4BQOA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein without disulfide bond between coa and cys14.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
308
structure length
308
Chain Sequence
QRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 117
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqoA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqoA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
1HKQA 2Q3HA 2EINH 4M9RA 3UMBA 4H1VA 4OX9B 1LDDA 2IGNA 4UTNA 4DWVA 4XRRA 5KVRA 3MQFA 2DFKB 5AKYA 4F60A 4PJ0C 1BVUA 1RM4A 1RFGE 5AVKA 5A71A 2GQ0A 3VDXA 3ZWQA 2P6NA 4PSUA 9ABPA 3E5NA 4PY2A 3HADA 3TR6A 3BHNA 1G8HA 3PPWA 2A1TR 1FYXA 1XU7A 1Z6QA 1JAZA 1ODTC 5C53B 4X9XA 4N0DA 4C76A 4WPGA 3B3GA 2CZQA 2G82A 3U4GA 1QGUB 1M8GA 2VF4X 3F21A 1J0BA 4QBFA 3UB3A 1VGRA 5A62A 5J59A 1M6VB 1HKTA 2XMCA 2WHPA 5H9WA 1KU6A 3OLVA 4PX9A 3W9UA 1Y1VJ 5AVYA 2Q2WA 4H1WA 1QU2A 2ZJ4A 2HGZA 4FINA 3IUYA 4L15A 4WECA 3KSBC 1BX3A 3CLRC 3A8TA 1RIOH 2HLPA 3FVRA 5JW6A 1Y0BA 3GJSA 4XKJA 3DNMA 1BJRE 1W1UA 2BGUA 2GR9A 2R1ZA 1BCRB 5HRAA 1W59A 3HBJA 4C22A 5U1PA 2PBRA 1U1GA 4PO3X 3CCVI 5E9WA 4ZYAA 4WXEA 1AMUA 2SKEA 4XGNA 4R8MA 4BU0A 4EP1A 5A9RA 4DBVO 4DQDA 4AWXA 3GX4X 2HPAA 3HVJA 2W85A 4MQ9F 2G3YA 1R9JA 3NBYC 1ZBQA 2RAVA 3JRHA 3RODA 3M5CA 5MHTA 4IOAF 2Z58A 1FFCA 2F2EA 3JQBC 3GEBA 4MS4A 3S2HJ 3VB2A 3R0AA 3SLKA 4KMUX 1R4NA 2PHZA 5A5GA 1ZW1A 2JJ1A 5UKDA 3QYFA 2W7NA 1MBZA 3BTOA 2IY8A 1ESCA 4HRAA 1U9OA 5B2FA 3VHXB 4DQXA 1PU2A 2O05A 4BBAA 2AC2A 1DRJA 3UXMA 2J3JA 3AV3A 2WJ6A 3H5TA 1KP9A 1UBMS 4RVGA 1N8KA 5JCXA 1YFZA 3WODF 4GEGA 3ND7A 3IUMA 3H4MA 2ZRHA 3A6PC 2VDOB 5C8DA 2GEJA 2PZFA 3ENNA 3VDRA 3BJOA 3FW1A 1FY7A 2Q1XA 4GNRA 4RQAA 4DV1B 3AC0A 1ILEA 3B6CA 1V48A 1N6KA 3EQ7A 3WMEA 3QOXA 1ZA2A 2AKYA 4AQDA 4J94A 4XVCA 2EVWX 4ZYTA 3OQPA 3R7SA 1SPXA 5A7FA 3DPTA 2VNSA 1MCZA 1S6LA 1P5RA 2WHQA 3WADA 3L8EA 1E3SA 4XJVA 5TJ9A 4CXMA 3FNHA 3TK1A 2CNKA 3ZOZA 3G5UA 4FW9A 1JTYA 3TAXA 2F43A 5K05A 5EYPB 2M30A 4MV6A 2NZWA 2E49A 3IXLA 4JV5B 1VG0B 1Z91A 4IXNA 4ZRMA 1U7XA 2GPJA 4D9EA 4GWGA 2OPHA 5HZGA 5C5CA 1WH5A 3QF7A 3GNQA 2DFTA 4B73A 1SFOJ 3LA3A 2IUUA 4TN1A 3CZMA 4C0KA 3P27A 2YXBA 1H8EA 4GECA 3NTUA 1E4EA 2ME6A 1JHRA 1JI3A 2YFQA 1KP3A 1G8AA 2WA1A 4QTTB 3EUWA 3BOQA 4A3KJ 4FX2A 1MLDA 2GBYA 4Y15A 2I7XA 1SCJA 1GQ2A 1Z3XA 5B37A 4D5EA 3CW2A 3RTAA 4B83A 1HT0A 3VKVA 4TKUB 3T34A 5EZYB 1DKRA 1M2WA 4PNPA 3AUJB 5TXGA 3CR3C 3O8CA 4F85A 4Z0TA 4I02A 4Q4AB 2COEA 4KMOA 2ZRAA 4CMGA 4GE3A 3HRKA 4M0UA 1Q3KA 1XQVA 1PGQA 3I30X 2OOSA 5D1NA 4ZJYA 4A73A 4XLNF 3PUBA 1KMHB 2WF6A 4FFLA 4M0FA 5JC1A 4IO1A 1G2OA 3BWXA 2W2LA 2RHWA 1IY2A 4XVRA 4ZI2A 2XGJA 1C3OB 4GUDA 3LUAA 1DMRA 3CCLI 5HTKA 2ZIXB 1GKIA 3R5XA 5E38A 2KIUA 1SCIA 1ULBA 2COMA 3B2NA 3E7PA 3FD8A 4W1SA 3KKQA 3ZI7A 5KTTA 5EZQA 4M0EA 2KDZA 2RGVA 3ROFA 1IXYA 3URMA 4TV8F 1ZGJA 5D3MB 3TOVA 3LA8A 4P83A 2W6JD 1VPWA 1KAEA 5AKXA 1KBOA 1UADA 3V6LA 2NOAA 4YREA 2BGRA 1X70A 3FY4A 1L4HA 1TD1A 4WOPA 2NUTA 3G3ZA 4R1LA 4CCJA 3K9GA 4HMPA 4A2CA 3NHFA 2D3TA 4LPKA 3IO3A 3MRSA 2RKWA 4R2XA 3T3EA 1ZBDA 4I1UA 3IV9A 1Q7BA 3ET5A 3I09A 1R9GA 1K8YB 2IZ1A 1FBUA 3S14J 1HFWA 2P40A 2MYNA 3E4DA 2YCLA 4P80A 2CJJA 3RWOA 1SVUA 4HEQA 3CUQA 2LXNA 3IUOA 4Q9DA 3CCFA 1TB4A 4AJPA 3U13A 1XALA 4Q19A 1IWPB 4MARA 3NKFA 4BYMA 2XNCA 2JMWA 2KW5A 4MV9A 1EX7A 2F3QA 3WRXA 3JWJA 4CM8B 1FFHA 3QUAA 3F6CA 4XEUA 3WQRA 2IVFA 5LP6F 1KDYA 1SFXA 4OAOA 4KHPB 1FNNA 5COAA 2HDHA 3HHEA 4LHEA 1FY2A 2FUEA 4MFDA 1Y6IA 2QXTA 1VYHA 4HJXA 4A2PA 2L54A 1WZIA 3AH8A 3WK6A 4C4RA 4D4GA 3WYCA 4A91A 4XD2A 1QCDA 3F7OA 3HCAA 1JFTA 4WQMA 4JR2A 3OX4A 3HV2A 1SBQA 5ITWA 3D4OA 2EPFA 1FB5A 3EN0A 1KE2A 1N2HA 2VLIA 2XWQA 1DUIA 5MGBA 1IM8A 3IPLA 4PG7A 2PVPA 5CVJA 3LP5A 1P77A 3IKTA 1GVJA 4MVJP 4BDTA 1TUBB 3VYRB 1U3UA 3N9IA 1S8OA 5CLGA 2A9OA 4H2DA 4P81A 3GFTA 4UUBA 3ZXYA 2WTUA 5ES4B 3QM1A 3P94A 3PFWO 1RM3A 2D5BA 4JNKA 4PGFA 5L3SB 1C81A 2GD1O 3KOOA 1FP2A 2ZJYA 4YUAA 3D2BA 2Q2VA 3KWLA 4KV9A 2G1PA 3NNNA 1B9MA 1B6GA 4LQCA 4YCLA 3UJ3X 2OSBA 4YIFA 1LH0A 4QJ3A 5IHPA 3UUEA 4QZVA 3S16J 5DUIA 1ND5A 1CU1A 3OYHA 2TSYB 4ENWA 4TKMA 4WK4B 4R9VA 3L7LA 1N2ZA 3B7WA 3NWBA 3F97A 5BMVF 3TJRA 1C9KA 2K4BA 2OD2A 4UV9A 5KYGA 1RRCA 1ODDA 3M9LA 2FUCA 3KUUA 4EKDA 5J9FA 3VPXA 1U3DA 2GVZC 2Y92A 4OJNA 3H5AA 3H9JA 2PTGA 1TAHA 1UZMA 2V74B 3O0DA 3SJZA 1O2DA 1MXHA 4OIPF 3JTMA 1U0NA 2FX5A 2WWWA 1WVMA 3T9DA 1BDHA 4IPTA 2IGTA 3AUYA 4CMBA 5CLQA 1ADFA 1J0CA 2A3RA 1BR2A 1SC3A 2O2GA 2CMDA 3BGDA 4FFVA 1GD1O 4C9YA 3FKJA 1J06A 1ZUWA 2UVDA 4RAGA 1XTJA 2JI9A 3C5EA 2Y0MA 4BDYA 1TD9A 3FCCA 4YCDA 1QUEA 2DFPA 2Q4RA 1EV7A 2BRUA 3WGNA 4NNOA 1QKKA 4KXFB 4BVJA 4QKQA 1NW5A 3D6TB 2XF5A 4BQIA 1PUEE 4GCVA 4XRFA 5GVSA 1U5BA 2JLBA 2HQNA 4YPVA 1SUSA 1GPUA 4DDWA 2XNDD 2D1RA 2JLZA 1W4BA 4PUSA 4CCYA 1IV8A 2L82A 2C95A 5ILQA 3AFIA 1EJ0A 1T26A 4UHKA 4CDRA 4YRBA 3S81A 3LFUA 2Y93A 1Y4ZA 1XMQB 4IIGA 4R1NA 4H7FA 2ZTUA 2CXXA 1YZYA 4O63O 5DTIA 1CE8A 4NC9A 2IYEA 4PLTA 3GLGE 3WIDA 4YBZA 1EFHA 2BTQA 2BISA 4Q1FA 4B17A 3OWOA 4WX2B 4A0RA 2X2EA 1W5SA 2QD1A 4AB1A 4BX8A 1UXOA 2K9QA 4L73A 2HCFA 1QTRA 4GQBA 1H5QA 1R00A 2ECBA 2XUBA 1DKOA 4DJAA 1WE2A 4WADA 5IHXA 3L79A 4FGSA 5LR6A 2YUIA 3WLMA 4BXFA 1YAHA 3DV2A 4Z8XA 3FCAA 4CI0B 2ME0A 5IUJC 4BBRJ 2UV8A 4O59O 2FSGA 1QHHA 3HTUA 3ZV3A 1OASA 2VB6A 1S96A 2FK8A 5IG2A 1Y4UA 1OXBB 2Q1UA 2VJMB 2WP8J 4BE4A 4U2FA 3GJ7A 1T2VA 4MTEA 2WJVA 2OWDA 1Z21A 4YFVA 3WR5A 4HZUA 2VTDA 2DQ4A 5DSZA 3H5WA 1JUSA 2P0YA 3SDSA 4X90A 4JLVA 2XGEA 4E7ZA 1PDVA 1NQWA 5TLSA 5JVDA 4EB3A 3TZLA 2QTWB 3SC3A 1P6RA 4CL3A 3GXOA 2FVXA 3TPFA 3RSOA 3KE8A 2Q2EA 3TSOA 4QWMA 1QRTA 4JHLA 1BS1A 2DWCA 3VSBA 1UFKA 1VXOA 1IXZA 1Z67A 2VSOA 5KYUB 3ASOH 3ESWB 1UKYA 4GOJA 2FGJA 4ZFNA 4G81A 2JCGA 1DFIA 2YJ5A 2W83A 5B3JC 4ITVA 1YA8A 4G0WA 1MNQA 3UZUA 8ATCA 1KEZA 4EZEA 3ZIAA 4DLNA 4FDVA 2IYRA 1AN0A 4IF4A 4Z1MA 2Y6VA 3TN7A 1M2HA 2R97A 3O90A 1FU4A 2MYPA 1TZKA 3RT9A 4LYEA 4LDRA 2FG7C 5DXFA 2W8ZA 3IKVA 1JS1X 1IK4A 2FNAA 1LBSA 4AMGA 2F64A 4QOHA 1J39A 2BFMA 4O3MA 1ETUA 3EH2A 2RGWA 2OXEA 3MT9A 2VNIA 1B0ZA 3PCXA 5HE8A 4P2BA 3HKBA 1E3JA 4PCUA 2UYYA 3EQ6A 5GZ6A 1CP2A 4U2EA 5IBCA 4MQ4A 3DQPA 1XZBA 2OPBA 3EA0A 5JBIA 5JECA 2VZEA 1NATA 5EE3A 5HPYB 5M34A 1L5ZA 5TARA 3TMKA 2FSHA 5CEFA 1GA4A 1QTIA 4TTVA 1AJEA 1CNEA 4OUKX 2DCMA 4ZOEA 1JA1A 3SJCA 2ZCVA 1F20A 1LBTA 1CF2O 1PLJA 5B6IA 4IIFA 1OYVA 4FCVA 1WJ5A 3FM3A 2JAOA 2WNHA 4BE2A 4BV8A 4YS6A 2Y1KA 5LFAA 1GZDA 5EXSA 1NXVA 3I8XA 3VPHA 3OQMA 3F6EX 2PXCA 4I8XA 1CR4A 4M1OA 2P9GA 2VDWB 4YJ3B 3SQXA 2HK7A 5BURA 1KVUA 1OXTA 3R7WB 1IVSA 1MVNA 3PFYA 4BFYA 1S7AA 1RMTA 1WUTA 3D6NB 4LYYA 1JDBB 1K97A 2W43A 5LPNA 2BLLA 5DV5A 2FX3A 3FPFA 3HGMA 4H18A 5LQCA 1D1AA 3SBDA 2MIIA 1T13A 1K63A 4BEHB 5HQJA 2VT7A 5U4QA 4RDIA 1GTRA 3I8SA 3K0KA 1IJWC 3DMPA 3AVVA 4LF6B 4AJEA 2JI8A 1KU7A 2HEOA 1ORRA 4B82A 4Q6BA 2GXUA 1TE2A 1IN5A 2P9ZA 2HU8A 2WBLC 1BEZA 2RKOA 4UQOA 4RZXA 3NONA 3GTJJ 3IESA 2D1FA 2GM4A 4DPMA 4MPRA 4LCEA 2HKXA 4YAOA 3L6EA 2XYVA 1DEXA 3B70A 2WG2A 4RVDA 4ZO8A 4CMEA 6ABPA 1ZRHA 4JQYA 4L7VA 4WLEA 4YP7A 4E3ZA 2SKDA 3NHYA 2FJ0A 2VE9A 5C44J 5LL6P 4RPLA 3BRWA 1XPRA 2QKMB 3PVSA 2PZEA 2Y0SN 4K05A 4IHTA 1TUGA 1N2CB 3AM5A 3O5AA 3PC2A 1ZICA 5FUXA 5HSGA 4JL5A 1ZD3A 1TA4A 2O48X 4KJXA 1UC4B 1Z2AA 2KFDA 2Y1FA 3H6GA 3OETA 1RYHA 3T0YA 1GSAA 3JR7A 4QLCU 4TMFA 4C0WA 2PO7A 2BONA 4RPGA 1GGJA 4UTPA 3NHPA 3BXEA 4UNSA 3GRAA 2XE4A 3LK7A 3R6LA 1L7AA 3LXMA 2FPXA 2ZBQA 4OK3A 1EFPB 4XWOA 1J0DA 1UMDA 5E6SA 4GP9A 3RV3A 5KOIA 3CHYA 3C7JA 3QU2A 3GJ0A 4NAHA 5F9MA 1X39A 4R54A 4TKVB 2YZKA 1E6UA 1BHSA 5IM4F 3ZJYA 1PGPA 1P8AA 5LA6F 3EPHA 4IV8A 4UNNA 3EXG1 1MKMA 4LC0A 3A58B 3MFYA 3OYDA 2HJ9A 3WLQA 2BYTA 2EBFX 1RFLA 1MC5A 2JEYA 3UFBA 4GL4A 1NI3A 4MR9B 1Z47A 4X1OA 1H42A 1DIGA 4NYMR 5DCFA 4U6SA 4NH0A 3OYNA 3KP7A 2ZAMA 3A1FA 3T7DA 5EMLA 1QQ6A 4XYMA 4CU2A 4JX5A 3F7MA 4OYLA 4ZTUB 4EHBA 3WNQA 5DSXA 4DXDA 1II0A 1YUBA 5IBPA 4N6GA 5T4EA 1UDCA 2PMZN 2D4HA 1Q7GA 4IDDA 1BWSA 4FGJA 3TIXB 5CG2A 4GW3A 1S7GA 2G04A 3S3MA 1AQYA 3O9ZA 3ZE8A 5DEOA 1Y0UA 4R0MA 4AC0A 3NBXX 2YJNA 1SN7A 4E2ZA 4E6PA 2WIBA 2VBYA 3F8BA 4Z54A 4DIFA 1DRWA 3IAHA 1RAFA 5IKXA 1OROA 2L7KA 5KIAA 5C4JJ 3QUTA 1R49A 3FXAA 2ZO4A 2P9FA 3LBNA 4C1NA 1NDQA 3M89A 4X91A 1Z0JA 4ZVTA 4Y17A 1R5OA 1LD3A 2RHCA 3K4MA 4BU2A 4P4UA 5EFOA 2OK8A 1PG0A 2PM8A 1E1CA 1CSEE 4FX4A 3ERMA 2OWEA 3ZK9A 2AS5F 4QYSA 5CHEA 1SOAA 3SHFA 4NNPA 3GFLA 5BR7A 1H2XA 4JOMA 4ZYEA 4WNYA 4UM8B 1F4KA 4WWCA 2CU7A 4X5OA 4JI6B 4I0AA 1F7VA 3LAPA 4XRSA 1FTNA 2K7FA 1YNOA 3KJEA 1KR5A 1F8XA 5HFNA 4FX0A 4YR7A 1IJEA 4EH1A 1EKEA 1T3HA 5T3YA 3B6EA 3WL8A 4R1PA 1NP7A 3NJRA 6PFKA 3TP3A 3QLVC 3HM9A 1B8NA 2PSHA 4CYCB 3ZZUA 1IL0A 1DIHA 4Q47A 5FO0A 1MZBA 2H1KA 4L85A 2NAPA 1JAXA 1T6XA 3RKSA 1XCVA 1BZYA 4C4ZA 1MB9A 2VP2A 4CIYA 2GPSA 1DXHA 4GPEA 2WUEA 2RI6A 1PUIA 3MBOA 4FOLA 3O1HB 4CM4B 1RHUA 4RSMA 3EXFB 3NIWA 1QZEA 3BAFA 1N0VC 3T61A 2NVWA 3HRUA 5BV1A 2QZPA 1H22A 3GPDG 1C0LA 3EXIA 3R3JA 1L3IA 4LV6A 4FTHA 4FHGA 3SZMA 2QD2A 1PLLA 521PA 1Q91A 2BM9A 2LOOA 4MS4B 3ETLA 1E1RA 4KSYA 2DMNA 2A9QA 5J6XA 2JJ1D 4UQLA 3OAAA 3S1RJ 4IINA 4QFDA 3CWQA 3A70A 2FQ1A 3O4IA 2LY1A 3L8YA 2DPMA 5EJGA 4ND6A 2EP8A 4ZQFA 2Q8NA 1GT6A 1E6MA 1GJRA 2E2JJ 4AZVA 3HN7A 3N8GA 3ORYA 1IGNA 5AKIA 4TQ9A 4DILA 1O9BA 1C9NA 3HU2A 4CFYA 2QZ9A 1FK8A 5ELLA 4ZDJA 1DAHA 4CF5A 4EG8A 2IEZA 1BR1A 1W1WE 4NFLA 1L5RA 3JAMK 1JKPC 3A26A 4B8WA 3FKQA 3DR5A 3U4HA 4ZI7A 4P98A 4U4AA 4WI1A 4D3DA 1HL3A 4YFYA 2HWKA 4MKFA 1X1TA 2XGOA 1M0SA 4P7JA 3ADCA 1OT3A 4A6XA 4ENMA 4Q37A 3BWEA 5EAIA 2NACA 3AJ9A 3W3AA 4ZC8A 1ZD9A 3AI1A 3GLUA 3DVSX 3L7IA 4FR2A 4KGVA 1XTRA 2HF8A 4RQUA 4AN4A 3C3KA 2EGUA 3LBIA 3FAZA 3C6XA 4TX1A 4QXQA 2QX8A 2E1NA 4TS9A 3KFLA 2F43B 1WP4A 2D0PB 1HFJA 1P44A 1E2MA 1REQA 2NTJA 5G1NA 2R60A 1IOZA 3KPVA 3RIGA 5G0UA 1UFOA 4TRJA 3F7TA 4JENA 2EX0A 1KI6B 4D4KA 5DN9A 3COAC 2XWBF 3K1ZA 1E94E 2E5ZA 3MWEB 2E18A 1LFUP 1TMYA 1Q5PA 3ZHXA 1FFEA 4EGAA 2G5PA 2X6WA 2D00A 3NW9A 1VNDA 1H8ED 2IRFG 4KE7A 1MENA 1GUDA 2VUSA 4P93A 1TC2A 4M0MA 1KS9A 1L7OA 2OBBA 1NRWA 2IUYA 1JHFA 2WRZA 2G9RA 4NV1A 4RV9A 3NHKA 2RGYA 3JVUA 3PXXA 1E9FA 1KDTA 4L0QA 1N33B 3PSFA 3V7SA 3O9VA 1ISIA 4CNQA 4JY7A 2AFIA 4KXWA 2WB1N 2IYWA 4MGKR 1XZIA 2X1HA 4JS0A 1I3AA 1GPDG 5D1HA 3C6QA 3SS9X 4OXYA 5CCBA 4M8KA 4Y1RA 5A4FS 5EJ4A 3CZ4A 2I34A 2I80A 3PHJA 4ZV9A 4BQQA 1ZH6A 5GONB 4CCSA 4ACAA 1K8QA 1XU9A 1HLPA 1TZLA 3VR6H 5DK6A 1Q16A 3VO9A 3WQQA 3OM8A 4FVTA 2ZB9A 4M0KA 5HKKD 1WQ1R 2OQGA 3GFVA 3HL0A 1LS6A 3ENKA 2QUFA 1H1DA 1SKQA 1MX1A 3QVMA 4DLLA 4DCPA 2NXWA 1EVLA 4U0WA 2RK4A 4IRHA 2G5TA 4Q3DA 4KWIA 3F23A 4ZOBA 4UBKA 2XKBA 4RAFA 1X4OA 1JSRA 1MH4A 3FYUA 1Y8QA 3NIDB 5H4GA 3AVYA 5AKJA 3S7TA 1Y6RA 3GI1A 1X1AA 1MN6A 4X8OA 4MUXA 3LGXA 4HFMA 1VRWA 3P9YA 2LP0A 3NHBA 2NUTB 2D3WA 3ZV4A 1P45A 3HB4X 4M9ZA 5JQGF 2I4IA 1KH3A 3TH5A 3CPJB 4QECA 3ZWWA 1XLWA 4JLPA 1KMCA 2HJWA 2DMQA 3I9FA 1JQAA 2OCYC 4Q9JA 3CCYA 1QHEA 2I6TA 4MLPA 3F8NA 4PPFA 3D1NI 3P9NA 5GGYA 5K3OA 3U44A 2FOLA 2GAIA 2J3LA 5FTKA 4YACA 4ENRA 4YQEA 3T3IA 5B3LA 3CUQB 3SOPA 4K6GA 4KDFA 1KK2A 5DT9A 1WB9A 1N8NA 1U9ZA 4XWKA 2QL7A 3A4IA 3A6LA 5L3DA 4HGOA 3OYAA 3HKEB 2ZXHA 1MJGM 4Y6GB 4RMGA 1JQDA 4O2RA 2PJRB 1WTCA 2BF4A 3V7YA 1ID8A 3NATA 5CB6A 4G5HA 3KX2A 1M0WA 4JX9A 4PR0A 3B6IA 3BTUA 2VK2A 1FBQA 2D59A 3UK1A 4D6YA 3QU3A 3ZHOA 1S72I 3ENVA 1DO8A 3L46A 1TCCA 5THKA 2B4RO 4JFRA 2XXAB 1E3IA 2VYFA 4JJGA 3PI7A 5FKMA 3WV5A 4HFRA 2FOXA 5H0IA 3QXJA 1H6AA 1FCJA 3QYPA 1H8HD 1KYQA 4WMLA 4OJKA 1PJQA 3A0UA 1CLEA 4QNMA 2V4UA 3QOWA 2OPTA 2XCRB 4R1SA 3ZGKA 5JXHA 4U6QA 1O89A 4W99A 1N0IA 4UZFA 2RHMA 1DTEA 3UGTA 4FLFA 1NULA 1ZN9A 3OE1A 4J0DA 2O0KA 3R3XA 1WSAA 3C87A 3R0IA 2EFWA 4X6LA 4GOOD 4G84A 1W48A 4PGGA 4I99C 2CS3A 3ZCTA 1XX5A 3TW7A 1YRNA 3DBLA 2ZVJA 1DJPA 2ASVA 1D04A 3HJUA 4MI3A 3X1JA 1BS9A 3SX0A 2EJCA 3Q9UA 3PK0A 2MH9A 3LZ6A 5D85A 2JRCA 1B59A 3DQZA 3LUHA 3FMSA 2Z04A 1I0IA 3MZYA 5CBPB 2R00C 3JQPA 3NT4A 1NLMA 1LDMA 1AKEA 2QWXA 2XKJE 1U2ZA 3NYWA 3I52A 3KT0A 3LOUA 5KU7A 2XIQA 3U4DA 5LNK6 3CGWA 4JBIA 3TM5A 1QAQA 1ZNXA 5F3DA 4Y2SA 4LGYA 5AVUA 1GPAA 4GBGA 1QORA 4ZC3A 1JKJB 2B0JA 4MW9A 4BE9A 4Y2YA 2FWMX 5CB4B 1QF9A 1DBWA 1TL7C 3IQZA 3ORRA 3FH0A 5FTLA 4CKBB 1Z45A 4MVJH 3O94A 2ZMEB 5ES3A 1SA0A 3ILHA 3AR9A 4TMXA 5CTJA 3QWIA 1O4WA 3W6OA 3EE6A 4J19A 2E6KA 4L3OA 5DYNA 3BK1A 3FMIA 4CL2A 2LY9A 4JEHA 2I4NA 4IWXA 3E5XA 2V1NA 4HDRA 2P6OA 4FQ8A 5E7IA 3WLTA 2JFNA 5FO5A 1B8VA 2X4HA 4KMFA 2F3PA 4M98A 1YRAA 2JARA 4KN6A 1U5CA 2XRFA 4KDEA 4OHZA 1JAYA 4LHXA 2Q6LA 4HAUA 4LJ9A 4MA5A 4XLTA 3QXCA 4EHFA 2ZRLA 4C89A 3P9SA 3E6CC 1Q15A 2NVUB 3U0VA 2FMYA 1U2PA 2VUIB 1CE8B 4UZEA 1AMNA 2O9JA 3B7PA 3M4JA 2BTQB 1N36B 3RD5A 5LZ7A 3CF6R 3KEOA 1YB7A 2PRYA 2OZKA 1PG5A 2VQGA 3G8DA 1UDXA 1GVHA 4Z7QB 4F96A 2HQAA 1R8SA 3LYAA 2X77A 2KBFA 1LRJA 3FWYA 2G9WA 4Q7EA 4HDKB 3DKXA 3V8KA 3MLEA 3EXEB 3GBPA 3KQTA 1OY1A 1X7XA 2J45A 4XKVA 2C7VA 3JYPA 3RUIA 4JOCA 1IH8A 4B2PA 4LOHA 4MWZA 4WGGA 5C8ZA 2VC0A 3FWPA 3C45A 4CEHA 1TF2A 3BEDA 5DD8A 4GKVA 3ZY2A 4QHSA 1C41A 3UW1A 3IC5A 2CBZA 5IYCJ 1HX7A 2XOXA 1V43A 4IZZA 3PEVA 1AKVA 3I0NA 3WK4A 1QQBA 2FW9A 4GP6A 4YLYA 1EZZA 1YR6A 1HDOA 1JBEA 4B4OA 5BN1A 4PPGA 3KTAA 4IH9A 1UAAA 5J4VA 1SC6A 1IC8A 4DC1A 4PFPA 1Z39A 5JVDB 2LNDA 4IJWA 3EODA 2M0MA 4HXEB 1VBNA 4LK1F 4EO7A 2WEKA 2AWOA 3LYLA 2BDTA 3KVOA 3ZW9A 2G25A 4BEVA 4DR4B 3WE7A 4J0IA 3OZTA 3DMRA 4LNUA 4IIDA 4LG0A 4OHVA 3ZIAD 1KJWA 3N2YA 4LF7B 3S1AA 1IM5A 2CXTA 2JHPA 2Q5CA 3SLRA 3PYLA 4PS1A 1XPXA 1RWWA 1KOJA 1SQGA 2HDNB 3N0VA 1R0KA 4QGHA 4XYLA 4NQWA 1TJ4A 5IKOA 3BTIA 1CUEA 4TTSA 3OR2C 3PZRA 2CF6A 4UHEA 2OP1A 3DDHA 2I8DA 3MUNA 2WOOA 3MGKA 4CYDA 2OO5C 1NG1A 3ROUA 4L0ZB 1JDVA 2RE8A 3THXA 1IONA 1G4HA 1ESDA 4BVGA 4KEAA 1CF7B 2Z9CA 4UHDA 2V9KA 2W5UA 4RANA 3I2IA 5AVSA 1RLOA 1GFWA 4ZO6A 4MW7A 1EBUA 3BR2A 2G77B 1DKUA 4ZQHA 3EXAA 4WH0A 5AW5A 4WBSA 3HGTA 1ZTRA 1NT4A 2YS6A 4OL0A 1LPNA 3W3CA 1ZAKA 3HS3A 4MLCA 1YQDA 1X14A 1BFKA 5EQFA 1B15A 2H9IA 1PFUA 5BW5A 2FPPA 2FQXA 2RIPA 4XWAA 1O94C 2VP4A 3IBSA 3ETJA 3K72B 3ZXUB 4IJUA 3FMQA 4M6YA 5JXWA 4ZD6A 1NR5A 1XB2A 1GT0C 3WLNA 1AK9A 3G1TA 4DTIA 5DE3A 1PJ3A 4HEHA 2HS5A 2I2FA 2Q46A 5GWXA 3SSOA 1JXAA 4OPMA 1W5CC 4HDUA 3C24A 3EXHA 1I2MA 5H59A 3OLWA 5TMBA 1QGDA 1MIOB 3RFUA 3I3SR 4ZDPA 5FTJA 3QLJA 4RGQA 4QJ5A 2OHJA 4ED9A 2DFDA 2M87A 5F2OA 3ROGA 1EFLA 1WO8A 3BMQB 1E2GA 2UZAA 3BK2A 3SU8A 3G6KA 4YONB 5TISC 5DGCA 1VLQA 4H7EA 2QOEA 4DLVA 1UG2A 1NHGA 2V1XA 5H8WA 4JASB 4BMVA 1Y56A 3P2JA 3QBJA 1A2QA 1M5TA 2BFDB 5PGMA 4G4IA 5K0TA 5A9SB 2ZUVA 5EHXA 4XOUA 1MAUA 4I6ZA 3HEMA 5C7IO 3AY6A 1NTCA 1Q1AA 4H6XA 3KALA 721PA 1SVSA 4ANFA 3KBBA 2HVQA 3HP1A 1I80A 5K2OA 2ZE6A 1LXCA 4UBLA 4D8UA 4OJTA 1OTYA 2IELA 1AE1A 3O8QA 3H87A 1G21E 3UUGA 5ILGA 1OCPA 3IP5A 2D7JA 1J0RA 1CVIA 1ZXXA 5DX0A 1Q7EA 4L3VA 2OJED 1B0UA 4D0PA 5AMXA 1BTOA 1ZX1A 1LNZA 5C1BA 1AGXA 3E4CA 3V97A 3M4NA 2R8YA 1EGAA 4HYTA 1S9HA 3VNRA 3BFXA 2G5GX 4KDPA 3NQ41 1NQOA 5K0CA 4QLOA 4BLRA 4JWKA 2I6XA 5K6AC 2OQIA 4LRXA 1N5LA 1ISFA 3STHA 2QM0A 1ISSA 3NV9A 3GQVA 4CV0A 3CMMA 3SQMA 2DBVO 3TSZA 2H0RA 4L4RA 4D0GA 1EX9A 1UMDB 2CYAA 3BS4A 1UBTS 2A4MA 5E6SB 4KB5A 4JP8A 4NFHA 1G4AE 2R4TA 4IV5A 4OKSA 5AOAA 5F3RA 2H9AA 2XCTB 1CT9A 4ZGBA 1FA9A 2Q29A 2OCXA 1M1ZA 4N8EA 4OIRF 3ZY5A 1RWBA 2WU8A 3K4LA 2BWJA 4I4NA 1NV9A 1MA0A 1P5HA 1KFCB 5AI5A 3KR1A 3BIFA 1JEJA 3NX4A 5KK1A 4UAUA 1FZPB 2OUMA 2IIVA 4YJKA 3I53A 2JLSA 2DT8A 3C3XA 4FE3A 4I19A 3QQPA 3OFNA 3DLPX 4C05A 2R0QC 3M83A 3IE2A 2DPHA 2PV0A 4YV7A 1SQFA 2DA5A 2VCHA 2PGOA 2REBA 1R37A 4R9RA 2AC7A 2F59A 1PR6A 1QO9A 2QMEA 1EXWA 3R7FA 1F5SA 1WH7A 4DHWA 5IPAA 2C2GA 4OINF 4KXUA 3AFMA 5CVTA 5KWVA 3DJFA 4EL0A 2NZJA 1H05A 1APBA 4P84A 1MG5A 3FFXA 3NWJA 3RSGA 5CDSA 3WGJA 1EB9A 3I5MA 2JGMA 3RUPA 4RM3A 2R1TB 2FU5C 3L09A 1MNAA 2GZRA 3QVSA 1YB1A 1WX1A 4WDRA 3BE5A 3RI3A 4E7JA 4CVNA 3MFQA 4U9IS 4CF3A 1LPPA 4RKFA 3W5VA 4I2OA 2CG4A 3RTGA 2AE1A 3OI7A 1SUCA 4RFSA 3MD2A 3L1PA 4LXQA 2X6TA 1OXMA 1DE0A 1UBNA 4Y9TA 4OFXA 1HNZB 3GJ6A 4S05A 4ZAVA 2GTPA 3GFQA 2HI3A 4BX2A 4NBKA 2I71A 4YUVA 1YGPA 3EDOA 2BXYA 2VJKA 4GKKB 4KT6A 4TXNA 3RVOA 3V6MA 1RYNA 3NGLA 3ZBTA 4YUWA 1M10A 2VTEA 1IBMB 4DIEA 5BXYA 1UWLA 2NS7A 3BJZA 3FUXA 5CB8A 5G0VA 3BWGA 1RXYA 4JNCA 2QTNA 4C0HA 3V4LA 3INYA 1X1CA 2RH9B 3VNUA 1MMFB 1K2WA 4OGWA 4JJKA 5BPFA 2PGNA 3PJEA 2YVUA 3I6ZA 3GRUA 2ZANA 4CR6A 1C3EA 1E0AA 3UCXA 4QJIA 2JD2A 4I50F 3SZ3A 4P3YA 2A94A 3MKZA 1SU7A 4WY5A 5BWBA 2K4JA 4JQOA 2WM8A 4GGMX 2PCLA 3ZCPA 4BIIA 2A5YB 2YICA 4DQ0A 1ODFA 2HMUA 3Q9NA 3LOPA 3IP8A 3W5HA 5F73A 2XUIA 3ZYCA 5ALGA 1VQ4I 3AP3A 1QRYA 1QRRA 4KZKA 3E22B 1S7CA 1ZUNA 4DCUA 1C30A 1MF7A 1VQ7I 5JZBA 2CFCA 2G9QA 1W4RA 2C9MA 1OPXA 4JLBA 3H04A 4IZHA 1VCNA 2ZWOA 3GGGA 1RKBA 5T64A 1HG1A 5BR4A 4DIKA 2DYRH 1C9EA 3QVJA 5IT0A 1GGEA 3V9AA 2CXHA 3VJRA 2VJIA 2R79A 2GPAA 5KEIA 2XAQA 3R9IA 5A4KA 2P2CA 4M4SA 3U16A 1R22A 3KVYA 2QTCA 2OXIA 2BUBA 1ZA1A 3TRFA 4UOEA 2JJ2A 4NJEB 4AS3A 4P4LA 1W94A 5B66C 2EDCA 2IV3A 4RA6A 4QOGA 4XM0A 2VRWA 4FCWA 4D9HA 1CJBA 4KWHA 1XL0A 1RR8C 2BY3A 3AKYA 4HDOB 2AI2A 5CW1A 4XX0B 1OLOA 4IQ4A 3GJZA 3W78A 4MV8A 2PUFA 4JBWA 5KZMB 6ADHA 1YUMA 1S3JA 1KDPA 4EHNA 2X48A 4DV6B 1XLUA 2YC4C 4ZI7B 4E4YA 1M34B 3RASA 2JFQA 3O6VA 3M9WA 1QG0A 3PPVA 4Z3DA 1O03A 1BG6A 1U6IA 2VKDA 2HMYB 4UVGA 4IKFA 1MZPA 1ZU4A 3FYCA 4TYPA 2I1LA 1M6EX 2QTVA 3BDVA 1P8JA 1CFJA 2N9UA 3KEQA 2CL5A 2QPAA 3WWEA 2JHGA 3QODA 1K3UB 5GIOE 2B63J 3PEWA 1CZRA 3CPHA 3KE9A 4JT4A 1E7YA 4EUFA 3K4KA 4DBZA 5KWJA 2V9ZA 4DWJA 2VZ8A 4M99A 1VECA 1KGSA 3L6OO 2WFMA 2VKVA 1WG8A 2FDXA 2W11A 4ZT4A 1QX3A 2DUJA 2F3UA 3M9AA 3ZQQA 3CN7A 2H16A 2CUJA 1YRHA 1U04A 1KC3A 3BRSA 3FFBA 4Z6KA 3CEPB 1E92A 3ML6A 3K9NA 3VO2A 5G0TA 2HEGA 2JLWA 3KCQA 1TJPB 4QYWA 5EWJA 3GYHX 2FJ1A 2H8KA 2IW3A 4TSRA 1E2QA 3UXYA 2X8JA 1QGOA 4AN1A 3LW7A 4EA6A 4YP0A 2YIMA 3VOBA 3KXLA 2JLCA 1TK9A 5KYKA 2AFIB 2EKQA 1AU9A 4KQHA 3U80A 3VDQA 4QASA 4GM1A 2JCXA 3TRJA 1L9XA 3SEAA 4IXTA 1W2WB 4Y1RB 1KRXA 2FF4A 2CUTA 2FQQA 3O9MA 1U9YA 1WDKA 2YMQA 3ESZA 1UZLA 1AKYA 4D2IA 5I7HA 3VR1A 2NUPB 3PJRA 3FX3A 3KSRA 1SU8A 2X5OA 3IUQA 1P0MA 5JV5A 4B6JA 3BG6A 3SDZA 1G2PA 3F9KA 3LSJA 3G2QA 3IDFA 2PZKA 4XE5A 3CUEF 3PD7A 3Q2IA 2GQQA 3NLLA 3UOAB 4L9SA 1LJ9A 2XGMA 4CKWA 1NI5A 3IOEA 1WMAA 1L5WA 1XXHB 2VHZA 3L0ZA 1VJ5A 4DN6A 5JFRA 2X0RA 4ESFA 1QPZA 1HE3A 1M6YA 3VU8A 3OZ7A 2ERCA 3OIOA 3WO1A 3W5UA 1IU9A 3P2OA 5IMBA 1CUDA 4CG2A 4BTEA 1RXUA 1Y8QB 3ZTYA 2XITA 1IUPA 2JA8J 4RK6A 5LZ4A 5TIIA 1W36D 421PA 3OCVA 4UW9A 1MBFA 1AUXA 2OHIA 2DR0A 3E7XA 1NUQA 4N82A 5B7GA 1W36B 2QMUA 1RXVA 4OFZA 1EH5A 4OMUA 4GSLA 1PRYA 3KJHA 1E3WA 2QJFA 3DUWA 1L5KA 5DKFA 5D5UB 2RHBA 1CUFA 1BWPA 5E6RA 3I76A 4BMCA 1Z34A 3DV8A 4W7HA 5F1YA 3SDGA 3QYBA 3G49A 4YXFA 4FC7A 3HK2A 3WL6A 3A03A 4KBYA 2W90A 4OJYA 3QA3E 4ABYA 2J3KA 2XPVA 2P1ZA 4KN7X 2BFAA 4CTNA 2WTBA 1N9GA 3KLNA 2GBLA 2X8BA 3E9YA 5IT9K 4AIDA 1H2AS 1KJ9A 4QC2A 2FPGA 1JHDA 2BDUA 4QQKA 2ISQA 1O1YA 2CZCA 1HT3A 2XYGA 3O26A 2OGZA 1IHYA 2PLWA 2H3HA 3MPOA 3KQPA 4RPKA 3IODA 3H84A 5IT3A 5C37A 4EQZA 2WICA 4KQIA 4E6KG 3SOZA 3K0AA 3QVVA 1XTAA 3AINA 4M6VA 2W37A 3I9LA 3H13A 5JDCA 3DYVA 4KXYA 3B53X 1J8YF 4A82A 1X1SA 2CNDA 3FZQA 1HDRA 4N7RA 4A5OA 4QREA 4TXMA 1OFUX 1SKBA 1RZRA 3D3WA 3DXJF 4ARAA 3SXUB 2FWAA 4FD3A 4HPXB 2QMYA 3A4YA 2BMEA 1K7FB 1E3QA 5FRMA 5HUHA 2M9HA 1V6SA 3C5CA 2D2WA 3IMFA 2HOEA 2YZ7A 3ZV5A 2C31A 4B87A 2O5RA 4QA9A 2OC6A 3ZK7A 2XCSB 4U7GA 2BR4A 1BOBA 5EMHA 2XZLA 1G6NA 4U7PB 4NIMA 1Y89A 4R3NA 2EGHA 1B6TA 1QK5A 4MS1B 5CYVA 2CV0A 3TL3A 4BTVA 5BMOA 2PNJA 1L1FA 1TI7A 1FOYA 4QEDA 2WJ3A 4KYTA 1KNXA 1MQSA 1L1QA 2WUWE 4C29A 5L3GA 1QPIA 3GZJA 2HQRA 1KR2A 2FZWA 2ZJBA 1NPTO 2WTNA 2HCBA 2N0SA 3EVFA 2MABA 2VT6A 2JAHA 4G0NA 3IURA 3E81A 4FFBA 5JLJA 4NSNA 2V8BA 3LQFA 3KEMA 3CLTD 1XMSA 3RARA 5HFJA 1QCYA 3R23A 3L0DA 3W05A 1XZQA 4IWNA 3SIXA 2QJTA 3EMKA 3KSZO 2JFOA 1RI4A 2R96A 2DOAA 3LT2A 4PHGA 5BVGB 2PLNA 3MWKA 1J20A 3NIGB 2VTVA 3GFRA 4RENA 3H36A 3IIJA 3PEFA 3J7ZI 4HN4B 1CUUA 3AUAA 9LDTA 2JGKA 2LCQA 2ACKA 1I9GA 3WNVA 2YV2A 1PYDA 4KQWA 4F5YA 1TF7A 2KZGA 3WJAA 1PJTA 2JZOA 4FPXA 3EQ8A 1ZD2P 3JALB 4HTAA 4TLAA 2KISA 3HXKA 5B4TA 3FTQA 3DO8A 2EQAA 3HKZA 1NU6A 1SANA 2OV7A 1RI3A 3CUUA 1BRTA 1PJAA 5K8VA 1NZJA 1S8NA 5JXGA 1X92A 3FDZB 3PQ3A 4RLFA 3WB0A 4D8YA 4LWQA 4KYVA 1CR2A 3H0CA 5EC8A 2LP4Y 4XIYA 4DWWA 5CDTA 5SZIA 3D2CA 1JSXA 3L1VA 2O06A 1US8A 1T1SA 1KBZA 4PJLA 4RVOA 1KSJA 5GINE 2Z5FA 2HK9A 3EWAA 1AHPA 4LK2A 1Z26A 4GM0A 4IIXA 1SXJC 1DDOA 4DRZA 2ZAOA 5BV7A 5HP4A 5BSTA 3E2MA 1U0TA 1KRWA 4QTUB 3U7RA 4JN6B 1RR6A 1CDEA 2XCUA 1LRKA 2NZUG 1JMKC 5DX1A 3ROZA 1Z0FA 5K51A 3K20A 1JLMA 3KB1A 2Y1CA 1JQ3A 3HFRA 5HUQA 3ZYZA 2FG6C 4CEHB 1CUIA 4DNXA 4GLJA 5AM1A 2JA6J 3I4LA 3UYKA 4D92A 4OIOF 1AHIA 2PL5A 2AG8A 1L7QA 3O3CA 2R7UA 4PSKA 4DCVA 5HKOA 1E7QA 4K0RA 5C3EJ 1Y8RA 3AR8A 2L9NA 4QQFA 1RI1A 5L3EA 3T7TA 3RG8A 3T8TA 3FETA 2H1RA 3RC9A 4DLTA 3KTAB 2Y71A 5IJ0A 121PA 3IMCA 3SHTA 3BR6A 3CRNA 5ERIA 4TT8A 3O3OB 4I6EA 2IP1A 4A5NA 3CDIA 3INGA 1Z35A 4J0JA 2ZSDA 1RLIA 1KYIA 4NCHA 1G7CA 1JU3A 2D5IA 3GK3A 4TLMB 3JVIA 2CVZA 3EGXA 2EH3A 2XI4A 3S70A 4HSRA 1THMA 3KELA 2JJ7A 3M6UA 3N2EA 4ZQGA 3VOSA 1QOZA 1OKRA 2CB0A 1YX5A 2WFLA 4KRGA 3JCUC 3S1AB 4I01A 1G8SA 2V7UA 4C3UA 2XA2A 1V4NA 1ZOIA 2X14A 1JKQC 4G1CA 2UWMA 1RCUA 3FB1A 3QVWA 2XAHA 5FIUA 2ALJA 3MYYA 1TPYA 4A6DA 4K8RB 2P11A 4MI6A 1EE2A 3R7DA 4XIDA 3KDSE 3UWKA 4M1SA 2FFBA 1R3UA 2B9SA 5THQA 1SMYF 2ZRMA 3FHTA 1JE1A 3BN3A 5CB0A 1UZCA 3U3KA 2X2PA 5COQA 3L2QA 2RJ3A 2JUGA 3V5NA 4I7EA 3BPVA 2D1QA 4GPD1 2X9QA 1S8FA 3I1JA 5AJWA 2QUIA 4PSWA 1PQUA 1H2EA 4KQCA 3JWGA 5KTKA 4O3FA 4L02A 2DN0A 4A3GJ 3HZJA 1EXDA 2GPWA 1PFQA 3OLXA 2Z08A 3W90A 3WHBA 3KZMA 4DJEC 3RUFA 4E5NA 4AMVA 1DXOA 1KI4A 2WMYA 2BKEA 3UJDA 1QOPB 3C3CA 4BLSA 4D9IA 4I1SA 2O8FA 5BOXA 1EUCA 1WZCA 1L4YA 3EEIA 3IV6A 3BPSA 4KTVE 1A9OA 3KD3A 3LX4A 3ND9A 3OSZA 4NHOA 5EIOA 1A3CA 1V5FA 2V6IA 3TLYA 2IS2A 5E1DA 3SJUA 3L4KA 1DAMA 1YXMA 3ASZA 5EUCA 4HB3A 3WWZA 4L08A 4KLAA 4V0OA 3WLKX 2NPIA 1ST3A 4RK1A 5JHUA 3KP4A 1XLTC 4BTLA 3DU6A 3EXHB 3OESA 4X6AJ 4TROA 4KYWA 5TEWA 2G67A 1U7HA 3BHIA 1IPEA 1YUNA 2JBAA 4D3XA 4MYCA 2ZBFA 2BIFA 2BZSA 5A3SA 4KOEC 4UNRA 2JF0A 4Q39A 4QODA 3Q7QA 2I4OA 4MB2A 3T1VA 3AHHA 4DL9A 3WLLA 1AK1A 2R7XA 2PVSA 4S3MA 2RVCA 5IF3A 1NW9B 2QNBA 2H2FA 3MZ8A 2B94A 1HYGA 1AA9A 5LMUB 3VOEA 1WXFA 3TQCA 3BE6A 2FP4A 2HMSA 4LWOA 1FPQA 5B3AA 1EFRD 2GRJA 4XVQA 1M9NA 2XUJA 1ZN8A 4BJTA 4G65A 5K0GA 1ZMTA 2KMLA 3MILA 1AKMA 4IUYA 2VUTA 2GXGA 2ZT5A 2V9CA 4MRSA 3ZHTA 1NYTA 3BE4A 3NHMA 5DHTA 4EPRA 1EUDB 1QDLB 4K86A 2D5LA 2BSQA 1OJ7A 3PSAA 3O8QB 2AOUA 2F6CA 1M1NA 3D3JA 1U80A 4IY1A 4JAVC 1W4CA 3TNLA 3T3OA 3KTFA 4J16A 4PX2A 4DLUA 1QFMA 1VQPI 4K6FA 1ECBA 4U2BA 3VUFA 4Y2XA 3K2QA 2XMDA 2MG4A 1T6BY 2CDNA 4Y9RA 4ZC1A 1YRWA 3IUEA 3K6RA 1LUAA 3GTKJ 1X3SA 5FFNA 4B4UA 1UDAA 4GRDA 4BV3A 1TKBA 4E5VA 4L16A 4ZYZA 1QCZA 3I2HA 2I03A 1UXGA 4BY1J 3BQZA 3ZD8A 1S9DA 3Q15C 3N7TA 2EG9A 2Q62A 2PZMA 3CWCA 3MQ4A 3CVUA 3CJRA 2QKYA 2LIVA 2J1LA 4MGYR 3AXTA 3AO0B 4P8RA 1Y3BE 1E61A 2W6CX 1TT5A 1QXSA 2VT3A 1V2GA 2NAZA 5FLVA 1QRSA 4BDSA 2MYUA 3S4YA 4XB1A 1MORA 4U7HA 2P67A 3Q41A 2OUIA 3ZMSA 3O4GA 4C0SA 4EV0A 1JU4A 3OL3A 3PFFA 2OHHA 2QPTA 2HCJB 3UK6A 1DC8A 4I14A 1F5NA 5IT5A 3SSNA 2I7CA 1MR3F 5FV7A 3UH1A 1XCBA 1UBCA 2HO5A 1Y1KE 1XQ1A 2GWHA 2WHPB 3CRQA 2G06A 4E11A 4FDTA 1DCTA 2AIRA 4PYJA 2CSUA 5TMEA 2P2LA 3OO0A 1Y8AA 3ZWYA 3GRYA 3KHSA 2YMMA 3OPMA 1D2GA 3N8DA 3PQ8A 5KO2A 2ILTA 2I2WA 4NY1A 1FP4A 4JB8A 4OAYA 2NOJB 3OQVA 1M5UA 1PYOA 3LHDA 4F2WA 4JKOA 4LYGA 1Y7PA 4B2YA 1JLSA 3TIVA 4QUGA 1I6KA 3T1OA 2RK3A 2HPIA 4FNGA 3Q7TA 3ESCA 2P4WA 2MLKA 4WFJA 1OGJA 4EPVA 2EJTA 2JCBA 3KT3A 5DBGA 2ECKA 1YRLA 1FLDA 1QHIA 2OZLA 4NCAA 4AWXB 1H23A 2WINI 1HA3A 2CMFA 2IHYA 1VRVA 3TF5A 3KP5A 4TMKA 1NJ6A 3I58A 5I8WA 2L19A 3N6RA 1MIJA 4O0LA 5LUAA 1WB6A 1VXRA 1QBJA 3O3KA 3IRUA 3B1XA 3RS4A 4I5DA 4B7UA 2AXEA 1BI3A 4AIKA 1AB5A 4ZAWA 1WPXA 3WE3A 4U0YA 4FYWA 3LGAA 3A6KA 1EJ9A 1BE6A 1ZKMA 3KQOA 1R4NB 2QLMA 3VA7A 3A1EA 4HB4A 1QTNA 4E5MA 5F33A 1KARA 1G18A 5F1OA 1HH4A 5JASA 2ROQA 2D7CA 2GAAA 4CYMA 3V1LA 2ZJPF 2IA0A 2HL6A 3CNHA 4EAQA 5B2EA 2LNBA 5FADA 1NMQA 3OJLA 4TYYA 1WETA 1X3LA 2VDQB 2VHTA 2XA1A 2H4XA 1V1RA 3LKVA 1B9NA 5LZ8A 2ZUFA 1YIDA 2BFBA 4MCHA 4BNTA 3KLBA 4DYDA 1KVSA 2WUVA 1QX4A 1T4DA 4Y3OA 4D9KA 1K8ZB 5JXIA 4KFUA 4V24A 4XPIA 5I3ZA 4RFLA 5JAZA 2HF2A 2H0AA 4FSXA 4BNKA 2A3NA 5K3EA 6LDHA 2Q0QA 5EMJA 3I2GA 4BMSA 5TS2A 4JLUA 2K86A 2ZIEA 1G3RA 1LV8A 4KXLA 3WDSA 4YEJA 1NHWA 4UAJA 3GVHA 3GO5A 1A6IA 1OVMA 4COOA 2GIVA 1E5LA 2FSSA 3P45A 4H59A 2AO9A 2PRKA 1N5OX 3S2YA 1QFXA 4WLFA 3PENA 1SCKA 1JAIA 3D8BA 2GESA 4JK3A 1VE9A 5DEQA 3G2OA 4EGSA 1DGQA 1MDMA 2PX3A 4GYGA 4KHZA 4HPWA 1XN7A 4RHYA 4J0GA 2W71A 4UTVA 4KRXA 5F1RA 1TVEA 2AG5A 2EZLA 4FOTA 1JKIA 2MBFA 1ZN2A 3PNVA 1G20E 4RGVA 3RYTC 4PLHA 1K78A 1VMEA 4QHYA 3OQJA 4QQ8A 2FLVA 2HA7A 2HTJA 1M73E 3HP7A 1UDWA 1I7SB 4Y0AA 3BB3A 1E4EB 3S17J 1UC8A 4G1UC 4RAYA 4LLGF 2JJ2D 3F5FA 3TJZA 3KOWA 3WTWC 4M9XA 2FZVA 3AR5A 2I2CA 1DHTA 3UBTA 4TRRA 2YWDA 2ODWA 1Z88A 1YITI 4IIJF 2IZZA 3FWNA 2WJ4A 3UJ8A 4OSPA 1FNCA 2C59A 3JATA 1WF3A 3PQDA 2JKZA 1B76A 3ZEAA 1F4LA 4B6OA 3GJ5A 2W2LD 4LMYA 2ZBEA 1TA9A 1YFJA 4EM2A 3HWRA 4LV5B 4PCVA 2C2MA 2GASA 4G7OF 1BRMA 3IBCA 1R58A 1N6LA 2KL4A 3P2YA 2QJWA 2BMFA 2CY0A 1VKRA 3RYCA 2VJDA 4DUZB 5JCPA 4H3HB 3P71T 1U02A 5E3LA 2GFQA 4P35A 4HAWA 3CF2A 5CD9A 3W5IA 2Y8EA 2F1IA 5LBUA 4BB9A 4U0VA 1Z5NA 5ECWA 4UD6A 1NXWA 2WV7A 1O7JA 5E8RA 3ZDXB 1Y9AA 1U9JA 2W6ZA 3K15A 4F52A 5L40A 3ON5A 3S28A 3PWZA 4X44A 4EGFA 4NMXB 3GRVA 5EKXA 5IZCC 2ZULA 1SFUA 3IA2A 3T7CA 4BCBA 2RGUA 3IWFA 2HJVA 4CMCA 1B1BA 3K32A 2C83A 4DMUB 1H4VB 1UIMA 4BHTA 3UTDA 1V96A 4LIVA 3YASA 1X9HA 1KZGB 3I5XA 2GXBA 4HNUA 4GD3Q 5J63A 5DNUA 3R4KA 4AJ1A 3DOJA 1KIMA 3N07A 4PQRA 3K0BA 2X5JO 5LQDA 2CJFA 2VDNB 3P2IA 4EA9A 1P1CA 4JI2B 5KSPA 2X8JB 2EFHB 3DULA 2I2AA 4A3MJ 3OM0A 4GXTA 2PH7A 4K6MA 3MQ0A 4ESVA 2M4KA 3LC0A 3FTCA 1QP8A 5CJJA 4N6OA 3TL4X 2W2OA 2EEPA 2E34A 1QO7A 3K0CA 4CDGA 4EYKA 1PDNC 1E64A 4CT5A 1T95A 1P1JA 3PT5A 3WIVA 2YDYA 4DIMA 2J9GA 3KKKA 4AJIA 4CKWB 1D2MA 2XF7A 4LWZA 1PAUA 2V7BA 3DUFA 5JYEA 4ENNA 2VA9A 4BFVA 2O6LA 1Q3HA 3OTGA 5CA0F 2CH0A 2EFNA 3CD6I 3VR0A 2PH3A 5K1ZA 2ZI4A 1DX4A 2DTZA 5KSOA 2M4GA 1T8TA 3KWJA 1FE8A 1WEKA 1XFDA 3UAWA 2HOAA 2OO3A 2XAUA 1F8YA 4CDMA 4P9NA 2PXXA 3UVEA 4RK4A 3Q4GA 4PG4A 2WVGA 1OQYA 2EOAA 1DIAA 3K53A 4U7BA 1D07A 1U2DA 3EYAA 2NXJA 3OTWA 1AHHA 3QKIA 5HNHA 1ORHA 3D8HA 3FFAA 4RPJA 3LY5A 4TGLA 2WWRA 5E3OA 3UK0A 1D7OA 3D5LA 1B0PA 5K0ZA 1MEOA 3R0XA 1YQUA 2O8XA 4YRDA 3K0FA 1H5NA 1G8XA 3ZHSA 4CH7A 2C4NA 4MMYB 3VR3A 1R1VA 3LL4A 2FR1A 4GUAA 4GR5A 5F2NA 4B3GA 1XRRA 2XVXA 4TMVA 4XPZA 2I4MA 2NSLA 2H52A 3L2CA 3FDYA 3DNPA 4PZEA 4QSHA 2W6PA 5HS8A 3SLGA 3DZDA 3TKAA 2H07A 3N5CA 2O50A 5GAHJ 3DMDA 1E5QA 2XUHA 5C1DA 4RF4A 2YFKA 2QTBA 4GKAA 4QOSA 4BMNA 2V96A 1FC3A 1T36A 2UXXA 1XCOA 5KPDA 2VPRA 3UAOA 2HAEA 3BL6A 1HBJA 1T1IA 1KPHA 3H0KA 1S3FA 1F14A 4XARA 4JITA 3NWPA 4AUKA 1MQ9A 4HLNA 3ANTA 3BA1A 5HODA 5AK6A 2I5PO 1K7XB 3N0XA 2EV6A 2V03A 3MCZA 3A9VA 3LSKA 3TLAA 2D45A 2Q1YA 5AR1A 2QUAA 1U5BB 1PZHA 4FASD 1YKGA 1QF7A 2Q6VA 2PRZA 1SXIA 1NUUA 4CCYB 2QR3A 1JECA 4HOYA 4JC4A 3S1SA 1RAGA 1K6YA 2BM8A 2P8TA 4PRLA 1T9HA 3QIVA 1I39A 4RDCA 2BKVA 3ZNPA 1DB3A 1MT0A 4C03A 1XMVA 1XV5A 4ZTBA 4IOKA 3HPGA 3I83A 4UJ5A 2IW5A 4XLAA 1XIVA 1P1BA 4UZSA 1Z68A 2EAUA 1NUTA 3LT5A 3IYLW 1HNWB 4AKHA 3GEGA 4G4JA 4E1VA 1F4PA 2H08A 5HS7A 2JUCA 2JB9A 3LRXA 4IKEA 5P8WA 1Y3HA 5BRAA 4NDLA 5JJBA 1I4TD 5BSRA 1E2JA 3KCNA 3PC8C 3EGWA 4RDUA 1X3UA 3WGVA 3HQ4O 1L2TA 3OLYA 5U4XA 4GWLA 1NXQA 2DFHA 1JEAA 5JROA 2LVBA 2QF7A 1CNMA 1HDIA 1U2QA 4RFVA 4ZO4A 1QHHD 5CJPA 2FEZA 3O8HA 4NCBA 3OIFA 1VGVA 4DM4A 4D1QA 1GSIA 1O9HA 1UPCA 4RORA 5T4HA 4CM5A 1NYQA 1QHHB 1Z83A 1C7QA 1T8RA 1VHDA 5DN6A 4LOCA 3KJIA 4OHOA 1D2RA 1UXJA 4OLAA 4XR9A 2IH4A 4DF3A 3WBBA 2B4KA 4G8CA 1SCNE 1V26A 1YE3A 3GBGA 1DL5A 2A86A 1SD6A 3H5RA 4G5XA 4HZUB 3KP3A 2SECE 2VVTA 4LRWA 1Q0HA 2QZZA 1G8GA 4PLCA 3HMKA 3R1IA 1BU5A 2ZITA 4M7WA 2G0NA 2W2XA 1TWGJ 3SSAA 2P3LA 5K0BA 1V9SA 3BWBA 1EVQA 1BDMA 2C2KA 3V34A 2P2DA 4P54A 2Q2EB 3W2FA 1ZUHA 5FD6A 1PWYE 4IHJF 1HOXA 2V1UA 5KQRA 3D81A 2YTZA 1IHUA 4JU8A 4EHKA 2DECA 1GAJA 3HG7A 2ORWA 1Z4LA 3EGOA 2EEZA 3HJEA 1LX7A 3KPJA 2ZE5A 4Z1MD 4W8OA 1X1PA 4ZEMA 5TQ0A 3WSVA 1KQPA 3ZDAA 3TFWA 1F8UA 5IP7J 1WCXA 2NNYA 5G2OA 1KTVA 1RRVA 4BO3A 4L4YA 5L53A 2IIQA 3NWSA 1O95C 1ZHHA 2CUEA 4P92A 1XZJA 4DMMA 3W06A 3PGKA 2W42A 2WG0A 4HCJA 1PK7A 3PWTA 1ZH0A 1L4MA 4EJOA 1NBOA 4U1RA 3WRYC 4QAQA 3HKBB 5BQTA 3BTSA 5ICEA 3QRFF 1BWRA 3TDUC 4RYLA 3EHEA 5IFKA 2XTNA 1FX7A 3KE2A 1C1DA 3CCJI 1NW6A 1Z75A 3I9V6 1T0BA 3L0IB 4RIHA 5BYBA 3A6HA 3W77A 4BE1A 1JQBA 3KT6A 5I7SA 1YMUA 4ICIA 5DDIP 2P5SA 4ISCA 1GPBA 1Y8RB 4BFUA 9MHTA 1U3VA 4W4TA 3CLHA 1HL7A 3DZJA 1ULYA 2B7EA 3FM5A 2RARA 3T4UA 3GRRA 3A1CA 5BNIA 2Q8KA 4LTDA 3BIOA 4BNMA 2HYGD 3BMOA 1A9YA 2FKAA 2XB8A 2ZRCA 1E60A 2OBNA 3ZQ7A 3PEYA 4JKYA 4CGZA 1YK0A 3NPMA 4K26A 1EWRA 5E3JA 1BQ4A 1DPRA 1LGYA 1A7JA 3EGXB 4AYBN 1LF5A 1POWA 3IAS2 3MTJA 3LDFA 3DOCA 1YZUA 1VIYA 1NR7A 1Z5UA 2YN0A 2WFLB 1TEXA 3QY9A 1FLVA 3HCBA 5B53A 2CQQA 2YWRA 3RVQA 4HC4A 3DMNA 4E4RA 4B33A 3SHVA 3T7JA 2I66A 1HLVA 5A3QA 3WGUA 3TCXB 4XCQA 5M5WJ 2AYZA 1TLHB 1IB6A 1JFVA 4MW0A 3V8PA 1XP5A 1PZNA 2HRZA 3MUFA 1L6IA 4CF6A 1HZZA 5JH7F 2WTXA 1SCAA 4KK4A 1B8OA 2QLZA 5TMDA 1QNLA 3OIUA 4F2DA 5AM2A 1Z0XA 3ZPLA 2FR8A 5CVDA 2WD7A 4KH1A 3F7NA 3I01M 1OILA 1GV2A 2NXNA 5FOVA 3ROPA 2YWFA 3BRWD 3R60A 3HLKA 4G0MA 4DBQA 3KKMA 4ZI5A 2ZNYA 1DBSA 5EA2A 2ID9A 3PNLA 4EJSC 2RI0A 2H17A 1Q22A 4YPFA 5ULLA 3DEHA 4MROA 3HM2A 3KYJB 3V1YA 1RUOA 1QCCA 1EZ1A 1FEXA 5DYMA 2QN7A 4WRRA 2O8FB 3H35A 2WSYB 2H4FA 3F3YA 4PANA 2Y4NA 2WIAA 1IRFA 3AKZA 3S2SA 3NCTA 3L0BA 2PJZA 1VHLA 1V4BA 3Q7RA 3JWHA 4OB8A 1YQAA 3HOYJ 5FYQA 2HNKA 3U3ZA 3QLUC 1DJMA 2ZJ3A 4E7SA 3AVUA 1NF8A 2QQFA 4ITUA 4OKNA 3H2SA 4RMIA 3ICOA 1CEEA 4BE0A 1DKPA 2XRNA 2JBAB 3K3PA 2ECCA 2FPOA 1U3GA 3F22A 3TTYA 1FTGA 2I4TA 4WCVA 2C3OA 1PG2A 3W1WA 3CF5F 1D4OA 2NT3A 1I2CA 2GN4A 3FDIA 2PIAA 1BE0A 3PNOA 4R5HA 5A6SA 3RJ9A 3P26A 4C78A 3LP8A 2R3SA 1YQXA 1RYMA 3FROA 4CCKA 2JEZA 1VJCA 2ODTX 2ZVPX 4E21A 3ZW8A 2FP4B 3EOAI 5BT9A 1P2DA 1N1GA 4YCMA 1IO2A 1EVJA 1W6UA 2OGWA 2FKNA 4AP6A 3VNSA 2GCEA 3UKGA 5GPAA 1GWNA 4ZAXA 2L4MA 5CMLA 2Q9CA 4FIDA 4XIGS 2FW0A 4QBKA 1JHVA 1HYBA 3THRA 5ALEA 3CZPA 3IBGA 2WABA 4YRZA 1OLXA 1W47A 4PJNA 1QR2A 5KTNA 1XB4A 4ARCA 5J8FA 1EKXA 3MWJA 4PTYA 1C4XA 3ML1A 2KIMA 3COZA 4TMZA 2BW0A 3JREA 1A8HA 3MMYB 4F3RA 5EEAA 1C9MA 1NVAA 4RB2C 3GIDA 3U3XA 1JV2B 1TC1A 1U28A 4YBRA 4YUXA 4W6ZA 1IZ8A 2R7LA 4DDUA 2NNWB 3K1TA 2CHVA 3QKTA 2YBDA 1EK2A 3HJHA 1JSCA 2QPOA 1NTOA 1VB5A 2XIJA 3ZHQA 1R18A 1Z16A 4I4TF 5ABPA 3UO8B 3CJRB 4YDQA 1I94B 3DV9A 4Y2QA 2D2IA 1TT5B 1UOEA 1M83A 5C8XA 4TV9A 2F6RA 1M7BA 3IPRA 4C7BA 3MAAC 3KRTA 2DTDA 4DIUA 3MGCA 4JT9A 4HZIA 4E94A 1HYEA 4II2A 3EZGA 1E1CB 5DT2A 1LTHR 3DV0A 1SUWA 3KS9A 2CMPA 1D8JA 4ARUA 4M1KA 2EB7A 3W9YA 5IJZA 2VF2A 4A0GA 4ZRNA 3R44A 2B5WA 4PAGA 2B83A 1GSOA 4MCAA 2ZUBA 4TPKA 1M34E 5JD3A 4P86A 2EKDA 4NMLA 1AKWA 1XTUA 3L7AA 3ADBA 5F1KA 1Z5VA 2AW5A 3RTRA 3AHGA 3H9UA 2IPLA 2GRAA 1YI2I 4BBJA 5ALQA 4JLJA 3TW4A 1P74A 2O19A 2DU9A 1T2KA 3QW4B 2UUAB 1YIAA 1IV6A 3CJQA 3TUIC 1QZXA 3NWTA 4RGSA 4YAIA 2Q9AA 2JIBA 3B5IA 3G5LA 3U40A 3RK1A 1KWGA 2GBIA 1Z8NA 3BE8A 3SQLA 3ROQA 1XPUA 2Q3LA 3ZNOA 4POAA 2XWPA 1IEXA 4EI7A 1T1RA 3OS0A 2C0PA 2HQOA 4EG3A 1Q14A 3COPA 3U21A 3C5HA 3T0FA 3X2FA 1I2BA 3UJ9A 1WOMA 3VU9A 1WCMJ 4BCCA 2VOEA 3DLCA 4WWHA 4M9SA 3OL4A 3ABQB 4R2JA 4TLEA 3FPAA 5H70A 5J4YA 2Z99A 2O61A 4IG4A 5JU6A 2O03A 1ZOOA 4ND2A 1KF0A 1PKXA 1E1RD 3EXIB 1P9RA 3O1IC 4Q01A 1PBNA 3OAAD 2R6HA 3QWLA 4L6AA 3IAM1 3OYJA 3VR4A 2MR5A 3Q6NA 4ZZ2A 2DFNA 4N40A 3QENA 4DYRA 4WKCA 4IIHA 2WUFA 1ON1A 3SS8A 4HEA1 5AUOB 3NHWA 5ELXA 2HSJA 1K4KA 1NXTA 4X0GA 1WRJA 3KZ1E 4EA7A 1O6ZA 2OKGA 2OXTA 3RS7A 4B6PA 1W9MA 4IOMA 1L9KA 2IIBA 4MXDA 2R93J 1YE8A 3MJRA 2H1VA 4AS1A 2HM7A 2VK1A 3AR3A 4AUMA 2GDJA 1DO2A 4CWAA 2WY8Q 3ER6A 4IIEA 3CCEI 2G4CA 1J23A 2AN5A 3OQNA 3KB2A 2BFBB 4Q16A 4R2HA 1XXHE 2GJAA 2HLNA 2V4MA 1R5JA 4RO0A 1FBTA 4NDNE 3S3OA 1XHLA 3V1NA 3RSQA 1NRJB 1FTTA 2BAGA 3TZEA 3RVSA 5CXUA 2NZ8A 4N5MA 4EHHA 4H7HA 4X61A 3H1BA 3W3AD 3F47A 4JROA 2YPRA 1M72A 1GVDA 3O31A 1Y8CA 1D03A 3IJEB 3GY0A 1J1UA 2ELHA 3MRXA 3JQFA 4YV0A 3JCZA 4L50A 3LOCA 1DKNA 1RPTA 3C3YA 5DHPA 4ADSG 5FTNA 4DLXA 4F1WA 4XORA 1Z5ZA 5FA6A 5C4XJ 4OQFA 5FEUA 2FU4A 4BY9E 5HXAA 1REQB 1T3TA 4BVFA 3AHCA 4J0KA 4OGGA 3N7AA 2GVNA 1G17A 4F8JA 3C2GA 1T4MA 4PR3A 4NMHA 3SXPA 1JL3A 3C3MA 1CKEA 4OFWA 3VX4A 4XTRA 2RNGA 3W7VA 3OQHA 3RC1A 3WU1B 1K78B 3K2EA 3WTUC 1OLSA 1QC5A 3FPBA 3ZQFA 3KYCA 5LJLA 3FI0A 2IJGX 3ZK8A 2LW7A 3FSRA 4RL6A 1AU7A 2IHNA 2C9DA 1T91A 2VDMB 2KPMA 3ZZNA 1LVAA 4W7SA 5L6MB 1WJEA 1LSUA 1I1HA 2ZR8A 5KHAA 2MD5A 3K0HA 5H83A 4FT2A 1Y37A 2Q0SA 1KI9A 1KTIA 1HFEL 1V1JA 2QTRA 3IX7A 1CCWA 1EESA 4BLVA 3MRTA 4UAGA 2E1MC 3DG9A 2PUCA 4PTLA 3IQIX 2UZIR 2WIFA 1HETA 1T4BA 2EKPA 1MB4A 2GKSA 3HSFA 5BWLA 2UYHA 4CU5A 2ZB7A 1BN5A 3BG9A 4JP1A 4I08A 4PXSA 1LDYA 4RIFA 4CXFA 3DDCA 2B8NA 1PJZA 4R8LA 3K16A 4GMKA 3V4FA 4I81A 1TFUA 4IRMA 4D45A 4B6RA 2AX3A 3RYCB 4WIAA 4B09A 2QLFA 3ODPA 4W1RA 4FI3F 1NG6A 3E1SA 3SX4A 4OK5A 3JZFA 3O1JC 2FMXA 3AOEC 3JVDA 3OPNA 1OCZH 1EBFA 5FCDA 4HF1A 1SK8A 5LQSA 4Z5XA 3FYUB 3G2KA 2XW6A 3P9QA 3HBLA 3RRYA 3DXZA 4BYGA 1ODIA 2NSDA 1Q6ZA 1CLUA 1E9SA 3O7MA 5B3SH 4GOND 4O2AA 2DR2A 4FNMA 3ISVA 3AFGA 1E2EA 4JB0A 1HCRA 1KJQA 2CD7A 3HCPA 3VHLB 1DQUA 2A5DA 1QHNA 1I3OA 5A7GA 3U44B 4UBJA 5EEGA 3A14A 3ZZMA 3HUEA 1YB4A 4Z2YA 1CB7A 2GEBA 1RWVA 4KMRA 3AK4A 3PNYA 4FI3C 3PV0A 4F4UA 1RKVA 1NVXQ 4XNFA 2BF7A 2ZJZA 3KO8A 3KQHA 1NAHA 3DYIA 1J5PA 4UULA 9ATCA 2J6CA 1L7RA 5JSZA 5B4UA 3WMWA 4FZ5A 4QUAA 4PAQA 2DSNA 3FNFA 3R4VA 4HBZA 1MSFC 3UMRA 4OJQA 2KE5A 4HDCA 1PK9A 1XYVA 2VZ9A 3FUUA 4RU1A 3GWZA 1KVQA 4ZCSA 2JT1A 3QEOA 2WYUA 4ID9A 4WK2B 3VYUB 5AM4A 2BBOA 2I3DA 3KU1A 3C3AA 2RBEA 4MRVA 1VQ1A 4R40A 3GOHA 2ZETA 3ORFA 2CSXA 2VZLA 2C0CA 3EGCA 1USVA 4OOEA 1WUHS 2O8CA 5JNUA 1OBVA 3WY9A 1YCGA 4UCFA 4ZYVA 5AICA 4EYOA 3P9RA 1RBMA 4KITB 2V4JC 4F84A 1YV9A 2KI5A 2WAYA 1QYCA 1XDWA 3DUFB 3QMPA 4Y7CA 4YN3A 4DCCA 2E5NA 3I59A 5KS2A 5IVPA 1A76A 1Q44A 3O03A 2IZ7A 3GFOA 1RCFA 4NS1A 1DAIA 5CK5A 2G0EA 1YRNB 1B42A 1EB8A 2P8JA 1HNXB 4RZQA 5AWFC 4DT1A 3DBLB 4ZH4F 4QYTA 3MTDA 4XD7A 3HBFA 4K6OA 3WTYC 2UYQA 1WXEA 4P34A 2IDKA 2IOQA 3HH8A 1OA1A 2ZWMA 4FEAA 1QNFA 1JXMA 1QBKC 3VZRA 3AJAA 3NHAA 2X0JA 3KUDA 2RDPA 4YO7A 3ABRB 1D9ZA 4UHBA 1Q0QA 3UAVA 4EJ6A 3U3RA 3NHUA 4WKGA 3ZZ1A 2I6UA 5KJ6A 4ZU6X 3ZVNA 3GRPA 1R88A 4JELA 3VR3D 3ETNA 3GAFA 3CKKA 3CNBA 2GBFA 3K0FB 3TGLA 5CIWA 2GSWA 3O3MB 4G41A 2C4UA 5CFOA 3HDHA 4TWBA 1VQ6I 2CFOA 1C4WA 2FWJA 4D0SA 2PGLA 3B1JA 1PV2A 1OREA 3GP5A 4XWGA 2QTTA 2R8RA 2R47A 2HZBA 3NRJA 3R2JA 3IOYA 2B30A 2CFSA 3B6ZA 1UFQA 1GNVA 1SKYB 3BCBA 4C0XA 3JTGA 3BBPA 2Z95A 1L8AA 5KVSA 3I1YA 3IKMB 3K71B 1SA0B 2UU9B 1E0KA 4NBLA 2IUSA 4G09A 4Q5SF 5FPHA 4WOKA 1Z4PX 2XLBA 3VKGA 2NVTJ 3HJCA 5D8LB 1TVKA 2XC7A 5AI4A 4PYRA 3WOVA 5GGXA 4HDRB 4RKWA 2QQAA 1SOMA 3H9QA 1WJFA 3FNBA 1I36A 1KAMA 2VQ6A 1J42A 1WABA 3NO4A 4A4DA 2C29D 1HG0A 4ZT5A 1USWA 1JXQA 1ZVVA 1KI1A 2XZDA 3E97A 3S1MJ 1GGKA 5D5HA 2LIPA 2WWXA 1XELA 4G0VA 3WTBA 4RZ3A 1U4NA 3CG4A 4QGSA 4L4XA 1A04A 1Z6GA 1T9CA 1ACMA 1U7OA 1EK5A 2ZZMA 4ZRDA 3AL2A 3PUIA 3EVNA 4OO3A 5EN4A 3NAGA 4IH1A 3KKOA 1G5HA 1YJ5A 2WU1A 3MCTA 3H2ZA 5E0OA 2JFUA 3TVYA 2RBGA 2PH1A 1JI0A 1K27A 2R5ZA 1Z07A 1H2YA 4KBGA 4AYXA 3FCOA 4Q7KA 3BF7A 4KQXA 3VYVA 5EG0A 1X7XB 1U2GC 4Y6SA 4KPFC 3GJQA 1R8QA 3ZE2B 1NKVA 5E7QA 2VHUA 1KQ9A 1N2CE 1YVEI 5DN6D 3OIDA 1U0SY 1YZHA 3FZYA 3KZNA 1KJNA 2RHDA 4L0DA 4Q1AA 3LSMA 4J3JA 2EA4A 3S8YA 3S40A 5B5SA 2XUZA 3CP8A 1BFUA 2Q45A 3KIOA 4DSOA 1TYDE 2GEKA 1T0HB 4EWLA 5TGTA 2R8OA 2Q8PA 2VJ4A 3PXDA 5E1XA 2STTA 3ZTWA 3ETDA 1E6EA 2H1SA 3BJMA 2B7CA 3AF0A 1TCAA 1VPTA 4I3FA 4PSDA 4UDOA 3RJPA 3F1KA 4ZT2A 4OH7A 1GNLA 1MV8A 3H2BA 4JYBA 3ABLH 1E3OC 3FHLA 1RVV1 1XEFA 1I27A 2G8NA 1UF9A 4RHFA 1C8KA 3F8MA 5AIQA 2WLSA 1ZD1A 4HGYA 3WTZA 1A77A 2B34A 4FOOA 5FKJA 2PYDA 3WU0A 2FZCA 1A9TA 1NBMA 2QN2A 4LNUB 3ID6C 4N48A 4LG0B 4LDPA 1O97D 2UZKA 4HAVA 3QG5A 1UBRS 3DZBA 1XJWA 4OXKA 1XNGA 1UBGA 4FMPA 1JUPA 2Y9ZA 4CM3A 4J0FA 3ISPA 1CETA 1R8JA 1PYVA 4NQWB 1CGPA 4QO7A 4UCQA 4PYIA 5TQ0B 3WLJA 4J07A 1YDWA 1PUXA 2I4LA 2RC4A 1WJDA 1WCV1 3MERA 2XR1A 3SHQA 2R2GA 3CZRA 1S02A 1L4NA 4MUGA 4JP0A 4U8HA 3KP1A 2RJNA 5H4HA 1TFRA 4ZVNA 2WUDA 4GU5A 3THXB 2C20A 5DXAA 2AC4A 4DLRA 4V1CI 4GIBA 2JHFA 1HW2A 2OAZA 2GOXB 1U3WA 3U1KA 1QH8A 4GDMA 1DVRA 2KQRA 2V7GA 4HF7A 2HADA 3VTAA 2WJGA 2X58A 1Q1QA 3RKYA 4GKBA 1MJHA 4RTLA 1SHKA 4DDKA 2BOVA 4Z1OA 1GPH1 3ROEA 1DEOA 3A25A 1H0MA 4FYYA 2WAEA 2BN4A 2O8DA 1J2XA 3FXUA 4XVUA 3GV0A 4ZVPA 1Z37A 1RXCA 4MUYA 4R8RA 2C57A 2ZSIA 2CBXA 3KSDO 3OZIA 2FPPB 2XADA 2X0KA 4YI5A 2EQBA 1GHTA 4QWWA 4OH1A 1FFSA 1R4ZA 5T5QA 1LBHA 3TSCA 4LSWA 4PN3A 4R2LA 5ADHA 4KW7A 2GWRA 1IIRA 1E9AA 3ESXA 3KYBA 5LJIA 3LA7A 3B1FA 4E03A 2FF5A 1SXPA 1G2QA 1A98A 4Q12A 2C8JA 1KIAA 5HOEA 5AQ1A 2K4MA 1RE1A 1MNMC 4L0YB 3TE7A 3PBKA 3G5TA 1ABFA 5LD2B 3CLUC 4RKQA 2EL9A 2AL7A 2EXXA 2H7YA 4Q1BA 6AT1A 3LUPA 5C1OA 1D3YA 2JLYA 5KDOA 2VAVA 1N8SA 4HQMA 3FMGA 2ZUEA 4UUNA 3TUZC 2GBCA 4BAYA 2BV3A 4MKRA 4U8GA 3CVOA 1YFLA 5D5QA 3FCSB 2F62A 4BGIA 5BQ5A 2APJA 4I4CA 3L4BC 4A3BJ 2Q7OE 1UKVY 3IBYA 2J31A 2RGEA 1E6CA 1H3EA 2FUG2 1QIHA 3OYIA 4LBWA 2WD7B 2AVNA 4F0JA 3UGQA 4Q24A 5GADJ 1YS9A 1UK9A 4IUCS 1WMFA 1I51A 5CM8B 1MDFA 3GELA 4I55A 1CF9A 4TXJA 4Q1VA 5I4IA 5IKEA 1I5EA 1BN7A 1KJZA 4MB6A 1VL8A 1KDVA 1TYZA 2V5UA 1NX9A 5TDHA 1UM8A 1C7JA 3DFIA 1NAIA 3CRRA 4EMTA 2YJZA 1JJBA 1CB0A 1Z5PA 3Q7SA 1OI4A 3S2GA 1NG7A 1P4SA 1QO0A 3DFFA 5JATA 3LAWA 5H3HA 1NNEA 1JJ8C 3WKCA 3LTNC 1IWBB 2DPLA 4HQNA 3WGLA 4X00A 4RSGA 1RKUA 2BFPA 4FMCB 1JPNA 5IZ4A 3JZAA 2PKCA 3L1IA 1Y1SA 2EJRA 1BI1A 5CA1F 1P0FA 1OSNA 2J9RA 2HF7A 2A9JA 4B81A 4QQRA 5B64A 1VA5A 5LLQA 1V41E 3G2HA 4L75A 4EJTA 1GV0A 2BD0A 1JVNA 3ZHYA 4BC1A 1H9BA 2QRVA 3CP2A 4QOEA 3CCMI 1P3Y1 4QLAA 3V2HA 1GAXA 1FYFA 1GNPA 2BELA 2UKDA 5F64A 1B7GO 8GPBA 3I9KA 5EDNA 2WLTA 4XM2A 4UUOA 4PLWA 3E5HA 5IJAA 3OFND 1VJDA 1LB2A 3WWCA 1UODA 2K5CA 2PX2A 4CG0A 2QP3A 1NASA 2IHUA 8ADHA 3EIUA 2CFTA 4KV7A 3RJ5A 1ISJA 4R1TA 3DU5A 1XRJA 1Y9JA 1OLXB 5A4DA 4BVLA 4ZYUA 4RLSA 3NTVA 5FULA 1HFKA 4DA9A 2H6BA 3U4IA 4Z2AA 2JJQA 1KSGA 3JASA 4KQ1A 3EYIA 3SFVA 3Q0IA 4DCSA 1KU3A 3GJ4A 4YYZA 3IP7A 1LDNA 2Z9OA 1ZG1A 4OXNA 4HNGA 2G5CA 3FMFA 4GMFA 4IUDS 2YOFA 5ED4A 1FW6A 2YRFA 5KOHA 1RIFA 2GA9A 2I3ZA 4JCCA 3VU1A 4BU1A 2EYUA 3NAMA 2Q49A 1L8QA 1U94A 2J6HA 2N3ZA 4RFSB 2OV1A 5AK3A 1KQOA 2NYRA 4IAOA 3VPFA 1P3JA 3BD9A 4ZPJA 2QIOA 4TMYA 3UPTA 2C84A 3QPLA 4HQRA 3ICVA 3IIMA 5HYVA 1XTTA 3ZE6A 4L5CA 2AK3A 4DSZA 3F3KA 1KHTA 1VA4A 1WPGA 3M0EA 4WZAA 1V8DA 2ZPUA 5LQNA 1E2KA 5KX5A 1S1MA 2YSRA 4GNKA 3M8EA 3NEYA 5AW7A 2CLFB 4KYUA 4V2FA 1IUKA 3DL7A 4EFKA 3L6BA 3SF0A 2VP9A 1CJSA 3WHPA 5C31A 3QE2A 1WPKA 2CWDA 5GTHC 3TNDA 3HOWJ 1P75A 5FH9A 4ZI3A 4EGZA 1VFCA 1ZVQA 1U9IC 3LDGA 4F9EA 3OOUA 2Z1DA 3PTLA 4H0EA 2J48A 2QUHA 3LC1O 5HOOA 4EABA 4V0KA 4DR7B 4G2TA 1ZH5A 3I6MA 3HUFA 3ZY4A 2YFHA 3ZJ4A 3ELWA 3FTDA 3ERED 4AW9A 1ZUNB 2C4WA 1C30B 5B57C 1YS7A 5H6QA 1NBWB 5FNVF 3Q3JB 4YMLA 1RC9A 3AJ8A 3T5CA 3DP9A 3KEGA 4IM7A 5EF6A 2WAMA 3L92A 5IYZF 2HK6A 1U8ZA 4CUZA 4ZEVA 2C0QA 3BA6A 2YS7A 2I54A 5D51S 1SQ6A 2YDXA 2QQ0A 3KXPA 5A5FA 5K01A 1NE7A 4C4SA 2V97A 3FOWA 2UV1A 4DUGA 2GGSA 1D1BA 5A06A 5EIBD 2DP4E 2GN2A 3LZDA 4YC7A 3HIFA 2OQ2A 4FZJA 5E6UA 3B9RA 1K61A 3F8TA 1ZL0A 4LJ7A 4L9VA 1GVNB 4KPGA 1ZREA 5EHQA 4RA6B 4ONEA 1QDUA 4YDSA 3DT9A 5HDKA 1H9CA 1J1IA 1LLFA 1QRUA 3KIPA 4F86A 1QVUA 3CV3A 3DS8A 3FLMA 2PG3A 2BGLA 2R6ZA 1VPVA 1QYWA 3M33A 3RVRA 3E15A 2GXAA 3J80Z 4NU8X 3DAPA 1H66A 5JJKA 4ZXPA 1XHFA 4UM7A 5KHDA 4PLYA 2VNHA 3GVIA 1XCPA 1J70A 1BCSA 2RHOA 3PC3A 4Y7DA 4YGYA 4FKMA 1TQ8A 3ENZA 4KJZA 2M3AA 4EHDA 3FSJX 1C50A 2HBYA 1FVOA 3HL2A 2QTVB 5D00A 2PD4A 3DMGA 2I6QA 1Q20A 2MSLA 5TT0A 2VBXA 1T4GA 3W04A 1NUSA 3O4RA 3FKIJ 4Q3NA 1ACLA 1QHFA 5DBEX 1TZBA 1YTYA 3L01A 4UHCA 2ABWA 1I01A 3HJNA 2DLDA 4Z9YA 2IL1A 1PJBA 3IDAA 4E12A 3NH9A 4LOKA 1IUOA 1MKYA 4HVCA 3A6GA 2NTYC 1T5IA 1BJKA 2MR6A 2FXVA 3GCWA 2AOWA 1OMIA 4YELA 1ORDA 3PC6A 4C88A 5JANA 4EHJA 1ZM9A 3AR6A 3D5TA 3TDNA 4QVGA 3R9KA 3BLYA 4OB6A 2C78A 1RQNA 3V32A 5MFZA 1QP0A 3T8RA 1F1BA 1YZKA 3Q3HA 2ADMA 3VZDA 2AD5A 1SBHA 1QC5B 1ZRSA 5LZ5A 3KYCB 3WMFA 4AD8A 1PTJA 3RBZA 2V8OA 4RH0A 3AVQA 1SAXA 2YYAA 1VCMA 4N9QA 2QAIA 1K1EA 1QGED 3HRSA 1TIPA 5F5LA 4F4FA 2CLKB 5EWJB 2Y0BA 1ZJ6A 3PUWA 1BROA 1SQSA 2Z8YA 4XWTA 2VAXA 4EO9A 2XNJA 4WN9A 3AJEA 4HQKA 4H7PA 2NMVA 4TXLA 4KE9A 3HI4A 2OE2A 3SAJA 1P4RA 2H59A 4RACA 2PSFA 3FXJA 3H8VA 3IKJA 2ESNA 3WNDA 3T5XA 2HXOA 2XTZA 3IIKA 4DA0A 4G4GA 1FYMA 2QS9A 3VPCA 1MX3A 5JD6A 2L2QA 4OEHA 3DONA 1T1EA 3DEEA 4NZMA 3F74A 5KYXA 3LPAA 3B60A 1ECJA 1CUSA 5I9TA 4KGDA 1MA3A