4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQNA 4BQOA
chains in the Genus database with same CATH superfamily
1P72A 3M33A 4MJ7A 5LD2C 4ENMA 2D5AA 3QAHA 5IJWA 5TRTA 1LDKB 1T95A 1W5TA 4I0AA 1Q95A 1T35A 4E22A 4XIFA 3IPXA 1B4AA 4INAA 4PCLA 1J42A 1RRKA 4OWRB 5H6QA 4B1RA 2X9QA 2AEJA 1P3JA 1XQWA 2I2BA 3ND9A 3G9QA 4TKZA 1GGNA 4O4LF 4GM4A 4Y1GA 2BMVA 5DBFA 4A26A 3ZN1A 5KAFC 3KR2A 3OOUA 4ESBA 1HSOA 2CUEA 1RHQA 2AOUB 2HRCA 1XIVA 1NZFA 2L19A 2H09A 2CSOA 3GR6A 3P5SA 4W1QA 4ZVSA 4AWBA 2AOXA 1BU8A 4KN6A 4Y33A 2JRLA 5J5CA 1CJBA 3G4SI 3KWLA 2YX7A 1AC5A 4NENA 1X80A 4WKPA 4G86A 2VDVE 4MUGA 4E15A 1CTQA 1ZD2P 1TI7A 2NV6A 3HG9A 2VSXA 3KR1A 4D6PA 2FKNA 4BBJA 2IP4A 4IDAA 4KLCA 4KQ9A 4PFJA 3HB0A 1JR3D 5ECDA 5AIQA 3T5CA 2KMUA 2BFNA 3DMNA 2VT2A 5EHNA 3WLLA 4C06A 4D82A 5JSHA 3MD9A 5IBCA 2R1VB 4DQ2A 1O4VA 1OGJA 2JATA 3S3OA 2ORED 2ZJ0A 2HJWA 1OA0A 2G5GX 5LUBA 3RS5A 5E9JA 3ZCSA 1R5OA 3IULA 5C8XA 5LM3A 3UV3A 4PAGA 4MRMB 5FWYB 1G6NA 2I6QA 5JCZA 4I9FA 1R0ZA 1OCRH 5D8DA 2IC5A 5BPHA 1Z6ZA 4BB9A 4FE7A 3UH0A 5JNLA 4BP8A 5ETJA 3RRBA 1W0TA 4HNVA 4XQFA 1USKA 3CG4A 2JHFA 3SICE 1SU8A 4L51A 2YWDA 1M2GA 3WJ2A 4F04A 1A2QA 1P39A 2FPIA 4Y6RA 3VU0A 1TIBA 4BJ6A 2DAPA 3RASA 3D0QA 5EGOA 2QAGA 3KYDA 4FKZA 3WK4A 3ZNOA 2C2OA 4EO4A 2WU0A 4NPCA 3ILVA 3JY6A 4YV1A 3CMCO 5JHUA 1FF9A 1K27A 2I3BA 2RJNA 3BFXA 2DFVA 2HKIA 3BMNB 3OEED 1ZYUA 4XJXA 2GN0A 4RQAA 3NM5A 4U7BA 5I51A 3D4LA 3W3ZB 5K8VA 2W58A 1BWRA 3TO6A 4F60A 5CVJA 1F2UA 2FLVA 4FOSA 4LHEA 4JQSA 4PQFA 5BWLA 4B4VA 2UWMA 1TCUA 4L2IA 3QLUC 5CXSA 3ZMVA 4E7KA 2QV0A 4ZA2A 1KE1A 4LFBB 1OGIA 4C08A 1CUBA 1P9WA 1YT5A 3D3NA 3C5WP 3EPJA 1TWFJ 3CZAA 3M6IA 4QLOA 3HPHA 1FLIA 2XUPA 3MRTA 2OTJI 1G5RA 4YRLA 3AF6A 1JX6A 3EX7C 3IUEA 4EKIA 4LGCA 2UZ0A 3NHYA 3OF3A 3CNHA 4TWBA 2YX4A 1KA9H 3X1JA 4B4DA 3F1KA 4MIEA 1OFHA 3CUWA 3RKUA 4EYGA 4NSNA 3WNZA 3GFPA 2HQ1A 1E61A 1Y3AA 3FWNA 2JI8A 4ESEA 4OXKA 1SUFA 3D8RA 3N0RA 2VN8A 3KDPA 1Z2EA 2EARA 1RM3A 2GIZA 5CTJA 4TS1A 5DU2A 5DNAA 3O2NA 4KWEA 2GKSA 1NBMA 3N6VA 3BORA 3SJUA 1Q3KA 1SBCA 4RZHA 1LC0A 4P3YA 2OBPA 4WA8A 2PN1A 2WSSA 4FDTA 1KQNA 2NZVG 4W7HA 2WYOA 3ZDCA 3REGA 2XNKA 1KIAA 3L07A 1VI2A 1Z2CA 3R7DA 1WGXA 1L8XA 4HXYA 3P9PA 2EGHA 4L5IA 3QP5A 3JYPA 2P41A 4UV9A 2I55A 2QX8A 2GIVA 1VC2A 5EIOA 5FTWA 3HI6A 3RJMA 3DP7A 2EQBA 3OIFA 3UV6A 4JLVA 1W0KA 2GN4A 4RFVA 4WY2A 4MPRA 3MNFA 4OPMA 3G5AA 4A8JB 2BUBA 3VSLA 4J91A 4TN1A 4MW5A 5EXSA 4RACA 2HVQA 5JCOA 1EH6A 1MOSA 1ELOA 1L5OA 2FOLA 3AAFA 2R7NA 3QE0A 4BYGA 2GCIA 4CF6A 4AJ2A 1OBHA 1WEHA 4FFOA 1SXGA 3AKDA 4DCMA 4QGGA 3RS0A 2EYUA 3MWMA 4WCFA 1BA3A 2YCBA 4UTZA 3ZE8A 2WTXA 3PXEA 1AO0A 4FT4A 3T1TA 1K63A 4O8ZA 4KIWA 3WK8A 5FXMA 3OZFA 5JI6A 3T38A 4G1FA 3QWLA 2GT1A 5B1BH 3D6JA 2VASA 1FSHA 5C4JJ 3OWOA 5FCDA 2CNWD 3R3XA 4HMPA 4O2RA 3VOTA 3GCXA 4JLOA 1EAMA 2YXDA 4AKTA 2XB6A 1NR7A 4IDGA 2JFOA 3BH0A 2J3HA 3GY0A 3REQA 4MDEA 3CMAI 5CDFA 3NC0C 3L1IA 1B76A 5E1OA 1ETKA 3DOFA 5TGDA 2Q9BA 3LP8A 5G0WA 3JTHA 5HG0A 1O57A 3SHWA 1C7EA 5FL7A 4CLHA 2UVPA 1QQBA 2OXIA 1YTUA 3OIDA 2CZGA 4NRDA 4ZEOA 1SZPA 2ZYVX 2YKGA 5ICCA 1SMYF 3K8ZA 3RRFA 1ZHHA 1NT4A 1K68A 3OE5A 4JL6A 1PTJA 1USWA 2J9YB 3CLUC 3CLHA 4NDZA 1L1RA 4XLCA 4RW0A 4XH9B 5KKCA 3T5PA 4GKKB 3FJOA 1WTAA 2DWCA 1U2PA 2BFPA 1BVRA 1E3EA 2IITA 3LECA 2JPCA 2IRWA 4N7MA 3UJPA 4H6WA 1T5BA 4WJKB 3WE7A 2NXWA 1WUJS 1NXWA 2VF8A 3MMSA 5UKDA 3U60B 5CT8A 2ZMEB 2JFQA 3ELYA 4JOQA 4Y2VA 5HF6A 1O9BA 5C1BA 3L9FA 1GIAA 1VMIA 2PKCA 1Z91A 2DW4A 3C3MA 3PU6A 5DD4A 3DBLA 3K0BA 2Z5FA 1H3FA 5L53A 2EQAA 2FRDA 2ISYA 2VNHA 3D3JA 4M86A 5DNWA 1LTKA 2MYTA 3V1LA 3JARA 4AUEA 4MQ6A 3KE9A 4CL0A 5HF5A 5LQNA 4FFWA 4RB1A 1PGPA 2JZYA 3GJTA 5HILA 2F9FA 3HGQA 5MN6A 1ECJA 1CF7B 2QQBA 1C8KA 1ODIA 3OG9A 3R9IA 1XXLA 4BKOA 4KXXA 3NMUF 2XJ4A 3VPDA 1GVHA 1RYEA 1Z2DA 4U87A 1XQ9A 2AQHA 4LYYA 3AB3A 1N2XA 5EMLA 1KQOA 1YBAA 4EJVA 2V6CA 3OX3A 4TMKA 2F4IA 1E77A 3K1JA 3LWZA 2FOXA 1UKZA 1J00A 4KYIB 1TEVA 3M8KA 2E5NA 1SHLA 4WECA 4RE5A 1P9OA 3QX7A 4M22A 1G8FA 1UPXA 3VRHA 3FETA 2HMVA 1CRLA 1KNQA 1U28C 2EIMH 3WTTC 3R6TA 1UHMA 5GAHJ 1W1UA 5E3NA 1HFEL 2R25B 3EGXA 3O3CA 3E82A 3RC7A 821PA 1F0PA 4B85A 2XF8A 3R75A 4ZJPA 3MPUA 2ZYSA 4M7WA 2MH2A 5AW8A 2RGBA 1XELA 4QEZA 5D3MA 4EGFA 1OLTA 1JIUA 4AJIA 3WLJA 4F4HA 1K78A 1QHYA 4B0OA 5E79C 2CF5A 3UMMA 3ETHA 2R2GA 4M6YA 2RI1A 3R8XA 3HCOA 2RGVA 3G0CA 4ZO6A 2VF5X 1FL9A 4MX8A 4ASNA 3QUTA 1HF3A 2Z3YA 1S2NA 1X1CA 4DJJA 1UDCA 3QHPA 1U1EA 2K2QB 1YS1X 2NNWB 3EVGA 3GBVA 5JT1A 1BVHA 1ESZA 2V9KA 3BXGA 4R6XA 3RT7A 3UFXB 3B6EA 2YBEA 1OCPA 1B6AA 1RVV1 2GXUA 3S2YA 2P79A 4Q1VA 5CURA 3TMYA 1O6CA 3GJQA 1HLPA 1F4PA 1WXQA 2LCIA 4IW3B 4YJGB 4HUTA 1ZL2A 2ZWMA 2B9VA 2JHCA 2RGWA 1M1EB 1RMQA 3EXIA 3GOHA 3GYGA 2UZ4A 3KP5A 1PTJC 1MH1A 1RIFA 1TRKA 3H3XA 4QBGB 5J2TB 4IRGA 1QVVA 2ONYA 4HNUA 4K46A 1Z33A 1DUSA 1GDHA 2Q4OA 3OJXA 4H60A 1YF3A 1N1MA 2FG7C 4F84A 2P7IA 3HADA 3HEAA 4HXEB 4OL0A 3VYUB 3BGIA 3RVLA 1LFBA 2IUYA 2B63J 2AJTA 4ZHQF 5DHRA 1S4QA 2Y6UA 4HEJA 3NJ8A 4ND7A 1A1VA 1AO3A 2RHTA 2DTZA 1G3SA 4QG3A 4KO4S 2OHHA 1NQUA 2F1RA 2ZC2A 4JNKA 2BD0A 2GPSA 3MCTA 2H2FA 1Z67A 3NBYC 2MTBA 4MCJA 4EQ6B 5FOQA 3Q0TA 3ADOA 4XBFA 1YVRA 2DA4A 2F6CA 3DR3A 5JANA 3GBPA 4BO8A 5JPIA 2L0KA 2PAFA 4PFOA 4CM3A 1AUVA 1OFTA 1ZIYA 3MSCA 5CDGA 3U17A 1N9GA 2Q4EA 5AVSA 1J49A 3EVBA 2R7TA 5K3SA 1PZMA 4MYUA 4BAZA 5JSZB 2Q3MA 4ZDOA 1O8CA 4PLGA 5FP0A 4ENJA 3A1FA 4JVMA 4V0RA 3U4DA 1CR6A 2BM0A 4PYLA 3OEHA 4MLCA 1K9SA 2FR0A 2VXOA 5A4FS 1HE8B 4UVDA 4EEXA 3EH2A 3J80Z 3FTNA 4UATA 3IP6A 2JGAA 1R3DA 1T8WA 3OE7D 1A8UA 4ITUA 1QYRA 5JCJA 3DLCA 1F6DA 1R88A 1NBOA 5E95A 4RPGA 2DAOA 3HYIA 4JUIA 4WESB 2VJOA 2X8AA 4E08A 2ATVA 1PE0A 3IOMA 3MD0A 3WTXC 4C4TA 1LBSA 5HKOA 3PIRA 2UU9B 3TQFA 2X5OA 2PMDA 2PUHA 4UM5A 5DEIA 4NCAA 3SFVA 4LDZA 1OTYA 2ACJA 3M5PA 3CLOA 5IVKA 5U1PA 3QBEA 2Y66A 2VTBB 3IPLA 4ERNA 4WDRA 2R85A 2ZI6A 2RHGB 3BT9A 1Z39A 1ZSYA 2Z30A 3G3ZA 2KDZA 3FTCA 3N53A 2V4JC 1QIKA 2FPPA 5IX8A 2F4MB 4YAOA 4XGQA 3HKBA 1ML3A 1T1JA 4ESFA 1ODJA 2V6GA 2X9NA 1SIBE 1UC5B 2L2OA 2MYPA 3O94A 3OOWA 4N82A 4TMFA 3TW8B 1II8A 3WMEA 2PSJA 5GOTA 3OMLA 1PG0A 2YR0A 4RHTA 5BUSA 2CVHA 2XB2A 4ONEA 2W2VA 4WLFA 1WXGA 3PSHA 4A3FJ 3OR1C 1XC5A 2IPNA 2PRJA 2D5IA 2AJLI 1LX7A 1Q6ZA 2BOVA 4KPUA 3AFMA 4M1WA 4K6CA 5DYGA 5ERXA 4Y7DA 2PV0A 4CYMA 3WYFA 1QK4A 1Z0FA 4W63A 4DLUA 2ZUBA 3GJ0A 4U2FA 3JREA 5JXIA 1S7CA 3TOSA 4BDZA 4YB8A 2DUWA 3TTSA 5ABPA 4LE0A 3BWEA 2Z6AA 4P3NA 3V9AA 3E22A 1NWHA 1XD9A 5IK2A 5BQPA 1PK8A 2PX9A 3DCIA 3DV0B 1NYLA 2G1AA 2VJ4A 2IXBA 5GOZA 2XAFA 4EA9A 4GBED 1YBVA 4LRYA 4XGRA 3PC4A 3WKDA 4P9FA 5GJBA 5AOAA 1S7OA 1P5HA 2W6MA 5CJPA 2ZTHA 4LG0B 2ENWA 4I5GA 5BT8A 5LZ9A 4DMLA 2YW2A 1YGYA 1F6BA 2W6CX 4MUIA 1E2QA 4URFA 3TW8A 3ZWVA 2CMGA 3A36A 1G20B 1PWHA 2IIPA 4YT4A 1YGPA 1SCKA 2C31A 4AM3A 3RAFC 4EATA 1B8PA 1HL7A 2JFHA 5JUWA 2OY0A 1QONA 1IHYA 3EG9B 3LT0A 4HTFA 1XVLA 5JH7A 1QVAA 4N6GA 5BMOA 4LVOA 2I33A 2JLVA 1I5RA 3E6CC 2XWSA 4B4WA 1Y3HA 2C8VA 3W04A 1KY3A 1KA8A 1MR3F 3PNSA 3VR1A 4ZHQA 5FNZA 3RU3A 5EQDA 1MC4A 3ZJ5A 4JY7A 1PWYE 4OOFA 5JWOA 1YHQI 4NBQA 3I59B 3EZYA 1Z62A 3DCYA 5ADVA 5KC8A 1NM5C 4MYCA 4LXHA 1JA1A 4HEA6 2R7OA 2BCJQ 4YRJA 2XR1A 2VBIA 1E6UA 1LZKA 5CYOA 3T5XA 1TK9A 2X13A 2ZI3A 4NB5A 3HHEA 4OXRA 1ZGZA 4PJJA 4J2TA 4RY8A 5BOVA 4BNIA 5J58A 4RTOA 1CNEA 1SHKA 2D4AA 5K8UA 4C4OA 4XK4A 2B7BA 2J0UB 4WBXC 4D42A 3PFFA 1SRQA 4YEJA 1NNUA 4A2CA 1NF8A 3SZRA 2H2HA 4DIUA 1W2GA 3T7EA 2YICA 5AKYA 1KU2A 3M1YA 4BLOA 1P4WA 1IVYA 4XRSG 2CJPA 3GJ6A 4EJMA 3PX2A 2LG4A 3LFKA 3AIOA 4NG4A 5T8KA 2W7TA 3BA6A 4M49A 5BSMA 1Y1SA 1T25A 3PL8A 2G9QA 3GGCA 4LI0A 5FBVB 2MCFA 1D1CA 4WTOA 3DLAA 2CNDA 5FLXK 4S0XA 4I46A 1S3FA 1RI7A 3HB7A 1MDMB 2CQXA 1L5WA 3CLRC 4Q4HB 4YNBA 5LC1A 2Y4NA 1E0JA 3I01A 4AAYA 4CL2A 1G2HA 4OHOA 4P08A 5L3VA 5JJLA 4RQTA 3AI2A 1ISPA 3ICWA 4XZ3A 2QRGA 2QRVB 3VR3A 4ER6A 1QP0A 1FTGA 1RWOA 4MROA 3KB2A 3KVOA 4MI6A 5I5GA 3WIOA 4XWOA 1LNSA 2W42A 3BJ6A 4NHJA 1SBQA 3GFRA 3T7AA 1E2IA 1JTFA 4BMCA 1Y6JA 1XNHA 3SFIA 3WE2A 2P7CB 4QPOA 2JDID 1ARZA 1HK7A 2G71A 4QNRA 3L4SO 3GXBA 4WD3A 5JO9A 3TBFA 4BV8A 4YAGA 2G1KA 2E82A 1OE0A 2YRFA 1RI3A 2BUAA 4RL6A 1QHEA 3EZ2A 4HLXA 1FSZA 1ZH0A 2QZ9A 3FSGA 3QIVA 3BL5A 4Y2UA 1ID8A 3TVDA 2H8GA 3ESQA 1DMRA 3PHIA 4IMRA 2WVAA 1IUFA 2Q2VA 2I62A 3FGPA 2NU7A 3CCUI 1D1PA 1F8FA 1QE0A 4HQNA 4RENA 3KJZA 1WHSB 4UKDA 2C94A 1ZICA 3DFIA 1JIKA 1TMGE 2V5AA 3PC6A 3FX2A 2FEWB 3QUAA 4Q02A 3MTGA 1JUMA 1P31A 4RB0A 1OI7A 3FFAA 3T0IA 1GPH1 2OYSA 3K6KA 2CVQA 3O47A 1IYZA 4MWCA 3V8KA 4QQNA 1U5TB 5I7AA 2C98A 3QFCA 3LLCA 2O59A 2NVBA 1XPJA 3OICA 1ST2A 4PG8A 3HXOA 4ZZIA 2A68F 3BRWD 1CJUC 3FHJA 4OSOA 3VZPA 1BMFD 3WGMA 3ZV5A 2HLNA 3VO1A 1SIWA 4EOGA 1XDSA 3F5SA 1JSZA 1BU5A 1BR1A 4HS9A 3PK0A 4CQMA 4JYZA 1AXRA 4J9UE 4BX3A 2OGSA 1QV9A 1A5ZA 3TBHA 3TQNA 1KK3A 5IF3A 1LS6A 2NZJA 4FOLA 3UH1A 3GFLA 2IVFA 1UK7A 4GYJA 3AR8A 2XNCA 3HO1A 2ZDGA 3QHQA 5ECWA 1ODTC 2HYIC 1PYVA 1DEOA 4TZKA 3EDPA 3PKIA 1Q83A 3M89A 1E1QA 3Q2KA 4HN2A 4LFAB 1HMYA 3FPGA 5A9RA 1YR9A 1BIBA 1K7AA 1X1DA 1JLMA 4GUAA 3UA3A 3CRZA 4MV1A 4Q3OA 3TDMA 4KDRA 2FU4A 3X1KA 1JR3A 2MHCA 1U3FA 2WM3A 1AKMA 2C9OA 4DADA 3TRKA 3S4YA 1G8AA 3K0FB 1U9JA 4Q1DA 1Z6PA 3X1WA 3WJAA 4RULA 5JOQA 1BYUA 1POXA 5E8IA 1OZAA 4ER3A 2ONJA 3ISTA 2OWEA 3K8QA 1WB9A 3ZQ7A 2Z1DA 2R7SA 1SUIA 3GD5A 4FFPA 1DGQA 4UMDA 2H1IA 1E2XA 1J2YA 2K5UA 5DV5A 4KOEC 4CI9A 3NIFB 3RSCA 2DB3A 2A7QA 5A5DA 1PVOA 5EVCA 4J90A 1HE3A 2HPMA 1QCYA 3AR5A 1L5KA 3MWDB 1W7PB 3DMDA 3LK6A 3LQRA 2GQQA 2PMZA 3FKJA 3IUOA 4RGSA 1RLJA 1TB4A 2AZTA 2FUG2 4CUGA 2XEXA 1ZR4A 2QZZA 3K1YA 2C84A 3NXKA 1U0HC 5EE3A 4K9DA 5EXXA 5BMVB 1V8PA 4P96A 4L3VA 1BMFA 2PTGA 1ANKA 5B1IA 4I14A 3ZU6A 4OK3A 3HP7A 3OYDA 2J8ZA 4FYVA 4KXLA 5MFPA 2AN5A 5M29A 3DB1A 3DVLA 3JVEA 2OBMA 2WJ6A 1H9BA 3INRA 1QHIA 3EBOA 4G6DA 3GUDA 1ENPA 5LHHA 3E5MA 3QEMB 2ZU6A 1AV7A 4NYIR 2NP7A 3DFZA 5B53A 4P86A 1P3Y1 1NKVA 4UXIA 1Q84A 2WZQA 1BVYF 3OWXA 4IIFA 5C4XJ 3RDPA 3M83A 1EIZA 1VOTA 2Q4RA 4MVJA 3OMWA 3T8TA 1QG4A 1WCXA 4JN6B 3J7ZI 1RYMA 1NT2A 1HNNA 3LPAA 2YIMA 4H7IA 1KO4A 3FSGD 4XQ9A 3V6LA 4D3YA 1E3JA 5TS3A 4Q5IA 4YP0A 1GZ4A 1PEYA 3HNRA 5FUVA 3OPMA 5CG2A 2KRFA 2R1TA 2QSZA 3RYCB 1P2SA 4KQHA 3RRJA 3TPFA 5CFPA 3ZIUA 5A5VA 3LFTA 2EZUA 1W9HA 1F20A 3BTUA 3EDYA 4NTZA 4CCWA 1FZPB 3DDWA 4JQCA 4YH1A 2FNAA 4JLAA 3MHTA 3IHUA 4MDFA 3TLKA 1BEZA 1SZCA 4F9EA 3DF8A 5I8PA 5IUNC 3L8ZA 3ZQFA 4CU5A 3BMNA 3BHJA 2E89A 1D04A 2HA4A 3U4GA 4PS0A 1BA2A 3UMFA 1QOQB 1WW3A 2P5TB 1PJZA 4URXR 3HL4A 5IJ9B 4DC0A 4FB5A 2FAXA 2WWYA 1VMAA 2WC2A 3K9NA 4O2BB 2XCSB 4HLCA 1YZGA 4UNQA 4XVHA 5HJ7A 1E0AA 1BDMA 3WNDA 3L2OB 3IEMA 1IO2A 4EGQA 3CZCA 4DABA 5HDKA 4U7HA 1XDUA 3CO6C 4XKBA 3DEZA 4D5GA 2YINC 5FD5A 3LPMA 2BEVB 3V8QA 3CD6I 3LA6A 3S2ZA 1PD1A 2NYRA 1R6UA 2RHOA 4IFEA 1XRRA 3QM1A 1HOMA 5TEWA 2CUFA 1K3FA 3A05A 5CDHA 4MUAA 4E46A 1DXOA 3CJTA 2W9XA 4G7ZF 3BDDA 2ACVA 4EA6A 4EYQA 4PPGA 2K4BA 2FPGB 2XNJA 3IMFA 2FWAA 3KKMA 4NCHA 2VRBA 2Z2YA 2Q0OA 4J16A 1IJBA 1FXUA 2QYHA 5H1YA 3TH5A 1DINA 4NHOA 1ZH5A 2KISA 4RAOA 3JTGA 2B20A 2QN1A 4H6PA 4PX3A 3DM9B 5F2KA 2SECE 3K9WA 5GJVC 3T4EA 1K7CA 1KAMA 1TP4A 2CSXA 5CA0F 5L8VA 2BPOA 2GWHA 3NKFA 4ZEVA 1NQ5A 3QRFF 3VJKA 4YT8A 1Y1RA 1B0ZA 5K1YA 4NC8A 2HTSA 1R6RA 3RTRA 1YZQA 2IGTA 2QLNA 3CLTC 2XH8A 1H8HA 5AW0A 1A2BA 4AN4A 1VQPI 1QH8A 2TMKA 3DW1X 2P9EA 2FW7A 4RKEA 2JAPA 1HG1A 3HCCA 4FJ1A 4OUKX 3U44A 3VFZA 1LKZA 3EZNA 1GFWA 3GJ8A 1H3EA 4FDUA 1CT9A 1EVIA 4XKJA 2MDTA 1MVOA 3RRZA 1A3CA 1F48A 1B8IA 4YIFA 1MO6A 3N3BC 3F6BX 3D7KA 2PRSA 4HMOA 5YASA 2Q8KA 1REQA 3RFUA 3TAUA 3BSFA 5ALLA 3VSKA 4L85A 5C3UA 2EZ9A 2JIDA 5JDCA 2IHNA 3FXRA 3IBTA 5EHIA 1R64A 2G0TA 2ZG6A 3LMMA 1SCJA 3LQFA 1SQ6A 2EZ8A 3HFSA 3T1QA 2HKXA 3U39A 3EFOB 2B3DA 2X5XA 3C85A 1TJYA 3IUNA 4P3PA 2F7SA 4YMSA 3QU6A 2EAUA 3PENA 4UTNA 2ELHA 4BGEA 4YFXF 2M2IA 4FYXA 1G4AE 2B35A 2R8PA 1C1XA 2WIAA 3C4QA 3I0MA 3LY5A 1YJWI 3OZVA 5AWFC 3RS3A 1UJCA 3KE2A 2C9YA 3TTUA 2L7ZA 4N4OB 2YU3A 3RGGA 1FT9A 5FLYA 2FEMA 3VYTB 3RVOA 2HQAA 4U0YA 1ZPDA 3AY3A 4BZZA 2IU0A 4Z7QB 1DEXA 3WGLA 4ZK2A 5ES4B 4RTSA 3UBTA 2VUTA 1SXJE 4G0NA 5FPYA 2O7RA 3AW8A 2RHHA 4GC9A 2EBUA 1Y5NA 3K6RA 4X1KA 1VA5A 2ZJAA 1KE2A 3W1VA 3D7NA 3MF4A 3WZ2A 1KO5A 1NDHA 4N5HX 4BNHA 3JR7A 2DJNA 3LQYA 2BBSA 5JBQA 5KX5A 3RADC 3M6FA 1ISFA 1BROA 4GZMA 3I39X 4KO3S 1WM1A 3ZW8A 3B6CA 1FTYA 2IEKA 4O3MA 2O2YA 4II7A 1IMOA 5G3YA 2XVCA 1WS6A 3C3YA 3E5RA 4IHQA 5K0CA 3ONQA 1I1GA 2P6NA 2WY8Q 1MZPA 4A69C 2O4CA 1IOVA 2P65A 1JVNA 5EEGA 3IDFA 2GK3A 3ZCXA 5JJCA 1KR2A 3WYEA 2WUWE 3F49S 3S2SA 4TWZA 4WXCA 1MPTA 4HZIA 2W8BB 3SXJA 3IDQA 4OTZA 2VK1A 2Y3IA 3SJZA 3S27A 1U8EA 1G8PA 1E9EA 3R7SA 1ZCAA 2FB9A 4Y2SA 1P1BA 4MRMA 5JSKA 2PMEA 4AUKA 5KPDA 2C1EA 2C3MA 1F2DA 1RXSA 2WSBA 4FI3F 5AICA 4W5JA 3USCS 4I3HA 2X1EA 1AMUA 3J80K 2PBIA 3DZHA 4TXMA 3RABA 3CVVA 2CL5A 1K7YA 3RTCA 1UBSB 3HRMA 3KLOA 3ASVA 1QG0A 2ID7A 2J5PA 2ZFUA 2ZBQA 3CUTA 1H85A 2VSFA 2YMMA 4HQ6A 4Y7CA 1EEXB 1N6IA 2Q1SA 2R84A 2BZ1A 5FGMA 3OPXA 4J3JA 4PVCA 4TV8F 3SQMA 3U4AA 5EPEA 4J3NA 4QBKA 4RB2C 5KYTA 5HJ2A 5IU6A 5MDHA 1KGSA 5B55A 2A4MA 2IGBA 1ULAA 1BKDR 3AM4A 4RDIA 4FFSA 3EF1A 4GOKA 4QICA 4QXQA 4IG4A 4ASUD 2Y1FA 3DLTA 4BFLA 3SYNA 3FVTA 1ONBA 2VQGA 3O3KA 1CLEA 3IKTA 3JD4A 5ILUA 2ME6A 3MCAA 3NATA 4Q9AA 4QTZA 4BQRA 4RWZA 1UZUA 2R3SA 2Q2EB 1YVUA 2HU7A 2NTEA 2ZUUA 1CR0A 4GKVA 4JJFA 3EDRA 4AB1A 3GRAA 1CY1A 4IIDA 4NYMR 4UAGA 2EX4A 2M2EA 4K3VA 3I83A 5CQGA 1VFCA 3O8DA 4OV6B 3S7ZA 5T7BA 4US1R 4EGCB 2ZVJA 3MT0A 1UJ2A 1JECA 1G7RA 1GKYA 2FP3A 1XVUA 3DA8A 3TQSA 5ADWA 5DM70 5SY4A 1SAUA 4IUYA 1Q0UA 1C1XB 4OK6A 3WYBA 4QHSA 1Z4MA 2ZSFA 2X6OA 5SICE 2WA1A 3GFJA 1RI4A 2X2EA 3TSZA 3IFSA 1L6RA 3GVPA 1DADA 2SICE 3OYLA 1SU4A 8OHMA 4D9CA 1E2KA 2VNIA 4PRLA 4OFBA 4Q7JB 4RZIA 2PGOA 3DO6A 4PHFA 3B2EA 1LSSA 3KOOA 4KUHA 3RCBA 4DA6A 3FUUA 1PL0A 5ALYA 4BDSA 1AQJA 1XZDA 2ZJ8A 3AI7A 4IGIA 4NE7A 1ESDA 5THKA 1X7YA 4F55A 4MRSA 1GZHB 3TOZA 3QLVA 3IV5A 2BJVA 2L9RA 5GAJA 4FTWA 3S5UA 2YZMA 2X42A 2D1FA 4YK7A 1L4GA 2BKLA 3HY4A 3T1NA 3UAXA 4B6PA 1H2FA 3MA0A 4CGZA 1GGHA 5GJWC 3BCBA 2A58A 5K2OA 4Z53A 1EK0A 3L8EA 4JFAA 2JIZD 5IT9Z 1X1RA 2FD5A 2CKDA 5HF9A 5KYUB 1SVUA 1J8MF 1IW7F 3H5RA 1BX3A 1NBIA 4IO9F 1QGAA 1VRCA 3GZTB 4NBTA 4A4DA 1WVGA 2ZJYA 4H7PA 4BNXA 4CF4A 5ADHA 4D25A 5CYVA 2FWIA 3KKOA 1E0SA 1BI0A 1X14A 4JCCA 2FSVC 1KDRA 2JCSA 3FMGA 3A58B 3KEMA 4KQKA 1WMFA 1F2VA 2AG0A 2OAGA 3A6KA 4M36A 3UMBA 5JNUA 4YRDA 3AVOA 4YAJA 3RF7A 3C3JA 4JEUA 2FN8A 1ONNA 4MPJA 2V65A 1N2EA 2K4MA 3KKKA 2V59A 4LKRA 2P1RA 4Z3KA 4W9NA 4YIIA 1QHNA 3GCWA 4R83A 1QBKC 4XIGS 4Z8XA 2NTNA 4HQLA 2WF8A 3FIWA 3H2IA 4HVTA 5L3GA 2P5SA 3NBZC 3LXXA 2R8YA 5J3LA 3HU1A 1NLUA 3NRCA 2DA5A 3WK7A 2QSYA 1QFSA 3QBVA 4L4YA 3BD7A 5DM4A 1N7IA 4C0KA 4DXAA 4FQGA 1CZUA 2RAUA 1DGWY 3OLZA 1FMVA 1WMAA 3IB3A 4JFRA 3E05A 3OQPA 2CXOA 5FD8A 1E3MA 4K9NA 5DLDA 1O7FA 4L7QA 2GHIA 6REQA 3OOEA 4IGEA 5IJ9A 2NRAC 4ZQIA 5EP1A 3WYCA 3M6LA 4R9RA 4Y9UA 1E5QA 1BXGB 5LGUA 1RLMA 3H05A 3JQFA 3L7OA 3WA6A 1Y82A 2DKFA 4EG1A 1PP7U 2GEUA 2V7PA 4AWXB 1FTZA 1JR2A 3AYXB 4PC3A 1IATA 1FP4A 1IJKA 2C5BA 2IIVA 2P1ZA 2PT6A 2PDAA 3AQIA 3HJHA 5BN4A 2H2IA 1G59A 3JARB 4FUTA 3C3AA 2J3EA 2YS6A 3HVHA 2PRZA 3EWAA 5B1DA 3DB2A 2DA6A 4KICA 4XOTA 1LCIA 2QZPA 3BIXA 3PWKA 1XTIA 2XAQA 1TJ5A 2PZEA 2F4OB 3BHMA 3CFYA 4EAAA 5BV7A 3KU1A 3QU2A 4KODA 4LRUA 4Q24A 5DI9A 2JA6J 1PHRA 1U7HA 3VTZA 1BJZA 3JQ7B 1SFXA 1Z36A 3PDIB 2WAQA 1PS8A 4WUTA 2Y30A 3C1UA 4R8RA 5FLVA 4OVKA 2XYPA 4HDNB 4RE6A 3ZCTA 2QEQA 2ZSAA 1LQ1A 1MBEA 1XTRA 1FEXA 1PEDA 2B8EA 2JKVA 1WMBA 3GBSA 1R5ID 4I1YA 2VKEA 4ZCLA 5KMGA 2JI4A 3TZ6A 4Z6KA 3GEEA 1DXYA 3GVAA 1HY3A 3E5HA 1XN4A 3Q72A 3ZQHA 4M7RA 4RZSA 4XAQA 1C4KA 1JFFB 3BWBA 3GFTA 3EUHC 1WJCA 3UKGA 1M0TA 3PE4A 5DNEA 3SNHA 3FHLA 3QVWA 3I6QA 1KEUA 4RSHA 3VZDA 3HJTA 4CF7A 1QJ4A 1LB2A 1E2DA 2W98A 1P0PA 4PZAA 1WHTB 4ND6A 4WX2B 5CCDA 5SYAA 3MQ2A 2C5FA 3TCXB 4C9BA 2EFOA 5BMVA 2WR8A 4NP6A 3UJ6A 1TECE 4AUXA 3FUVA 3OU7A 3CS3A 1NAHA 2UUBB 2QX6A 5ICSA 2EP5A 2F43A 3DLPX 3AXTA 1EDEA 3K7EA 4GG1A 1IBCA 2EZTA 4OQFA 5IH3A 1AQ6A 4BQFA 1SO8A 1PR3A 4RUKA 5AVUA 2OHXA 1EP2B 4AVZA 5HHTA 1EFHA 2J32A 4UEQA 2F1IA 1SQ5A 4NU5A 3PUKA 5HMMA 3VR6H 3ZGLA 4CEHA 1O95C 2GEVA 1BQ4A 4YFYA 3LNQA 4DZPA 1BX0A 5FNVA 2DLNA 2D0OB 3K7AJ 2PKQP 3CR8A 3HCFA 4JJ7A 4JLPA 5I9BA 5K3FA 2E71A 1I4LD 3JRCA 1JE1A 3B7GA 1YL6A 2I1VB 3OPVA 1IONA 4IGAA 4JYCA 1BWQA 1LBQA 2DRIA 2REQB 4KSBA 1N36B 1MH9A 3HUTA 3ETJA 4X84A 3ECAA 3P0RA 2H7YA 4Z1MA 2PIAA 3VPFA 4D99A 3L7YA 2PGNA 2VPQA 4BKXA 4OSEA 1OW3B 1AMOA 2X86A 1DIAA 2O0JA 4DV0B 4ISBA 2HLPA 2Q1UA 1FBTA 3NDIA 3OCUA 2NPFA 2FK7A 3CP8A 2K9QA 1O1YA 3KL2A 4JU8A 1F5TA 3I4NJ 1AUOA 1HGXA 1A9XA 1XL1A 2OBFA 4HNGA 2F64A 4NC9A 3B6JA 3RVBA 4EI8A 3H2ZA 3CZ9A 3OI7A 1E6MA 3CUKA 2CDNA 3CB2A 1XOIA 3LLUA 2HSEA 3GUYA 4ZYZA 3TRHA 2G25A 3L6DA 3TWOA 5JS8A 1QAMA 3ZHQA 3HKBB 4X54A 3RK4A 1BYIA 3IL2A 2FUEA 1C7JA 1A69A 3NGLA 5G0VA 4ZYXA 5I4KA 4D5CA 5E6SB 2LIVA 3WBBA 4EM1A 1LPSA 5IDYA 1LD3A 2O2XA 1EDZA 1R5HA 4A3SA 1WIWA 2REOA 4G56A 2GZMA 1BM9A 1L4EA 4WXHA 1N2ZA 1S2GA 3CX6A 3IPAA 2GOYA 1PDNC 2AWNA 3HDDA 3AZOA 5E1MA 2B34A 4JBWA 4P84A 2A7XA 1RZ4A 4GSKA 1K7XB 1R12A 3PDUA 2QIPA 2RREA 4MVJI 4CMBA 3WRYC 4ZN6A 5TF4A 3I92A 3AKEA 4OI2A 3RYHA 1W0JA 3KZKA 2HRBA 2EDCA 3IJ5A 2EZHA 2E4UA 1TLTA 3I12A 4NNJA 2ATEA 3MEQA 1P5RA 3FXOA 1L3BA 3PUZA 2I6SA 3AYZB 3LL4A 4I8IA 4L3WA 4QVGA 4QYIA 4IILA 1P0QA 3LXMA 1R6DA 3RC8A 5KNBD 4RVSA 4W4TA 4RKQA 4UXHA 2QWWA 5EEAA 3E3AA 4GOXA 5AO9A 1MC1A 3UJNA 1UMKA 4CU2A 4DIQA 1LRJA 4JUBA 4LSZA 3MUNA 3O2QB 4ZIRB 1OLXB 3DFGA 4IKFA 2VDWB 4LB6B 1BQ3A 1H69A 1KZYC 1G8KA 3EEIA 3IHTA 2IHUA 1LDDA 1JJ8C 3QMPA 2MJLA 5BWCA 5CFZA 1C4WA 4BNDA 1MVNA 2O0KA 1W93A 2VWGA 2JUGA 2I7CA 2R6FA 3ESXA 3L7JA 2VPYA 4GP9A 1G1AA 2A5LA 2VE8A 1GN8A 5FEMA 4RTQA 2QVOA 3GLGB 1R49A 2F3RA 1SB9A 1KI9A 3LXRA 4XRFA 4HF7A 1BIAA 4I5IA 3ANXA 1Q77A 5CA1A 3PHHA 8MHTA 5J1YA 2ZJPF 4XXHA 3VUEA 4WZZA 3KZMA 1TMYA 3C41J 1BOFA 2NT3A 3K6JA 4N6OA 3N74A 3SJBA 1SVMA 5CGQB 5D1HA 1TVKB 3KLMX 4TKMA 1WKVA 1ACJA 3NVMB 5F2OA 3F4LA 3TLJA 4E2WA 5F9FA 3L2RA 3HKCA 4C6HA 4IZ6A 4FHGA 1F4KA 2ZJBA 3K53A 4N0BA 2X4IA 3UICA 4B84A 1D1QA 3ICEA 1NVKA 2Y1CA 3QY9A 3GGDA 4KN9S 4GKAA 2FBHA 3KP6A 2D59A 4HDKB 1MIOA 4D0NA 2EW8A 1J39A 5J43A 2CQKA 3OZXA 3B1KA 2X1MA 1SBTA 4Q1AA 1UHSA 2QNBA 3CVOA 2EKZA 4X6LA 4DJFC 4OAOA 3PXAA 5IP7J 1NUSA 3HOUJ 3F71A 1HFJA 3OHMA 3W8FA 5JZVA 4L8YA 4MCIA 1GKIA 2OK8A 1YJXA 4UPDA 3VBCA 2JCXA 4JJGA 5HK9A 2QGZA 2ORIA 1Z13A 4XLFA 3WMGA 3F8SA 4OQDA 1SUEA 3I6IA 4KTTE 3H0KA 4LRWA 2IEYA 3ZQIA 3GUUA 4Y1EA 4DJEC 2ZYGA 2HSZA 3SEQA 2Q4BA 5BN5B 1I7DA 1FW8A 4YJ3B 2C61A 1S3SA 1IM5A 2Y1OA 4KQ1A 5FO0A 2I87A 4KX5A 3BMCA 1U7DA 4ZDLA 3CRVA 4KC0A 4NYJR 2JA2A 3Q8LA 2QRPA 1LLDA 2JFZA 3HHGA 1P7JA 1V3UA 3I6YA 4CT5A 4LG0A 1KEZA 1LEHA 2IA0A 5I3ZA 1NRXA 4HRIA 3HK2A 1H6BA 1VKHA 4MKIA 2HN9A 3DGEC 3HB4X 1J75A 4HGZA 1YTYA 3FSRA 1TL8A 3KJFA 2O2DA 3SQOA 2REBA 1X3SA 4C3IJ 3KWFA 1P2VA 4KR9A 5DH9A 3RS8A 3VV2A 2NZ8A 4HX5A 1EFRD 9LDBA 5LLTA 5FR1A 1DKQA 2EKLA 1FOWA 1RLUA 3VU8A 5IJZA 2O9JA 3SHVA 3BIFA 3VR0A 3CYFA 3R74A 3I32A 3LHDA 2GXBA 1DJQA 2ZSBA 1LLUA 4V03A 3QXGA 2H18A 3ZY3A 5FIUA 5EG5A 2DU8A 1V1JA 4FD3A 2FCAA 1DX9A 1E5XA 1Q7GA 4DIBA 2LIPA 5ARCA 5FJJA 4ETIA 1Z68A 3B13B 2XUIA 4REQB 5HKAA 1AK9A 3OQHA 4C3VA 3BXOA 4LCJA 1ZO8A 3CCMI 5H5JA 3RGWS 2G5CA 3N8NA 4G2TA 4EM0B 1ADJA 2W71A 3Q98A 5AI4A 1XCLA 1W1WA 1DQUA 3I37X 3UXYA 3V2GA 1BIFA 3FNBA 4R1NA 3BQYA 4NFYA 2P7VB 5JO0A 2BEWB 2BE7A 2P11A 2X8JB 4DNFA 3GTLJ 3K96A 2H8WA 4R2WA 3VR6D 4N4NB 1KMNA 1PJ4A 4CDGA 4TT3A 4ABZA 4UOQA 3ZH2A 4BTEA 4DCCA 4AMUA 2OFFA 2M0CA 1OH7A 2QI9C 1KOJA 3N0TA 4DLVA 2FF4A 3FSJX 4MHTA 4HFMA 4XARA 2KKOA 5B12A 5LOVB 2WBMA 6ADHA 1KQ0A 5GY7A 2IYNA 1BCSB 1SEUA 4DIDA 1VA4A 2H5JA 3CGWA 5H7XA 1NG9A 2FPGA 3AR7A 3KEFA 3FDZB 2FQ3A 4US0R 2GOXB 4NZNA 3PA6A 1ZOPA 1Q21A 2VKVA 1NQXA 2XNDD 1T5DX 2RDPA 2X6XA 2ZETA 1R8YA 2ZBGA 3IUSA 4LDQA 3SLKA 3T34A 1YVEI 3Q10A 3BIWA 1CUJA 1X7YB 1Z6TA 1BCRA 2CE7A 4AD9A 3BQ9A 5LDHA 4LGYA 1KI1A 3NI2A 2NYVA 4CHGA 3WWCA 2OAEA 2GXQA 5B64A 3X2EA 2P3OA 4D9GA 5E7JA 1JE0A 2QTWB 1PS0A 2XHZA 4JDUA 4RJIA 1FYLA 3TGNA 3P7NA 1JIVA 3I1FA 1N5OX 4NMWA 2QROA 4EK9A 1EQAA 3A9SA 3HVRA 5H3LA 2JBAA 4D0RA 3O8LA 3W2GA 1GU1A 5AJTA 1US8B 4A8PA 5JNVA 1ZRCA 4NJEB 1VXOA 4KXVA 3ESWB 4YLEA 3L1KA 4C22A 4F3KA 5L6LB 5M3FJ 5GINE 1QRDA 2Z43A 2KB0A 4BGDA 1PN3A 3IOYA 3KQWA 4K6FA 4PG7A 3GCDA 4RK4A 5ILGA 1PRYA 5BSVA 2NZWA 1YR7A 2IUTA 2AYZA 2XGCA 4QPPA 4CIDA 4F4IA 3TZKA 3HDVA 1QF6A 2VYQA 1XMXA 2WBLC 1UANA 2OMKA 4YDQA 4X7RA 5PNTA 5SYNA 4CQMB 1MRNA 2A69F 4BXFA 4D3FA 3VZSA 3EOBI 4FISA 1PYOA 2ZUSA 3E61A 4P34A 4GOND 5L7YA 1RQRA 3F6OA 2HGCA 2GO7A 2A9FA 2IOFA 2QSGX 3EHDA 4BMOB 2HT1A 1BCSA 1CY0A 5COAA 4L5CA 4HX9A 3D0SA 4WZAA 1CEEA 2O8XA 1L5MA 5GV7A 3WGKA 2VWQA 3FYUC 4DCPA 1IHUA 3M9LA 3OTWA 1GYQA 2JBWA 1M2FA 2VJDA 1M8KA 3QLJA 4FIDA 2PANA 4LJSA 4UBLA 5CLHA 4B8YA 5EJEA 721PA 5KDDA 5KVVA 2PJPA 2HAEA 2PJUA 4JGBA 4HG2A 3SF0A 1D1BA 1DDNA 1TTHA 4NBSA 1B0UA 4RFSA 4WIAA 1XMSA 5AOCA 5F77A 3HACA 3W8RA 4LMYA 3EGWA 4JIGA 2Q45A 5I4CA 4AY2A 4TLLB 1H88C 1I4OA 3I8SA 5LZ8A 3ZCPA 2M45A 1SD7A 4IL5A 3S40A 4RU1A 4N48A 1Y5MA 3AG1H 1Y8CA 1UXGA 3NHPA 4LVUA 4DB2A 5EEHA 4JJ8A 3PZBA 1G16A 1G21B 4DW6A 1JQLB 3NC1C 3W2TA 10MHA 3VYVA 1AK2A 3M4NA 5I3CA 2D5BA 3LJKA 4YJFB 2Y92A 2VWPA 4M8LA 2IHJA 3FYUB 2CJYA 5ANRB 2XT0A 5JD3A 3K0SA 3A0UA 5ENDA 1KK2A 1ZMBA 4DBLE 4NZ9A 4PHGA 2HDDA 1GUBA 5DXFA 4NULA 3UN1A 1XTUA 4BAYA 2BKAA 3E7DA 3U2RA 2WHXA 2YXEA 1RC1A 2C3OA 2ZAOA 4GLFA 4B0PA 1TKRA 2FEZA 2E1PA 3KBBA 5C8YB 3GTQJ 4AYXA 1XZPA 3PITA 3OIWA 1R66A 3H86A 5EIBC 3HBMA 3WISA 3WSVA 5IEJA 3SIWA 3N5CA 5A3JA 4CYDA 1HDEA 1ZI8A 4HN4B 4U7PB 1A9QA 4L3OA 4JA2A 1ZR2A 2JLUA 4HAWA 4EO7A 1KU3A 1FY7A 1S29A 4NOKA 3DEEA 3WGJA 3HSRA 5HTKA 1IFXA 1ZQ9A 4OJMX 2VTDA 1ITYA 4MINA 1V8ZA 5A9SA 3NIBA 5H20A 1GP2A 2WWRA 3O2PE 4CCYA 3RRXA 1U8XX 2LUOA 3QPWA 2O20A 4BNMA 2VTKA 3FDFA 4MMZB 1DCFA 2QX9A 3UTCA 4J1QA 1FNBA 3KETA 2EJBA 2WILA 1U5TA 4H1TA 3CESA 4M46A 1Q2XA 1HQDA 5EESA 1UMDB 2Q5OA 3QU3A 1SD2A 2XYRA 3BWCA 1RVDA 4IOAF 1D2MA 2XWJI 1E94E 4RPIA 4WOBA 2GQ0A 1VKRA 2RH9B 1LWNA 3ABZA 3E5NA 4PSWA 2WPNA 3JATB 3GMEA 3G2PA 4MS1A 4PLPA 3WV4A 2Y9PB 1QIHA 4OLHA 1EJ2A 2HYDA 2CFRA 3NIDB 4D8VA 3WU1B 1KAEA 3FF1A 3FLBA 1ZISA 1W76A 3STUA 1U8FO 1M2HA 4BXUA 2L42A 1DXQA 1H2YA 3B6KA 1CQXA 1EG7A 3QKRA 4XM3A 4F56A 1WQ2A 2QUBA 2P4UA 2BH9A 5FFFA 4L57A 3X0DA 3LQ4A 3E7LA 4D8TA 1DBQA 3BYZA 4R7ZA 2QJWA 4C7OA 3FA2A 3PQEA 5LXTA 4Q47A 2QAIA 2KQUA 2Z04A 3D6MA 5T8KC 4C0XA 2CJJA 4IDQA 1DQYA 1VMDA 2LTAA 4EHLA 1O87A 1RU3A 4IHXA 2WA0A 3AJRA 3W77A 4ZVKA 1FSEA 1ULTA 2Q6TA 4I2NA 1TLLA 3W6KB 1H0HA 3I54A 3O8QB 3KR0A 4KLAA 4DIMA 4NZZA 4EPTA 5DYTA 1SXJA 3GLHA 4AL4A 3VH2A 1UINA 4HLYA 2H85A 4YACA 2I5UA 2I8CA 2Q6OA 3WZMA 1TJ3A 4OHZA 1REQB 4ARUA 1OU4A 1USGA 4PZ9A 3RANA 3VKVA 2FZVA 1ZY2A 2ISSD 5JS6A 5E0KB 4AURA 3F73A 4UD2A 3ZWKA 4C78A 1TQIA 2Y71A 3U21A 3W6VA 4DZZA 4GKBA 1WJBA 3CKMA 4X1EA 1QTIA 1QWSA 4F46A 1FTNA 2C78A 3OM8A 2B5WA 3HVIA 4HNAA 5HS9A 3W3CA 4LHXA 3D2BA 1OT5A 4YR7A 1NQWA 3PUHA 3HNPA 3PQ4A 4RPHA 5BOSB 1D2EA 2NSYA 2WJIA 1TADA 4WKCA 4P9NA 3LWBA 1PQPA 4NECA 3EQ2A 1F5NA 5ALJA 1D2GA 1KAOA 1ZN2A 1GSAA 5A3QA 1ODDA 3U3RA 1JKFA 4H77A 1KP3A 4JLUA 2QNRA 3F98A 4ZJYA 3W4IA 2LKDA 4WX9A 2C9BA 3DAOA 2YWXA 4L5JA 3BB3A 1L4UA 3MZ0A 3OUTA 1TMOA 4R16A 1I5ZA 5DHSA 1QBJA 2A92A 1G0NA 2IPMA 4A0XA 1YITI 5A5FA 1TW2A 1CIPA 2J6CA 4BX0A 2QJTA 1LY1A 4E2ZA 1VHTA 4FYPA 1P75A 4X00A 1PQYA 2Y0DA 1RC0A 2C4TA 1DLJA 3A31A 1SXJD 3LO8A 1E9AA 3ZH9B 1ZOIA 3RUHA 2ZPAA 3FPFA 3TOXA 4UHCA 2B2XA 2OZPA 1ETQA 1W35A 1M1YA 3SGLA 3LFUA 3TQIA 4ILKA 5L95A 2Z16A 3KYCA 4QO7A 4KYWA 3LUCA 2EBIA 4ECEA 3ADCA 3DVRX 4M1YA 1K7EB 1Y3IA 2C99A 4LISA 4YR9A 1NZJA 2QRNA 3BTSA 5KVCA 4JHXA 1FYFA 1U5AA 1F7VA 3EVNA 2WJVA 2LVBA 2AMJA 5DCFA 3GNLA 4JOCA 2D13A 4R7GA 5DMHA 3DFUA 4BE0A 7ADHA 2MINA 2WTBA 5K6RA 4DQLA 1TC1A 2DYKA 5E8GA 4BX8A 1MMAA 1FMLA 3IOCA 4F4CA 1VJ1A 2XITA 3SXPA 3IELA 1SK8A 4M0EA 4JCOA 2M30A 4D9BA 2DLCX 4QZVA 2DQ4A 2AI3A 5DHUA 2M6RA 1VQ6I 1FE8A 1V39A 1NTRA 1WOMA 1PHPA 4TTIA 5G1NA 1GZ3A 1ZIXA 1OREA 1ZUWA 2O0HA 1MKYA 1OX4B 3OLQA 4AJJA 4DAEA 2F3PA 1UBEA 2HPIA 2JW5A 4YCAA 5BV2P 1P3DA 1KO1A 3LKZA 1XHLA 1A9SA 2OKCA 5F1KA 2GNAA 1QFMA 1MUUA 3NEJA 3MGGA 1D3AA 3EVZA 3HB5X 3JRXA 3SKYA 1BVUA 1DEKA 3PFNA 2OYRA 3KR9A 5BYKA 1YASA 4QGFA 3AO0B 4EB6A 5B5SA 3OYKA 1R3UA 3HRIA 4ETNA 3DLBA 3OQOA 1ACMA 1CNMA 5EY5B 1RPAA 4OATA 3FWPA 3AJ9A 3CKKA 3ZMSA 5GONA 3SYRA 4G8BA 1EE2A 4UM9B 3LVBA 2ZM5A 1YQUA 2BMAA 2ZQ5A 1CHDA 4EJOA 4FQ5A 5GTIC 4ZO4A 4Y2QA 1CZRA 2R2AA 1U3UA 5B3KA 1TBXA 4XRMA 3HR7A 4FSHA 3ENNA 3M9WA 4OB6A 3KQLA 5CK4A 4ZVRA 3U7QB 4D5EA 1HW1A 2C7RA 2FI1A 2VHVA 3ZE7A 1GUDA 1G3MA 2FUNB 3DMPA 2JCYA 4DN6A 5C46F 4L4ZA 3SZTA 1JDVA 2XDQB 4DT1A 1EKEA 2ERXA 2ZPTX 3EA0A 5K0EA 3HL0A 3EEQA 3KUXA 3HCPA 3TLMA 3UVEA 5ADUS 2ZJFA 4AUNA 3Q3IA 5I7OA 4J03A 5F3RA 2CDCA 1VFNA 2WM8A 4JROA 4F86A 2NM0A 3W2VA 4HEHA 2I4IA 4UCXA 4MAFA 3BA1A 3AL2A 3E2MA 2PFKA 3TZHA 2ZCJA 1N3LA 1E92A 2CW8A 3GJYA 3W2FA 4BACA 1E3WA 4OBWA 3IAM6 5F51A 1XGMA 3I4MJ 2PUWA 3KQPA 1DUXC 2CFCA 3JU3A 1EHIA 2CC2A 3FNHA 4QFMA 4JH0A 4O0LA 1ICIA 2ZXFA 3VXKA 5FD6A 3N2YA 4NK5A 4CIAA 1VL8A 4E03A 1XJWA 1AOYA 1TGVA 3IVRA 1G2QA 4TV9A 4X20B 3TR5A 5IYDJ 4XYBA 1BMDA 2GEFA 2V97A 3GA5A 2K85A 1MTZA 3N5KA 4AK9A 3DV9A 4DCNA 1DIHA 4FHZA 1QIMA 9ANTA 4EY5A 3D0OA 3QSYA 2WPDD 2EZIA 3CSDA 3ITNA 3PC8A 4IINA 2R6HA 1ON2A 2VNJA 3TRDA 4Z1OA 1LK5A 3R2JA 4UY8I 2JGMA 2QZ4A 1HKQA 1PJ8A 2WLTA 5G0TA 1TRHA 2W6JA 1NONA 2PAAA 3GAAA 4W8GA 3DZDA 4ZVOA 4YAIA 2LSOA 1X39A 3BILA 3UUWA 2EIJH 4OI1A 1MD9A 1KOFA 4YWJA 3DWIA 1EPUA 3PG5A 1KI3A 3OIVA 4Y9RA 4BWYA 5AQ1A 4QE3A 1M2NA 3GMSA 5C52B 1EQUA 1YE5A 4OF4A 1TF2A 2BFFA 5DGTA 2MINB 3OHSX 5IHXA 3HA2A 3R0JA 3MTEA 1A7UA 4BWGA 3LA3A 1QR2A 3ZU2A 2BP7B 2PG4A 3A9WA 3CH4B 3R44A 1KNXA 1AN0A 4N0DA 5K09A 2BBWA 4TLEA 3MVPA 4HDOB 4W9NC 4WNAB 2F67A 1RJDA 4DQ0A 3NBMA 4H16A 4KACA 2CGPA 3LIPA 3THYB 5DDIP 2I2CA 3K35A 3II6X 4ZODA 2QXUA 3K5HA 2BZ0A 2WABA 2W83A 4LTMA 4QA9A 3FLEA 1A1SA 1G3QA 2JFVA 1ND6A 4JP5A 4KCGA 4ER5A 4IY1A 1QK3A 2VDNB 2QLZA 4FZRA 5DTIA 2FPMA 4BOYA 2VTEA 4DMCA 3PXUA 2UUZA 2MMCA 1OYWA 1DUVG 3VZQA 2K7FA 1MIOB 3MZHA 4P33A 1NRIA 4U3JA 1G0OA 1KIMA 1KR5A 1AKYA 1JFVA 2F3QA 2QMQA 3GLSA 1W0UA 1YFZA 1YIAA 1PI3A 3COSA 5E7MA 1G98A 2V5UA 1QGPA 2L9NA 4AMYA 4B9EA 1X8KA 1BXZA 4AS3A 4BJ5A 3ABQB 3ITKA 5IP9J 2WKWA 5DHPA 4O29A 2QE7A 5FL3A 5JIBA 2HPVA 3K20A 4EKDA 4XSHA 4PWZA 3MN1A 4EB3A 3I62A 3CDLA 1NVFA 2UVQA 4HF2A 1T2VA 2V8BA 3CZQA 3EYAA 5BNIA 3K0LA 2C9CA 5DDGA 3ABOB 4KVAA 4INJA 2E4YA 4RV4A 1W1IA 3SOPA 3WL3A 3IMEA 2DCMA 1LJUA 3WHCA 3FCXA 3MPOA 3TO9A 4M1QA 2DQZA 1V25A 2D62A 2PMFA 3BCSA 2VUMJ 4O1HA 3SDSA 1XSEA 4B45A 3RJ9A 4MCHA 4JP8A 3UW3A 3S1SA 2JGEA 5AM0A 4JODA 3WLTA 4IIVA 4WBNB 4BE7B 4G5QA 4NWIA 3QU5A 2BP7A 1Z4LA 2B6NA 1W8DA 4IOCF 1XDBA 4GYIA 2JIBA 2W24A 4NFLA 2EJVA 4QFBA 1CS0A 1G20E 3H2SA 2HQBA 3OPYI 2I78A 1ZGWA 1EG2A 1GA6A 2QU7A 4HQRA 4IICA 4QJ5A 4IAOA 4S2EA 3U4HA 8ATCA 1VYUA 2VJQA 3OT1B 1KBOA 4TVBA 5C4IA 3TF5A 1XFAA 3Q8WA 1M1YB 2GEDA 4HPJB 4MTCA 2HJSA 1OXSC 4TV9F 1LKXA 2Z95A 3BQMB 4BO4A 4U88A 3U3KA 4D8WA 5LMZA 1CBUA 1G5TA 2Z09A 3EB9A 2I7DA 4RKYA 5CDSA 2NPIA 3N97A 1PJCA 3EIHA 3FSEA 3PIDA 5AJYA 3PQCA 4XCQA 1YCDA 3RC9A 4DA8A 5IULC 4DM4A 2G63A 3ZTWA 1JW9B 3FPKA 1TNTA 1JG3A 5ARDA 4IM7A 2ZWIA 3CW9A 1FU4A 1NW7A 2XPWA 3A2LA 4WBNA 1I3KA 1PJTA 2HC9A 3GA0A 3TCNA 1EMDA 3ESCA 1R8QA 2BEUB 2JI6A 4RLFA 1QVRA 3LBYA 3N8GA 4OM7A 1TT5A 6AT1A 1CX9B 3JRFA 5D3ZA 1NBME 1FFXB 1A8SA 3R4VA 1GGFA 1AGPA 2C2GA 5CVUA 3NW9A 3UIEA 1UC8A 2XSZD 2B37A 1PZHA 3PE3A 3ANNA 2JCVA 3D5QA 1A4UA 4X6YA 1JXMA 3SFTA 1SU7A 3DE3X 1ZSVA 2O7QA 2VP4A 2AXTC 2YHAA 2FP4A 3FY4A 4OQXA 3EYYA 5AI6A 4ENQA 2IYQA 3UANA 4JMPA 2HZTA 5AIAA 2P5YA 1DAMA 3L4BA 1J59A 4OP3A 3RSGA 2H1WA 3NWJA 4R4JA 2XGDA 1JRLA 2MOKA 3IQDB 1AD2A 5IBPA 5DTDA 2DVMA 1EVYA 2BFBA 2JASA 3L7NA 1E2UA 4UBIA 1C14A 4WVFA 1L5SA 4LYGA 3F6PA 4FW9A 1AQUA 4K05A 1RS0A 4WXEA 1YA4A 4BASA 4EMTA 4E2YA 4XYGA 2G36A 2VPRA 1YB2A 1OFUA 4GU5A 2HOSA 1QU3A 3K9CA 4PYOA 4V1CI 5B6IA 1HDPA 2BEUA 1Y42X 2OFXA 4I36A 5CB6A 3LAPA 1R4MA 1JGSA 1MGPA 2KZVA 4CDMA 3LWFA 5JEEA 4ESJA 1DC7A 1E7WA 4IDPA 4ZAFA 3QOPA 1LLCA 2C20A 3UHAA 2ZSDA 5B2FA 3AB8A 2VF7A 1I80A 2VBWA 3CEJA 2QTRA 1FX1A 2DG2A 3V4GA 2E2IJ 2SNIE 2ASEA 4IWYA 3IKVA 3T1YB 3WMWA 1PT8A 1QORA 1ZH2A 3USES 3VBEA 2BY0A 2UV1A 1XEWY 4H1VA 4NCXA 2ZXJA 2WC1A 4A2QA 3VMFA 3TL6A 3OCVA 4DTCA 4N3GA 1ZU4A 1U6KA 4GYWA 3I5UA 2L4AA 1ETWA 1C9EA 2DFPA 1FS5A 1V96A 3R8CA 2OHJA 4NFSA 3INYA 4G65A 3K4KA 2VLBA 2YNMC 4FB4A 4AU7A 5AK0A 3FN4A 3SPXA 4DUZB 1HXDA 2O4UX 5HIKA 1GCIA 2NVTJ 1SHUX 2WJAA 1G8GA 2X0IA 1KQ3A 1QMPA 2JRTA 3K8YA 2CV0A 3C3BA 4Q3EA 3KELA 3H87A 3KVVA 4XOPA 2R48A 1JHDA 1E9FA 3MW8A 2ZJ5A 1E3LA 1TKBA 1SIOA 3FZYA 5EE9A 4CG0A 4ODIA 3RNLA 2Y0SN 2ZB3A 2ZRQA 2OL4A 3SR0A 3MUEA 1D8JA 3Q0WA 3FLMA 4XL9A 4FHDA 4KXUA 4OQMA 4ZO9A 4D4LA 4F3RA 5HZKA 1SD6A 4EPVA 5C7LO 2O14A 2NSLA 3FZEA 4UAVA 2EBHX 3WTYC 3PJRA 1V5IA 1KY2A 2B1QA 2FE1A 4FT2A 4Z9AA 1BKSB 5AM3A 3IURA 3FOBA 3ZHSA 1BGWA 2B78A 3QMVA 4PWYA 1LBEA 4PHCA 4GLLA 5AK4A 2E1NA 4U7FA 2HZ7A 4G0XA 5JCPA 3KL4A 2OHOA 2QKLB 5D86A 4AJLA 5K8LA 1E3IA 4EDFA 5E18F 2FMYA 1XQ1A 4G7HF 2WNSA 3I9NA 3P2IA 1FQOA 1UKEA 5ARBA 5CTAA 5KWJA 4YUWA 4EMBA 2GYUA 3T1OA 3EMVA 1NTCA 4GLBA 3D8TA 2O03A 3QKWA 3L4KA 1Z63A 3L8HA 4XX1A 1KWKA 2PXHA 5GAGJ 4GPZA 3I28A 4YDRA 1KSGA 3QNWA 1X42A 3HXMA 1GAEO 3HGTA 1CUFA 3AZQA 4D5FA 2ZRFA 4J0CA 4NNOA 4RK1A 3ZLBA 3TKYA 1EFDN 4IOMA 3MJEA 4D41A 4KV7A 5BS6A 1AX9A 3IP4B 2XZTA 4MPTA 4YJDA 4B3MB 3KE8A 3GZNA 1I8TA 4FOOA 5K3EA 1UBFA 4EG7A 1S0UA 4IX1A 4D6YA 4HPQA 1TD1A 1R0KA 2QD4A 3JQGA 3H9QA 1GLVA 1X4PA 3MBIA 3TYXA 4CLRB 4DIKA 3D54D 3I3LA 3AY0A 4RHEA 4E09A 4ZEWA 3OHPA 4POOA 5LNK1 3IQGX 5DNUA 2AEMA 4J07A 1T24A 3AUSA 5AM4A 3SDZA 1NFRA 4CG3A 3ZHCA 4Q7EA 3MBOA 1KSFX 4L74A 3GJXC 1MRZA 5KJ6A 5FJ8J 2F48A 2QUZA 4Y15A 3HKZN 4C88A 1WMSA 2H2WA 3NAGA 1FFWA 1ISHA 4HGOA 1US8A 1ZK0A 4G9GA 3UT6A 4CIBA 5J4KA 3Q3HA 2NNLD 4MWDA 2XTAA 1IWOA 5EL0A 4ZT7A 4F0JA 1SC4A 3TRJA 4MITA 3N2ZB 3BKWA 1EBUA 1X13A 2PSSA 1R9TJ 2UXNA 1JLRA 2YWRA 4LJ5A 4U2DA 4G4SP 2YYYA 4H3SA 3RSLA 3HOXJ 3CF4G 3P5BA 1CUSA 1PNTA 5EIAA 4KUEA 3NH9A 4LYHA 5SZHB 3S28A 1UKCA 5IJXA 3HM5A 4NZMA 4A0GA 1K2WA 5KNBH 5F4ZA 1YUBA 3I2HA 2OMEA 2M9HA 4X7PA 4J7AA 4RDCA 2FMLA 4E6PA 5ALVA 4FYJA 3WQBA 3Q5EA 4MLPA 2DH6A 2ZS9A 2XAGA 4YGYA 3LDHA 5JW6A 5IT3A 3ASOH 4LDJA 2COKA 4AS1A 2E1OA 5EXTA 1YW9A 1TVMA 3HUGB 2AXEA 1KJJA 3LP5A 3RI3A 4EJUA 5KI6A 3ZY6A 5LIPA 5JROA 1NG6A 2NVWA 3UAWA 1IBKB 5LUAA 4LNHA 2I65A 3HRTA 2XF6A 4QYSA 3SAJA 1UR5A 2VZEA 3IERA 5A03A 3KYJB 5F5LA 3PNYA 4KKVA 4ZGBA 1YCFA 1JKIA 2ANCA 3AF3A 4INPA 4XPZA 1D4OA 4XICA 1C50A 1XEFA 2CD9A 3V4RA 1AS2A 2NZ2A 1N6LA 1FSFA 4MWTA 4ZOCA 1Y4UA 2IV7A 1KZ7B 4EI2A 2AFVA 1J1IA 2ECQA 3FNEA 1N7JA 1CUUA 1UMCB 3D3KA 3ZZ0A 1R74A 1JAZA 4PSCA 2GFIA 4H7JA 1E1MA 5GTHC 3LSKA 3KSMA 3VKGA 5EKXA 4CLOA 4TM8A 1WP4A 2FRVA 1XSVA 1QDEA 3LHSA 1ECPA 4B76A 5I01A 2XUQA 1GZSA 1O7JA 3T3GA 4B2YA 3WTBA 4FN5A 2Z98A 3RVRA 3WGZA 2YX1A 1T2FA 1ZX1A 4I50F 3BQNB 4PSVA 4WNIA 1F60A 2VPTA 3HDHA 3DTYA 2WSMA 4NQWB 3UKJA 3L0IB 3CWQA 4U0KA 2GCNA 4P22A 1TA9A 1XZHA 2JI7A 1PVDA 1D8KA 5IKEA 3KZCA 2JBAB 3DOIA 3MD2A 3EXEA 3QUQA 3U1KA 1GM5A 2I2WA 3JQAB 3KHSA 1RXYA 3RS4A 3D6FA 3F9RA 1GCOA 4QFDA 4FNGA 3QJ5A 3QXJA 2I7XA 4TQGA 4E14A 5JPCA 1KVSA 1UADA 2QTLA 2QD1A 4OAZA 2VUSA 3JRBA 2VH5R 2DFIA 1A8PA 3CCVI 2JLQA 4BAUA 4DRYA 2A14A 3TNJA 2D7DA 4E5KA 3F67A 1KTVA 3PEVA 1T56A 5AXDA 3GTKJ 4D9MA 1OKRA 3CDIA 2HF2A 1JXSA 1XCPA 4RH0A 2OAQ1 4A2PA 2NVYJ 3MRXA 5F6FA 5IOZA 5IWAB 2C7BA 2CNLA 5EZQA 2I6TA 5GGXA 3ZN0A 1ZEMA 2G06A 2XRLA 4ETSA 5DN6A 1YR8A 1II9A 2EV9A 2CSUA 1PR9A 5FR2A 3MILA 3ZD6A 5B37A 1R5BA 4JUAA 3OL3A 4ML3A 4YY3B 1MB2A 2C57A 3IEIA 5B7NA 3WFJA 1LFAA 1E3SA 1UBJS 3NG1A 1WWKA 2A57A 4IKEA 5DGDA 3OJOA 4R2XA 3WV5A 3ZXYA 1J33A 1LPOA 3L06A 1IVSA 2EWVA 4TWRA 5A7GA 4ZYLA 4FOPA 1AM4D 2WYVA 2NQ8A 1GY8A 1HOTA 2VP3A 2NU7B 4S1VA 2W11A 5HFAA 4HFNA 1T34A 1U7XA 1JKMA 2BEWA 1IG3A 4EUNA 3SZMA 3RREA 1M0WA 4I4NA 4JC5A 5L3SB 1C30A 3EWSA 2P69A 3ZEAA 1GAQA 4Q9JA 4TL6A 4G8CA 3B73A 5B4TA 4LTDA 1QR6A 2QP3A 4X0GA 3MB5A 3E58A 5A4IS 2OGWA 3ABTA 3E3OA 3NVKI 5HGXA 4BUCA 3HSKA 2NWQA 2O6LA 1JL3A 4EI7A 4ZI7B 5EP4A 3NP7A 4EPXA 3MMXA 4N3NA 1PFKA 3O73A 4OH7A 1UG0A 1MW7A 3Q9VA 1FS6A 1BHQ1 4DSZA 3EY4A 2A35A 3KZZA 2A9QA 1NUUA 1Y7PA 1OCTC 2HJGA 3Q87B 4GECA 4JKOA 4TSRA 4XGKA 2GYVA 5FUBA 2G6TA 3BJZA 4H0CA 3G8DA 2QUHA 2OCIA 3G2IA 2Y2ZA 4BN0A 4U2BA 5KREA 3WGIA 1LWOA 1QRRA 2R79A 3K9TA 2WHEA 4AMVA 3CCJI 3ZGKA 3ECOA 3C2QA 3OURA 4GXRA 1MV5A 1G63A 1WB6A 2QLTA 5AJUA 3HOTA 3SYLA 3W6UA 3AH8A 2I9KA 3ZJ4A 3SJMA 1QHFA 3DVAA 1DC5A 1GRCA 2ZSIB 3HGGA 4K0RA 5BXYA 1R0SA 1WDMA 9GPBA 3GX4X 1A6QA 3UJ7A 4R41A 2IK8A 2Z5UA 4YA6A 3OS0A 3G7UA 4BRSA 1PFYA 3ZV4A 1SC3A 5FF9A 3ONDA 4BJ5C 1I9GA 4JGGA 4EG0A 5DWDA 5EIEA 1Y4ZA 3IVGA 3O3NB 4QBHA 4U0WA 1V5WA 1XRJA 3AUKA 4DNQA 7YASA 2UZ1A 3ENZA 2WTUA 4BXXJ 3LUHA 3WU2C 4OOIA 1ZDMA 3KJXA 2EINH 5DM1A 1RABA 3R3SA 4MR8B 4Q3KA 5EE0A 3FDIA 4D97A 3HZZA 3RWBA 1XTKA 4TRRA 2QZ8A 3B3FA 4X3CA 1T3LA 2OQVA 4C7OB 2CHEA 1H4SA 3TTTA 1DBIA 5HS8A 3IQIX 4IKPA 3SYMA 4CUKA 5JFOA 2PX2A 1Y37A 2H1VA 2X4HA 1NJ6A 3BWMA 4MI9A 1F8GA 3LF2A 4ZZ2A 1XU9A 1BOBA 1PTKA 2E4VA 3FI9A 4MS3B 4L78A 2J3JA 4H1WA 3KT6A 3IE2A 1ZMXA 2CQQA 1DKMA 3L41A 2IVMA 1EWTA 1W49A 1Z9BA 2IF2A 2OKGA 4KQJA 4B4OA 4B3HA 3RYPA 4Y52J 1L7XA 4IIYA 4BVLA 1DGRM 3NNDA 3ZVKA 1PJBA 1RMYA 4L95C 2OV3A 1BC7C 1MSEC 1QIFA 4KAXA 2H94A 5B5EC 1FOEB 2DFDA 4ROSA 4DCGA 5FORA 4PFSA 5HLIA 4LQCA 1SVNA 3M3HA 3P5JA 4HBGA 4DWJA 2D1VA 2DOAA 3QYEA 3P20A 2YW9A 4E94A 5H2FC 1ECBA 1LX6A 3CUQC 1RRGA 1RFLA 1EHCA 2B98A 2WYUA 1NW5A 1LFPA 3ZHUA 3RIEA 2YV3A 4DMKA 1OUMA 2IW1A 2PS1A 3DGFC 2G7HA 2HCBA 2R6DA 3DL4A 4TTJA 3F8NA 3I1YA 4YJ2B 1VQKI 4BL5A 3FE2A 4I81A 4MAMA 4QQKA 3SEAA 1U0TA 3JZIA 1N1DA 1H42A 4DNCA 4DHWA 1YZTA 3O84A 2MSKA 3R41A 4K6KA 4BNFA 4TTVA 4UHJA 4TMVA 2PYDA 5L4LA 1P61B 3UWSA 2ZO4A 4GT1A 4O4JB 1N2SA 5DSTA 4U0JA 5SV2A 2PK3A 3RUPA 4OHUA 4BL0B 4BBSJ 1BRMA 3SQWA 4JYAB 1LPPA 1Z0UA 5E4TA 2OCDA 4Z1MD 1QNFA 1H2BA 2FXIA 2X77A 5CA0B 2WAAA 1XKLA 1RYYA 1RPNA 4JR1A 1P33A 1VB3A 1QYIA 5DHAA 3SZUA 1EVQA 3CIOA 4KO2S 2HA3A 4XLLA 4CDNA 4C9YA 3BY6A 3B5JA 5CA1B 1JVBA 1L3IA 1R2QA 3G1WA 1WHTA 2EXXA 3TLBA 3WGTA 2QSFX 1YRWA 1LDJA 1TAUA 2QOEA 3ROZA 1MQAA 2OD7A 1FEZA 3U7GA 2I76A 1KY5A 2DWUA 3NHMA 2H29A 2GJ8A 1NUHA 1ZRMA 4K6OA 4LPSA 3TXYA 1U2WA 2NTYC 4ZAVA 3NIWA 4C7MA 1GVNB 4B4UA 2X0JA 2E0IA 3P0IA 4NFHA 4M37A 4B5KA 4V1CA 3H5LA 1GZDA 2GAAA 2QT1A 4A1OA 2XRMA 4CEHB 1IN1A 3M6UA 2W2LD 3HWSA 3OP1A 1IDOA 3GUZA 2VWHA 1NXQA 4ZDWA 3RJTA 7MHTA 1DO0A 5IDXA 2HGZA 2L7KA 4IHWA 4NQWA 1JF8A 4M1KA 3QG1A 1KI2A 1P1JA 4NESA 5AK3A 3EMDA 4B3TB 5J5VA 2MWMA 4CGYA 1UMDA 3KZYA 1ID1A 4E7LA 1C3LA 3FTQA 1MH3A 1F2TB 1TM3E 4I1RA 3QY0A 2WOOA 3PX7A 3LDUA 3PSFA 4Y6OA 2QQAA 2CLFB 3GZ4A 2ZRBA 1JEYB 2I4NA 3CW8X 3EEBA 3I4FA 5TQ0A 1VE3A 5TPWA 5H4HA 1VQMI 2R93J 2ZBPA 3LYAA 2ZE7A 3LKVA 3R3HA 4DTIA 1Y5RA 5ITZA 3V48A 5J4YA 5TQ2A 3R9XB 4N5LA 5DCWA 2JSCA 1IY9A 2VKTA 1CRWG 2QD5A 3WP1B 2I3GA 1WPKA 5IHPA 3E4CA 3I8XA 3H3UA 4N41A 1GDDA 2CMDA 2FWMX 3SMVA 3T3PB 1H0MA 3OLCX 1OISA 3E1SA 1VB5A 3B1FA 1I4TD 1UT5A 2WHPA 3HLTA 5CH8A 3EQ8A 5T6MA 5J2UB 4GPIB 4P4TA 2V45A 2Z8YM 3RKRA 2ZR0A 2H1CA 3O8NA 3RFFA 3V8PA 2G7ZA 1D5VA 2C00A 1DO8A 5ELMA 3FUXA 1IY1A 3BP8A 2BGUA 5FBHA 4G1CA 4KR3A 5D5PA 4FDVA 3NUQA 5EG0A 1C0PA 3QYFA 4OU0A 1LVUA 3KTOA 3I2KA 4J94A 5IEBA 1PR0A 1GARA 5K2MA 2A9VA 3NHLA 4DV4B 4JEHA 2DT8A 4F3YA 1I94B 4Y2TA 1GGKA 5BQFA 1F8UA 5EJ7A 3FTPA 5KVRA 3LZCA 4IIJF 5DW0A 2ZKLA 3W8DA 3FAZA 3FUTA 2Q0XA 3QEJA 4WZBB 1H4QA 2VXDA 2H6CA 2GPAA 3UCXA 4YMLA 3QVMA 3ENVA 7REQB 4CN9A 4KVGA 3IP9A 3L0OA 1E0DA 5JCOC 4UM8B 2ZCWA 1TF5A 3Q9UA 5KYVA 4C43A 4KE6A 5DEQA 3WAKA 2VT3A 1JPNA 1O6ZA 4D3XA 2Q5QA 1EZ1A 1T9ZA 3C24A 1YZYA 2IZOA 3THYA 3MWLA 2GTHA 3IDSA 3PPIA 1IUKA 2AQIA 4PV7A 2KZGA 4JIMA 1AKEA 1FUKA 4Q1CA 4KI0A 5FI1B 1SXQA 1U1FA 3N58A 2KHMA 3HMQA 2NQTA 1CY6A 5FTMA 3ZS9A 1L7EA 1FDRA 1OVMA 1U9CA 2GPTA 3PDIA 1WF3A 1QDUA 4G63A 3FTFA 2H52A 4J6FA 4IIEA 4M54A 1H2HA 3FMOB 4W1PA 2GDJA 1HE5A 3C18A 1BW9B 3QVLA 2VUUA 2YWJA 4QELA 3X3HA 5HVNA 1ZJWA 1I7QB 2LKSA 3U3MA 1WI9A 4RJTA 3NAUA 1Y34E 2ISCA 4MFDA 3R6SA 3TOVA 2ID3A 4TL7A 1RACA 2VBGA 3GARA 3MB8A 1L8AA 2ZXIA 1K98A 1RHUA 1V37A 3CEMA 3IP3A 2NO6A 3MLEA 1E9CA 4MGHA 2BXYA 2C4MA 4Y9DA 5DFAA 3QP9A 1W8IA 4FX4A 3GLGE 4HPWA 1JLSA 3GGOA 2W48A 3ZDXB 2ZUEA 2VEDA 3DE4X 5CDFE 3ZJUA 1J9IA 4TPKA 4DY6A 3G2OA 4QUJA 2XE8A 2FDRA 4N7BA 3GDWA 1IN4A 4DOMA 3RRNA 1AHIA 4R1TA 2XGXA 4CM8B 3KYLA 4YO8A 1LF5A 1I2BA 3IHKA 2Z5LA 3LD9A 1N3YA 1JPJA 3FZVA 1SOUA 1KFCB 2PO5A 3I3SR 4W5WA 1OAKA 4XDHA 3UK6A 1A4XA 1JTEA 2DE0X 2G9ZA 1L4HA 2L2QA 2XQIA 1SXJC 3OEWA 5CB4B 3UT5B 1GADO 4RKWA 4ZYGA 1PBNA 4OI0A 4PXYA 2LY2A 1JU3A 1JI8A 1PL6A 4NQZA 3KXPA 4AX4A 2GJAA 2BVNA 3C6MA 3PLNA 1XAIA 3ZGXA 3LFHA 4B32A 4UC0A 2CCJA 3BBLA 3CHYA 4UU0A 3UT0A 3A3OA 1AV6A 3D64A 1B42A 3OJ0A 3GB9A 2V6FA 4UDXX 5EOVA 3VVMA 2DU9A 1QG6A 2I9PA 2UUAB 2QS9A 5KU1A 1VPDA 3DPIA 2KI5A 4Q9IA 3UHOA 3OOSA 1C7RA 1HQYE 4OREX 3V4PB 2AD1A 2VA8A 3CCFA 4JMLA 2JIQA 1K6XA 3HGYA 1QPGA 4GNKA 3DMGA 1PK9A 1HEYA 2FUKA 4FZJA 4GE0A 4J43A 4PZLA 3I0NA 5JY6A 2I66A 1HNWB 4RGXA 4WJZA 4BJ6C 3CONA 2OXEA 3RS2A 4Z9BA 1WJDA 5JMOA 2O8CB 1UFQA 1ZD8A 1Y8RB 5H4GA 5C2JB 6GPBA 4NOJA 1AG9A 5AVZA 2XUAA 1D6SA 1JAIA 2PL3A 3EIOA 3LKDA 1FTSA 4NDNE 3BGDA 4P5EA 4YRFA 1Y6GA 4IP0A 3U09A 1XZEA 4DV3B 3C8ZA 3K1MA 1W34A 4R2JA 4N5IX 3F8FA 2HJRA 2OZVA 3I6ZA 4DCUA 1S2IA 3IAUA 1OXKB 3VYRB 2IPXA 1ORWA 4HV4A 1XMVA 2BFCB 3CPHA 1E7MA 3H4VA 3NWPA 3EQLF 4S0HB 1KZ6A 3QLUA 4I09A 2WT9A 2Z57A 4EJWA 5HW0A 1BXGA 2QU8A 3ADDA 4LPKA 2PZAA 5L4SA 1W87A 2IDKA 1T5TA 2YV1A 3KRTA 4N9IA 3IA2A 2XAUA 3HU2A 1BR2A 4WJLA 1Z5UA 1EVEA 2PGLA 1OY1A 2P90A 1Y8RA 2ZROA 2X85A 4MULA 3NGXA 1H9GA 2FU5C 4TLAA 5LGTA 4KK3A 5K6AA 1CWUA 1L2TA 4K9RA 1YNSA 5ALSA 4F9TA 4AKEA 2V3WA 2XCIA 5TDHA 2O8KA 3R40A 1CUCA 2H51A 5LQKA 2PA0A 4YCSA 3E70C 4GPTA 4WK4B 4CLRA 1E4EA 3O0DA 5HDBB 1AS0A 5DNDA 3NC4A 5HYVA 5KINB 2J6HA 5DSZA 1FJGB 1THMA 3C6QA 4MUXA 4QU9A 3B6AA 4X1IA 2PGJA 1E6CA 4MVJD 5E38A 4Z86A 3FWZA 3WK9A 2OJED 1V8OA 5HUJA 4YQZA 4HOBA 2ZCVA 3G0IA 2ZAIA 3BR1A 4J0JA 2LWIA 2XOKD 3MVEA 4B80A 4MQEB 1XHEA 3L2UA 1LC3A 2JGIA 2NXCA 1LDNA 4EF5A 5CB4A 1GCGA 2P0EA 3P2MA 1CZNA 2CWEA 2A0XA 3EUWA 4EQ6A 4TX1A 3EXIB 4CCKA 4ZU6X 2OCEA 3GH3A 2VJJA 3T3DA 1RLOA 4BZPA 4DW8A 3WBKA 1G5HA 2UYYA 4LQ4A 4LLGF 3B6IA 2I2XB 4W99A 4FX5A 2XDAA 3DEIA 2NS8A 3EYWA 4LYJA 1PNQA 3K4PA 4JT9A 1E69A 4MW6A 4K88A 3VOSA 4C6SA 4BYYA 3JVIA 2PZGA 1VHLA 3BQZA 3GDGA 2BFEA 1XO1A 3NFYA 4YPFA 2CMKA 2B7CA 2VHWA 2JG3A 1NVWQ 3MWGA 1D2RA 2XCRB 1GXSA 4V0QA 3UAOA 4RGUA 4JBAA 2YFYA 4RMIA 4YUVA 4B74A 1OXMA 4TYQA 4DCSA 3I71A 1ATZA 5ICFA 2EJUA 4PGMA 1Z7GA 2UZ1B 1NA5A 1WUIS 1HTBA 3FMVA 1A97A 3LC7O 4FEEA 5CA1F 4L72A 3H13A 4HVLA 3HKCB 5J2TF 1YUNA 2JBHA 1MTOA 2VJMB 3ROMA 4DWOA 4XX0A 4OHKA 2JPDA 1BZYA 3KYCB 2AFHA 2YJGA 4W97A 1WBJB 5C1IA 5D5HA 4BZQA 1IVNA 3CCSI 3NNSA 1N9GB 1FNDA 1K9VF 1UH5A 1P7YA 2LBFA 3CRRA 3K5WA 4JOSA 4M0LA 3RIXA 2KJCA 1YX3A 1E1RD 2YV4A 3LSTA 4RJ2A 4YECA 2O8BB 3FXUA 1XCOA 4KI7A 4G85A 1M66A 3P9ZA 4LI3X 4A82A 1CR4A 5K0JA 3W4KA 3EA4A 4OYLA 4CTNA 1DC8A 1U78A 4G5YA 5EPOA 3ENQA 3H18A 1JQDA 3O1LA 4KL8S 4X92A 1Z5GA 4OMFG 4ZCTA 5KSYA 2ZYHA 5AYVA 1D03A 3UV7A 1A9YA 3EXG2 2ECFA 5IY5H 1MX1A 5ALZA 2IW3A 3FX3A 1FYKA 1WUTA 3EVCA 3KXDA 3L1VA 5M3BA 2PD6A 4CTOA 1U6JA 3FZGA 3JSOA 3MKZA 4MGRA 1TPYA 2XUOA 1JNYA 2YY5A 2TRSB 3OE7A 4GMXA 5CXXA 1IGNA 1FNCA 1P0MA 2J5XA 2QM3A 4JVNA 4ZZ0A 4PR0A 1FVXA 2C82A 2PL1A 3OY2A 4EEFG 3PFWO 3IO3A 2GPNA 3LLVA 4N4AA 5FL7D 3DL7A 2W84A 1E9VA 3DL2A 1SHTX 2A5WA 2OO3A 2WMDA 2Y2UA 1DTSA 4A6EA 3WE3A 1O3TA 1C9NA 1D1TA 1JYEA 1KYQA 2ETXA 4GXTA 4QOGA 4QSMA 5EYPA 4OX9B 4UUMA 1G4HA 3PEEA 4DMGA 2HOTA 3JALB 1MT0A 4HLQB 5DD8A 4XEHA 4C21A 5CFQA 1C0LA 3QE9Y 4MOWA 1LSJA 1W5CC 1NN5A 1ZBDA 2O1EA 2X8BA 3IQZA 4EW3A 2B9EA 2I4RA 2VIIA 2Q62A 2ZSJA 3O95A 4JD5A 4A16A 3KTAB 3L7MA 3PO2J 1LRKA 4D79A 1UM8A 4BB0A 4GO1A 3QOFA 3B48A 3NP9A 2V0GA 1YZFA 4KB5A 2A4KA 2CYAA 5K01A 2ZI9A 1PFWA 2V0NA 3EN0A 3FYDA 3KDSE 4NMXB 1TQMA 3A01B 1ISJA 5T5QA 4DUYB 621PA 5IT5A 1I0LA 1IXSB 1XSDA 1FK8A 1NW6A 1YR2A 1MMSA 1QH1B 2C5EA 3OPNA 1A27A 1Y6FA 2Z6QA 4JI0B 1JXOA 2VPZA 1Z2AA 2DJ5A 4G0QA 2GXSA 3D6AA 3ON5A 1NATA 4NAVA 3NCTA 2L7FP 4RK0A 3T7CA 2HLDD 3ZDAA 4OGGA 4WH0A 1Z0DA 2JJMA 1NE2A 2WJPA 3ZGVA 2JGFA 4ZOQI 5KTNA 3RHTA 3EPLA 5F0CA 2UUOA 1MJBA 3LCUA 1Q1AA 3MCUA 5U4XA 4PTYA 5CNKA 4UBNA 2PT9A