4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQNA 4BQOA
chains in the Genus database with same CATH superfamily
1R6AA 1FP7A 3R0IA 1PE0A 4L74A 4RM3A 2X4GA 3BJEA 3QHAA 1GCOA 1XTPA 4FXPA 1X80B 4JVOA 4KZKA 2AUTA 4LRTB 1R0KA 2XPWA 2X40A 3GTOJ 4G9YA 2AMYA 2AMLA 2FRDA 2ZBFA 1X8LA 3TYXA 4GG1A 3IIIA 5CNJA 1I5RA 1O6CA 5HIIA 1FZQA 2JJ2D 4Z1OA 4GH5A 4EY6A 1NUTA 2JGFA 3QOYA 3OLWA 5IM5A 3E84A 4MQBA 5FBQB 3ZU3A 2MYTA 2PR2A 4HN4B 2F5DA 3HL2A 4HV4A 3H87A 3JWGA 2XE8A 4RAQA 4RLQA 2P5UA 3VMFA 4ON0A 1VQ8I 4DLXA 2R6ZA 1A04A 3SICE 1IRZA 2Q3DA 1JU4A 5KYXA 3ZHCA 1W5AA 2F4VB 4X6XA 3N8IA 4QVGA 3N0WA 3EY4A 3OPYI 2BXYA 1FCJA 1D7AA 1NPYA 2CNWA 2ZYDA 3EA0A 3PQEA 4JMLA 1Z05A 2VPLA 2C3UA 4CFYA 3V7FA 3S7ZA 9ANTA 3HEBA 3H3XA 4OLJA 2PMHA 5UKDA 1R0RE 5FCDA 3ZWWA 1KQ9A 1X3ZB 4MNUA 1SHKA 2G88A 1OFGA 2HEIA 2QHXA 4MW1A 3G6EI 1GZ5A 1KO4A 3L49A 1MOPA 4UHHA 3KKLA 3ACCA 1SXIA 1RESA 1DRUA 2UUZA 5K7HA 1N2GA 1SQ0A 3HLTA 4NICA 3DPLC 5H83A 1ZLKA 3U81A 3ELDA 3C6KA 1EZZA 3SXJA 4HF2A 1VQPI 4G5GA 1A6QA 2FF5A 3LIPA 2W85A 2K3FA 3GPIA 3DCIA 2V7PA 1IXRC 4EM0B 1E4EA 4AXXA 4HDNB 1SC7A 2DA5A 2XWPA 2FWIA 2V6IA 2O1SA 2FZGA 3NNSA 1HKTA 5FPPA 1BE1A 4LZAA 3BA6A 3NHPA 1M34B 1ETVA 2ZE7A 3SJBA 4FYJA 3CGGA 2ZBKA 2G09A 4MWGA 4RCZA 1Z82A 5EXTA 4DLNA 2YMPA 2LBFA 2DAPA 2GXGA 2EW2A 3AC0A 1ZELA 3P0IA 2YDXA 1G59A 3PWTA 4L4XA 5BV0A 2CJWA 4NE2A 3VQTA 3VR1A 3OFNA 3LBHA 3URKA 5F9FA 3K9NA 1NVXQ 4HSRA 4RVHA 4GYIA 1XLTA 5A6VA 2OV1A 3L79A 2H4JA 4IY1A 4LZPA 4IKOA 4N9HA 4YACA 1FTNA 4GBGA 4O29A 1NGSA 1RAGA 1T3HA 2XSJC 5EPEA 3HGMA 3RIEA 4OMUA 4IRUB 5D51S 4B8WA 5KKCA 5TPZA 4J07A 4Z49A 1NPDA 1CUGA 1TQ4A 4ZQBA 2JJ7A 3SFIA 1XAHA 3DE6X 1W0TA 3L4SO 1N5LA 5CIQA 1F2TA 1T1SA 2CFSA 3CUTA 3MJ4A 3PEVA 1F9NA 1R88A 2C2MA 4ZT7A 4MDHA 2FGKA 4IFIA 4R81A 4BE2A 5BT9A 3WA6A 5B7NA 1SCUA 3L07A 4B4KA 1HFKA 2F1RA 2OR3A 2X6OA 2XV4S 1JXAA 4FFBA 1OLSB 4J0GA 3UF0A 1P3DA 2HRBA 1WTAA 4CCWA 4LG1A 1A88A 1UWVA 1XZJA 1Z6XA 3KK0A 3LBFA 4P3PA 3BE8A 3BRWD 2QTNA 4EFLA 5HQ3B 2D4AA 5ILUA 1VC2A 2HA2A 3JYNA 1XS9A 5LP6C 5C8YF 1S9HA 1O94C 1RACA 1J56A 1FNBA 5KPDA 2N47A 1MBEA 2X0JA 3OCUA 2ZROA 4H6WA 5D7BA 1I6XA 1AD2A 2J0UB 3WGIA 2EW1A 3KC2A 5FI0B 3BJMA 3SLGA 4CKBA 1PZFA 4DKJA 5HF5A 2V5VA 1O1YA 1R58A 4R1OA 2CUTA 4ZDWA 1POGA 2CFXA 1TJ4A 5M5BA 2FSSA 3H7AA 3NDPA 3QWBA 3T3PB 1K7XB 4AX8A 4D9CA 5EIEA 4TZ0A 2GD1O 4FFSA 4ZMRA 3DTVB 3O83A 3N5KA 2CXPA 3SY8A 1W46A 2OC6A 1QO7A 4IDQA 2VQHA 1H94A 5IBQA 4QNMA 3ROPA 3RRZA 3UHFA 2WUFA 4LRWA 3QVUA 5ICFA 4NAVA 3RWOA 1Y5LA 4AKIA 2P65A 1G55A 3W6JB 5IVPA 5A5EA 3OLVA 1SZCA 2GQ0A 4P7KA 2NPOA 4QASA 5EJ6A 4MW9A 1LGYA 4EA7A 3RVDA 4F8YA 2WAFA 1ECBA 2QUBA 3ON5A 5A6SB 4BB5A 3HI6A 3IH5A 3LX5A 5LP6A 3GTJJ 1D2HA 3QNMA 1VZ2A 1ZD9A 4MB0A 3SS8A 1OXXK 4AVZA 4W82A 1T38A 3LAPA 2C4KA 3A6LA 2SNIE 3FHOA 1YQGA 2EJBA 3L0DA 4N54A 2LMDA 3Q5DA 3HXKA 3THYB 1F1ZA 1RJ9B 1R4AA 2HLHA 1OCPA 3DYBA 4YIIA 3ABOB 4XICA 1QK4A 5DV5A 1YAJA 4O5AA 1ZSYA 2VSYA 1PTKA 1ZARA 2TMGA 5D5HA 1EVZA 3T38A 4WINA 1D3YA 2DTEA 1C30B 4YJGA 4UHEA 3Q5EA 5KQSA 3BKXA 4FQ8A 3A1NA 2EZLA 3SXYA 4M8LA 3F98A 4GRDA 3QQAA 3KL2A 4IHYA 4LJKA 2GLUA 4YFNF 3HU1A 4FQ7A 3SKXA 6PFKA 1Q20A 5K7FA 1LSJA 2I5UA 2GETA 4B0OA 3M6IA 4XRSA 1CFZA 2QW0X 3WOHA 1CVLA 1I4EB 3BE4A 4E2FA 5BQ3A 1E4VA 3FMQA 1QBKC 2BL4A 3O84A 2I03A 3IMEA 3S70A 2JH8A 3AEQA 1DC7A 1EX1A 3QU6A 4HOYA 1U31A 2IXTA 2DODA 5L7WA 3S17J 5JCOC 5L3BA 5ES4B 2AJCA 5FLVA 1XWIA 1BFDA 3C3KA 3FJYA 3GIDA 3NQ41 5K3AA 5CA1A 4DEVA 3JQBA 4BC0A 4R2JA 4B43A 2RC5A 2DFKB 3M7IA 2OCKA 3OP4A 4CGYA 1V11B 4KBFA 2G1JA 3SF8B 1Y5IA 4UQLA 2DMUA 2QR2A 3NC1C 3JZFA 3WNDA 5B57C 1UPTA 1ZH8A 3HNRA 2P4SA 4RE6A 1VQMI 4UHDA 3RRXA 3M81A 3OQ6A 3OYHA 3GARA 5AR1A 2GZ2A 3UB3A 1Z3CA 1MVNA 2VZEA 4YJGB 5AI5A 4YVFA 5IEBA 2YNMA 4DUZB 3W5HA 2D7DA 3HEMA 3QXJA 5H1YA 1DV2A 1PFYA 2IYUA 3RCBA 4D02A 1SD1A 4OJKA 1QE3A 2BISA 5B1IA 2DOFA 3EN0A 4RACA 3NWSA 1SG0A 3H8SA 4E07A 2C0QA 5T6BA 4LITA 2HYDA 4NSNA 5ALNA 3R9WA 1RHMA 3SNHA 1OV4A 3RD5A 4J3JA 3RVRA 1L7DA 1BHSA 1D1CA 2E60A 3W04A 3W3ZB 5BQFA 4YY3B 2R1TB 3TMOA 4XVRA 5H80A 3KP5A 3BF7A 4DAOA 1GRNA 3ONQA 1HTBA 2A3RA 1L5MA 2WIKA 3ENVA 3RU3A 3VZSA 4N40A 3SE7A 4MX8A 4RPJA 4ZDOA 1U0HC 1YI8A 3T3NA 1FW6A 1IQPA 2FZCA 3UAWA 2J3KA 4LMYA 2BVLA 1XEXA 4Y3OA 1K8ZB 1N5MA 2BW0A 4RLHA 4ROTA 4WY2A 2DY0A 3U3OA 3W3AH 2Z6QA 1O6GA 5C53B 1GRRA 2QRNA 4N12A 4XSVA 5EQJB 1HTWA 5TGTA 2FNAA 1DX9A 2CXQA 3QELB 1PDWA 4JYMA 3GLTA 3SYTA 1Y80A 4K03A 5LNK1 3EF1A 1QQ6A 3LT4A 1Z36A 4PC7A 2GEKA 1SURA 4UU7A 4HSEA 1JHHA 2H94A 1DUVG 1Y9JA 4RZUA 4DA8A 2NYAA 3B60A 5AW6A 3O2QB 1B72A 2EBFX 1B43A 1OWMA 3Q3SA 3DV0A 3LDFA 1E3HA 2ZIZA 4M0CA 3LKDA 4OFXA 5A3JA 2XRZA 2GNAA 2LDBA 1P1IA 4XYMA 2WTAA 4QRDA 3KL4A 3DAHA 4NFHA 4I36A 5AKYA 4C06A 3R8CA 1C1HA 3ZXUB 1AOXA 4I1VA 1AS0A 1EWYA 1TKRA 2ZCVA 5BOVA 2PJUA 2EQRA 3RJTA 1PTJA 4IZIA 3G3ZA 5K1YA 3QPLA 1PT6A 1FFHA 2K5UA 2QMYA 2GAOA 3X1XA 1EG2A 1WKMA 2R86A 3EOZA 1QFSA 5F1YA 1LDKB 1RI5A 2BFDB 3S3TA 3QF4B 4M3EA 1A1SA 3PR1A 4QQRA 2DB3A 5U9CA 2STTA 2VH5R 3VB2A 2OXCA 3TZBA 1K61A 1FFEA 1RDFA 2BGKA 2QGZA 1J06A 4LA4A 5AKLA 2VUHB 5FNVA 3TLZA 5FH9A 3HVRA 1UG2A 1PJQA 2EZUA 3PQ2A 4CV0A 4AYTA 4Z3KA 3S8MA 2OPBA 2WKSA 1R5ID 2HEGA 2Z1NA 3Q9UA 4MA5A 4JXKA 4PR0A 1RM4A 2FP4B 4EH1A 1GQOA 3AVWA 3VKHA 3WJ2A 1X7XB 1O94D 2WUGA 3H2ZA 5IYZA 2YV2A 4N8DA 3VPFA 4X65B 1HKUA 2QZ8A 1XC5A 2BFMA 2P67A 1BS2A 2EFOA 1MAAA 1T4MA 1SIUA 2VDLB 5JCJA 9LDTA 1MEOA 2FPLA 5HQTA 2A5DA 1TUGA 2FH5B 2NVBA 3CZCA 3FF4A 4REQA 4X91A 1VQ9I 3HRKA 4WFIA 1MJFA 1RZ3A 4S2EA 4ZA2A 3TZHA 3AXTA 5ICGA 1FP4A 2BOVA 3GT0A 3UCXA 1AN0A 5L3QA 3DTKA 4LEIA 4BE9A 1RETA 4K9KA 4EB6B 2PMDA 4ETMA 2XUAA 1ZOPA 1TC1A 3ILSA 1BX1A 2Y8EA 4QO7A 4WNYA 5FQOA 1UODA 4NU5A 3CJRB 3AGPA 4C0XA 1K0UA 2CMKA 4PC2A 4ZYDA 3C4QA 4NRDA 5ALUA 4CYCB 2YWHA 4IIYA 1VLHA 4XM3A 4UC0A 5MN5A 5KOYA 3H5OA 2UYCA 2GJKA 4KQ6A 2HU8A 5J2TB 1ULUA 2XNCA 4FOSA 3DMTA 4LOKA 4PHCA 2A58A 4D4IA 2WJAA 1XGNA 3RCOA 3MYYA 1KEUA 4P4UA 1JHDA 1XUOA 5CX1B 2ORED 4C5CA 4LCBA 4DMFA 2VHWA 1JFTA 2KZGA 5IY5H 3T3OA 3OHMA 2OA0A 2C5AA 2PGOA 1T3LA 1WB5A 5TQJA 4B7AA 1GY8A 4EHNA 3RIMA 4ZYXA 3KE2A 5TMPA 4Z2YA 2MBFA 1ZNWA 1J8VA 2ODWA 4IV5A 4HUQA 1ULYA 3ZDAA 2JFUA 2C9BA 2VP9A 1Z73A 3I62A 2BGRA 1I3NA 3H2HA 4GM4A 1GGVA 2R79A 4KYTA 3Q98A 1AWCA 2EDCA 1UXGA 1SUSA 4JJZA 4MLPA 1IUFA 2I7VA 2W00A 2XMQA 1MIOB 2FEZA 1I1NA 3M49A 1QHHA 3ZIDA 1WMFA 2GM5A 3NETA 1PX2A 1E3WB 4PVCA 4H0EA 1X94A 4DDVA 2V7UA 1M3SA 1D5YA 4QHYA 3FDZB 4G6TB 1PGNA 2WTMA 2YUIA 4GP9A 4ARBA 2VQSA 4MKHA 4DIFA 4ZDKA 5B6IA 4CCYA 3ZTWA 3NBXX 1T0UA 2OEPA 1AJEA 1BW9B 3L6BA 4MULA 3FSEA 8ABPA 3IJRA 3JQ9C 4FYMA 4KA4A 1XNQB 4RVSA 1RRVA 4G0VA 2ZC2A 3GJQA 3FOEC 1E94E 3NWPA 4I1OA 3H19A 1DPFA 1ECCA 3ECCA 3OD1A 1KDOA 1QCDA 2DFDA 2DMPA 4JA2A 4MQMA 1DJOA 1HLGA 2A0WA 3O8QA 4R7ZA 1DKOA 5EHZA 3B9PA 3P97A 4YDQA 5EIXA 4XOIA 5K2OA 1IBRA 2ISCA 1K79A 3HA2A 4HPXB 4DCUA 3U9SA 3VRHA 3WIVA 5JY6A 1VHDA 2A3NA 1MRZA 1UZLA 2R4QA 4OYHA 1EFTA 2B9EA 2VSNA 4MQLA 3S2ZA 1HK7A 2HADA 3WQBA 5GTHC 3EJ6A 3HEAA 4R1TA 4BJHB 3WIOA 4ZEVA 1KZ6A 1Z3IX 5LQKA 1JMYA 2YVUA 4L5AA 3IURA 3KJQA 4AVYA 2YJ5A 4PZYA 1R9TJ 4RKFA 1GYQA 4DQ0A 2PS3A 3IPXA 3IBGA 2H08A 4LOCA 4NXMB 3UOGA 4R6XA 2ZUTA 2FK7A 2IF2A 4J43A 4RH0A 1Z2OX 5AKEA 2WJWA 5EWMA 4RLFA 4GKJB 4UDYX 4JUAA 2PRIA 1XL0A 3GW8A 1W34A 1LTHR 4ZKEA 2PJPA 1H6BA 3KB8A 4ITUA 3K9TA 3DCJA 3IV9A 1LJ8A 3EPPA 2OO7A 3K3PA 2JH3A 4CYMA 3EQ2A 3U17A 1EWVA 4EJFA 5A02A 3B82A 3PQ8A 1F2UB 4B74A 5IFKA 1ADJA 3DAOA 3EQ6A 3OQPA 1YL6A 4EPWA 2BONA 3GEMA 2IZ0A 1MX5A 2QSZA 2PUTA 5FLKA 1YJWI 1HKSA 1H2WA 2V6JA 2GD2A 2QVBA 6Q21A 4A5SA 4I6JA 2O2ZA 1RYNA 3CB2A 2P75A 3O3CA 5ECYA 1UJ8A 1W19A 3HUGA 1GA1A 1H2ZA 2JW5A 2VKTA 1PYVA 3FTNA 2V7VA 3AEUA 5KNBD 4P2GA 1MABA 6PAXA 1V4NA 2CDCA 4MEBA 4DV4B 2IS6A 4MGKR 1FLIA 1GYPA 1GZ6A 2BHNA 2PJRA 1RTTA 2OO3A 3BWMA 3TKLA 4AQDA 3VZRA 2O03A 2NSYA 5AJUA 1Q5PA 1XSDA 3EZNA 4S35A 5GV7A 3O82A 3GVAA 4XMYA 2POQX 3F3SA 2Y0DA 3PICA 3U1KA 5JRJA 3HOUJ 1LD3A 2HJGA 2COMA 2O3UA 3EEFA 1D2AA 3MLEA 2LRDA 4D92A 2RD2A 1Y3IA 1R1VA 2FMXA 5DM60 1QM5A 3Q7TA 1N8TA 1TB4A 5AVJA 3EVZA 2GX6A 3W2TA 2YJ3A 1RXSA 3IP4B 2I1WA 3QA3E 4ETIA 4NYIQ 3EVGA 1DWQA 1AGXA 2BFNA 2DR2A 3AM1A 3UG6A 3CVOA 3L7BA 4ENSA 1JE1A 5ERGB 3V4ZA 2R5WA 2OZ6A 1DAHA 4AJ9A 3C4JA 3EYYA 2L7MP 4Y2SA 2HC9A 2BFEA 4Q4ZF 4S1VA 3OPYA 2P90A 5KWIA 4BNDA 2ZXFA 3UHPA 1W0JD 4N3NA 2E2HJ 2P40A 4WV3A 3ZK7A 5KINB 2NPFA 1QYXA 4OJMX 4MPRA 4W1SA 1XN1A 2XRFA 5DGDA 5ALLA 2VOOA 5ICEA 1YR1A 3V34A 2O14A 5TQVA 3ROQA 4PAQA 4RA9B 4J3NA 4ED9A 4IOJA 2PUGA 2M9MA 5FXMA 1TPYA 1Q0PA 3WO0A 2M34A 1T4GA 3OF5A 3D3WA 1UK8A 4J16A 3LBAA 4K46A 4ROSA 3ZH9B 4ZIRA 2DOAA 2YS7A 2BIFA 3HXOA 1YF3A 1J0AA 3LL7A 1YDWA 2L0XA 1SXJB 5T3UA 4XQGA 1MX9A 1P2BA 4YJHA 1CG6A 2ONJA 4F93B 1TD1A 2DEUA 5ESRA 3HZJA 3ZR8X 2QL9A 5E4YA 4K3UA 3WAGA 4MUNA 1CEYA 2EIJH 1BWQA 2X0EA 3T34A 1FSGA 4IQ8A 4I3GA 3I58A 1G8KA 2JHAA 2CQXA 2QROA 3RS5A 1FQJA 1X13A 1ZIYA 2OD2A 3GDWA 4YDSA 3N86A 5IAKA 2HR1A 3G2LA 1EH7A 4BY1J 3GCGA 1ISIA 4GI3A 1LLFA 1I3MA 3IUEA 4XUEA 4QWWA 2BM9A 4G1BA 4IHJB 3OJOA 1B15A 4IF6A 4R2KA 5DYNA 4A4DA 3UXMA 3IDAA 1U98A 4YFVA 1VNDA 1D2CA 4JEUA 3AJDA 3CR8A 1LQTA 3D7MA 4FSHA 1A9XA 1GT91 3W2EA 5LYJA 1JL3A 4KDEA 4TV8F 4DARA 1Z4LA 1K7AA 5A2QZ 1II8A 2EJCA 1GG2A 1O7JA 3L7CA 4BQOA 1ZK1A 2VPIA 1S9DA 3KQWA 3MCUA 4RBNA 4AC9A 2L5QA 4DSTA 1BXZA 1KBQA 1QIMA 1PP8F 3D3WB 1SHLA 3FIJA 3S2GA 1RQGA 4YRNA 1CR4A 1WBDA 1M8KA 1HGXA 1D7OA 4WBNA 2NAFA 4BYYA 1KJNA 5K0FA 2VLAA 3DTYA 2EFCB 1RC0A 3TSYA 3RKQA 4OAPA 4RKQA 2RHGB 1F1JA 1QO0A 1JGGA 5K3DA 4YHHB 2E1CA 5JISA 2IXEA 4RXMA 3T4UA 2IDZA 4U7PB 2H2FA 1EJ6A 3N7UA 2BKAA 2FXAA 2QUIA 1QYIA 4IJQA 4QJ4A 5EIAA 3WIEA 4CCSA 4HDKA 1WAMA 3EFEA 3QXCA 2JA2A 1WF3A 4CSWA 3BXHA 1GXSB 1I33A 5IK2D 1MNQA 2CHUA 2QTGA 3OQHA 5EXSA 1RPWA 2XB8A 3S1LA 1TEZA 2F4IA 2DTXA 3CCSI 4ZU3A 2DFNA 1GITA 1E5LA 2Z04A 4IVRA 1LPBB 4BLWA 3RRBA 1OHHD 3D3QA 5ALZA 1KWKA 1HE5A 1QRDA 1VRCA 4XUCA 5E6RB 1L7BA 2W37A 2NTEA 5BWBA 1U1GA 4EGZA 2A07F 3LP8A 3OIDA 4R6WA 2ZU0C 3ZCVA 4L27A 1F4PA 3BB4A 3IODA 1WA5A 5FADA 1RYMA 1DFHA 3VHXB 1N75A 4A5OA 3F67A 4JP5A 1NQTA 4C7MA 3GBVA 3NIBA 4QTXA 4ZJYA 1O5IA 3C3XA 2VQGA 2BFOA 4EA9A 3TXXA 3KTAB 1PV4A 2CEAA 2PGAA 5HLHA 1OGJA 3LQQA 3OUUA 1DINA 2AT1A 1PQUA 2R00C 3O4GA 3Q1LA 1YONA 3S7TA 2IYZA 2RGYA 3IEPA 1P7YA 3BDVA 5SYMA 3OC0A 2P9TA 1QWSA 1KSHA 1BN7A 2Q3MA 3QMMA 1E3DA 4ESBA 5CM9C 2OV3A 2I3DA 4N7BA 2QS9A 3DOUA 5KIAA 4JROA 2RGVA 1XZEA 2OUKA 4X1YA 1S8AA 3OI7A 2A78A 4BUCA 1UM9B 2H63A 3TMYA 1EFCA 3G9TA 1KY3A 1XZIA 2G5CA 1V4VA 1WPRA 4JK3A 4ZVQA 4CMEA 4FKBA 3KZYA 4UB6C 1YGYA 3LCRA 2L42A 1HV8A 3EDQA 3PF8A 4YFXF 2HSWA 4NCIA 4QOIA 5MDHA 3F6VA 1VJCA 4M1KA 2XCRB 2G7HA 1DKUA 4R83A 2FOWA 1U6IA 3MTIA 1DMRA 3LUDA 4TMVA 4N4NB 1GNQA 3O8QB 3KO8A 2R4UA 1OA1A 4I5DA 1CJCA 3G9ZA 4KIUA 4MJ3A 4PNHA 4RHYA 3HCWA 5CH3A 4AM3A 5A5FA 2C5EA 2OF7A 4E94A 4JI5B 4GKKB 2Z4RA 2G7MC 4CM4B 3C18A 1DUXC 1W96A 2SBTA 2FPOA 3ZZUA 4Q01A 3LXUX 5J1RA 1TA0A 2NNLD 2YV4A 1GQYA 3RT7A 2JSCA 3PX3A 2H59A 2XF8A 4RVDA 4GIBA 2QDKA 1KDZA 4LG3A 4N01A 3G59A 3OE1A 5DBHX 1Y8QA 3LECA 3ISJA 1PL6A 2B2CA 3RUAA 1FA9A 5FV7A 1IG7A 2NTJA 3RHZA 3RUHA 1Q1AA 4DANA 1LDDA 2R8RA 3HZRA 1GR1A 4HKTA 4U5QA 3GC6A 4WLVA 4D0NA 2H3EA 3IJPA 4GYKA 3IE1A 4L9NA 2GA8A 1OX4A 3MSXA 3E7FA 1XZAA 4RVOA 2JASA 5EESA 3IB3A 1YR2A 2ZRPA 1RXWA 2PBRA 1S0UA 2ZB2A 3MTEA 4L9SA 4DMRA 3FWPA 1EMDA 3KJIA 3I1YA 3V9PA 5I6DA 4BFTA 1E9FA 2WTXA 3ZD9A 5AJVB 3U3RA 4EG6A 2V65A 2COKA 4C7OA 4S3MA 3EHDA 4QJBA 3JAKA 3RSNA 1Z7BA 4IIJF 3VPSA 5JYEA 3ESBA 1ILEA 1NF3A 4MUAA 3GJ3A 1FX0A 1B59A 2VBFA 4HEHA 3BR5A 4B7XA 4J4TA 3E5XA 5I4KA 1EUDB 1T8UA 1SUIA 3KXKA 3VDNB 3UKDA 4UVBA 3AR6A 1VKOA 2C4UA 3D5QA 3G7SA 4KCGA 4XVQA 3KAQA 3TIFA 5H6RA 4E5SA 5DEIA 1HNZB 4TYYA 8ADHA 4XVUA 2QPOA 1NHWA 2ZJ3A 4G8CA 1A9SA 5CVTA 3QELA 1GG8A 4OATA 2QRMA 2NUBA 2Q49A 2WJVA 3PNSA 1I27A 1IL0A 3KP6A 1CUVA 2P6UA 4J7AA 1UK7A 3VNVA 4YONB 5TIIA 4YT2A 3UJ8A 2WJ4A 3WNCA 1V95A 4JGIA 1Z0AA 4K9OA 5WRFA 1G3YA 1Q7BA 1GXQA 3DMRA 4YGYA 3ZU4A 3OLCX 4AF7A 4ACAA 3V8LA 5G0UA 4PR3A 5J4VA 4D8VA 1H1DA 3RLFA 3C85A 4DR5B 2G9ZA 1OREA 2ZE6A 5KHAA 1KA8A 2QVOA 4F7WA 3KEMA 3PKZA 4KIBA 3BROA 4CTMA 1LC0A 1C9MA 2VOPA 3G5AA 3V46A 1Z8HA 2VDOB 1S96A 1R6RA 5KJ1A 1YVPA 2LZ0A 2VHCA 2GFHA 3KPYA 1SUDA 4FMPA 1LY1A 2HA6A 4Q24A 1YA8A 3C70A 1MPTA 4JLUA 2VJIA 2R0QC 4N5LA 3ZWXA 1K68A 1YIOA 3WMGA 4TYMA 4C08A 1ADYA 4JX5A 1SQSA 1DJQA 3I9V6 2VAMA 4BE4A 4RAFA 3M6FA 3FWEA 5AJWA 5BQXA 4B5KA 1L4FA 2W6JD 1FJXA 4ITRC 2BGGA 2XE4A 4ZO7A 1OXKB 1VGQA 4WACA 4AYWA 5F1RA 2JEOA 1UR5A 2NU6A 1DT5A 1JHXA 3W3AD 2EYUA 5AK3A 5CVCA 5FJJA 5TC4A 5ITZA 4YJ3A 4BTLA 2E34A 4KAJA 1SCNE 2Z3VA 4ONEA 5HQ3A 4F6LA 1C7FA 3QBTA 1K4SA 3R6GA 4Q4CA 4N41A 4QDUA 4BX0A 1OCOH 3BGDA 3KYJB 2C57A 5IYCJ 1USVA 2P9FA 3QTBA 1XTBA 1BCRB 5F4BA 4F5YA 4XEUA 2HSZA 1OB2A 2ID8A 2ZOSA 5FBKA 3HSKA 4P93A 4EPTA 3QW4B 3WLIA 4E03A 3R0JA 5HW0A 2Q5LA 4HGOA 3K4MA 2E71A 2ZSKA 4Q1CA 4XGQA 2EHDA 4XIYA 4MROA 4Y8VA 4M1SA 3ZY5A 5LHGA 2G1PA 4US1R 1ANKA 1X39A 5LQNA 3ZGZA 2AR7A 2RFLA 1LNWA 3U0BA 2HCJB 3OLZA 4D43A 2ZIAA 4A12A 2FHSA 2Z5LA 1G4UR 4XIFA 2PR7A 1W47A 2EBUA 4MIKA 4R8MA 4TMTA 2PNJA 4DCNA 4ZGWA 4Q9DA 2HU2A 4ZOCA 3RGWS 1HYEA 3TDMA 3N2KA 3GJZA 3K1PA 3NTUA 1XGMA 4LJZF 3NB0A 4BQFA 4CG3A 1D6SA 4IO1A 5JD6A 4MICA 1JAYA 1NVVR 3BZKA 1R10A 3GVXA 5IDQA 1VLLA 1XZGA 2GCGA 1EQ2A 3C8HA 4TV8B 2GAIA 2B35A 2PV7A 2DF8A 4I8IA 2WY8Q 2JCYA 4J94A 4CR7A 3WLOA 4G41A 3IUSA 3WNZA 2ZB8A 2B98A 2O52A 2OQ2A 3AF0A 2C5LA 2IXGA 3QE3A 3OQBA 3PNVA 2XSDC 3ZZ1A 5A6SA 4MINA 2G4VA 3A4LA 1YFZA 5EJFA 1R6VA 3T3HA 3VJMA 3UMGA 1UCRA 2XPCA 5T4EA 4WK4B 3KQHA 1P7WA 3W3AA 3KYCA 3MAGA 1I3QJ 4J00A 2WJHA 5LZ2A 2IEAA 3V8PA 1ZIDA 4K9NA 4L9JA 3A9UA 3GD7A 3V6LA 4NBKA 2CCGA 2DLLA 5AK4A 2CNWD 3CTPA 2XF7A 4KMRA 4Y3UA 2XHZA 1VMKA 4CU5A 4DY6A 2AWOA 2VF4X 3J81k 1H5QA 4IWNA 1P1BA 4IGFA 3X1JA 4F12A 4DR6B 3KP7A 3UK0A 1YFHA 1NK2P 3OYLA 1MPXA 5L51A 4NNJA 1TC3C 1BE6A 4X41A 3BDAA 3N2KB 3P4UA 4I2NA 2IQIA 1QR6A 2P5LC 2QZPA 1RPNA 1W29A 3HHGA 1X2EA 4HF7A 4OMZA 3KDAA 2XC7A 3ZPXA 1ODJA 2PSJA 2R2GA 3LKVA 3AEQB 4HQNA 3P45A 4BFYA 2Y1EA 2Y05A 3PVCA 2O8XA 4K6CA 3RYFB 5E3OA 3M4YA 1LU9A 4ZTJA 2GAUA 1F12A 2DK8A 3K4BA 1WKCA 1G6KA 2QMUA 3HOSA 4MOWA 2QSFX 1W9MA 3GQVA 1MEEA 5J2TF 1YX5A 1IUYA 1DFIA 2WSYB 2B4KA 4MTCA 2OUMA 4HH3C 5LXTA 4W1QA 3GPDG 1QXSA 3RQ4A 4IJ5A 1EBFA 3LOCA 1H0HA 1SC3A 3F6YA 1SQFA 3WNBA 1L3BA 8GPBA 3QVMA 3MAJA 1SCKA 2RNGA 5LBUA 5CJJA 4I9HA 1SUPA 1XEFA 2VPQA 3MRTA 4P84A 2WIBA 1Z25A 2EJVA 4ZI7B 2WZDA 1AQNA 5AUPB 4IKFA 1QHXA 3HPRA 3OE7D 3HA3A 5DHSA 3AR7A 2WD7B 3FPAA 4P5DA 3NEUA 1JDUA 2EQ5A 3RFCA 3CVVA 2FF7A 4AIDA 1N9GB 5COAA 1QMPA 2QD4A 3MMYB 5AIQA 2B30A 4AUNA 1XHEA 1Z7GA 2KDZA 4EHLA 4A0SA 3AR8A 2PUFA 4F3NA 2V8BA 3U3KA 4JEHA 4DMLA 4KXUA 4RBOA 4B33A 4YMUA 1EM8A 2I2CA 3AW8A 4R0VA 5F23A 2IBTA 4XLEA 3AUJB 1TCAA 4FE7A 1Y89A 2R60A 3U09A 4GVPA 2GWHA 1WR8A 3LFKA 3CH7A 1MNEA 1RJDA 3CUEF 4CQLB 5BMVB 1H6DA 3I6IA 1XMQB 2HOSA 1YI0A 3JQAA 4MI3A 2BCJQ 3LA8A 3DKRA 2X7HA 2VSQA 4KVAA 3RABA 3UA4A 3Q41A 1FMWA 1CLEA 2BFPA 2JHCA 3D6UA 3E0QA 4HP8A 3MVPA 3O3MB 1KJZA 2ZSHA 4I50A 4LWPA 4EFDA 3FDYA 1XCOA 4QECA 1E6CA 3ZCRA 4QXAA 2AOXA 4M3NA 4OHBA 4U3JA 2HIAA 2Q2QA 5KWVA 1LVKA 1QLJA 3IGFA 3PUBA 2WV7A 4M76B 1DIGA 1XALA 5EXDA 3QVTA 3M8JA 1RBMA 1MENA 1N6NA 3LCMA 1VF9A 1CE8A 2Z5UA 3Q6MA 4V1CB 4QKQA 2CU7A 4WXRA 3CLHA 3I64A 2D7JA 2H1SA 4DMMA 1NKSA 5FAXA 2RHDA 4AZ0A 4YRIA 5I3ZA 5JPDA 2UUOA 3CUUA 1D0ZA 1IK4A 1WUTA 5E2IA 1ZJWA 2UXDB 1VE3A 1U3DA 1O4XA 3SPXA 2TS1A 3S14J 5D5WB 1J9EA 3EA4A 1ZXXA 4JLAA 1ZGJA 4BVAA 2W4IA 5HUHA 4B6SA 3OYCA 1NX6A 1ZRSA 2W4MA 2OZUA 1CZLA 2G08A 2PMCA 2XQVA 3E9EA 3I37X 4LHSA 3SXUA 3DKVA 3NYWA 5DF1A 3WGHA 2CYBA 1DBSA 3WLQA 2VXDA 4WKBA 4AG6A 4NECA 1CVRA 1XQ1A 4K2HA 2IUYA 4X7BA 3SSMA 5LIPA 3KVNA 3K70B 2ZB3A 2QZSA 2XGMA 2IP1A 2GLOA 3L1KA 4FCYA 2K02A 4EO9A 1HUQA 3PF9A 4GM1A 1NJFA 4MV9A 3T4EA 4I50B 4BTVA 3M5WA 4HV6A 1JFLA 1R74A 2GK4A 2VHQA 1KL7A 3QK7A 5DV9A 3WYEA 1Y39A 1Q1QA 1HDEA 2ZVQX 3DGFC 5EWJA 3ZYZA 3I2KA 4Y18A 1V5GA 2JH9A 1SCUB 2R11A 4ATNA 4M7WA 3X1MA 3N07A 5E9JA 4RK1A 3ZQUA 1GLGA 1Z6YA 4TV9A 2HTSA 3QVKA 5DB4A 5CT5A 4M9CA 1CQTA 2WMOB 4D7AA 2KLOA 1GV0A 2DKFA 3HBFA 4KHZA 4FFBB 1LK5A 3NH9A 1RC1A 4Y7NJ 2CL5A 2NRAC 1V7PC 2LKCA 2Q5OA 4XB2A 4HLUC 5ISMA 1YVRA 3IE0A 3GN2A 2A5WA 4KGZA 3ZMZA 4CT4B 4YCMA 3PX7A 3TLGA 5I9NA 2Z8ZA 2LV8A 1O3SA 4Q00A 4CCLA 1SHJA 2BGNA 3GTKJ 1LX6A 3LX4A 4IH1A 2AJLI 2HK7A 3IEKA 4HDRA 2ZRMA 2K5CA 1ISHA 5LLSA 3ZHOA 2YN0A 1E5QA 3N97A 3KYDA 4H1UA 1OTYA 1VL1A 2FN3A 4QPQA 1J1IA 1C7RA 2FQWA 1TVKB 4QICA 1RNLA 3A2KA 4FQ5A 4ZJUA 4KIJA 4CKCA 4ZYUA 2DDBA 1F8FA 1OISA 4ZCQA 5T4HA 3TX2A 2OCXA 3EIFA 3IALA 1QTNA 2HY7A 4HATA 2A86A 2P0AA 4IHKA 2FGJA 1QNLA 2OHIA 1OCZH 3JRHA 4H2DA 4P92A 2PI0A 1L6RA 1BXRA 2CB9A 3ASYA 4PAWA 3HKDA 1N9ZA 1AZWA 4E4RA 5C4XJ 4UZSA 4I9FA 3VISA 3B2EA 1ZYUA 3DOCA 5HX7A 2VRCA 5AW1A 1E3WA 3KQQA 1TKCA 1YR7A 1X42A 4ZZ0A 3K32A 4YJ2A 3LHIA 1GFZA 5A03A 4G8JA 1Z2NX 1ZR4A 2B4AA 2SHKA 3BXFA 2CCKA 3S1AB 1ENHA 3QU2A 1N5RA 4JJ7A 3MXTA 1U3UA 2DU8A 4O5VA 3MWLA 1T3ZA 4AVPA 5MFZA 2DT5A 4DLAA 3NBAA 1YNOA 2GZSA 2NAPA 2EKBA 4LY9A 2R6CA 5KDLA 4DW8A 1HR0B 3C1DA 4UVAA 2ODBA 1PJLA 1B8UA 1C9DB 1G41A 1A5ZA 3UPTA 3J80Z 2CHEA 3VBCA 2G70A 3C16C 3LYLA 3TQCA 1C4KA 4LPSA 2P6SA 4YPFA 3A9CA 3B5EA 2N1BA 3QX7A 4H0NA 1EVJA 5FL7A 3SXPA 1Z7YA 3FGZA 4CHGA 5KOHA 1LX7A 3FHNA 2PIAA 4M3BA 4FTHA 3GX1A 4XSGA 3QFRA 2F67A 3BWEA 4WVFA 3JVVA 1U2RA 4LJ5A 4QIWN 3QUQA 3KTAA 5JZVA 1PVEA 1GHCA 4HAYA 2GXBA 4R1UA 3LNQA 1GZ3A 3OOPA 1J70A 1YC5A 2BT4A 1ZITA 2B1RA 2I0FA 4LCJA 3B1ZA 5ECDA 3OIVA 5JD3A 1ONPA 4QDZA 1NW5A 3PRKE 2PMBA 1YUBA 5DTIA 1FW8A 1KDTA 2I99A 2PIDA 1Z3XA 4EL5A 1I7NA 4EVSA 2GBYA 5K4GA 4IIGA 2BAGA 4JT4A 3ZJVA 1YO6A 1ZAKA 2VATA 1AGPA 3EZ7A 2MSWA 4GBED 3C7CB 2IUUA 3ZIUA 4DCVA 4F46A 2UDPA 3RJMA 4AJJA 3OUZA 9ATCA 4DZRA 3LDUA 3T41A 5IKEA 5L9AA 2UZ4A 4N6GA 1KAHA 1UXHA 4S05A 1E77A 1V8OA 1YUMA 2NT3A 2OCIA 3DZBA 3MS7A 3QE0A 4L51A 4OEHA 4F7ZA 3D4OA 4BEWA 3P9KA 2L9RA 2DYRH 4HGZA 3ELKA 1MVOA 1X7HA 3SZOA 4DXAA 5FLXZ 1G5TA 2ZS9A 3BTLA 3S5JA 3RTRA 1QG4A 4ZDJA 5JNUA 1YQAA 2JLCA 3LUPA 1J90A 4KITB 2H2HA 4PZ0A 4Q7JB 5F5LA 5DW0A 2AR9A 2F7SA 2W6ZA 4C3OB 3LNTA 3ZWNA 3HVIA 4MQ6A 4BNHA 4A3JJ 1UEJA 2EG5A 3G8BA 3HCFA 1CW2B 3H5VA 3NYIA 2CLHB 3UICA 2LVSA 4R2LA 1F9AA 2ID6A 1A96A 1U5TC 1QFJA 3ETNA 1H23A 4EBFA 2WKRA 4B6OA 5LMZA 1V2HE 4M71A 4RA2A 1TZLA 5L7YA 1SVWA 4RAOA 3RHTA 4G5QA 2BEUB 2ZYVX 3ONNA 1WXQA 3AEUB 3Q3CA 1N0HA 3JSOA 1I01A 1M67A 1O58A 4GT1A 3T0YA 1QG0A 1T5BA 3CF6R 4ZCPA 4U87A 3WGTA 1Q6YA 2WV9A 3N3BC 5IXJA 2O8KA 3T0IA 3CLOA 1E1NA 1Q2XA 2KWIA 4JXXA 2A5YB 5EHGA 3A6DA 4ZANA 4XBFA 3PRJA 5K03A 4TPKA 1ZD4A 3HKBA 1OFCX 2J5RA 1TF5A 3FKSD 3MLBA 1WV0A 2XVAA 5ALPA 1JKFA 1M2OB 2OY0A 5BNWA 5IMBA 5I01A 5JH7A 4OCZA 4DIBA 4JYZA 1MH4A 4U9UA 3A9WA 1JGSA 3R0AA 1OH6A 3G8YA 2HOEA 1NUHA 4TMFA 1ZONA 1YRNA 2DW4A 3VTFA 1KHTA 1L8LA 1R7JA 5ED0A 2J6HA 2GEUA 2ZT7A 3F8BA 4LXXA 2OGWA 3DE3X 5C35A 4XOTA 1G21E 3DFZA 3BSSA 4U1RA 2V4MA 4ZHQF 1XLTC 3G0CA 4MWCA 1P5ZB 2NZJA 4IIJA 5JPCA 1ESEA 2H00A 2QSHX 4ISCA 4D0PA 4AJEA 1OAOA 5HUQA 2P3SA 4WWCA 3FUTA 1B9MA 3RWMB 4WEOA 2H5IA 3L4BC 2G4CA 2GT1A 1TF2A 1FP2A 3QI2A 3R5KA 3WBKA 3D8SA 1ISPA 3QOWA 4XPIA 4DIMA 3K1NA 3UTDA 3WLEA 1DJPA 2B20A 2XPUA 3GJXC 4AWAA 3IESA 4AJPA 2DLNA 1J0RA 3TXYA 3PR3A 1SVUA 1CQPA 2C20A 1BCSA 4PYIA 1WQ4A 2RHHA 2J5KA 3F9RA 2H29A 3UWOA 5K0EA 4U0JA 3W78A 2YXBA 3HJCA 2GN4A 1IWBB 1X7ZB 3H6HA 2MD5A 2YWGA 4OXQA 1DARA 4X8MA 3ICWA 3THSA 1GN8A 4QYWA 2IP4A 1MNDA 3CF2A 2A1TS 3EXFB 1SKMA 2WSLA 3QKRB 5CT9A 3E8XA 7ABPA 3HTUA 1I94B 2AN9A 5DGHA 4KZPA 2BBTA 1GSOA 4BKQA 3LOPA 5DWQA 1UXOA 3R6DA 1I0IA 2E4VA 1GFSA 1Z7EA 2H4FA 3DEJA 1OKKD 1K7FB 1Q1GA 4MQUA 1EAMA 1Y1PA 3BTUA 4RKEA 3LA2A 3S27A 4CMAA 4Q34A 1SUAA 1M1YA 3SI7A 3TF5A 3ER8A 4JLWA 1T56A 4AB1A 1ZAOA 1CX9B 1E9SA 1MH3A 4CXMA 4RF5A 1RIFA 4LQ4A 4EUEA 4GGOA 1E2BA 4ENMA 2P1ZA 4IOCF 2ANCA 3TW6A 4MNTA 5KZMB 5CAEA 1V45E 3EZ2A 1P45A 2QD3A 2IYYA 4YELA 2Z9OA 3KYBA 5DBIA 3TTTA 2X42A 5F5XA 3DDZX 2B1GA 4K2AA 5CW1A 4CLRB 3QKWA 2VO1A 3ZU5A 3D4PA 5GWXA 2AH5A 2OTCA 4TLDA 4X1IB 5TPWB 4RS8A 3WYCA 1QLHA 3GFBA 1TIKA 4RD3A 3ECSA 1P1CA 2E36A 3DAPA 2YFKA 4BKXA 2AI3A 1Q0LA 4EEFG 2R8BA 1VBKA 2NZ2A 3HM5A 4XQCA 1XZBA 4MRAA 3P2IA 2JD2A 3M4ZA 4LSZA 3NGLA 3CVWA 1EFRA 3P32A 2E87A 2WNSA 1QU3A 2GESA 2HMYB 3QUBA 4GSYA 1NMSA 4NCKA 4US0R 5KJEA 1Z47A 4YT8A 3THYA 2I9KA 2PD4A 1EFPA 1R4NA 4DLYA 2REBA 1OVGA 4MI1A 2R87A 4JEIA 5A04A 2O3FA 1K98A 3IOCA 1L5SA 5CLGA 1D2GA 4WKPA 3SNKA 4CKEB 1L7EA 1Z6RA 3PNYA 1XKLA 2D62A 2MU1A 2PSFA 2KPMA 2RBEA 2VNIA 2ZJ6A 3A1UA 5BSGA 1BMQA 5IP9J 1JUDA 1QCCA 5BMOA 2OB1A 2Y68A 3RTGA 3WL5A 3GDFA 1T9AA 3KR1A 5K7ZA 4HDUA 3OX4A 3TEDA 1GZDA 1V3QE 3GMEA 2D3TA 1R4MB 1IPEA 3VUFA 3WTZA 2FUCA 2OAP1 5EINA 4D82A 1DUSA 1C9NA 3AERB 2OFWA 2O3RA 3FZEA 4AJOA 5FOTA 1L1FA 3WTCA 4ZI5A 3WZMA 1BG6A 3WHCA 3CRQA 3DL4A 2HRQA 2JHFA 2J9FA 3K20A 3TG8A 1IOVA 3NDRA 4E7ZA 2M1XA 4HADA 1PEDA 5KYUA 2VYCA 5D3MB 4MWSA 2CUJA 3PO2J 2ZSIA 3BE5A 4HDSA 1AK2A 3Q15C 3NLLA 1PT8A 1Y0UA 5DHUA 5L4LA 3NQOA 2XF6A 2HTFA 3CR3C 3CV3A 5H70A 3SBOA 4ZVUA 3J7AC 3GF2A 5DS9A 2I4TA 4MMZB 5FL3A 1CIPA 1IWPB 1J1ZA 1WTCA 1PNQA 2SECE 2WUVA 4MW6A 4P31A 3TH5A 4DXDA 3K8QA 4BVJA 1TK9A 2I4RA 2Z56A 2Z43A 5BW6B 1EV7A 2B4TO 3P7NA 2R44A 3ZLVA 3PXUA 5KJ6A 1A2BA 4A3FJ 1F5TA 2ZREA 1XZCA 3OPXA 1H1LA 4WTOA 5TF0A 4UEWA 3JR7A 1E8MA 4EARA 2C1EA 4K6OA 1CETA 3H4VA 1J0EA 2I1QA 3LF2A 4KXQA 3JVDA 1NPTO 4P80A 3H5NA 1GAWA 4S1PA 5IARA 4PQYA 5KAPA 1RMTA 3O8BA 1VGRA 8LDHA 1W4AA 1DGRM 1DU0A 2BFWA 3T1HB 1FX7A 1YJ5A 1YS9A 2J9GA 2TYSB 3C7KA 4MEAA 1NJSA 2FMIA 1X8KA 1GSHA 2ET6A 2P9YA 3CONA 4G09A 4Y9DA 2AE2A 5EVJA 5JR3A 3TP0A 5EY5B 1NX9A 2E18A 3ZQLA 2J9FB 2KBFA 2BFBB 1GR0A 3HKCB 3N87A 4X3CA 4JC8A 4NAHA 3ZV4A 4JOMA 1WHSB 5A4MS 1F1BA 3G0HA 2FQYA 3EIEA 4I1PA 3HUGB 2M9HA 1AM4D 1E18A 3STUA 2E5FA 4HPJB 2XX3A 5BRAA 4Q37A 1X1DA 2PKRA 4XLLA 2ZTSA 1GFWA 5JD5A 1TUIA 5B58T 2XMSA 3NYRA 1FIPA 2XYQA 2XVCA 3GCZA 1I7QB 3L09A 4GX2A 5KYYB 1OCRH 2BFFB 2Q29A 5CFQA 1GNTA 4NNOA 2FG6C 5D5PA 1OYWA 4W9NA 3DNFA 1WJ5A 1M34A 2Q4BA 1DRWA 1X9IA 2H4XA 2D1SA 3MWMA 3JRXA 5E0KB 1HBXG 2WG2A 3NPMA 2QP9X 3SC3A 1A4XA 2H7VA 2QU7A 3I9OA 3KRTA 4C20A 1D0YA 1E3IA 2GOYA 1A3CA 1Z8FA 3DV0B 2FSIA 2G6TA 1ACJA 3CPEA 3TGNA 1N36B 2XZDA 3HDTA 3JCUC 1CUXA 3LY7A 3O0DA 4HHEA 5C4MA 4YREA 1A2KC 5J43A 1U9ZA 2PU7A 2VJMB 3AUFA 3TL6A 4AZVA 4ZEWA 2VLIA 1GZSA 1YB1A 3K2EA 3GXOA 3OJ0A 4JBIA 2XNKA 1FBNA 4YLYA 1F2TB 4BQAA 1KI6A 1RHJA 2VT7A 3CURA 3WRYC 4F9EA 3AL2A 3RBVA 3TOBA 1QZ3A 1W93A 4LK1F 2VUMJ 4Q48A 1AQIA 1PFKA 1POWA 3BHJA 2C2KA 1ABFA 1IG3A 1U7PA 2AI1A 3GMSA 4ARSA 3O8NA 4HW0A 3MWDB 3BL5A 4Q4AB 2BY2A 4AD9A 2IXFA 1QPBA 2Q0SA 3TE6A 2UYQA 2ZRBA 3ICVA 3FETA 3PV0A 5BSHA 2VZ9A 1QGZA 5AW5A 1A71A 1IMJA 1G6HA 1MO2A 4TKUA 4ZO6A 1XVLA 1IWOA 5F7JA 4XCVA 3C1OA 3RKSA 4A82A 4CM9D 2AFIB 5DXFA 4LF6B 2F59A 5C18A 1TP4A 1BZYA 1YZTA 4JBWA 5LMUB 3V4RA 4Q05A 1VKJA 1QIJA 2YVKA 1U3WA 2GPBA 5DM4A 3BR2A 1ZGWA 2UYOA 2NVOA 2FSUA 1NR7A 1YQ9A 3ZVKA 1M76A 1M6NA 4MKZA 1XI2A 3ZNQA 4AS2A 5AVWA 5I4IA 2JLZA 4ND8A 2R7LA 6ABPA 5B5SA 1FYVA 2QRGA 2Z6UA 1P1FA 2N9UA 2NXNB 1EWTA 2UZ1B 4FCTA 4I9NA 4ZDLA 2AOWA 1N2IA 4Q3KA 2CUZA 2I55A 1EWKA 1RJEA 1SB9A 3PQKA 2FVXA 1ZJZA 2DI3A 3LS2A 1V35A 4KVFA 5AI9A 3H5WA 3E82A 3KFLA 3H86A 3JR3A 4B44A 1W48A 4G8DA 5DWDA 4GMXA 3OU2A 3HCNA 2V3VA 1KIFA 5EWJB 4C2AA 1HMPA 3NDJA 5KYWB 4OL0A 2EAUA 1UFOA 2IYPA 2O2JA 1YIDA 1A9QA 2PX8A 4RVUA 4S1WA 2A67A 4H17A 4JHXA 1WV1A 4JT8A 2Z2XA 3IULA 3WL7A 5JVDA 4XRMA 5HP4A 1XL1A 4QBIA 3IVGA 4LUCA 3NVKI 1WF6A 4F86A 1J21A 2F4MB 1URPA 1SOMA 1E96A 3FSGD 2W2XA 4TKUB 4DYVA 1AT1A 1RKXA 4CGZA 1N57A 1G66A 3FRHA 3IC5A 4YEDA 5AKXA 3W5BA 4I81A 1OZGA 4RSMA 1BJRE 4PLVA 2LH9A 2WYIA 1T1JA 1RZRD 4MKGA 4GU5A 1J7KA 4FNAA 5FTKA 4D0LB 4GXTA 1W25A 1OX6A 3I5UA 1JWBB 3CPHA 3NVDA 1TYEB 2QX7A 2WFAA 3KHTA 4KRYA 3BXEA 4EBBA 2VQFB 2H52A 3AFIA 1ULAA 3H2GA 2P9BA 3LP5A 4JJAA 1PEKE 4F4IA 3K5WA 3K0CC 4OQEA 1TEXA 1N3LA 2VT2A 4PIVA 1WXEA 2QXTA 4BO1A 3A6PC 3W90A 1EDDA 3WWZA 3UT5B 4Q3BA 4C1NA 3FCOA 1T8PA 3N8DA 2JG3A 1U3VA 3FFXA 1GXSA 4RZIA 4E4TA 4QULA 2A1TR 2BH9A 1R9NA 3AFNA 2PU5A 1QYDA 3L1JA 4NHOA 5HEKA 4NLLA 3BPXA 3U1VA 1M5UA 2Q8KA 2PKQP 2IYFA 4DDMA 5JASA 1T98A 3W4KA 4G12A 1NWHA 2I2DA 2OGTA 4KFSA 3TO9A 3TLJA 2OZVA 3BQZA 1UOPA 3VDQA 1FVHA 2XBLA 4CICA 1JPVA 2JHGA 1BROA 4FS8A 4GP6A 4PX5A 4R2HA 4ZVNA 3UGQA 2VCYA 1T4CB 3JALB 4J0IA 3GRKA 1ZWKA 3LZCA 3MB8A 4GC9A 4FI3C 3AY7A 5A9RA 4A3EJ 4IFEA 1Y1RA 1IQRA 1S3SA 3GRCA 3UY4A 3K1MA 3PIOF 5LL6P 4UUSB 1RYDA 4GXRA 4AKTA 4YYZA 3ZN0A 2ASVA 2JFNA 2O0HA 3LDAA 3MF4A 3ORSA 4MVJG 4MRRA 2M8GX 5F78A 4QPNA 5JI3E 1Q57A 4QHTA 5LKAA 4BXFA 5CPRB 3HUFA 3DOJA 4KYUA 3QEBZ 4KR7A 1KZ7B 3P5BA 2RH9B 3NM6B 1JFSA 1WUJS 1GTZA 1C3LA 1WW3A 2OG2A 2ZBEA 2X2FA 1K6EA 3EUWA 4NMLA 2MSKA 4Q7EA 1QNTA 4FR2A 5IUKC 1OH8A 4GWKA 4D42A 4HVLA 4IFTA 3HGQA 4J0FA 2YVAA 4MKXA 1RQ7A 3OO0A 3D1NI 4E70A 1GGKA 2VSFA 2YJ4A 1XWFA 4V0MA 2R7DA 4BAGA 4C04A 4MUKA 4MW7A 4M8SA 5IC4A 4UUTA 1LFAA 2DTDA 4IHAA 5HOQA 4QGHA 4FDAA 2ERCA 4PHGA 3S2SA 3TO7A 3VJKA 2P0EA 4AK9A 4CBVA 1M5TA 3N58A 3V4LA 5GVSA 1P1HA 4YRAA 2HVRA 1PUFA 3IJEB 1Z88A 3MWEA 2ZSDA 3KJXA 3GZTB 4FW8A 4R2IA 2L2OA 4JC5A 1X15A 2RH8A 4Z6YA 4UQOA 2WU4A 2XOKD 1F6DA 5CR9A 3TR6A 4BP8A 4UOEA 2LXNA 3OAAD 3WLTA 3CJQA 4Q1VA 3FVVA 1EIWA 3I5YA 1GT6A 2OSVA 3IQGX 3KR0A 1VP3A 2FMLA 1OI4A 4F2PA 1ZJYA 2KS6A 1F60A 4FD3A 1GKIA 3GOQA 1YSCA 5M3BA 2WD7A 2OBLA 1TBXA 3Q0UA 1NP6A 2B0JA 2VAPA 3EGVA 4F52A 1A97A 2JJYA 3IT2A 3P9QA 4JUDX 1UEXC 2JFGA 5HS6A 4BV9A 3HMKA 2LLKA 2NO7A 3NRCA 4POAA 4D8XA 5JANA 5BYJA 4JI7B 1QHEA 3CSDA 1R4ZA 2LDUA 2BEVA 4GMGA 3P0JA 4QODA 1FRVA 2J07A 2ZUEA 4IS2A 3HDVA 4MFEA 4BHBA 5CFMA 1RIOH 1K27A 3LJKA 4HRAA 3OPYB 4JR1A 2P1DA 1TWFJ 1WXHA 2IEZA 3LAJA 2PPLA 2H85A 4AMGA 5KYNA 1Q3HA 1QKJA 1W7AA 3L8FA 4FGZA 3HK2A 4D7NA 1P2DA 3AQIA 3TUJC 4X66B 2P6OA 4BO6A 5DJ5A 3JD4A 3I5AA 2D00A 1VP9A 3BHMA 1F5NA 1UQTA 4URWR 3HU3A 2FRDC 3CUVA 4GPD1 2EJUA 5TEVA 2L01A 1JE8A 1H8EA 1W52X 4BLVA 3DZGA 4BZZA 1S5PA 3ETCA 1CUSA 4N8EA 2VC2B 3D7SA 3IRQA 3H8JA 3KZ1E 1VM6A 3D1VA 3Q3JB 2PLRA 4JJKA 4HLNA 1FYKA 1IHPA 2AEJA 2XAQA 4LJAA 3WRYA 2AIRA 2IYOA 2OOKA 3A2LA 3I3OA 3A28A 4C1BA 4UM8B 5KWSA 4D9IA 3GLKA 1H2YA 4A0RA 3BCRA 4CE6A 3PJEA 4Y2YA 1JBEA 1YZHA 5BN4A 5IT9K 3RRMA 3FTQA 3MD0A 4HDCA 4RZSA 2QN8A 4RF4A 1J9IA 4CA0A 1JHRA 1CP2A 1WDTA 3FCCA 4R1QA 1UZNA 3JAWA 5DXJA 3ZGYA 4DIEA 1T8SA 1DKPA 1Z4JA 3FYUC 5HIAA 5BR4A 3ZHXA 5IFLA 3VUEA 4RY9A 1UK9A 1EFDN 3M1LA 2BEWB 1T5HX 2G9RA 2G04A 2ZYUX 3GDOA 1BRMA 1W4LA 3HCPA 4QRHA 5IF3A 5LLTA 4NB5A 3VSLA 1M2HA 1V1MB 1V4BA 3BMOB 2VAXA 3IXLA 4GSKA 4DYQA 1WDLA 4KGXA 3H36A 4TTVA 3U5ZB 3T99A 4CO8A 4X5OA 2C88A 3AZPA 3H05A 4FIZA 2YU3A 3RIYA 1QWOA 4MDYA 3CCQI 3ZJUA 1VPLA 1ULBA 3T3EA 5K8TA 4O4HB 5KMGB 2ZYHA 4JLKA 2J08A 4C3IJ 5EE9A 1JJ6C 1Z74A 3ACBA 3QXGA 3WK7A 2XNDA 2W6NA 3QY0A 1IY2A 1BJAA 5LYYA 4BNIA 5C9ZA 5AM3A 4OXYA 1WSUA 4LY0A 5CHEA 1QRTA 1YXMA 4OQXA 1QPMA 2SCUA 5F52A 3ADOA 4TMKA 4Y6LA 4O0LA 1I32A 1SVSA 2JLSA 4WXYB 4Z9BA 4YMVA 2HIHA 2KDOA 5K3FB 4AUKA 3OJXA 4PXAA 4KYWA 3IFSA 1LDJA 1NVTA 3HP7A 2OPTA 4AULA 2Z98A 4P08A 1PZHA 1XKQA 2G8NA 2HWYA 4I2OA 1ORDA 3SVLA 1PG2A 1OXUA 1ZDMA 2GRAA 4WOBA 5FTWA 3OIUA 2LFBA 1SCDA 3EC2A 2QKLB 4UEJA 1NDUA 1YE8A 4JBLA 1LI4A 2NQ8A 3A1SA 4PLZA 1KOLA 4BBJA 1AHIA 3B8EA 1PP4A 5TMBA 4ZC8A 3RYHB 3DTTA 1EI9A 4IEFB 3W4JA 1GKYA 2I1LA 4QUGA 3BZWA 4D4GA 2PBLA 4N7MA 2HCTA 2JA1A 2ZKIA 4Y67A 1TQDA 4NE7A 1RJ9A 2WAMA 1YJNI 4LE1A 1B2LA 3V8BA 1J20A 3CZ5A 3GP5A 4IMRA 4ZV9A 7REQB 1KU7A 1G60A 4O4HA 5JU6A 3BOSA 2IA0A 3GRPA 1OXTA 2OZPA 3PE4A 3QBDA 5BSUA 4CPDA 3ABRB 2BV6A 3NUQA 1WVRA 3VU1A 1QANA 4HRVA 1U6JA 2FKNA 3BXZA 3WQHA 2O8FB 4MJ7A 1DJMA 2P5VA 4KX3A 2J0VA 4R40A 2AWNA 3T7CA 1HDRA 2CXHA 5BWCA 1P4WA 4BMXA 5B2FA 3ZZNA 2W22A 1W6RA 2BUAA 3VR4H 4G0OA 1R1UA 2WE8A 3RAJA 4PHHA 3AESB 1E2DA 2WV1A 1YULA 1NSTA 2G6BA 2Q27A 4NCNA 4QTUB 3FIUA 1TECE 1FXSA 4RDXA 3JXEA 3VAAA 2HRCA 3OOYA 4UVDA 2E7WA 4Y15A 4HYYA 3UAYA 1L4GA 1M54A 1XSEA 2ICAA 3IDQA 4L22A 4PLWA 1ZGBA 4MA0A 2A6TA 2HDWA 1X4OA 1YL5A 4EHKA 2RB4A 2EFYA 3EXHC 3AFMA 2DFTA 3RIGA 5C1BA 1GL9B 2NTNA 4EG4A 4ZU6X 1TX4B 3QYBA 2H9AA 3N70A 3NMUF 4LC1A 2QPTA 4Q66C 1W0JA 1Y48E 1A5TA 1GPKA 3HYTA 2JTVA 4XKCA 4UHCA 1QGOA 1ABEA 4I4TB 2WIGA 5EGOA 2VODA 2ZKLA 5KUTA 1VBFA 4DEYA 5GJWC 2H5EA 4MPJA 5JXIA 1PUXA 3OOHA 3LSYA 5ER6A 5TPZD 1LCIA 1ESCA 1U02A 1AXGA 2FPXA 3LDHA 4JL5A 1BEUB 3HB1A 3LPLA 4WZBA 3V3TA 2MFZA 1K6JA 2PTHA 1BD3A 1FE8A 2GA1A 1DC8A 4HDMB 4LGMA 1SOWA 5IP6A 3HM2A 4BRZA 2L4AA 4FBMA 5G4LA 4C03A 4KW7A 5JHHB 3CGWA 4B3TB 1KU3A 1ZOSA 2QAGA 3KKPA 2ZTVA 1E2PA 4H60A 2O9LA 3EDMA 4TLCA 2GM3A 2ID9A 2RJOA 4FDTA 1O3QA 1LH0A 1QUEA 4AJ1A 5AW7A 3D3EA 4BB0A 1MV5A 2QY9A 1Z18A 1C7EA 2FG5A 3A1TA 3JQGA 3OYEA 3RC3A 3UUWA 2J7KA 4OQNA 4RPIA 1ZLYA 3AHIA 3IC7A 1CF7A 1AKUA 1P2VA 4LRYA 5E6UA 2QQGA 2W6OA 2FFJA 3N1UA 3OU6A 1WPKA 5JS2A 3BFPA 1AE1A 1Q12A 1MDFA 3BB3A 3ZXYA 3SHFA 5ILGA 3WSVA 2I9PA 2O2SA 2ACKA 3BULA 1Q95A 3PHLA 4KN4X 2WHQA 3HRMA 4BEVA 4BS9A 4O1IA 2Y1OA 4JEMA 3G0OA 4LQLA 3SZUA 2OCBA 2TECE 1ECJA 5AVXA 5F9HA 1ZRHA 4IYRA 1USIA 4TUYB 2EA4A 4Z9AA 2D6FA 3GVIA 1MFPA 4C0BA 3LUKA 1UFQA 1O96A 2FSWA 1R5OA 1YZGA 4TT8A 5BWLA 4O1MA 2G40A 5IKOA 4BJTA 3ASZA 4BNDB 5C5CA 5J4KA 2VPXA 4DV2B 4ARCA 2HSEA 4WXHA 4KICA 1CFJA 4FC7A 1XQWA 2XRLA 2V7TA 4FHTA 3FDJA 3L7LA 4XD2A 2C0CA 1IAQA 1P4GA 2BFFA 5F73A 2WP8J 1N34B 1KSJA 1VG1A 3AP1A 2QVYX 4UE2A 2F3RA 4D5EA 2A9JA 5BN3A 3GLGB 1SHUX 3JQ8B 2UVQA 2NMVA 3OT1A 1MHPA 3OIYA 1Y82A 5AW2A 3B70A 1DQUA 10MHA 2E7ZA 3VR2D 4JP0A 1XCBA 1BWPA 4I02A 5IEJA 3PKJA 3JRBA 1QIFA 2X9NA 4II2A 4KWHA 5HK9A 2FFRA 4UDOA 3ZVLA 2HREA 3ZMUA 3PUIA 1WEKA 3KHUA 4Q4HB 2QLJA 3GPLA 2JDIA 3OQNA 1NLZA 3F5MA 4LV8B 5I3CA 1LQUA 5JY1A 5E0OA 4WJLA 3OF2A 3EPLA 1XRPA 2GHQA 3QBEA 1Z6TA 1FBUA 4L07A 1XE3A 1U4SA 4LYHA 5KWEA 5H6QA 4LE0A 3VC2A 4ND6A 2L7FP 3ZVMA 2O3QA 3K5PA 2RGCA 4D99A 4YP7A 1AUOA 3F3XA 1NNI1 2XVZA 4M99A 5IDXA 5C0OE 5K0TA 2ZWAA 5L3DA 1ZD5A 1G64A 3IIJA 4JYCA 5G1NA 3U1DA 3C4VA 2PMEA 1B41A 2R85A 3JTMA 2H31A 3OA2A 2NU6B 3ZXSA 3OSUA 4CRWB 1BI1A 4J1QA 5CDUA 5DNYB 4IJWA 1X74A 4JSRA 3K8YA 4OB6A 5FO0A 4HFMA 3UCEA 1IPFA 1Q3TA 1V0JA 2I4NA 1UXIA 2VDJA 3V4SA 4DTIA 1HNXB 1I4TD 3KZIC 4NP6A 5IJWA 4N47A 1CNEA 3QSYA 3OIPA 1QO9A 1RAHA 1TAQA 4D96A 4GOND 1U5TA 3FDXA 2EK5A 3LSGA 1Y4DE 3O73A 4K0RA 1VCNA 5EJ4A 1ZBDA 3M9XA 3RTDA 3TW8B 4BNTA 3QE9Y 1ZM9A 3UAXA 3FGPA 1B1AA 2B8NA 4BY7J 1ISRA 2O48X 3JD2A 1YR3A 2EYQA 1TW3A 4XN0A 2R5YB 4FLFA 2K9MA 4ME6A 1WCMJ 2X9DA 1K2VN 4TN5A 5U1PA 4NHJA 2IOFA 3IDSA 4F3RA 1QYCA 3RADC 3MJTA 1KYIA 3C7AA 4RJKA 4NC9A 2GOMA 5DI3B 1N2ZA 3EZFA 4JS0A 1O03A 2ZWOA 4IJMA 4J1TA 3JQ6A 4ADSG 3FHTA 1PR6A 2AOTB 2E89A 1J33A 2R25B 1SZDA 1XMXA 2VF8A 3ZGXA 3GLSA 1VPWA 1P74A 2EIHA 4G5SA 2BTQB 2NXEA 3OICA 4JC0A 4MR7A 2DQRA 1KI3A 2ZIUB 4P54A 5CAEB 4PG8A 3JSPA 2QZJA 2W9XA 3V4OA 3DEIA 4X7MA 1Z15A 1ZNZA 4OQMA 5EUBA 4L2IB 1M1YB 4B32A 2GOXB 1DUIA 1E1DA 1H2XA 3KUXA 4YP0A 3N05A 1PJ3A 2PEXA 3ROUA 4FGWA 4KQFA 3GH3A 4TL8A 1QTIA 1C30A 1LDBA 1R6BX 2CY0A 2CXRA 5HJ7A 3T3DA 1DRJA 2AFHE 2F64A 2PWPA 3DOOA 3LHFA 4FVTA 4XQ9A 1BR4A 3DF9A 1TO1E 2M4GA 1HW2A 2WT4A 2Z2JA 3IE2A 3K94A 3RO7A 1U5CA 4B17A 3G5MA 4U2GA 2WG0A 4ER3A 3DV2A 4PAGA 2G3YA 3F47A 4JMPA 4LHYA 1U8YA 3C97A 5DUIA 3JYOA 5DM1A 3ZHVA 2J6IA 3DW3X 4FHFA 1TCBA 5DISB 2ZJQF 3E7PA 2GCNA 1ZW6A 1DBPA 5KNCD 1WD7A 2V7WA 2GBPA 1NOKA 3Q9SA 1N1DA 3IKJA 4Q4JA 2H1KA 3X1YA 4BH9A 3VOSA 1S8NA 4OXKA 5AM1A 5C8YA 3WBBA 1R0SA 1D1SA 3ICQB 2XF5A 1JKQC 3JQ7A 3S55A 2GO1A 3P19A 4IHQA 1VQ4I 1HDPA 2VF5X 3JWHA 2M45A 4KXYA 2K4JA 1YB7A 2Q9AA 1T36A 4K6MA 4EFMA 1IYZA 4D9MA 4NDAA 3Q7RA 4B7UA 4E33A 4R16A 4MYRA 2PKEA 2V58A 3B7PA 3IKTA 4XRGA 4LXYA 4UEQA 2UUPA 1LXCA 4L2IA 2IWHA 3UT6A 4LB5A 1D0IA 3F49S 1OZ0A 3NDBB 1UZAA 3M6MD 2LGJA 3PDIA 2K9LA 4KO1S 4F6RB 1OILA 1NYQA 4MQEB 4AKGA 1XGKA 2AF4C 4CM4A 4EF5A 2R8ZA 5EZ5A 5FBHA 3LUGA 1EXNA 2H0AA 3CS3A 2FY8A 3GXBA 3GMTA 4ESVA 3QOPA 2MT9A 4KQKA 3WYBA 1G3IA 2JAWA 4JENA 2R7KA 1I24A 1ZJ4A 3FPGA 3HBJA 3L8GA 3B1XA 4Y13A 4IJKA 3QVOA 3H1PA 5IMSA 2XGXA 3CW2A 5AXCA 1LDMA 3AG6A 4WT7A 3S2YA 3V7SA 3SC4A 1EB9A 2DBVO 4LDPA 4J7UA 1K9SA 3QU9A 3GLHE 4WECA 4AS3A 2XKOA 1ISGA 3D0SA 1SD2A 1M34E 2V9ZA 3GNTA 4Q9HA 3ZKAA 1Q6ZA 2FDRA 3AF1A 4UREA 1MQAA 5TB5A 4C3VA 2CO5A 4DTCA 1RQLA 3BBLA 3DUFB 3AG1H 3OBBA 2GTPA 4I7HA 3U9TA 3JATA 2AXNA 2OGZA 2RAVA 3V4VB 4HVTA 2UUCB 1BRTA 3LSRA 5HKLA 3L2VA 4PK4A 3RS0A 4IJVA 2JK0A 3RBAA 2RG7A 4BU0A 4RTRA 3TQQA 1RWMA 2PJRB 4M22A 4BP3A 1E99A 4MV8A 4RPCA 1JG3A 1MC5A 1WETA 3DLBA 4RPLA 5AHKA 2YX4A 3ULKA 5EPUA 3A3KA 3CIFA 2F5FA 1QFXA 3B3QA 5JLJA 2O8CA 4BNGA 1RXIA 1EM8B 4FI3F 3I2YX 2HRZA 3QFCA 1D5WA 4E21A 4C0JA 4BUPA 3GRRA 5JQGA 3ESRA 5P8WA 3T61A 1LVAA 4BO3A 5B1AH 2HDNB 2XW6A 1BOOA 2ECQA 5GGYA 4ESHA 4FFOA 2A0FA 3KOZA 4HDMA 4MV7A 1YDMA 3B7GA 4F91B 1VRVA 4HX5A 3BMQB 5AVZA 5KNCH 1QK3A 4LVNA 4YCJA 4AUXA 1OCEA 4JOQA 4WMLA 2EX0A 3C5HA 1E9EA 3MTQA 4BFZA 5J1YA 2P9HA 1Q11A 1OJLA 4G0QA 4ESJA 3J80K 1W1UA 4QUAA 1SU4A 3MG9A 4RGSA 1WZEA 3REOA 5CVIA 1C7ZA 1Z62A 3IQIX 4PS0A 1RKBA 4I6GA 3RHSA 3VC3A 2VC0A 3ZKWB 1VYVA 4L18B 3HCBA 1ZVQA 1NH3A 1II0A 2A0XA 2V5UA 3EXEA 2F62A 5EDNA 2A0KA 1RWKA 3DDUA 3IIMA 4KLNA 1E5VA 4KXNA 2I8LA 4MZDA 4EJSA 3HYNA 1OTXA 2EOAA 4K8RB 6REQB 4LX8A 2GJ9A 3E58A 1JHZA 4OK6A 2ADFA 4UASA 4FE4A 1R12A 3NOOA 4Y7CA 3ZUPA 4URXR 1BVYF 3OBIA 5DT9A 5IYZB 3E3LA 2NV2B 4TUYA 1TYBE 1YU6A 3S1QJ 3CCVI 3O03A 1PL0A 2Z09A 1DP3A 4FU0A 2XF2A 3U44B 4J4BA 3QY9A 4YIRX 3W2AA 5DM7F 5AHWA 4I1SA 4BNJA 4G0WA 2CXXA 1Q7TA 3BTOA 1VHWA 2QQAA 3KQPA 1UH5A 1RWQA 2Q21A 1QS0B 2ES4A 2Y1GA 3B36A 1RW4A 2ZB7A 4QU9A 3TBIA 5LYJB 4PUSA 1DPGA 1O97C 4TZ6A 4NYMR 5LC1A 1Z6QA 4WNAB 4YH1A 4HGPA 1PD0A 4BAZA 1FXWF 5JVTA 1YO5C 4ZI7A 3SCZA 2NZUG 2RGNA 4PGHA 2FOLA 1Z5PA 1GUYA 2BFAA 1PR2A 2H16A 2I3GA 2C04A 3K9WA 5H0IA 4QM6A 3A4CA 3CCUI 1OU0A 2H1CA 2VDVE 4JU8A 4M86A 4PO1A 4QEDA 3RJZA 5IWCA 4RE5A 4LDRA 1ADCA 2BF4A 2W2MA 4JI1B 3SR0A 3EVTA 2Z2IA 4GS5A 3RVBA 1DQPA 3EC1A 4W9MC 3NP7A 5K4HA 4PZUA 1PHPA 1PGJA 2HBRA 2IELA 4XJVA 4ML3A 1R0BA 1VI2A 3KJGA 2PWZA 4F2HA 3G8AA 1GNRA 3G9QA 3UFXA 2BGLA 3KP3A 1F38A 1H0MA 1MG5A 3X43A 3PB3A 2C3YA 2NZXA 1KH1A 3CNHA 2EIMH 1U8AA 1VJDA 1CUWA 4A6EA 3I5MA 3R5HA 1Y34E 4L76A 2WJYA 5DCWA 4OHPA 5FPTA 3VI3B 1NIJA 1I4DD 4G0MA 4REMA 3FZYA 3FI0A 4FINA 3ISPA 3IDOA 1Z7LA 1ONSA 2RH5A 5CLLA 2C03A 1JTXA 1MGPA 2R92J 1WQ3A 2XA9A 2C9CA 3GUVA 3HL4A 4I50F 2IPNA 3M4JA 4O5OA 5K05A 4YIKA 5E6RA 4F06A 3UAVA 3M3DA 1XZNA 4L8FA 5FNVF 3C2GA 4ZPJA 5HXAA 2GCOB 3PZBA 4J1NA 2IV7A 4BKOA 4MLOA 2AUMA 2BFCB 3CN7A 1M8JA 1E7QA 1K8YB 4L6CA 5HM8A 1QRYA 1G6NA 3K0LA 1UELB 1XWWA 3LKBA 4FJ2A 1I10A 5FUBA 4IDHA 2XVYA 2GZRA 3K92A 3LQRA 2UYGA 3DDWA 4QOHA 1Z0XA 2HHLA 1RQPA 5FUVA 4DMHA 1ZOIA 3DV8A 1FBTA 4MRSA 1VZ3A 2WNHA 4XCQA 1T10A 3OE7A 4ZCSA 3ESDA 4M37A 1KBOA 4GMKA 1YCGA 3LQFA 3WL4A 4EJ6A 4N76A 3C1UA 1HEYA 4U0YA 2D1VA 1L8OA 3CYFA 3LT1A 2Y0CA 3OHSX 1E64A 3STTA 2D0PB 3V4GA 1CEXA 5EJ5A 1KJ8A 1LEHA 1JDJA 1KZGB 1CDDA 4HXGA 4R5HA 5CG2A 5IRCD 1QRUA 3UW3A 1IUOA 3TBFA 2JRTA 1G20A 4YV2A 2BR3A 2HPVA 2ECPA 1XX6A 3O9VA 3WBJA 3ICOA 5IUNC 2DSTA 4KPYA 1TMYA 3ZJ4A 1RLMA 4QGSA 4RDHA 2R8PA 2H1WA 2ZYWX 1I2ZA 4MS4B 4KRFA 4BOYA 3BB1A 4ZRMA 1QIGA 3JWEA 1K8RA 1V9SA 1YRAA 3PXCX 4LF5B 4NJMB 4B79A 3LQ1A 3QI7A 3KJZA 3U49A 3HYIA 3ABTA 4KE6A 1KEEA 1V41E 4KN7X 4R7GA 1A5BB 3BREA 3WB9A 4BHPA 1CS0A 3MBKA 4BKUA 2COBA 3BSWA 4JI4B 3DMPA 4DGSA 4MGZR 2D4HA 3VZBA 4JDUA 4B6JA 2DA4A 2Y1FA 4XLFA 1KOJA 5JLXA 3K72B 3LX8A 4CMHA 4NABA 4P3OA 1LW6E 4IZZA 1Y9ZA 5JS7A 3BFJA 4OH1A 4BMVA 4DCCA 5C1PA 3WAJA 1CVIA 2Y75A 1X7DA 3ZCSA 1Y8AA 2Q5IA 5JNSA 1RUNA 3UPDA 2Q2EB 3BA1A 4FYPA 3RKRA 2I67A 1ETUA 3KPHA 1I30A 3WBFA 3N6RA 3E5QA 1G8XA 3O8HA 1UJMA 1PZMA 1MOZA 4P33A 3O2JA 4RS4A 4PICA 2XCSB 4U00A 1H3EA 3DDOA 1SVNA 3UMJA 4YO8A 3DSRA 3RYRA 2XJ9A 5JD4A 4MIMA 3K6JA 3K7AJ 5C4IA 3EASA 3BPSA 3D7LA 1E79A 4AIKA 1R6UA 3DWFA 3ME5A 3IHUA 4RABA 4QQKA 4MV0A 4EITA 1KONA 1JXSA 1G8PA 1PGQA 2KBEA 2PVPA 4JI6B 1J2RA 3ZGKA 1P91A 1YR6A 3LP6A 3T35A 3BERA 4BO2A 5IJAA 1I5EA 1QRAA 2O2CA 3M4XA 4PZLA 5T4FA 3RFTA 3PL8A 1FFWA 3PNKA 2J33A 1H2EA 2R7SA 2O19A 2EV6A 4JI0B 4G5HA 4PYQA 4OUDA 3DLAA 3INRA 3GAZA 3RNLA 4R9NA 3COWA 3X2EA 1QRRA 1RMQA 4I5GA 4QDXA 4WOPA 3EF3A 2X6RA 5THKA 4E15A 1E7RA 4Q12A 3DZ8A 2A6HF 3FPHA 1MW7A 2WKQA 1XDGA 2FDXA 2BHRA 4NESA 4LMRA 2ZMEA 2H4ZA 4Y6GB 3ZCXA 2HSJA 4J7CA 3O75A 2IE0A 5BYBA 2CXTA 4NATA 1N32B 1T0FC 3KPVA 4FTWA 1QAQA 1AA6A 1RXYA 4XIDA 1QG2A 4Y4RA 4WXMA 5DE3A 3EIQA 2MR6A 5A3VA 3IUMA 4YMTA 3BTCA 1KK3A 3S16J 1MZVA 4J91A 2P7VB 2JIBA 5HIMA 1FMJA 1P4RA 1XA0A 2OZEA 3OYGA 2K40A 1CUJA 1EZ4A 1VI5A 1CRQA 2JK1A 3K9BA 4B4VA 3HDJA 3KEYA 4G9EA 5B58C 2OG1A 3D02A 4N39A 3Q8XB 4AMZA 4MR8B 3T12A 3ZDRA 4EMTA 4RGXA 2OAZA 3SZLA 4PFJA 4HLCA 2AFHA 3L00A 3L06A 3HCAA 5A4DA 2DLCX 2V9KA 1UJ6A 1F2DA 2D5IA 1A69A 1NNLA 1UBTS 1U9YA 1ZIXA 2XTMA 4M6WA 4D45A 2QI9C 2ISQA 4KNWA 4C14A 4CMJA 3CD6I 1MXHA 3AY0A 3K05A 2FE1A 5AUOB 3V8JA 5KPJA 1TJPB 2KW5A 1UMBA 3MLAA 3VSKA 4OPMA 4RKYA 4CW7A 3G89A 1QCYA 4EKGA 3GLRA 1YB5A 3PQJA 1IHOA 4NIMA 4GPZA 1LFPA 1NMXA 5EXEA 1AV6A 3TLCA 1VG8A 1GSAA 1QH1B 2NYRA 2OA4A 2ZW9A 1GCIA 1ORRA 2DBZA 3KJHA 3DVAB 1JJ7A 3N5CA 3PITA 1UBCA 1ISFA 1Y3AA 3LSKA 3NEJA 2GGSA 1ZH6A 2FAXA 5CTAA 5GJVC 1YDHA 4RCYA 5GP9A 2OCCH 1JAIA 3FPEA 4UPDA 3W6PA 1LBIA 3ZZTA 3KSMA 3KQMA 3Q5GA 4UVGA 3RSCA 4B2LA 3KLPX 4KT6A 3K9QO 3LHSA 2GB4A 1Z12A 4UMVA 4JOCA 3ODGA 1XFAA 4BV3A 5FUWA 1KIAA 3CKLA 1J0CA 1J49A 1LPPA 1E1MA 2W11A 2Y2ZA 1GUBA 3C8MA 4I46A 2XUJA 1APLC 3U44A 2NO6A 2O1WA 5EAIA 2OHGA 3JW4A 3LQ2A 4OSEA 1KMNA 3T5AA 1Y33E 3ZTYA 4UUOA 1IQUA 3GLIB 1NAHA 5M34A 5DSXA 1ZM4A 4HNQA 5CGZA 4IWXA 5L7TA 2Y1LA 3DFUA 4HQEA 3PC8C 2WABA 3T1OA 4MB2A 2VI5A 2NP7A 3B89A 2X0LA 3BC1A 2W43A 3ZQ6A 1KY2A 3DQQA 3GA5A 4ALLA 1YKSA 3PXAA 1QK5A 3ZHSA 2HFHA 3A03A 3TNLA 2GCIA 2UXXA 1BGXT 2FEMA 3PA8A 2NO4A 5AW0A 2O0LA 5M04A 3EPJA 1XCMA 4CIVA 4Z1MD 2HF2A 3O38A 4PPFA 3I73A 3FPBA 2EH3A 1L2TA 3OMWA 1Z3YA 3B6EA 5J4YA 3D6HA 1RCUA 1PQYA 3ABKH 1TM2A 4YFYA 1MN6A 3DZKA 3KIOA 1WZIA 3ECOA 2VQCA 3FXOA 4HA8A 4CWAA 3VNRA 1AB6A 4L4SA 2XWQA 3ANLA 1EFPB 3D6JA 4ZRNA 3RVPA 3MKZA 2DG2A 1D1TA 4EVQA 4KREA 2IH5A 2YBEA 4G0XA 4EECA 1M5RA 4DIUA 1UINA 4CMEC 4DRZA 2YXNA 1A8PA 4RKRA 3GZNB 3R60A 1CYDA 1E1QA 1KYTA 3QKSA 4KR2A 5IJ0B 1EXVA 1LNSA 1J9ZA 2AE1A 4QPZA 5B4TA 2O3SA 1QQTA 3OESA 4HRYA 4B40A 3R9IA 3QRWA 2JRMA 1NTOA 4DLBA 3W5IA 2QQ0A 2XWBF 4FIDA 2BDTA 2WAXA 1AQUA 2M6RA 3H17A 1OBFO 1PQ4A 3KM0A 2O05A 2VK8A 4HMOA 1K6XA 1XD2A 4OK3A 3WI7A 4L8WB 1Z8NA 3QBVA 2ZDGA 2OFOA 2FBKA 4QNNA 4V03A 2WIJA 2O1XA 3AOEA 2GXSA 1IBKB 1VPVA 2Z99A 2HPMA 1KFJB 1RWBA 2BLNA 2IITA 1GL7A 3QUSA 3ZE7A 1K6IA 2W70A 3WY9A 2CFOA 1J09A 2DU9A 4TV7A 5D3MA 2CC2A 1QGAA 4PO8A 2O8BA 3LQKA 1QNFA 5HTKA 1KORA 3W8NA 3CJTA 3CCBA 4MPDA 4P5EA 2AYZA 2LOOA 2VB6A 3Q8LA 1M0EA 1EINA 1R22A 2DPXA 3CZRA 3L7DA 4PZZA 5KDDA 2HQBA 3GJSA 2ME6A 2ZBVA 4LSGA 1XB4A 2XAGA 2XB4A 4NZNA 4UCXA 4YGXB 1BM9A 5DNEA 1FUYB 1HY3A 2JD1A 3UXEA 2WLSA 5HIKA 5HHTA 2QN1A 5JVGF 3GHYA 3LMKA 2Y31A 1LB1B 3AUSA 4FNMA 2CMPA 1IOWA 1ULHA 4PSKA 5DP2A 4Z0PA 3BR6A 4R98A 3BRQA 2ZYTX 1NBME 4JLBA 1TZ2A 5K7SA 3BH7A 3ZCOA 4KISA 2BYTA 5FTJA 3AJ9A 4XGNA 2GA9A 3W5VA 3CMYA 3DONA 1YR9A 2B7LA 2JD0A 2GA2A 3E3AA 5D01A 4A8TA 5JFOA 1SXGA 3BGOS 3L02A 3RUFA 5EJ8A 3GEDA 4Y6RA 1KWGA 2H18A 5F76A 4H9GA 4CEIA 5J5AA 1DAEA 2AFVA 2ZPUA 1ZK0A 3U3ZA 1MBJA 1DT3A 2J09A 1DRVA 1WVGA 3CPSA 4RQBA 4EQQA 2C4TA 3EWSA 5K5RA 4GBMA 2VJLA 4KMMA 4N8SA 5FPHA 4XK4A 3R3YA 1A72A 4YRRA 1TQPA 2P0WA 1MQSA 2FPSA 3H99A 2XZPA 4V0ME 3R7NA 4DS3A 2W7NA 3BIJA 4AYXA 3D3NA 2G1UA 3CJQB 4ZT6A 2QPAA 5A71A 4F4FA 2DT6A 2FQ3A 1XZQA 2C95A 3PYXA 5AM5A 3CF5F 3D6VA 3NT5A 2FK8A 3A26A 2W2LA 1M2OA 3HKEA 4HZGA 4IQJA 3AIIA 3OX1A 1QPZA 4LHEA 4PPNA 2PZAA 4O8ZA 4C7JA 1T91A 1XV5A 2HUNA 1W6UA 4CIBA 1H4SA 2OHFA 4TTRA 1JQEA 1PR1A 1H9TA 3RVOA 2QUJA 4UTNA 4FUQA 4BVBA 4MQ5A 4V0RA 2QV7A 5IAJA 3ZJYA 1JAXA 2DYKA 1D4ZA 3L0BA 1FFAA 3EDCA 2EQBA 1LPOA 3HKZA 1Z5GA 2NU9A 3LTNC 4A26A 3B13B 2ZIXB 1EKEA 4X3PA 5I7RA 4IRMA 2IZOA 1V25A 2PMZN 5J40A 4RWZA 3WAKA 3M1AA 2PX6A 1YCDA 3ONDA 4JIMA 1OLTA 3T3IA 5ILVA 2Z57A 3NONA 5C7OO 2C3OA 5FLMJ 2WSMA 2IXSA 4QIHA 2GFQA 3E4DA 2WBLC 4X7PA 5K0SA 3HXQA 1BGWA 3OCXA 3QVLA 2CS3A 2ISZA 2ANBA 3GFVA 3SC6A 4BGEA 5FLXA 5EZSA 2ID3A 3K5IA 4IIDA 3IP9A 3F6CA 1FSHA 4LHXA 5JE8A 4Z1MA 1XTZA 5FNVB 1C1XA 2C9OA 2DVMA 1W4ZA 1O08A 4AWXB 1LRLA 1X7WB 1I6KA 3L04A 4C2BA 1VL8A 2YCLA 5KTOA 5ALKA 1J1UA 2ZNZA 3HKZN 1ISMA 1M0TA 1E0DA 1GVNB 2VKDA 2I87A 3HJUA 4XWGA 1KRHA 2JNWA 4AN4A