1FFXA 1ZA1A 1QE3A 2W4MA 3FMVA 4IO0A 1Y8QB 3UMGA 4YALA 4PX2A 3L1UA 4CUJA 1AMOA 4ER5A 5EYRA 1ACIA 4V2UA 2SNIE 2C98A 3ADDA 3C5CA 1YHQI 1SM4A 1ISSA 1QUEA 1D2GA 5LEJA 5JZ9A 3WRXC 2GF0A 2GETA 3TM5A 3IMKA 3KIOA 1ST2A 3RC1A 1HQDA 1X7GA 3JRAA 4N39A 3VVLA 4XYLA 2WUEA 3TW6A 3AUKA 3UANA 3LVRE 3BEOA 2K5UA 3NHSA 1F4PA 5AMXA 4AMYA 1FTYA 1ZOPA 2RH8A 3ZTYA 4KMUX 2IUEA 3MKLA 1XRLA 2DMTA 3MWDA 1A4XA 1T1RA 2GCGA 4MMXB 2CXTA 5HVNA 4YVFA 3UWSA 3N76A 3WLNA 2H6BA 1ZGAA 3AJAA 1YIDA 5THQA 2G1KA 4HXYA 3W06A 3H4VA 4GWKA 2LY2A 1QIGA 5CCXA 4ZAWA 5K6AA 3QYAA 3I12A 1HW1A 1FP4A 1JV2B 5K45A 2IZ1A 2DH6A 1FFBA 4IFTA 4AIRA 4FR5A 1Q7GA 4ED9A 5AQ1A 1GXPA 5A3JA 2GZSA 3QYJA 3SJZA 2FZVA 4HEA1 5FJIA 1D8KA 3EQ8A 5DCFA 3BG5A 3T3DA 2LR8A 1KZ7B 4FYIA 4AKHA 3ONWA 4RZ3A 5LXTB 2YVKA 4RDIA 1YB5A 5JTTA 2D5BA 1DINA 3ETNA 1HE4A 5CLIA 1XN1A 4HNVA 1QP8A 5EJ6A 1J0XO 3D0KA 2HTEA 1MX3A 2KRFA 3NHFA 4N5MA 4DWVA 1E32A 4RM2A 4DV2B 4AZWA 3OM0A 4ZT3A 4MVJF 3B9BA 4BHCA 4QAJA 3NEUA 3DWIA 1NASA 2FZCA 5IRCD 4ZAVA 1Z6YA 2XVAA 1GGHA 3M1IA 4A2WA 5EMJA 3UPDA 2H6EA 2ZB2A 2I3AA 5GV8A 13PKA 1P7JA 2R87A 1G8KA 4JWTA 4K8RB 2HFJA 3FKIJ 2P2CA 3TAXA 4L9VA 4CIWA 3PV0A 5LFAA 3E22B 2E2JJ 1ZCJA 2QN1A 3P9ZA 3S2HJ 5IC5A 2ASEA 4MO2A 4DCGA 5IG2A 3O9ZA 2VBZA 5BV1A 1NQTA 1GGVA 1PQYA 2FI1A 2I33A 1BFKA 2Q45A 4V1CI 2I4LA 4KR7A 4MFDA 5AVQA 5EHZA 4QOHA 3I1YA 3HPQA 3OG9A 3C5WP 3I9NA 4A3FJ 3IJEB 1E61A 4L4UA 3R6DA 4WZAB 1PWXA 1P4JA 4XUGB 5THXA 2ZB8A 4HH4A 3O3MB 1JTVA 5T3UA 4B82A 2QLMA 3CJRA 3DHEA 1DAOA 3E9MA 3R09A 4NEQA 1SU8A 4UVBA 4DIOA 5AVTA 1NQWA 5LGNA 2PQ8A 4EGFA 3TE6A 4EMUA 4UD6A 4FYVA 5B5SA 1GZ3A 1C8LA 1MB4A 4G23A 2NOAA 2WF7A 5AM5A 2FJ0A 3AR6A 3PUWA 5BSEA 5G53C 3V1YA 5EJCA 1W2WB 1N5OX 2PZEA 2QRGA 1KYVA 4AWXB 1V41E 4UUSA 3L0YA 2MW8A 3UCXA 3WOVA 3R7SA 4Z54A 4XUDA 3I8XA 4RPKA 1ZJ5A 3CEAA 4JT2A 2FN3A 3ND6A 1Z2EA 5EJ4A 4LXIA 4RS3A 3MS2A 3PRKE 1FLAA 2C2MA 2CW8A 1FJGB 4ZYLA 4Q3LA 4JZYA 3K8YA 4NJEA 4ER6A 1L7EA 4JR0A 1R5JA 1P4HA 3WKBA 1JR3A 1Y82A 3NO4A 3W2GA 3EETA 4R9RA 5DNUA 4I3HA 4WAUA 3H7AA 4YGYA 3LQKA 3KPWA 5EEAA 4L9JA 1NKVA 4FOOA 1GUZA 3FNEA 1BQ4A 2X9DA 3DL4A 1Z5OA 3CIOA 2HJ9A 1SC3A 1CS0A 3SIXA 1VJTA 2WHEA 4MOWA 2ZIGA 5LZ7A 3SZTA 2ZATA 4IRXA 3E9ZA 2P2ZA 2Q1ZB 3MTBA 5FAKA 5G1NA 4XWKA 1F12A 4DLRA 3VAZA 2MFZA 1RCTE 3KTAA 2J3LA 3KQQA 2VPRA 3A2NA 1PSWA 3UPTA 2PXXA 4Y52J 3K4HA 2QSUA 1J99A 1YK1A 4YO8A 3RRNA 3SFVA 5MN4A 3ZWAA 5CT4A 5JYCA 1QAOA 3PCTA 4LQ4A 3VR4D 4RLQA 2HK7A 2IZZA 3HJTA 3K0KA 1L5YA 1P5HA 1E9SA 4TMFA 2ODNA 3QYPA 5KSPA 1E8DA 3FCAA 4QXRA 3WWZA 2IPNA 3PFHA 3G9TA 4ALIA 4CTMA 1TW2A 5B4VA 1JSXA 2BKLA 5ES3A 4H08A 1W5CC 3V8KA 4NDAA 4RKFA 1XALA 3UH1A 2A0YA 1T9HA 1XSVA 2VDUE 4HNTA 1Z0FA 4J3FA 1TTHA 4RC9A 4NENA 2OQGA 5ALEA 1G8HA 1THGA 1QG4A 4ITVA 2R8OA 3M1EA 3QVJA 3BCRA 5H0IA 2GYWA 3WGKA 3TEFA 1ZMXA 1DAKA 2Q6OA 2Q9AA 1FRZA 1HZJA 5AO9A 3RIRA 4HDQB 1QJCA 3Q72A 5F3WB 2CMGA 1ENOA 2ON6A 2G7MC 1GZUA 1NK2P 5EVCA 5ILVA 1MO3A 2TMYA 2RAVA 2IHZA 5LYJA 1IRZA 4R54A 1K78A 3WZ2A 1FTZA 5KOJA 1TUEA 2O1WA 1T9GS 2RH5A 2GZ1A 2E4AA 3QHQA 1IN8A 1NQXA 1RS0A 2DYSH 4YCSA 4Y2VA 5KTSA 3O8OB 5AYVA 4D25A 2BRUC 5DM1A 4BNVA 1FRFS 4AI6A 1ZIXA 3OJCA 2VE9A 1L8OA 3EXIB 5ALPA 3S17J 2UUBB 3L7MA 1XPOA 3FVWA 5DU2A 4GI3A 4Q9JA 4COOA 4W1PA 1RLTA 2AG6A 3AJRA 1NJ2A 1FZTA 3LFKA 1E2MA 3ILHA 4NYIR 3PTZA 5KYYB 2NU8B 5KYUB 3PR2B 1KMMA 4LTDA 4DEXA 3WLFA 2UUZA 1T0UA 5DRYA 3RTCA 3H5RA 2IY9A 1UMBA 2ZTMA 1CULC 2BCEA 3ADPA 4EEZA 1SBHA 4PAGA 4A03A 4YV1A 1Z62A 2Y27A 2WF6A 4K9KA 4EECA 2KRCA 3RVDA 5BQFA 4IOKA 2E5NA 4U02A 5LB4A 4LOJA 4RW0A 2B9SA 5EHGA 4ENKA 5L6MB 5M3FJ 3LX6A 2NN3C 2XIJA 1PTKA 3BXGA 3OQMA 4Q48A 3KQHA 4DCSA 3F8NA 5E4TA 5EINA 3DFMA 2LP4Y 2BGWA 3ND8A 5CEFA 3ZY6A 1RI4A 5HK8A 4PYOA 1WVIA 3COAC 3WWYA 1FZPB 2EFJA 3L93A 4AKEA 2ENUA 2XPUA 5E3NA 1KAQA 4QOFA 2B8JA 2HQAA 5KSYA 4CETA 3F6SA 3PZBA 4DDKA 1O6FA 3CUOA 2CQXA 4B6GA 4M9UA 4MJXA 3E81A 1WLSA 2Q27A 1LSJA 2Q1TA 2ZBDA 3T34A 3BCUA 2H94A 5C4XJ 2CHEA 2RG7A 4MCHA 4BMXA 2Z30A 4QATA 1L4BA 5JLWA 1V1MB 2EFQA 4WK8F 4HS9A 4H2DA 2NO1A 3TAUA 4UQLA 1CR1A 1QBJA 1T8SA 4WW0A 3FIJA 3UMYA 1AKVA 3FM9A 2N46A 3RC2A 4J1QA 3BE8A 3ZJ4A 3SYRA 5J4VA 1O6ZA 4F72A 1ZU5A 4AP5A 5IT3A 3L1KA 1M67A 3NRJA 1Z6TA 2XUQA 2CJXA 1ZDMA 1BCSA 1HDDC 3HKZA 1OPCA 5D4RA 5TVKA 2HR1A 1MB3A 2WVHA 4WJLA 4M3FA 3FDZA 4QOSA 2NVQJ 2M0CA 3HKBB 3MWGA 1N5KA 1XEXA 2IE8A 1WJDA 2G5GX 4R7TA 2JA7J 4J0HA 5EUQB 1GVDA 3IMGA 1XWFA 4QODA 4FNMA 5A04A 1HEIA 1VLVA 4MQ9F 5C7OO 4C0HA 1KWGA 2NT3A 4H16A 4NCKA 2WT4A 4B44A 2AEMA 1U8AA 1YJCA 4ZT5A 3RUFA 2D2VA 4ZU1X 1NY5A 2WWRA 2R6ZA 4EYGA 1QYDA 4IDFA 5G0WA 3P96A 2DI3A 2IRWA 1ZK1A 3U3XA 5BUZA 1SD4A 1THTA 2R7XA 2AG8A 4IRGA 3TMYA 4C0KA 3T5CA 2YX1A 2CEKA 3AEQA 2GD1O 3OQVA 1W2HA 3RSQA 4DEYA 2Z08A 4H17A 1DC8A 4XVQA 1SFUA 4G6ZA 4J7AA 1XZMA 3HJCA 2CYAA 1RRGA 1MMSA 4Z9FA 4Q3OA 1GPDG 5J4YA 3FIWA 3ZNPA 4I8IA 1EQUA 3QA9A 4PSVA 1I3LA 5DF1A 2QSGX 3F1KA 1N32B 2PLAA 3P26A 4ZO7A 4LF4B 4BBRJ 4NNOA 1A76A 1G8AA 3V4SA 2RGVA 1W0JD 1H8EA 2HBRA 3J81K 2FH5B 3V6LA 1ZBQA 3FK6A 3D4IA 3OUTA 3RYFB 1AZSC 2CW7A 5GTHC 4R41A 4RHTA 3GUZA 4QG7A 1W25A 4RCVA 4UW9A 4F7ZA 3PNPA 4WV3A 2GZMA 2YINC 1FPMA 1E2JA 4BX2A 3D6JA 4Y13A 2IHVA 1CEEA 1L7RA 2A9PA 5KQGA 1RXUA 4X7RA 3AUXA 3ZDXB 2VC0A 2PS3A 4F4JA 3MD9A 1FY7A 1C9JA 1P7IA 3CUQB 2TMGA 4D8WA 2HAEA 2NW6A 3FVRA 2B0LA 1RYZA 2C8KA 4AXXA 2FKNA 2XQGA 3UGTA 2H8WA 1W0KA 3X1XA 5EXTA 1EWVA 1XCGB 1Y1KE 3S4YA 1Z6AA 2DKOA 2QMEA 4D81A 2HBQA 2XE7A 3BG9A 1FFYA 5CBPB 1LEHA 1YF3A 1V8ZA 4V39A 1TJ5A 1ON1A 8ATCA 5F9FA 1ODCA 5BV7A 5ITWA 4MVJD 1E7MA 5CVRA 4E6KG 3GG2A 1LI4A 4DUGA 2ZRCA 4BY1J 4N6OA 1Z34A 3O47A 3IEUA 2RGNA 1U9OA 1F4VA 2VR1A 5JAUA 1QYWA 3SEFA 1L4UA 1Z7YA 1P9NA 1XNHA 3AVWA 3TTYA 2WD9A 2H9IA 1HEUA 3GUDA 2ORYA 2ZJ5A 1MBJA 1AGYA 1K75A 5IK2D 2B1GA 2DTEA 3CZ6A 3RF6A 1AE1A 4QC2A 2AHOA 4B3IA 3U7JA 1Q0SA 2HH9A 4X65B 2FP4A 1D0SA 3IT2A 4WLNA 4GGMX 2IVMA 4UEOA 1UPBA 4BTLA 3QW4B 1PKEA 3DLHA 3GEPA 2WJYA 3Q0UA 4DVJA 2HLDA 1KAEA 1SC9A 1STOA 5LQUA 5M5WJ 2VTKA 2J33A 3BERA 2R84A 4XB6B 3GEMA 1VGVA 2IDKA 3RS3A 2J5KA 4ANJA 2QG9A 3LUPA 1T36A 1RMQA 4ESBA 3MJFA 2XHEA 2JLRA 2JRTA 1XV5A 2X85A 4JN6B 4LS3A 5B3LA 2AL7A 4GWLA 1XBTA 1C4OA 4CLXA 3OP1A 1JJ7A 1UQUA 4V1CB 4TV8F 2BCGY 2ZE7A 3EQ7A 3LWFA 5A3RA 4O5VA 4GXTA 3Q7EA 2Z1NA 2WFZA 5BQ3A 3F98A 2EKBA 1PD1A 4EPWA 3HU5A 1BO6A 4DQXA 4S24A 2R11A 3QBJA 1S8FA 1MHTA 1K88A 4NZZA 2DTZA 1EM8B 1KJNA 3ZE6A 2Q8KA 3FR8A 3GHYA 2CG4A 2FJUA 4DMCA 3OP4A 2AHRA 3M6XA 1W88B 5HF5A 1UDRA 1SB8A 1RR8C 3THYA 1G59A 3R9KA 3G2BA 3V7SA 2AHQA 4I1YA 4Q18A 2X1HA 4BB0A 1V16A 4CKEB 1WY7A 4I9NA 3OE4A 3CLRC 5CA0B 4IW3B 4Z1OA 3AEUA 4Q5SF 3PXEA 3UUEA 1V11A 4XEHA 2GZ3A 1A2QA 2EK5A 4LSGA 4I02A 1HSJA 3S8PA 3LKBA 1CUHA 2A1IA 3UFBA 2VP4A 3EULA 2OK7A 3KP5A 2CJFA 4PK4A 1P3DA 1VI5A 4K9QA 2OMEA 1H88C 3CKYA 4BTEA 2QL5A 5EKTA 3QKRB 2R7FA 1JVBA 3A26A 2LWIA 4K26A 2LCQA 4S3MA 1DJOA 2CLMB 3RC3A 5I7HA 2XAUA 4V0ME 3HRSA 4ENJA 4KO3S 3PI7A 3U4AA 4AUMA 4EG6A 4A3GJ 2FUNB 4YMTA 3EVCA 1BVRA 1VQ1A 3PQKA 1PJRA 4EJOA 2JC3A 2XNSA 2LTPA 4WZAE 4HQ6A 5B6IA 1KSFX 1D4AA 3R5SA 4QFDA 5T57A 3QVOA 2FRDA 5JVTA 4M98A 4HV4A 3I30X 2J5XA 1GKLA 4HDOB 4RORA 4ER3A 1HYGA 2H1RA 1BW6A 5H83A 3KOUA 2BI8A 2ZCJA 1N0IA 3JASA 4CJXA 3Q1LA 1SCJA 3A6JA 1P9RA 2P7VB 3QXHA 4YJGB 1KHHA 2QB5A 2DQRA 1W46A 4GLJA 2OHOA 3FBWA 4OKIA 1UDBA 2WJWA 4ZKDA 1UOQA 3C6ZA 2DQSA 4MVXA 4X71A 2ATEA 2FCRA 4ND7A 1ZK8A 3SWWA 3O8HA 3FMPB 1BE0A 4XKWA 1ISHA 2XSZA 2P6UA 4FW8A 1UBFA 3Q11A 5HKKA 2XUKA 3OPNA 3I54A 1UIRA 4L5BA 4PS0A 4JSRA 1J97A 2K2QB 1IEXA 4A9AA 4P5OA 2C42A 3ICVA 2OJED 2OUMA 4AO7A 4QFMA 3MJRA 1X42A 4N76A 1PCXA 3A1YA 3J7YJ 4JL6A 1PBNA 1IAVA 3F5FA 2OV4A 4NV3A 4G7HF 3I9MA 4E3ZA 3BXZA 5FBZA 3O3KA 4E11A 4ZCPA 1NZJA 1QRDA 1YRYE 1Z8DA 5CT6A 5EAIA 2VAWA 2O59A 4I5FA 1ZCFA 1I33A 4LZOA 1A97A 3T5DA 3PHLA 4KWHA 1C1YA 3KZIC 4FQ5A 5DTRA 1CSEE 5MGBA 4Q7MB 4EVIA 2VUTA 3ZEIA 1I7LA 2OT3B 3WYGA 4GFDA 4UXNA 3C2HA 1MG5A 2VDWA 2KIMA 1MTZA 1HE3A 4N8SA 1NLMA 4EJSB 3P4UA 1YRHA 3Q8WA 1EHCA 4AJHA 2HZBA 1ZHHA 4YBZA 5JOQA 5JBNA 4KH1A 3GJYA 2AF3C 5CT8A 1PI3A 1DP7P 2GPYA 1X70A 3PFIA 4HNUA 1MJGA 2DLDA 1JS1X 2BIFA 4CO8A 1IPEA 3H9EO 1DVRA 5HKOA 2PQ6A 3SGLA 3GZJA 3EEOA 2DHEA 3JD3A 1D0XA 1I7NA 4FHTA 2QE7A 3HYSA 4NYMQ 4IM7A 3R0JA 4OOFA 1G4AE 2E85A 1CJVC 1J7JA 3LXXA 1EQAA 5IXYA 2YWCA 3HLKA 3R61A 3RFXA 3A6KA 3HJFA 2RSLA 3NNDA 3NTQA 3LC7O 1XNJA 5AI6A 2FW7A 4HKTA 4L4XA 1JTEA 1KQFA 1A69A 1F6BA 1E8MA 4QYXA 2I62A 1PT6A 3BWYA 1LB2A 2RMKA 1PR2A 2O2XA 1OTYA 3OEEA 2ZR9A 3M3PA 1E5LA 1LC3A 3GBSA 3IRUA 4QXAA 3BGVA 4Z4QA 2QX7A 3GB9A 1QQ5A 4FOPA 4DS3A 5K0NA 4UUSB 2VP5A 3W8EA 5LUAA 2WZQA 1DJMA 5D3MA 3EDPA 5HGXA 4RPJA 5EWJA 3HB9A 3FUTA 4U6SA 5JNSA 2CXSA 2WG2A 3DVAA 1EK1A 5T4FA 1E94E 4N0MA 4Z7JA 3U6KA 3B38A 4FCTA 2ZSHB 4RAQA 1FDTA 1NMQA 3K94A 2OO5A 1HCRA 4ND2A 4RL6A 3S5UA 4YRSA 2OP1A 4PZAA 3VPHA 5JYBA 4AS3A 3WG7H 2D00A 3KDSE 5ALTA 4UHBA 1WMEA 1SUAA 1JIQA 1JLHA 4ZGWA 1HOTA 4UHDA 2WWTA 3ANNA 1HQYE 3WDMA 4QELA 2IZOA 4C01A 4LGCA 1ZYUA 3CCEI 4RK7A 1CS0B 1Z73A 3MBKA 3KSRA 4YJKA 5I3ZA 2YN2A 4L27A 1IOLA 3OEHA 3LSJA 5G02A 4MW4A 5C35A 2PBIA 1EXVA 3U4MA 4XGRA 2QTMA 2W2LD 2X7XA 3IR5A 4PHTA 1U3DA 1E3SA 2OBBA 4B6EA 1A1VA 5K0ZA 3GFSA 4JLUA 1EIZA 4TTVA 3ZV6A 3H13A 2GAIA 2PBFA 1QE5A 4WECA 1EFTA 1ZUNA 1C9EA 3L6OO 5TQ0A 1PYGA 3OIFA 2F5EA 5PNTA 4M54A 1JPUA 1HSTA 4D3SA 3WFJA 1UXJA 4CMEC 1N5MA 2JLSA 4RMJA 2ILVA 3ZTWA 5LP6C 3D3JA 2VI5A 1DUXC 3JPYA 4MLOA 2PKYX 2V4JC 3RK4A 4F5WA 4KREA 2CUJA 3PL8A 1TRKA 4XSHA 3BGIA 3ETHA 4IILA 3M4XA 1L7XA 2VOJA 2CU7A 4G12A 3GMIA 5LA6F 4PZDA 4NOMA 4KAAA 4PLCA 2OV8A 1L0OC 2FUEA 3ZHZA 3KOOA 2G04A 5AKIA 3ZHSA 1VE5A 4MVJG 2Q49A 4M8LA 4GYKA 4F85A 1BJAA 4MYHA 5M3MJ 1Z9BA 3DB2A 3ETJA 1APLC 4DQKA 2WEKA 4HLXA 1R8JA 2VFAA 1XZNA 2WILA 2WIKA 3RYRA 1W35A 3WQRA 2HDHA 2EX0A 3DW3X 3UEOA 4ZYUA 4BBPA 3N6RA 5AFSA 2XPCA 2VXCA 2RD2A 3FMFA 4YJ3B 3NAMA 3GJ6A 5GINE 2XMCA 1OI4A 1I6KA 1KJIA 4DDHA 4IDPA 2ZO4A 2P4QA 4WEQA 3MYYA 5D8LB 3C3JA 1L5KA 2VNHA 3ZWXA 4GGGA 5M5YJ 1TM3E 1K78B 1TADA 3BQNB 5IH3A 1D1PA 4O33A 2NU6A 1Y7PA 4M3GA 1MT0A 6NULA 2VBFA 1EGVB 3STVA 4KMMA 4IIXA 4PNPA 1G4UR 3ISTA 1U8CB 3DAOA 4KN7X 5D5XB 2WM8A 1V1RA 2PMFA 5IM4F 4OMYA 3DF8A 1N4DA 1W30A 1SOAA 2XEDA 1S7OA 1R58A 2JFVA 2HMSA 1JFRA 2WWYA 3MJEA 1XSEA 3HKCB 2JCSA 1F5NA 1RJEA 4AJ9A 2ZANA 3U60B 2QLFA 3HEAA 2X3FA 4BQNA 4EBFA 1IN7A 5GONB 1A35A 2EFOA 2R7ZJ 3FCYA 3U80A 2F5VA 1AC5A 3CPEA 4OTZA 4F9GA 5FKOA 5D5PA 1D8AA 1MRNA 2XWQA 4MTLA 3MXTA 1CR0A 3IXLA 2WB4A 3IP4B 3BK2A 2IS6A 1KYIA 1RPZA 4S1TA 3AAFA 3P9RA 1T2UA 3EAGA 3I23A 4ZCMA 3FHCB 2J7PD 2VK8A 3ZCVA 4KLRA 5TMBA 4QTTB 2B7EA 4LFAB 5J6XA 4A0ZA 3E5XA 5J63A 4LSZA 4RTLA 4XONA 1XGMA 1W73A 1K9VF 1NHWA 2RGCA 3DAFA 1G3RA 3KAJA 2L42A 4PYIA 4K2AA 4PN7A 2ZNYA 1KIFA 3CLSC 4UNQA 3HL2A 2HQBA 4WKBA 4AULA 1XYVA 3PC8A 4KMOA 3SICE 1WHSA 1DOHA 4REQB 2EDAA 1ONPA 2F9FA 1WPXA 3CDIA 4ANFA 5C5EA 1T0HB 3SN6A 5JQWA 4P80A 1U7TA 2W4SA 3W6ZA 4A6XA 2PJUA 2PUEA 3U1VA 3T35A 4ZT7A 3AHFA 2VAMA 1CFZA 3SF8A 3U0BA 4NMLA 1D4OA 5B1EA 2E60A 3E2IA 4WCVA 4HW0A 3LIIA 2F1KA 4UVCA 1JU9A 4CMIB 2G4CA 1ZUWA 1IN6A 1VCHA 2O0KA 4G24A 4I6EA 2XGEA 1K7EB 3OUUA 1SULA 3HH8A 2MSKA 5DGDA 1USVA 3NEPX 2D5CA 2JBAB 2AOTA 2OM6A 3H6HA 4PPFA 1LPNA 1CF2O 4WK6A 3KOMA 2Y9PB 1ZCZA 3P9KA 4GH5A 3DNMA 1D9ZA 4FXOA 2HK6A 4RD2A 2ZNZA 4MJ3A 1ZM9A 4ON9A 1OVGA 1VMIA 5H02A 2WV1A 1N25A 3V1LA 4E33A 1NXVA 2V6CA 4S0XA 3UG7A 2G80A 1U99A 1TQHA 4KFCA 1PYVA 4DJJA 2IV7A 1RC1A 5J40A 3C7DB 5F2EA 1HYBA 5J58A 4BFVA 3DE0X 1JZQA 3FDZB 2CWWA 2G07A 4KAJA 1P2BA 1XEXB 3SI7A 4LTMA 3OFJA 1UAGA 4GOJA 3K6SA 3QVXA 4A5MA 1ZCBA 4JLWA 2DQZA 1T0FC 1OTXA 3AMVA 2I8DA 3A0BC 2BFPA 4IIFA 4NULA 1A98A 2W7TA 3WGZA 5FFXA 4Y18A 1KAMA 3IERA 3L8HA 4C76A 2R7RA 2R5WA 4JLKA 1HDOA 2XKOA 5GOTA 4CODB 3K4NA 3RIGA 3U0VA 3OOJA 5EP1A 1V6SA 3CF6R 2VKQA 2SCUB 3ROXA 3TLYA 4B3CA 2NACA 3EXEA 5AW7A 3LK7A 1VKZA 5IP7J 3L7BA 2E4UA 3R7WA 1I1HA 2DKFA 3T9BA 4QLCU 4Q4DA 3F8MA 1IW7F 3MTEA 1E3EA 5E4JA 1TJ3A 3CZMA 3HGQA 4DW6A 5J5VA 4L0ZB 4YQZA 3FTNA 4FDAA 5YASA 1NW6A 3O75A 2Q2EA 2MINA 3GGJA 1HM5A 2I3ZA 5KOYA 2VYVD 3M8KA 1GGJA 2KE5A 3HUGB 4EPTA 2N3ZA 2ERXA 4MQLA 3MSXA 2IJLA 2NWQA 2H2HA 1E9RA 5JCJD 4F97A 2A6PA 4WOCA 2AZDA 1B00A 4YMUA 2ICWG 4XYBA 4J9VA 1ORRA 4WH0A 3T8TA 3AHGA 1JGTA 2HTFA 1EUYA 3Q9LA 5CTJA 3ABSB 1LJ9A 1IXSB 3PQJA 2VUSA 4K9DA 1JKJB 1L4HA 4HMQA 3MGBA 3TSYA 1KYWA 4CEHA 3SSNA 4RJIA 2TRTA 3H2HA 3WKEA 1Y3FE 4FXPA 1JGSA 1QA6A 2XNDA 5FLMJ 1OVMA 1YFLA 2V58A 3PEYA 1UKZA 4N0QA 4F86A 1N6OA 5H3CA 3II6X 3K30A 1MSFC 1N92A 4Q4HA 4JBWA 2A58A 1J8MF 1ZL2A 4Q05A 4XOPA 3LDUA 2OO3A 2ONKA 2QV7A 5LQAA 3CCQI 4MW2A 3IQWA 2NVUA 4BB6A 4KMRA 4X6UA 1KPIA 1LNSA 3L0BA 5BSWA 4QBTA 3BMNA 4GCVA 1XDSA 4RABA 2HJGA 2X9QA 3EWSA 4DDWA 2QUKA 1U1CA 4G25A 5ALYA 4KP7A 5JFGA 4TLAA 3S3NA 1E6CA 1NMXA 2M4KA 1SHKA 5EZQA 2Z9DA 2ACJA 3TDMA 1DG3A 3QITA 1LWOA 4HVLA 3LO5A 1V5FA 4BQQA 4W6ZA 2HHLA 3FROA 1IUFA 2IZ0A 3HCRA 4MLCA 4YRCA 1T9DA 3KKNA 2C6YA 4E7ZA 4MUFA 3K4PA 1YS1X 5EZYF 3VAAA 4NUBA 3OX4A 4NQZA 2FP4B 1KC1A 4N7JA 1COWD 1VMDA 5LD2C 4LE0A 2HA4A 1ZQ9A 4R8RA 1H1DA 3ZI0A 3OZXA 5KU7A 1R36A 3VHXA 2GJAA 4YXWA 3COPA 2O2ZA 2MYSA 2IS1A 3VNRA 2LY9A 3FDYA 5HF8A 3ZE0B 3TLKA 4B31A 1YWGO 3I37X 2F43A 3QPTA 4XYEA 1W96A 1RHUA 5JLXA 4PFJA 4FHEA 4D92A 2F4VB 3P0RA 4HAWA 4IO9F 4PXYA 4TQUS 4PQYA 4HB4A 4MGEA 2RFLA 1TKBA 1ETKA 1NBAA 4D0SA 3KFXA 4B79A 3AJ8A 2HS5A 4P84A 4GO1A 4K6GA 1G291 2BUBA 3GVHA 4E7HA 3HM5A 5DN6A 3OBIA 3PNBA 4DSOA 3HNOA 3COYA 4JP5A 2R7SA 1JUMA 1GFWA 1E96A 1T34A 1E2DA 3GZ6A 2UZ1B 5E18F 3NUGA 4RZSA 1VPWA 5JAIA 4DNCA 5FKLA 4FYHA 1R9TJ 3FPJA 1OFVA 5EVJA 2QQGA 3ZCTA 3THYB 1E77A 2V98A 3JQDA 1LBHA 3IR6A 1GNRA 1HGXA 1N0UA 1YS9A 3R6WA 1DAHA 2YWFA 1WNTA 1SVMA 2AN4A 1H9AA 2OZVA 4BLPA 4HSGA 5KHDA 3KQPA 2IA0A 1BHQ1 1OA1A 3ABZA 3C14C 4LOIA 1DG9A 4Q15A 5DV5A 4Y2YA 3BPXA 3KE8A 3CUEF 5JRDS 1ILEA 3MYRA 2AWOA 5EG0B 4RA2A 1NG7A 4ZZDA 3UYKA 4YHBA 2L9NA 3ZOBA 1LBEA 2QY9A 1LNWA 1FB5A 4NU0A 1W1UA 4RH0A 5J1RA 2ZJ3A 4ZOAA 1FLNA 3S1AB 2DUWA 1F1JA 1ELOA 5F5NA 1R37A 2PYZA 5E2AA 2AEEA 2JEZA 1VSBA 2FFQA 3N59A 3L0CA 2BM9A 3S2YA 4IQ4A 1FYFA 4QUGA 2VP9A 3GLSA 4A12A 3D5LA 3Q7QA 2G1UA 4C07A 2LR0A 4PFKA 1P31A 3E84A 3GT7A