4BQSA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with adp and a shikimic acid derivative.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis shikimate kinase inhibitors: design and simulation studies of the catalytic turnover.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 60
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bqsA00
4Q5IA 2FGJA 1X3SA 2W2VA 3MLEA 5JRZA 1D8TA 1MKYA 1XCPA 4ASUD 3PJRA 1TQ4A 4QGGA 4DZZA 1W44A 3CO5A 3MD0A 1U8AA 3GLGE 4UNQA 3GPLA 5DN6A 2J0UB 3M4YA 4C0AC 1FP6A 2KSQA 3EWSA 3ASZA 1HTWA 4OL0A 2IS2A 2XTNA 1UDWA 1Z63A 1A7JA 1Z0DA 3CWZA 5FOUA 4DLTA 3LLUA 2BBWA 2WKRA 3CUEF 3KTAA 5EE5B 1T8TA 2ZRIA 1MH1A 2PLRA 4D4LA 4LV6A 1NKTA 2CK3D 5CK5A 4YDSA 4BRUA 3AQ4A 3CF6R 4S2EA 1FQKA 221PA 4IVPA 4PHTA 2O8CB 1US8B 3I8SA 4OQXA 2W6ID 4DCVA 1J8MF 3AP2A 4TWZA 1AQYA 1R0XA 4PC6A 3VR4A 1ZNZA 2UZ3A 1IBRA 5SZIA 4LZZA 1B0UA 4R71A 1PV4A 4LV8B 2CE2X 2RH5A 2VP0A 4GP6A 4WAUA 4Q9HA 4PR0A 4TMXA 3A1VA 1G9XA 1G3RA 1ZUNB 4GRAA 4B6FA 1E96A 3DEFA 3B1YA 2V9PA 4TT3D 1I2DA 5BYJA 1X1SA 1IHUA 5KYKA 2WWWA 4HATA 4P4SA 4MYCA 3MGCA 4Q7LA 1TTTA 5CM8B 4B73A 1W49A 3UPUA 2XXAB 1IY1A 3S1AA 5JFGA 4XWAA 2JLWA 2HXSA 4C2TA 3QXCA 2G9NA 3PEUA 3T61A 2IYTA 1NSTA 1GITA 4HB0A 1F48A 5LBIA 1F5NA 3C8UA 3EIHA 4C7OA 2ZI4A 4ILEA 1LS1A 4TL9A 4D4KA 2QQEA 4A2QA 2QI9C 2GXSA 4MKGA 3U5ZB 1ZD8A 2GXQA 2IUSA 2FX3A 3Q7QA 1M2OB 1KSGA 2A30A 1XEXB 1IM2A 2P6UA 3EW9A 4KFTA 4MUAA 4MYTA 3DO6A 2VO1A 3I4LA 3H2YA 4MGKR 4KO8A 4BLRA 4TSFA 4LJ8A 1W4RA 3REGA 2Z4SA 3QXSA 4P0TA 4ZPXA 2XB2A 5KPJA 3AVXA 1AIPA 4ZCMA 2IW3A 2LKDA 3NBYC 4PHGA 2OILA 4H1VA 1NJFA 4M1KA 3KL4A 1JXOA 1IN8A 3D8BA 1NJGA 4AYXA 4MRSA 5KNDA 3OE7A 4A2PA 3VU9A 3VHLB 2EYUA 5FPTA 3KKOA 1WDTA 4UXHA 4BFVA 3SN6A 1E0AA 4EQ6B 4TMKA 1N2CE 1N0UA 1SVLA 1TQDA 3OIUA 2CDNA 2RGAA 3CZPA 3MFYA 4QNRA 2E9SA 4KU4A 1VCOA 1OSNA 1UJ2A 3LY5A 2ZSDA 2ZVQX 3NHAA 4US0R 5KHOC 1OH5A 821PA 4G5RA 4QFMA 5HPYB 1FX0B 2B8TA 1FW6A 1AKYA 1MO6A 2BIFA 2HYIC 2QAGB 1R2QA 1E0JA 2RGDA 1E2FA 4H9GA 6Q21A 1D6JA 5G40A 4D0LB 2XITA 1I4TD 1N0VC 2VEDA 1CKEA 1KI1A 2FSHA 2IYWA 1WB9A 1G19A 1OPXA 5GJCA 1KY3A 1S3GA 3IIMA 1QG4A 1RPZA 2YOFA 3WYFA 1G6OA 3CWQA 1S1MA 3Q5DA 2WWXA 2V1UA 4KBFA 3GJ5A 2CNWD 5FOTA 2RGGA 2ZI9A 4HAYA 4LJYA 1ZM4A 5FTJA 1QHNA 1DBSA 2JJ2D 4IOJA 1SXJA 1N5IA 5JHGB 2QE7A 3QENA 3K70D 1DAIA 2XNDA 5KNCA 1D9XA 3I72A 1KAOA 4BFZA 1NF3A 1NBME 4YDHB 3B78A 2EU8A 4IDQA 3T06B 3ADDA 1JR6A 1MV5A 2DYKA 2JEOA 2IXFA 1E9DA 4GMDA 4UQOA 3QI2A 2ORVA 4JYCA 5JCZA 2X2EA 2QY9A 2Q3FA 3NKVA 1R8SA 1YHNA 1OT3A 4QHTA 2R6AA 5C4GB 2IS4A 3C41J 3GJ8A 3KB2A 2AWOA 2FU5C 4GZLA 2V7QA 4M0LA 2FG5A 5LDDC 3RSOA 1T91A 2BHRA 4Q03A 2A2ZA 2JLZA 2NQ2C 2Q6TA 2ZI6A 1TU3A 4LRWA 2EQBA 4Q4AB 3SYLA 1NBMD 1Z07A 1JQLB 2CMKA 2FFHA 2IYUA 2EFDB 4C3ZA 1DAHA 1ZC4A 1RRCA 1ZJ6A 1CEEA 4RD3A 3Q3JB 3QQ5A 3WYAA 2B8WA 3C15C 4FXPA 4LBWA 5DLQC 2CVFA 2ZYUX 3VTKA 4BGDA 3K0CA 4C0JA 3LVRE 1UFQA 1SVWA 3TSWA 3WP0A 1E2LA 4YXWD 4TQUS 4I99A 3GEEA 4OBEA 2R8RA 4QHSA 2RGNC 1U0HC 1WF3A 5GVRA 3BIFA 1QHYA 3T35A 1YRAA 2ZS8A 4HLUA 4OJQA 4JLVA 1OH6A 3CX8A 1YR6A 3RRZA 3VR3A 4EFNA 2QL6A 3SHWA 4WZ6A 1W36D 2ZQ5A 4DRZA 4KI0A 2H18A 1N0WA 1AJEA 3CH4B 2YOGA 4N0DA 3IEVA 1UBGA 1R0ZA 4Z1MA 2GA8A 4LOAA 2QQ0A 1W48A 4GSYA 3B1WA 2QPAA 2P65A 2FH5B 4LV5B 1XTRA 2RGNA 1GRQA 3ASYA 4UJ5A 3TH5A 3BXZA 3K9GA 5J4YA 2YNMA 4LX0A 2YZ2A 2HV8A 1G3UA 3GLHA 2H16A 1TF2A 2WWIA 2JIZA 4LYAA 3Q8XB 4AURA 3ADBA 5BXQC 3B7GA 1SULA 3SNHA 4EJSB 4YMTA 4FI3C 2XJ9A 2BEKA 2PZGA 4DLVA 2ATXA 2R6DA 2ZE8A 4WBSA 3SBDA 3DMDA 3I92A 2REBA 2ZRHA 1M8PA 1M7BA 1NN0A 3DOEA 4GMXA 1T9HA 4C0KA 4YMVA 2ZE6A 4R7ZA 3FKSD 2WJYA 1CRPA 4NDZA 3U3OA 2FDCA 2GZDA 3RDPA 3GLIB 1TADA 1D2NA 1S9HA 1QBKC 3CM0A 2YWGA 2XXAA 4PPFA 2F1IA 3RHFA 5K8TA 1P9WA 1OB2A 1T5LA 1DG3A 4IDPA 1OHHD 2AL7A 1ZP6A 3ZD6A 1PVOA 4H1UA 4DIDA 2VYFA 3AB3A 4A92A 3K0AB 2XJ4A 1G3QA 1KNQA 2HLDA 2VSOA 3DHWC 1LFDB 4M1WA 4WXRA 1WP9A 2AR7A 2GAOA 2LKCA 2J0SA 5G41A 4PSAA 1EWQA 1KSHA 1QF9A 2VTKA 4HLCA 3U6BA 1Z6GA 4YXWA 2AFHE 5GJWC 2D7DA 5FBWB 3W8NA 1ZINA 4HDQB 3DL0A 2F7SA 1U2RA 2WICA 4UJ3A 5K8UA 1SXJB 1E2PA 5AJXA 2GEDA 3LNCA 1VG1A 1NLZA 2JCSA 2F43A 4QOSA 4URYR 2GWHA 1OXXK 3HR7A 1VHLA 3Q9LA 5UKDA 1GP2A 3RRMA 4ZV4A 2XEXA 4DT1A 3GLGB 1CP2A 2GILA 2J0UA 2QP9X 2P5SA 2WSSD 4JBXA 2AK3A 4Q1CA 1ZM2A 3J81k 1F2TA 4JLMA 1HA3A 2QMEA 4N1AA 5J4VA 4XWKA 1OJLA 4NCHA 2WWGA 3VX3A 4OI2A 3SU8A 2WSMA 4BFYA 1RYFA 2I3BA 4OYHA 4Q01A 2YJTD 1GOTA 2O8CA 2G0NA 4FMBB 2JJ8A 1M6NA 2PBRA 1GNQA 4PAQA 4NYMQ 4RKFA 1U90A 4EPRA 4II7A 1EG7A 5KOYA 2QP3A 3I3SR 4GNKA 3TIFA 2ZJYA 4B71A 1W2GA 4QBHA 1KDRA 1CULC 4I1OA 1TNDA 1XTQA 1O3YA 4CEIB 1XD2A 2QE7D 2OAQ1 1NVWQ 3WP1B 4JJZA 3R8CA 4W5HA 1DS6A 1XNJA 3CPHA 4BFWA 1KJYA 3T5GA 1AGPA 4ABYA 1RRGA 1UKZA 2ZUDA 3IQWA 1VYVA 1KMHA 5TMPA 2W58A 3U60B 521PA 2QGNA 2Q9AA 1N6NA 1T8UA 3F3YA 3IBGA 1XDBA 1WMSA 3NC0C 1SKQA 4B47A 1E2DA 2EYQA 5GADl 1I2MA 2I1QA 5CIWA 3T15A 3QY0A 1MABB 4EJSC 1KJZA 4AKHA 1E9CA 2BMEA 1CR1A 2C9YA 2VHJA 1A4RA 2FA9A 2IS1A 1US8A 5KSYA 2P2LA 1CJMA 3KQKA 2Q21A 2CBZA 1GSIA 1P62B 1TQ2A 1W4BA 4RD1A 3W34A 4KFRA 1P72A 1VIAA 3I73A 2GZAA 2ZJOA 2XZPA 3BAFA 1NMYA 3EZ2A 1ZBDA 2G77B 2ZIAA 3CW2A 4NH0A 3AKDA 2ONKA 1D2EA 5AK0A 3RABA 4PSVA 4L8GA 5FI0B 3C5HA 2VHCA 2WJVA 5CLQA 1OH8A 3LQQA 1EFRA 3ZQJA 5B58C 4EJSA 3EPHA 1CJKC 1CTQA 1E98A 2PX3A 1EXMA 1EFTA 4PPGA 5EZ6B 4RCYA 3TSZA 1T5IA 3K0SA 1R6BX 3NH6A 3Q85A 2QBYB 1KMQA 2ZU6A 5CYPA 1G64A 2AXNA 4V0ME 3GFPA 1YZKA 3B6EA 2W6IA 3OFNA 4QBIA 5KDOA 3EZFA 5KSZA 3L0OA 2OESA 3ND8A 2HDNB 3OESA 4MA4A 4B3XA 4EIWA 1N25A 1ESMA 4BFUA 4B74A 4XVRA 1AS3A 2C78A 2IYRA 4OKSA 1Q44A 3K09A 4JL5A 4GL2A 2CHQA 2C8VA 4TYYA 2CHVA 2Z0MA 3WY9A 5HZHA 1KSJA 3EZ7A 2QUZA 4XD7A 3RWOA 3BH7A 3GEHA 4OQFA 1N6PA 1XMSA 4RD0A 4NYJR 3TR0A 2VP9A 3H84A 1OB5A 4A8JC 3ZZTA 4NE2A 2ODBA 1RYHA 1HEIA 1G16A 2F3TA 3NDPA 4Q9LA 5FTNA 3X1WA 4A0FA 2XAUA 2FOLA 5P21A 2WMNB 3H4MA 1C4OA 2CL0X 3DKPA 3LBHA 4P32A 2BCGY 3WRXC 1PZNA 2N1BA 3FFBA 2IYXA 1EX6A 2PX0A 4ACBA 1Z2CA 2G1KA 4F4JA 1AS2A 2JLQA 1M1YE 4WZBE 2IHYA 1GNRA 2D4HA 2BJWA 1GL7A 1G8FA 3QKRB 4UXIA 3VMFA 1KK3A 3X1DA 4LGMA 3RSLA 1Z06A 5HE9A 4YONB 4TTRA 1FQJA 2G6BA 5JZVA 1XF9A 621PA 4A8JB 1XMVA 2JGNA 3TAUA 2ZS9A 3L8YA 3PUYA 2O8FB 2ODNA 1EWRA 3A1UA 2VH5R 1LY1A 3KJIA 5HTKA 3N2IA 2ZS7A 4IVRA 2FZ4A 4C9BA 5FFMA 5KSOA 3KB1A 4Q47A 5KNBA 2WAXA 5SZJA 2W00A 4QXAA 5FUWA 3KFVA 1YVDA 2W2TA 3FE2A 4M1SA 1CR4A 4G0NA 1S2MA 2JDID 3SZRA 4DDUA 3AKYA 4G5QA 1GKYA 1U81A 3AF3A 3QXJA 2A5DA 3U6KA 4HAUA 2JJ1D 1HT2E 4BLOA 4D0GA 4Q1AA 3GP8A 3ICQB 1DAEA 2REOA 3WBJA 2OBLA 4BE7B 1G7RA 1JEDA 1UEJA 3TQFA 2JA1A 1QHSA 2BKEA 3LBIA 4EKDA 1SGWA 1HT1E 4D0NA 1N5LA 2OFWA 4RFSB 4JYBA 1S1CA 3QUSA 3G82C 5IF9A 4WA7A 1FUKA 3BRWD 2KE5A 2IX3A 2OBNA 4LJ6A 1QHGA 1X6VA 4UNNA 5B30A 5DSZA 5EXPA 1VMAA 1LS6A 3AP1A 3CKLA 1XB2A 3N5CA 4FW9A 4BLPA 1E9SA 1RW4A 5A0FA 3BOSA 1KO8A 2C5LA 2UZIR 3LFUA 3H1TA 1G18A 1XXHA 1UF9A 2RGXA 4WIAA 3BGWA 4NCNA 3K0FB 1TU4A 1VG8A 1IOZA 3IGFA 3SFVA 1S4QA 2QN6A 1E2NA 1YR8A 3BC1A 4E07A 2F55A 1RRFA 1G5RA 1P4SA 3R9XA 4TT3A 1W0KD 4B32A 3LWNA 4GOXA 2V4ZA 4LJ9A 1Q20A 2DFKB 5TY0A 1PLLA 3A4LA 1XBTA 2KBEA 2FJUA 2QTVB 1CLUA 3A1SA 2DB3A 1SVIA 1R4AA 2WOJA 2VF8A 2A5JA 5E95A 5HKKA 1X8KA 5KUTA 3MWLA 3WHLA 3TR5A 3ZIAD 3DZ8A 2GTPA 4YMSA 2ODEA 1TQ6A 3WMEA 4K8OA 1GUAA 2QMUA 3ZZ0A 3CLVA 5J4KA 1J99A 2G1JA 1P7CA 2IWRA 4JS0A 1KJWA 1FMLA 4HAVA 1NMZA 1YR9A 3QBVA 4RZ3A 5FL3A 1LB1B 3HU2A 4FN5A 2WZQA 5EJEA 1ZAKA 2H17A 2FPMA 1JXMA 1DARA 1UAAA 4D6PA 1AZTA 4IHQA 3CZQA 4NYIQ 3MJRA 1WBDA 2QRNA 3B85A 3OEED 4EPYA 1COWD 5EZ5A 2BKUA 3HJNA 2CLSA 3AVOA 4TZ0A 5DE3A 4YMUA 4JBYA 4TN1A 4HI0E 2NG1A 1GVNB 1N6LA 3KQLA 2V8OA 1JPJA 4IFBA 4XVUA 1J90A 4R2HA 4A1FA 4Q4HA 1X8LA 1XEWY 2IXGA 4LJ5A 1RKBA 3W3ZB 5L3SB 4WW0A 1SHZA 2WKPA 1E6CA 1TF5A 2E87A 1N6KA 3I8XA 2CEAA 5AWFC 3T34A 1U98A 4RZXA 3EPKA 3ZYCA 1BYIA 2HYDA 3AF1A 3IQXA 3UWKA 2KB0A 2DWOA 4EPWA 2OT3B 3KXIA 2IF0A 2QAGA 1NNEA 3A37A 1K8RA 3O47A 4NYMR 3QNUA 1XP8A 2KBFA 2ZRAA 1IQPA 1LF0A 4WZAE 2WJJA 2IUUA 1Z08A 1N6IA 3GJXC 2FPLA 1Q12A 4B43A 4D25A 5DIFA 2B7BA 3LVQE 1VDZA 2ZRKA 2L0XA 1DTSA 1F2TB 5F9HA 3K0AA 4RKEA 4IEIA 2QM8A 4C30A 1ZUIA 3A4MA 3THWA 2A3RA 2R62A 2WPDA 5EP1A 3NC1C 4RZUA 1DELA 5FTMA 4HB4A 4TLAA 1VYTA 4GOKA 3LX5A 4CGZA 2DWPA 3HWSA 3TVTA 5FBQB 4BASA 1XWIA 1KYIA 4Z54A 1GKIA 4DSOA 1W4AA 2AD1A 2IEYA 1RJ9A 4PPNA 2MMCA 2V6IA 2Z83A 4OHZA 4JL6A 3W9YA 4MKHA 3Q5EA 2VP2A 3ZS8A 3GLFE 1LF5A 2N46A 4BLTA 4Q9JA 4TL8A 4U00A 4D80A 3QPWA 3EWAA 1G4UR 1KO5A 5JHHB 2J41A 1EGAA 3ZDQA 2J87A 1E79D 4QM6A 4M22A 3TUIC 2YWHA 2ZSBA 2D2FA 4D82A 3IPYA 3U4QA 3LW8A 4X8HA 3K0CC 1U0LA 2BM1A 3OAAA 5G53C 1CXZA 4C0BA 4BEBA 5CB8A 3QKSA 1G6HA 1GL9B 3MWKA 3SFZA 3P20A 3DZDA 3NEYA 5CJPA 1OH7A 1LNZA 1Q57A 4XJXA 1XPRA 4JLBA 3K0FA 1UM8A 4NU0A 3I5XA 4QL3A 4CEJA 4DLYA 2ZSFA 3P32A 4MRVA 2GJ8A 4JBWA 1XJQA 4TL6A 4DLRA 1KI4A 2ODWA 2J7PA 2XNSA 2JDIA 2QG6A 2OZEA 3P4YA 2J7PD 5LB2A 3L8ZA 1E79A 3B5JA 1DPFA 3TJZA 3SQXA 4KLNA 4CIDA 4KSBA 4DDTA 1GRRA 4DC9A 2RHDA 1JBKA 1CU1A 4CEIA 1Q0UA 5ANRB 2PZEA 1TL7C 1Y3AA 4IVQA 3I5YA 2WM9B 3QKSB 5AJVB 3U7HB 1R5BA 1Q1ZA 4RCZA 2R6FA 4B34A 4O3MA 1OIVA 3HYRA 3QKRA 1A82A 1F2UA 1PUJA 2A78A 2JASA 3GJ3A 5EXXA 3QVVA 4JMPA 2PLFA 2YVUA 4WOPA 5D3QA 2RGBA 1L4UA 3CNLA 1DG1G 3ONWA 2VP4A 3MWYW 3QJYA 1HY3A 4TMVA 2R9VA 3R20A 1XTSA 1E2MA 4Q1DA 4P4SB 3K9HA 1NLYA 1OE0A 4MKFA 2C2HA 1QHXA 4GPTA 3SYNA 5JJKA 3OF5A 4MRPA 1FL9A 3IPXA 1HQCA 5FTKA 1G8YA 1NY6A 1P9RA 1QHIA 4NCJA 3U2QA 2JJ2A 2FV8A 2GCPA 3UMSA 2QPOA 4DJTA 4FIDA 4DT1B 2K5UA 4P33A 2RGCA 2FFAA 5EE1A 5KDDA 4PC1A 5JS7A 2QZ4A 2H5EA 3LV8A 1BO6A 3VFDA 1SXJE 2W6JA 4M9XA 3MSXA 4A0HA 4LWZA 4XSHA 1SZPA 4C0HA 3QG1A 3RWMB 1EESA 1CR0A 3B1VA 3PV0A 4L9WA 2R6GA 1FTSA 3N2EA 3OIVA 1X8JA 2C77A 3HDTA 3FHCB 4DEXA 5G3YA 3C5CA 5BN3A 1JAHA 5EE9A 4A4DA 2JLYA 1Z2AA 4GFDA 3O8RA 2HJVA 1FOEB 3EX7C 1WE2A 3RS3A 1KAGA 3EA0A 2QSYA 3MUFA 4IOMA 3W5IA 4LHVA 2NZ8A 4G3XA 1T0HB 5EUMA 3VAAA 1P75A 3WNCA 2ZM5A 2ZRDA 3E5HA 2G88A 2AWNA 2QM7A 3KTAB 3RRNA 1WBBA 4LJ4A 1XFAA 3JZMA 4IOLA 5DHAA 4MDFA 5FH9A 4L9SA 2CLCX 4LC1A 4TLCA 1ZW6A 1LV7A 2XOKD 1VHTA 4LBYA 4RY2A 4AD8A 2EW1A 1VKJA 1OIWA 4P31A 3R7WA 3VNVA 2NO0A 3BS4A 1BIFA 1MO5A 3B82A 3CIOA 3THYB 5BN4A 4OI0A 3OE7D 3MCAA 4B3GA 3SR0A 5FUYA 3CH5A 1CF4A 2IYYA 2OAP1 4PO9A 4JLNA 4LHXA 3T1TA 4EQ6A 3L0SA 2YINC 3MWJA 1NLFA 1KKLA 2ZRFA 4JL8A 2PT5A 1E2EA 4BFXA 3L0IB 5JCPA 2C9OA 2QTHA 1GZSA 1KDPA 5BQ5A 3SJAA 4D81A 1DO2A 1M7GA 4LYJA 3V00A 4DSUA 2J5XA 2WV9A 4QBGB 4Q21A 1KI6A 1EFRD 3EIQA 2AKAB 4X8LA 5DN6D 1SVOA 5TVKA 1KO4A 2JATA 3ZGXA 4B35A 1JPNA 2VHTA 3BH6A 1Z0FA 2BMJA 4GT1A 3K53A 3PUVA 1YU9A 3IUYA 2J46A 4HAWA 4I81A 1UKVY 2QBYA 2AN9A 4MRRA 4ZCLA 2Z43A 5IHPA 1IN7A 4DSTA 1T3LA 1XX6A 4N0EA 1GWNA 2GDJA 3TW8B 4EUNA 2BMDA 1K5DA 2AFIE 721PA 4UNPA 3QXHA 2J45A 4ZKDA 1R5NA 2FPKA 1W0KA 4Q18A 1YZUA 1ZD9A 1AM4D 2IYLD 3PFIA 1KNXA 3OEHA 1A1VA 3B60A 4OHYA 2C04A 3UG7A 3QVUA 2X77A 4DIEA 1W5TA 3AVUA 3QPVA 3CRMA 3PITA 3WXMA 1IXRC 3SJZA 1TMKA 3U3JA 5J4HA 5C2JB 4OHWA 2OCPA 2ZE5A 4EPTA 1KK1A 4HB2A 2BDTA 3ZVLA 2VF7A 3BWDD 1MO3A 2A7QA 1KY2A 2G0TA 2QSZA 5H8WA 2GJAA 1NL3A 2VSXA 1RVDA 4PFSA 1E2IA 3GLIA 3HU3A 2VA8A 3SHFA 3VR1A 2ZSEA 5FPYA 4BLQA 2YV5A 2VHQA 4US2R 1II8B 4ARZB 1JAIA 3BERA 3P1JA 2CVHA 4FD2A 4I4LA 4R98A 1ODFA 3X1YA 3BH0A 3P26A 5JJLA 1Z0KA 3F8TA 4IXMA 1M7HA 4PXAA 5JWOA 4TQAA 5KSPA 3SJCA 1NKSA 1DAMA 1ZNXA 3RVBA 2CCJA 1XEXA 3NBXX 3WMFA 3FB4A 2ZAOA 2IK8A 4M21A 5JRJA 2ERXA 3D31A 2C03A 2LCFA 3R7WB 5AJZA 1GRNA 1G8GA 4ITRC 1D9ZA 1HE1C 1NN5A 2VLIA 4HLQB 4IRUB 1N5KA 4A8JA 4AG5A 4ON9A 5AUNB 2O8FA 2NOAA 3WHKA 3UK6A 3KXKA 4L16A 1XXHE 2XGJA 1JEEA 4M2LA 2OHFA 4ARZA 4BZQA 3GJ4A 3V4FA 2H1LA 2GEVA 1S9DA 8OHMA 4Q66C 4NL4H 1E0SA 2BJVA 2EWWA 2JLXA 1BMFD 2QMOA 4XTRA 4DUGD 3KXLA 1RZ3A 3QPUA 1E9AA 4M9SA 5ELXA 2BV3A 5JWHA 3M1IA 4JVLA 5CB6A 1MO4A 1P60A 4PX9A 2ZJ8A 4CEJB 1ZNYA 2ZUCA 4QHYA 1XZQA 4NTZA 5JI2E 4GDFA 3WRYC 2ZSAA 1G3MA 2YWEA 4HAZA 1XPOA 3ZVMA 2C99A 3W5JA 1P5ZB 421PA 2OO7A 4US1R 3W6NA 1Q3HA 3Q7PA 4G01B 4LI0A 2WBLC 2WJHA 4AIIA 4UKDA 4HUTA 3LH5A 2YOHA 1YZLA 3PVSA 1G1MA 2P67A 3L82B 5JWRA 1P2UA 2A9KA 2WIBA 3THXB 4URUR 1W36C 1G7TA 2XSZD 3CF2A 2O8EB 3CRRA 3ZVNA 5C46F 2GJKA 3A36A 1NY5A 4KAXA 5DISB 4HDCA 3OZXA 3O8BA 3BFKA 4PZYA 4EPVA 3RC8A 1R8QA 3IBYA 4UNSA 1KDTA 4V0LA 4PO1A 4ZDJA 2JIZD 2C96A 2HEIA 1T4GA 3OEEA 4WVFA 1IN6A 1VPLA 4Q00A 3UATA 2CCKA 1X86B 2IYVA 3EZ6A 4IKEA 3AVVA 4A82A 3C4JA 4KBGA 1XD9A 3U7EB 5M04A 4ACAA 3LRPA 1FZQA 4Q1FA 1Q21A 4URXR 1FFHA 2P6NA 3KDSE 3EPLA 1W46A 2OFOA 1KDOA 5F3WB 2R65A 3I32A 1EX7A 3KZ1E 2O8EA 4TL7A 2Z5FA 3CRW1 2NO9A 4DVGA 4F4CA 4Q19A 1P2TA 4JLOA 2GJ9A 4XH9B 4HZUA 5GVSA 4OI1A 2FEOA 4ZIRB 3NTUA 1BYUA 4BUJA 4AKGA 4DBLC 4V0OA 1G7SA 2PJRA 1T3SA 4ZO4A 2QTFA 1XRJA 4PAMA 1Z22A 4Q7JB 4RFSA 3AEZA 1OFIA 1GNPA 3GEIA 2ZEJA 5AUQA 1DVRA 3RS5A 3Q72A 2Q3MA 2OV2A 4F92B 1R0WA 1P61B 1C1YA 5CITA 4D26A 5EE3A 2GNOA 5LD2C 3DM9B 4AK9A 1IY0A 2IL1A 3KKPA 1HURA 1KI3A 4NCKA 5DGXA 3T1VA 3BFVA 4Q4JA 3BD9A 4FCVA 2W0SA 1S0UA 1XD2B 3K70B 2O0KA 2IUTA 4IDHA 3LDAA 3UANA 2D74A 2A5YB 2GETA 5L3SA 2DBYA 4EFMA 2ERYA 4RZ2A 2NO6A 2JJ1A 2VP5A 1KI9A 1E1RA 3VR2A 2OXCA 2AX4A 3MMPA 1KGDA 2V54A 4CYMA 2XSZA 1CR2A 5B64A 5C1BA 3QEJA 4B2PA 5JBQA 5FBVB 2ZRGA 3DDCA 4RD2A 3UG6A 2BBTA 2ZI7A 3EG5A 3OFND 4NYIR 3CBQA 1IONA 2NTYC 1GAJA 2P0EA 4MITA 1NI3A 3AUYA 5J40A 2QRZA 1MRNA 2N42A 1K6MA 1KO7A 1UBCA 2XTMA 4M9ZA 4PHHA 1NN1A 3W6PA 5B2ZA 2WJIA 3O8CA 1JI0A 4C0SA 5AJYA 4DEYA 2CLDX 1KI7A 4TZ6A 5CJ2A 2C95A 4HUQA 3LQRA 3IILA 3AH8A 3FWYA 1E1RD 3RS0A 3TUZC 2ZITA 4G1UC 4I1SA 4PPQA 1YZNA 3NVAA 2IYQA 4A0GA 4ZDIA 1Y63A 2XZLA 2P3SA 2RMKA 1Z0IA 1UBEA 3SQWA 1W5SA 3VNUA 2QAJA 3WBKA 2W2XA 2WWHA 1E2KA 2GXUA 2JAQA 2OSBA 3BE4A 3LXXA 2QAGC 2XNDD 2BCJQ 2IT1A 1ZM7A 1ZYUA 4IW3B 2Q9BA 3B13B 3RNLA 4JKIA 1XEFA 2C98A 2WOOA 1ZUHA 4B76A 2O8BA 4KHZA 1COWA 2RGEA 1G8PA 3K09C 3IHWA 2PT7A 3RS7A 1WXQA 3PCRB 1TF7A 2J1LA 3RS4A 4MGZR 5KDLA 1KSFX 2XOKA 3ZQ6A 5CDFE 2YC4C 3IHLA 1S8FA 5LB4A 3H86A 4JVMA 1II8A 4XSGA 5H68A 2Z4RA 1W47A 1G4AE 3BB1A 4HUQB 4QNMA 3FKSA 1N6OA 1UKYA 3NBZC 4K81B 2WAYA 3AKCA 4NMMA 4B75A 4JT4A 3LD9A 1W0JA 3AUXA 4NKRA 5L3QB 3DKVA 2PEYA 1GTVA 2W83A 3K8YA 3RAPR 4BLSA 2EVWX 3THYA 2FE4A 3W8RA 4QKQA 4GI7A 2H92A 1S96A 3EIEA 5AUOB 3PUXA 2O8DB 4OHVA 3RLFA 4WXPA 1AN0A 3E70C 3L43A 3B8HA 2OXRA 4C2UA 4G5OA 1OKKD 2ZJAA 1YZTA 2EFCB 1G8HA 5CDFA 3CR7A 1QHHA 3DPUA 1XJCA 3OIWA 4Q4JB 1ZIPA 3I1FA 4PQYA 1SXJD 4JT2A 2YC2C 2OFXA 2ZUBA 4XD7D 5FL7A 2X19A 3FGNA 4Z51A 2FF7A 4AI6A 3QE0A 2FNAA 2QROA 4TTQA 1JR3D 1R0YA 4JVNA 1XZPA 2VQSA 1JR3A 4GBMA 4B6EA 4HZIA 2P6RA 5DYGA 4Q7KA 3I61A 1LTQA 1UDXA 3MJHA 1L8QA 5KU1A 3T5DA 4C0LA 3SI7A 4YQFA 3U7GA 1MABA 2GF9A 2NZJA 1SKYE 1IY2A 4LYHA 4XOIA 1TAGA 1BH2A 2OCBA 4F7WA 2ZYVX 5JECA 2VSFA 4B2IA 5JLJA 3W3AA 4BFSA 1H8ED 2WVJA 3CPEA 1OFHA 1XCMA 1X1RA 3KKQA 2V3CC 1G291 3A6PC 4B3FX 1OHHA 1QG2A 4W5WA 3VKHA 2GCOA 3AV0B 2BEJA 4U5XA 4U02A 3KJGA 4PSKA 5FTLA 1JNYA 3TVDA 1H8HA 2W0MA 1YQTA 2HT1A 4KFUA 2ANCA 1CRQA 2CCGA 3EC2A 4HDOB 3R9IA 3E1SA 1KI6B 1YE8A 3F5FA 1E9RA 2ZRMA 4P3YA 1E99A 1XTIA 4F38A 2B6HA 2V55B 4DXAA 2E1RA 3MRSA 1J2JA 3B9QA 1KZ7B 1SXJC 4RD6A 4F4IA 4M1YA 5FL7D 1ELOA 1VCIA 4CEHB 1JJVA 2HT6A 4LY6A 5F98A 1TEXA 1DOAA 1L4YA 4KYIB 2O52A 4KVGA 2R44A 1KO1A 2CXXA 4Q9KA 1ZU5A 4TQ9A 3THWB 3PUWA 2BM0A 2IA5A 4DSNA 2ZRCA 4XTCS 4W9MC 2ORIA 2NO7A 3CONA 3SDZA 2FSGA 3CR8A 4LHZA 3EPJA 3DOFA 3KJHA 3O8DA 1A2KC 2FGKA 4HLDA 2QENA 1G5PA 2RKOA 3PQCA 2OM2A 2QA5A 4LJ7A 2HF9A 5B57C 3U3RA 1II0A 3X2SA 1L2TA 2QEQA 4BECA 2OLJA 5FPHA 5CIQA 1IXZA 5BN5A 2KI5A 4G5SA 4PQFA 1J8YF 2I1VB 2NMVA 1HYQA 1T6NA 2VRWA 4RVCA 1OXTA 2AHOA 2Q0HA 3FMOB 1SHKA 3ECCA 5J5CA 4IOKA 2BOVA 2EFGA 1IN4A 2KWIA 2V1XA 4QJ5A 1DAKA 1CS4C 5CM9C 2IXEA 1Z0AA 4CDGA 2WTUA 3IIKA 3U7FB 2GHIA 4JJKA 3VQTA 1YR7A 2DWQA 4F91B 4TLBA 3U61B 1ZU4A 2ZJBA 3FOZA 3QOFA 1IN5A 1E2QA 3BJIC 1ZC3A 3ZLJA 2HLDD 4Q1BA 1NVUQ 3AF2A 2BWJA 1OV4A 4IEEA 1J7KA 3LO5A 1E1QA 1IAQA 4Z8XA 1WCV1 3HU1A 3NEJA 1Z47A 1NMXA 1A5TA 1YKSA 3MG9A 3OHMA 4LYFA 3TSOA 5JJIA 1GDDA 2DHRA 2G83A 1C9KA 4L5BA 3TAHA 1F2UB 4Q4HB 5DI3B 4NP6A 4O0MA 2D62A 3ZZUA 1ONBA 3ADKA 1XCGB 4B2LA 3FDIA 4OQLA 1Q1EA 1NN3A 4Y0AA 1IXSB 1W7AA 2JLSA 3G5UA 2IWHA 3K9LA 1P73A 4X8OA 5K8LA 4CZ2A 4R9UC 2FFBA 3C7KA 5E4FA 1RE0A 1P3JA 1E1QD 3DMNA 3IO3A 1FP7A 2GBLA 4A6PA 1U9IC 1OXUA 2D3WA 2OCYC 2WHXA 3RYTC 5J47A 3W6OA 4DDVA 3CF0A 1XXHB 2H7VA 1BS1A 1AZSC 4PAOA 2WKQA 4HSEA 1OF1A 2ZXUA 1W2HA 2F3RA 4AG6A 2C9CA 4ZIRA 2RAPA 2ZVPX 5EXSA 4DKXA 1E4VA 3PEVA 1L7VC 4JLDA 4M53A 3TE6A 1Z3IX 2HXYA 4JSYA 1MOZA 1GFIA 2WWFA 3TW4A 4C0QC 1ZIOA 2J9RA 4URZR 5TDHA 2PJZA 4XVQA 4FMDF 1KKMA 4DLZA 1XPUA 2IYSA 4X8MA 3TRFA 1W0JD 2VL7A 5FUXA 5IT5A 2A5GA 2GEUA 2QPTA 1YJ5A 2DY1A 4KFSA 2FEMA 5BYKA 3P27A 3SEAA 2F43B 1QDEA 1E69A 5TV2A 5H1YA 3U44A 1T0JB 4Q4AA 4EPXA 1KK0A 1QVAA 4OHXA 3ETLA 4PO8A 3EARA 1RC8A 1M74A 3T1OA 3RRYA 3TBKA 3IO5A 5KTYA 2MSEB 1NBMA 5FUVA 4URVR 1GM5A 3B1ZA 3FTQA 1Q1QA 1AK2A 1G7CA 2AKYA 1QHHB 2ZJ2A 1QRAA 2R2AA 4RJLA 5CK4A 4IFEA 3K9NA 3GD7A 4V0MA 2UVQA 1AA9A 3CNNA 1TEVA 4B44A 2IHBA 2JLUA 5L3VA 2X8AA 4B3BA 2XZOA 3KQNA 2OEPA 4NZYA 1Z6AA 1KK2A 1N5JA 2ZRBA 4I1UA 3CPJB 4TMTA 4ZCIA 2YKGA 4ASUA 4DHEA 1FUUA 1E94E 1UPTA 1K5GA 2PMKA 1SQ5A 5H70A 1N6HA 4JIMA 4LUCA 1P9NA 1ZVQA 2ZTSA 1F3OA 2ZROA 3BBPA 4M1TA 1HUQA 5DHFA 1W36B 3PUZA 5HCNA 2DFTA 4MRNA 4E22A 1XTJA 2QGZA 5DI3A 3SBEA 4CT4B 4TYPA 1DADA 1Z6YA 4URWR 1CJVC 4HEJA 3HR8A 4MYUA 2CHGA 4IDNA 3ZD7A 1E2HA 1ETUA 1WRBA 4IJMA 1WA5A 4EAQA 3TGPA 1UEIA 1DAGA 1H8HD 4NCIA 4TMWA 3VX4A 2GF0A 2BBOA 3CX7A 2ZU0C 4LC0A 1NP6A 4DLUA 5FOVA 4QRHA 3REFA 5E3HA 2CL6X 4G5GA 2HCBA 4C4PA 5A4JA 1V5WA 5TARA 2DFLA 3R9WA 1JQJC 2PMDA 4LDJA 3AVYA 2GESA 3E2IA 1I4LD 4PC3A 3C16C 5F9FA 2QP4A 1KI2A 4JLKA 1MR3F 2RHMA 1FTNA 4V03A 4V0NA 5FPSA 1KTVA 5HR5A 5D3MA 2LWIA 3AVQA 4MKIA 4JSTA 3ZVRA 1Q22A 2GZHA 4KLZA 2J59A 4GOJA 5IRCD 3THOA 2OLKA 2ZI5A 2WIAA 5EP3A 4A9AA 1IJFA 5L3QA 4YMWA 4TYWA 4ESHA 2VHUA 2QU8A 1OYWA 5FOSA 1AGRA 4LSGA 2QMHA 4LJAA 2J0VA 1W1WA 4QGHA 3KQUA 1ZMXA 3QBTA 2JLVA 2UKDA 1KHTA 3AGPA 2QORA 1AKEA 4R2IA 1OKKA 3FYHA 1GL6A 3EZ9A 3KX2A 3WNBA 1CBUA 1ZM3A 3FFAA 3NXSA 1Q1BA 4JVSB 4LPKA 3HP1A 1JECA 4TMZA 4E09A 5HKKD 2ZR7A 3IIJA 3UXMA 4QJ3A 4KSCA 4KODA 4FWTA 4E5UA 2I4IA 4ESVA 2FWRA 1TX4B 1NG9A 2JLRA 4UNRA 4MGYR 4P4TA 3ZH9B 1E3MA 4LPSA 4JLAA 4M4SA 4OQNA 3WNDA 1G21E 4NHOA 3PG5A 1G5TA 3GMTA 4A15A 2R6CA 1FNNA 1J70A 2OE2A 2ZRPA 3FHTA 4GZMA 3C14C 5E7JA 5JS8A 3U3KA 5LPNA 3EXAA 3RANA 3FMIA 2GVZC 2WWYA 3L2OB 2BMFA 3S1AB 3QF4A 3AM1A 1I4DD 4LCBA 1BOFA 3NH9A 4M8NE 3FPAA 4O2LA 5AJWA 5J4LA 3K1JA 4O25A 4JKYA 2X1VA 2GKSA 3RC3A 3WYGA 2NPFA 3NBFA 1VIYA 3M6AA 3KUDA 2PZFA 5AUPB 2ATVA 1CJTC 3D7MA 3GFTA 5DYIA 3X1ZA 1G17A 4DB2A 4GP7A 3V4RA 4C7OB 5EQTA 4M1MA 2VP6A 4BQSA 1R5OA 2ZYWX 3QSYA 3U4QB 3TLXA 1A2BA 4B48A 1S3SA 5JEEA 1VCNA 2J3EA 2BC9A 3AKEA 2IEZA 2IBMA 4PANA 3VKWA 3GLHE 1CIPA 1ANKA 4DB4A 4PHFA 1OXVA 2XX3A 5L3RA 1F6BA 3AP3A 3ADCA 1B23P 2DCUA 1N3BA 2GJSA 2VIIA 4RSGA 4CVNA 5GJBA 5HZKA 4NBSA 3V9PA 1NVXQ 1SVKA 2VBCA 2XTZA 4NONA 4CRWB 1TPZA 3ICEA 2Q3HA 2HJGA 1E2GA 3SYKA 4D2IA 4B3CA 1OYYA 3JZAA 1OXSC 3VU9B 1N6RA 3IDQA 2ZETA 1Z29A 3PXGA 4KITB 4I1VA 4HB3A 1JR3E 1P2VA 3FMPB 5FPKA 5DI9A 1E32A 3K70C 2CK3A 4PTLA 2DPXA 4W5JA 5AR1A 1VTKA 4AY2A 3GJ7A 2V7QD 2ZR0A 4BEJA 4Y0VA 1VCMA 4AYTA 2WPDD 1DEKA 1OIXA 5EXTA 4MGIR 3GLIE 3GJ0A 1BMFA 4FMCF 3CRQA 1YZQA 4BZPA 1FX0A 3TQCA 4V0KA 5DO9A 4B33A 1ZNWA 3GQBA 3CB4A 1E2JA 2GXAA 1KZGB 3AVTA 2GRJA 4YLGA 5SZHB 3A1TA 4QC2A 4J0QA 1XMIA 4Q48A 1NRJB 1UKEA 1Z83A 1E4YA 2D06A 2REXB 3KKMA 2ZRJA 2O5VA 4ZI3A 4DWJA 2KJQA 4AC9A 2MSDB 2IYZA 4S35A 2H8KA 3TMKA 3BB3A 4EFLA 3JVUA 2HUPA 3GFOA 3QXXA 4PC7A 5D3MB 3NIBA 2NGRA 4MUBA 5F2EA 1HV8A 4LBZA 2CL7X 3ZS9A 1UADA 3UIEA 1TUIA 4HYYA 4AKEA 3FHOA 4NPHA 4XIGS 2O0JA 1DAFA 1VECA 3OEHD 1H65A 4LBVA 3T12A 4QG7A 4KV9A 1NIPA 4XWOA 3QG5A 1H8EA 4ZKEA 3UKDA 3VHXA 4AWXA 3TK1A 1JJ7A 4POAA 1MT0A 4M9QA 4E03A 3PENA 4KVAA 5BW8A 4AYWA 4EDHA 5FI1B 1ZCBA 4CW7A 2OUKA 2O0HA 1OFUX 3OIYA 4TLDA 2CE7A 1ZRHA 1PUIA 5JSZB 1M34E 1JB1A 2GCOB 4DLSA 1D5CA 1R7RA 3GLGA 2ZAMA 3VR5A 1OFTA 5CLLA 2GK7A 2RB4A 3G0HA 1EK0A 2G3YA 3LLMA 1G3IA 3W90A 1KMHB 5EP4A 1E0KA 5DNYB 1NVVQ 3GLFA 1ESNA 4JZKA 5LD2B 1XJ0A 3FVQA 2B21A 1RFLA 3KUCA 5HCIA 4FMDB 4QGFA 4FINA 1IJEA 2MMGA 3A1WA 1Q3TA 2CJWA 4BRWA 1FNMA 3L0PA 2F1JA 1Z6XA 5JEDA 1KI8A 1PLJA 2O8DA 3LAWA 3ND9A 1MRSA 5CYOA 2BBSA 2GK6A 3QF4B 1OW3B 2PEZA 4OK5A 2MSCB 1U0JA 4TLEA 1R10A 3HPQA 1GKUB 2ONJA 1NVVR 4PZZA 4V02A 3NDBB 3SC3A 1GIAA 3BORA 4OI4A 2DR3A 3SOPA 2QT0A 2OBMA 3LXRA 4A36A 4D4MA 3EC1A 3EAQA 3AVWA 1G41A 2AD5A 2SHKA 3DVLA 4TSFD 3KFXA 4DCNA 4F93B 4DCTA 4MQBA 3RS2A 2GBLC 4D4JA 1SVSA 2GCNA 1U9IA 1XU4A 2ZE7A 4OK6A 1HQYE 3TUJC 5FBRB 1YRBA 1UBFA 2GAAA 2QNRA 1E9BA 3LW7A 4ZI2A 3U44B 4P4UA 1W4CA 2AK2A 3F0TA 4DUGA 5A5GA 5IDVA 1DO0A 2PL3A 3JVVA 2F9MA 4RD4A 3R8FA 2J7KA 1XMJA 4NYJQ 4DLXA 2GVDC 5TB5A 1AS0A 2AXPA 4TYQA 1FMJA 3B9PA 4FMCB 2EFHB 3BK7A 4KXFB 1P2SA 2DFNA 4OJKA 2RCNA 2Z6VA 1D2MA 3EASA 4O2RA 1NIJA 2ZR9A 5KPDA 3T1QA 1TUEA 4KJZA 3A8TA 4DCUA 4BZXA 2F1HA 3CNOA 4BPBA 1QZXA 2Q9CA 5EUQB 1SKYB 5IK2A 5C18A 2W6JD 3OAAD 1RJ9B 4JLPA 2ZJ5A 1ZD1A 4RFVA 2V6JA 3DM5A 3PIRA 1KIMA 4B3DA 5L8VA 3LA6A 2ZI3A 3UMFA 2FFQA 1U99A 2F6RA 3AF4A 5FR2A 2PCJA 4PC2A 5DH9A 1VG9B 3HYTA 5K8IA 4OK3A 2A5FA 3PEWA 4MYHA 1NG1A 4FWIB 1DE0A 1SVMA 1XEWX 3TKLA 4HLUC 3NG1A 4Z1MD 4KCGA 3LBNA 1KOFA 3PR1A 3ZIAA 1Z0JA 4UXJA 1O87A 1Z8FA 5E7IA 3SJBA 4OQMA 1VG0B 3LX8A 1RRPA 2FN4A 5JI3E 2WMOB 4LHYA 2CNWA 2ZYTX 4AKIA 4Q1EA 1LVGA 4CF7A 2ASEA 5IK2D 4BFTA 2QT1A 4ZDKA 4IXNA 4Q9IA 4MDEA 4FCTA 4Q4LA 3QF7A 5KO2A 3D3QA 3AF0A 1GILA 4Q02A 4L4UA 3FKQA 4PZLA 4QJ4A 2FSIA 3AGQA 1EFCA 3KJEA 5FOWA 3H0KA 1CJUC 2X2FA 1HE8B 1NSFA 1VYUA 5EE0A 4DLWA 3GLHB 3KQHA 2WJGA 1F60A 3A58B 4U7DA 3D6TB 3VR6A 3PEYA 3BFXA 2Y8EA 1P6XA 4A6XA 1PLKA 2ZRLA 3EA5A 2F1RA 2WSSA 3CX6A 4CT5A 2OG2A 2YYZA 3WMGA 3N70A 1YZGA 2D2EA 4LK2A 2NO1A 4DDWA 2HF8A 2F9LA 1BKDR 121PA 2ORWA 3M0EA 5HE8A 5FBLB 2IS6A 2CJWB 5G3ZA 2PCLA 3QIAA 2B92A 1II9A 2P5TB 3AVPA 3VKGA 1QVRA 5SZKB 4FCWA 1ZCAA 3IEUA 4DCSA 2EWVA 2IC5A 3P4XA 2H57A 4PQRA 4HAXA 1WQ1R 2BVNA 2O8BB 3QEOA 3SS8A 2J0QA 3GJ6A 3I62A 5E7MA 4A0RA 3UMRA 3THXA 4ZDWA 3U3MA 4L15A 4QM7A 4QBFA 2D7CA 2XB4A 5EP2A 2HCJB 2ZREA 5TXGA 1XTKA 4ERNA 2ZRNA 1GG2A 1LW7A 3NWJA 2ZANA 3QKTA 4MH0R 5JMTA 2B7CA 3KKNA 4N3NA 4K46A 4BWYA 1E9FA 2ANBA 5C4MA 2FMXA 4TYNA 2FZLA 1Z28A 2TMKA 1EFUA 3CRVA 1RIFA 1ZM9A 3ZJYA 1OLOA 1E9EA 1JALA 1Z6TA 2YHSA 4M1OA 5GJVC 4CEHA 4A2WA 3NHBA 4YC7A 3MAAC 1G20E 4JLJA 3B1XA 1T3HA 2ZJZA 2EFEB 5JSZA 2PH1A 4KYUA 1Z5ZA 1FPMA 2VPPA 3QKUA 3HPRA 1HH4A 4HZUB 3K0EA 3X1XA 4W7SA 3UWOA 4IDOA 3SE0A 2ECKA 2YWFA 3FMFA 5BWMA 3GLFB 4TTPA 3A4NA 1U94A 1U8YA 4Q7MB 4Z8YA 2FSFA 2NPIA 2IF2A 3TNFA 1AQUA 2NIPA 5FR1A 5FOXA 3IKJA 3GCGA 4QGAA 1V43A 4LHWA 3BB4A 2OCAA 1U8ZA 1EFHA 3B2EA 2ZPTX 1PJRA 1XD8A
chains in the Genus database with same CATH superfamily
4Q5IA 1I1QB 1K68A 3L9WA 4QEKA 3V8MA 4E12A 3BD8A 5J9FA 3T3DA 3KHUA 4ZO9A 2YHBA 4Z7NB 1MOPA 4DBLE 1W44A 3DR3A 3CO5A 5BSKA 1V3TA 1ECJA 4UNQA 3SHTA 3QX9A 3GP3A 3M4YA 1YL6A 4C0AC 1GZUA 2KSQA 2W2KA 3H4TA 4YO8A 3CWZA 5DW0A 4ZAVA 2G8LA 2R7NA 2Y1GA 1RWPA 2OXFA 1H85A 4UZFA 1P4HA 1JSLA 3K31A 4TM8A 1C81A 5BT9A 1MH1A 2PLRA 4H6XA 4BFLA 3K1ZA 4DMGA 4ZPJA 4GX5A 5C8YA 1Q1GA 4GLOA 5TQVA 1XXLA 4DQ0A 4LY0A 5EFOA 1UBMS 1R8YA 4MHSA 1UQUA 1IRXA 2B37A 2B5VA 2P41A 2XUIA 3IDFA 4KK4A 4ZVKA 5BVHA 1U7PA 5L4NA 2W6ID 2E82A 3SJ7A 1VGQA 1ZNZA 3T3MB 3U60B 2GNAA 1IPEA 1IBRA 4AXXA 4CR6A 3B2NA 2QUIA 3MAJA 3KZOA 1B0UA 1M72A 3ICWA 1GCOA 3AESB 2CE2X 2PZ8A 4HQNA 1J56A 2RH5A 2G4LA 2Q3DA 5T4EA 4Q9HA 5D1HA 1EAMA 3P9PA 4PR0A 5KKAA 3A1VA 1G9XA 1DPGA 4JXXA 1G3RA 1ZUNB 4CQLB 1E96A 1TK2A 3B1YA 4YT2A 4KDFA 1OLXA 1XZDA 2WTEA 2XLCA 3QWBA 1PQUA 1LTHR 4KRXA 4BTVA 5DF1A 3ME5A 4P4LA 4LJRA 4KX5A 4XIYA 1RC1A 3OU7A 2QKYA 2V9ZA 3IIEA 1UIMA 4MYCA 4P4SA 3VKFA 5AVQA 1TECE 1F3LA 1JHAA 4FQ8A 2MSLA 5EESA 4B73A 5JFGA 1SCBA 4XWAA 2GI4A 2V3WA 3WYDA 4N9WA 2W48A 2JLWA 2HXSA 1U04A 3A06A 3CVVA 2AI1A 3QXCA 3E9RA 2G9NA 2Q41A 4K26A 2IYTA 1NSTA 4G0PA 4LE2A 2PSEA 1F48A 1PX2A 1QFSA 2BUCA 3MHPA 3ROPA 9LDTA 4BWFB 4E46A 2Q1XA 1MFZA 3KLPX 4ZARA 3BDVA 3EMVA 4M7OA 5J2UF 3WIBA 3GVHA 3PQFA 4FSXA 1JDBB 2AN3A 3IPAA 2QQEA 3V80A 2YQ4A 4YP6A 4Z7OB 4JCCA 1N7IA 3U5ZB 3Q7QA 1CZUA 1KSGA 2RG7A 4CF5A 2A30A 1XEXB 3QWAA 3CZ9A 1GU7A 5FX2A 2JARA 4X44A 4BLRA 4EA9A 4KO8A 4MA0A 1V6CA 2UZ4A 4KZKA 4IS3A 3EDMA 1W4RA 3REGA 3I09A 3NAGA 3UHOA 3DTTA 3K4PA 4QWMA 4ZPXA 5J2UB 4DBVO 4YX9A 4J6FA 4XJSA 4B82A 1NNLA 1JPUA 1JSZA 3KHKA 1P2DA 3FYSA 4GSKA 4PHGA 2IU0A 3QH4A 4BWVA 3KL4A 3IT1A 4JHLA 5CT5A 2OV6A 3EFBA 1VJ5A 3D8BA 1YVRA 1XU9A 5LQMA 4MRSA 5DTMA 2VYVD 3IQZA 2YDXA 3OE7A 1RXWA 3IA7A 4A2PA 4RHYA 4EY3A 3VHLB 2CSUA 3PHJA 1KIFA 3A2NA 3MTEA 4G1BA 5FPTA 4ETNA 2WJZB 1XDSA 5AD1A 1E0AA 5L9AA 3DULA 1HK7A 4TMKA 1IOWA 3F5MA 1MJ5A 2CDNA 3M33A 5FBZA 3FSEA 1JX6A 5ES3A 4XI9A 4U6NA 4J90A 1NU8A 1QIHA 3MWDA 2GD6A 4RF3A 4UUNA 4H3HB 1P0IA 2VK4A 4KU4A 4EHAA 3RUCA 3D4PA 1OSNA 2ACWA 3WLHA 1GR1A 3LY5A 4C03A 4RHEA 3NHAA 1P1CA 2VN8A 1YQEA 4FI3F 821PA 4QFMA 5HPYB 2D6FA 2Q5LA 3ONEA 2JD2A 1PG2A 2ZJ0A 3ZY3A 4P36A 3RSQA 5K01A 1F2DA 1R2QA 1Q2XA 4PZ9A 2NQTA 4EATA 3CFYA 2GERA 1D6JA 1T2NA 3P52A 4BUCA 4TS9A 4D0LB 5IYZF 3TLMA 1OCEA 1YS4A 4ZCTA 4P5PA 1KEUA 3LY9A 3BRWA 1U2GA 2VEDA 3FSGD 3TM4A 1G8AA 3ZJUA 1UXKA 2IYWA 1MQ8B 2Z57A 4MK4A 1UDRA 2AMYA 1JIUA 1O95D 4OJNA 4DCOA 1KY3A 1H6CA 1S3GA 2XKJE 3NOQA 4Z3DA 2OBFA 1NPDA 3M5WA 4HDKB 2G5GX 1DWOA 1G6OA 1DHRA 3CWQA 3Q5DA 5GM1A 1VXOA 4BP9A 1J06A 1T3ZA 2V1UA 1XLTA 4TQGA 3NIGB 3SPXA 2B98A 5DWQA 4BVJA 1ECLA 5HGJA 1OC2A 4LJYA 4D98A 1IG0A 1ZM4A 4Y9UA 4OGGA 3GGJA 4GUAA 4IOJA 2NU9B 1QTIA 5IMBA 3S3TA 5DX1A 3W2FA 2FN3A 3UCEA 1OWNA 1DAIA 1HBJA 1OGJA 1Z62A 1TI7A 3DDHA 1KAOA 1GA1A 1P81A 2P6PA 4MQ5A 5ELLA 4ER6A 3ETJA 2EU8A 2Q5CA 5EMNA 1GDHA 2WB4A 4PZUA 5GP1A 3S28A 1ZCJA 2GRAA 3AR3A 2ZSIA 5IVHA 1N1GA 4ZK2A 3F49S 4UQOA 4D9HA 4EUKA 3SHVA 2P5UA 4RZHA 4RQTA 5LP6C 1P33A 4CG2A 4CTMA 3KC2A 3L0CA 3EXFB 1HE3A 2IPAB 1R8SA 4ESEA 2R6AA 3PTZA 2ZYSA 3QE4A 4LYYA 3HN7A 4HH1A 4XFDA 2QNIA 1KKUA 3HL4A 4UBMA 5HBGA 3UJAA 3UUEA 4F5EA 5LJLA 3S2GA 2IS4A 1FNSA 1G5QA 3QOXA 4R54A 3WLNA 1GYQA 1B6GA 1G2IA 1JEQB 5C0OE 1PX0A 3E3LA 4YT8A 4L6AA 1EX9A 1T91A 2BGLA 2I87A 1OLXB 4D92A 2V03A 2X6TA 3G59A 4X3OA 2W11A 2NQ2C 2JLZA 1HOXA 3BJMA 2QTVA 1D2AA 2YZMA 4J0EA 2ZI6A 5TGTA 1TU3A 4LRWA 1E59A 1PGJA 1HX7A 4NQZA 4DMHA 1Z07A 2FFHA 2IYUA 3R2JA 5HX7A 3JQ8B 5ALEA 4ZEXA 1DAHA 1XAGA 2RBGA 3RM3A 1V9LA 5K3BA 4PF1A 4N3BA 3TCKA 4AN1A 1IB0A 3QQ5A 1JVSA 2Q4DA 3OT4A 1SEPA 2B8WA 3IP3A 3KO8A 4LTNA 1SFRA 2E6UX 3LVRE 1DWPA 1UFQA 2PZMA 3DPSA 4OB6A 5BMVB 1JIKA 2YH2A 2O06A 5CG2A 1XN4A 4YRTA 1FP4B 3W6UA 5A3QA 3PXDA 2ZUEA 4IG4A 4UZEA 1JSRA 2Y2VA 4GSLA 4QHSA 1C9NA 4YV1A 1W75A 3J80A 1A2QA 1U0HC 1WF3A 5GVRA 4IICA 5BY2A 1ZMOA 2XUJA 2ZS8A 2WG1A 3D3KA 3IUBA 5K2MA 2OGZA 3C3PA 3ENKA 2D3TA 3ZHSA 1E66A 4P0PB 1Y42X 4WZ6A 1W36D 2VI5A 1GPMA 4KI0A 1K5HA 5HJEA 1AJEA 3IQIX 3CH4B 4AZ3B 2E5WA 3G9QA 5DGTA 4N0DA 1SCQA 4P93A 1UBGA 2C61A 5KJFA 3KR0A 3AY7A 2GA8A 1J2EA 2HB6A 4CMCA 4F9EA 4GSYA 4LMBA 3B1WA 3A70A 4R83A 2P65A 2FH5B 3G2LA 5F1KA 1ZR2A 1N57A 2PL1A 2FK8A 1U6KA 4LV5B 4E13A 3E8MA 1F0PA 4RQUA 2YNMA 4LX0A 2C5SA 1QE5A 3F1KA 3LYLA 1TF2A 2WWIA 2JIZA 1F17A 3M3PA 2IZ1A 2P2CA 2VQ3A 3N7UA 5SY6A 3SHQA 3ONVA 3B7GA 5F21A 3NHWA 3SNHA 2PUAA 4YMTA 2HMWA 3P9YA 4JLSA 4GBED 2OD9A 3TDKA 3B1KA 4WBSA 4BB6A 3I92A 5L45A 1LBTA 2ZRHA 1M8PA 4AVYA 1M7BA 3IDZA 2FRDC 3RT1A 4YMVA 4C0KA 4I08A 3IESA 2ZB8A 3C3DA 1QPBA 2DPHA 4BV3A 4R7ZA 4H4DA 4KZPA 5HSGA 2AFHA 5FWYA 3A28A 1JHVA 4G86A 1EXDA 5FYQA 4R1SA 3U3OA 1U11A 2A94A 2ATEA 5EWMB 3RRJA 1J4AA 3HSSA 4HMPA 4YJ3A 4E5PA 2YWGA 4BQFA 4IZHA 4PPFA 2O0LA 1DG3A 1I2CA 4Q9DA 2I1LA 3A11A 4H1UA 3ZGOA 5AJHA 2ZM6B 5K6TA 4EX6A 2C3YA 5HWSA 2BR3A 1CDZA 5FT9A 4A92A 1E7YA 1VI5A 3U4IA 1JAYA 4DGSA 3W3AH 4E5MA 1ZS9A 3AG5A 1L5HB 1ATIA 2VSOA 3DHWC 1LFDB 1X1AA 4WXRA 1N0HA 2DPLA 4BMOB 1A9XA 1N9ZA 4KSYA 2B2CA 3IAM6 2YRFA 4F0JA 1WULS 1EWQA 3Q88A 1QF9A 4FFBA 4M0PA 1I4OA 2YRWA 3W5HA 1QGUA 3OHPA 4DV4B 4WERA 1FBTA 4AKTA 2XYRA 3KQVA 5EIBC 3CSUA 1HORA 2XCQA 3MNFA 3DL0A 1VL8A 5KHAA 1N75A 4X1IA 2BW0A 3DBHA 3LNCA 4JY7A 3TLAA 4HH3C 1EGHA 4NU8X 2Z30A 1TO6A 3PFNA 4CI0B 2VH2A 1Y8ZA 3UH0A 4URYR 3ETEA 3HDVA 2JI8A 4MICA 1A2OA 1VHLA 2DFDA 4G41A 5B1IA 1NE2A 3Q9LA 3DWIA 4AXBA 3RRMA 2O2EA 2IQIA 5E4YA 2J0UA 5KTOA 1XDWA 1XQVA 1XZGA 1ARZA 2FUG6 2WSSD 4XA8A 1PAUA 4N5MA 1BDIA 4NEGA 2Q0SA 3D43A 3MWFA 1O54A 2HO5A 4MVJA 5MHTA 5SYMA 1JHOA 5J4VA 1U3FA 1T10A 4N3AA 4MPTA 1OJLA 3WAGA 3GLKA 5DFAA 5IJ0B 2MYUA 4OI2A 5CYFA 3GP5A 4GKBA 2WSMA 2FW0A 4P38A 1SBIA 3RYHA 1AT1A 2GMWA 4Q01A 2YJTD 1PYDA 3D0RA 4K28A 4PIPA 4WTOA 4RDXA 1UZMA 4H27A 2HPAA 3K5IA 1GG8A 4K9SA 3OJFA 1P29A 4AS2A 1JKIA 4YAOA 2C4MA 1V95A 1JLRA 1V7CA 1TRHA 1A27A 1KOJA 1NW8A 2AS0A 4C4AA 2QP3A 4I1YA 2EX0A 4E6EA 1R0RE 2PBLA 1QUFA 4R8RA 5EG5A 3HZZA 3KWFA 1TNDA 2JFGA 5I8ZA 1XD2A 2QE7D 1W76A 2IHVA 2MSKA 3R8CA 3A6GA 1DS6A 3CPHA 3R3WA 4J75A 4LQDA 4PONA 4AZVA 2XAAA 2FG7C 1UC8A 3EXHC 4LF9B 5IARA 4NBNA 1Y3BE 3ORHA 1SD2A 1VSTA 2OV8A 4K6MA 2PKYX 1DB3A 1POWA 3EFOB 3OZAA 1WXEA 2H65A 4TV8F 2B69A 5AHRA 1D5WA 2XDAA 1DCFA 4BJ6A 4EG7A 5CYGA 3FPEA 1R5JA 3G5AA 4UTOA 1U1EA 1E1KA 1V7ZA 3K4HA 3NFRA 4FOPA 4Y2SA 1JTFA 2GPBA 4HQOA 1IM5A 2WVHA 4X1KA 5GADl 2ZQYA 5KX5F 1E2DA 2EYQA 4G0MA 1I2MA 3T15A 5C1DA 1KJZA 2C8LA 2ZCUA 4BMDA 2IOQA 1NJ6A 3RAFC 3UVEA 2VHJA 3SQMA 5E7QA 1MTZA 2DLDA 4WLVA 1TYDE 4BNUA 3O4GA 2Q21A 2CBZA 4MWEA 3FZGA 4KXYA 1B41A 3W34A 1SD5A 1P72A 2XBUA 4KFRA 4E6PA 1VIAA 2W8BA 4MB0A 2VXOA 2XZPA 3C7AA 3C7DB 3K3PA 2QJTA 4M6WB 1ZBDA 2PS3A 3EQ8A 3O2SB 1HLPA 2CLFB 2QTCA 3AKDA 4NH0A 1SIOA 5D5PA 4U8HA 5TJHA 1YONA 3EXEA 1OFUA 4P98A 3A3OA 5FI0B 3EPHA 2WJVA 5CLQA 2C7GA 1L4KA 1WXFA 4HYEA 1E4EB 2X0JA 1EFTA 4M8LA 1OYOA 2GN0A 1SU8A 1LCIA 1Q50A 4MV6A 1O8BA 4ZYTA 4XR9A 2QBYB 3O8OB 1DNPA 1KMQA 3E18A 3NR2A 2P9GA 4JQCA 4CR7A 5KVQA 2IY7A 1ULTA 3PSAA 1YZKA 3B6EA 1QCCA 3EGWA 1B6TA 4KTTE 1B16A 4QBIA 4QU8A 1OI7A 4DARA 4HAIA 3MMXA 3HRHA 4CR8A 4RELA 5KSZA 3L0OA 2WTNA 3ND8A 4B3XA 5FWXA 1F6DA 1DHTA 2ZUVA 4LXQA 2VSYA 2D1YA 1T9AA 2WD7A 4L5JA 1XA0A 4ER5A 1MJHA 1X7ZB 4OKSA 1Q44A 3K09A 1RPJA 2RHCA 4JL5A 4GL2A 4PLHA 1XTUA 2Z0MA 2JPDA 5A3JA 4OYRA 4HNQA 3HXTA 4G63A 5LSAA 1D1PA 3BH7A 3UENA 1NNI1 3DAFA 3GEHA 1N6PA 1XMSA 2JAOA 4R7TA 4OQEA 3TXAA 4NYJR 3BICA 3BUSA 1K2WA 1N5MA 3FNRA 5I5GA 3S4YA 2VP9A 4H6WA 2C7QA 4F84A 5B1HA 2NUAB 4QUIA 5JY6A 1ZA1A 1C8BA 2UYYA 4A8JC 4C43A 3IAS6 4CL2A 5MN4A 1RYHA 2ODBA 2F3TA 1DSSG 2ZBFA 4KQXA 4L8FA 1C0EA 1BDJA 1OPRA 4REQA 4LN1A 2XAUA 4XIFA 1PKEA 3I64A 2O2CA 4TN5A 3C6XA 1THZA 3KBBA 4GI2A 1C4OA 1CYDA 3F67A 4RORA 3WMWA 3DKPA 1AHHA 4P32A 4D46A 2AI2A 1M5UA 2EGUA 1IULA 3H8WA 1MQSA 1Q92A 5B3LA 4IV8A 1XELA 4R1MA 5TVGA 3ORRA 4EKEA 1ZH6A 2UYQA 2P9TA 4Q9NA 1Q74A 4DR7B 4F4JA 4JZYA 2AG1A 5KMGA 2DPGA 3RKRA 3VPSA 1IHXA 1NT2A 1M1YE 3DVQX 2H63A 3TLZA 2IHYA 4UTXA 5BUZA 3V55A 2FW8A 1KK3A 1QLJA 4KUHA 3MTQA 4F2WA 3WZMA 4YONB 2OOKA 3PNBA 2VNAA 4MW5A 2GPAA 3UC5A 4B3HA 2PV7A 2W70A 621PA 2JGNA 1TU0A 3A9UA 1XHLA 3FETA 3FYUA 3D6AA 2Z58A 3A1UA 2OPHA 5IDXA 1LY1A 3KJIA 2GAFA 5HTKA 1DC4A 2V8BA 3GWZA 4N3GA 2FZ4A 3OMXA 5FFMA 1QYVA 3KB1A 5KNBA 2CXHA 4XLZA 1MZVA 2OECA 2JLAA 3UV7A 2NPOA 5FDFA 1JMKC 5FUWA 3KFVA 2W2TA 4BO8A 2FMIA 1CR4A 2RIRA 3G9XA 3A3PA 4I4TF 3OA2A 2E4YA 3AKYA 1OROA 2A5DA 2C3MA 3I6ZA 1T43A 1V6SA 4HAUA 4WLOA 3G2MA 3OCUA 3GPBA 4D0GA 3CLSC 3T38A 1IBLB 3HI6A 2O50A 4J16C 4BE7B 1YTLA 2BSXA 5AJTA 1ADJA 4DJ5X 4DJAA 1JEDA 5IULC 1NW5A 3L07A 4CM1A 2BKEA 1S2LA 3LBIA 4I4TB 1FUEA 1HT1E 1SGWA 4WBXC 1M2FA 1A8HA 3ZNQA 4CLDA 3MB5A 1LDGA 4WA7A 2CLHB 7ABPA 4V2UA 5DTJA 3RFUA 3OOEA 3MWGA 4LZWA 5E3JA 3U5TA 1LPAB 1QHGA 2P4EA 2VKTA 1R1DA 2FUKA 2VP3A 2OZPA 3FLEA 7MHTA 1XK7A 4G4SO 3ESQA 4XD2A 2UZIR 4YJGB 3MBOA 1G18A 4RA6A 3BJRA 2A0KA 3K1AB 1BGWA 3K0FB 4DV2B 4P84A 1BD4A 1E2NA 4OFXA 4OQYA 5K3FB 3A7EA 1QCDA 1QLHA 2PHZA 2PUWA 1F2VA 4HRVA 4KQGA 3I9KA 1SZJG 1WZNA 3ZXUB 4CLOB 4AIRA 2E4WA 4CETA 4IJWA 3O03A 2VAWA 4H3VA 3AZPA 4KV7A 5DJ5A 1Q20A 1A97A 3LA8A 4Y67A 5JANA 3Q3HA 4ALNA 1TA4A 3A4LA 1PR3A 1XBTA 3KKKA 1SC3A 2FJUA 3BCRA 3DZHA 3TZCA 2RBEA 3C87A 3DAHA 5JD4A 2R7AA 2I03A 2VF8A 1SAYA 2R8BA 1IE3A 2PS9A 3TFQA 5HKKA 5KUTA 1E2UA 3WHLA 4IMPA 3KSMA 4YTEA 5C5EA 4KXUA 4XM0A 3LYAA 3HJBA 1L7MA 3KETA 2PANA 1OAAA 1R74A 2GTPA 5HK9A 1TQ6A 2OZKA 5HVNA 1XR3A 1BCRB 5E6RB 4N5LA 4ZREA 3ZDRA 4EG8A 1OXBB 4TRMA 4BYMA 2QSUA 2RJOA 1FTGA 4E1BA 4FC7A 1U31A 2G1JA 3W2GA 2WU8A 1FF9A 2BF4A 1KJWA 5KYTA 4IIXA 1SVUA 4TZKA 3AM3A 4E4RA 1GNSA 4QVGA 2HGSA 1EUCA 4P35A 4C78A 4H3KB 1OGIA 2HIAA 4I55F 4KIUA 3NBUA 5EJEA 2V97A 2D0OB 3UYLA 5CHEA 3UQYS 1ZAKA 3TQQA 1DARA 4MQFB 1UAAA 1WDLA 2PBZA 3CZQA 2P2ZA 4IX9A 1L7NA 5HQJA 4X5OA 1SY7A 4BTEA 2IPOA 1WXDA 1WBDA 3V8RA 5PNTA 3ZWMA 2Q5FA 3VYWA 2OD7A 2CDRA 2COUA 4P82A 3FOBA 4RTQA 4HDMA 4TN1A 4G0QA 2MINB 1FTYA 5DOVA 3RASA 2ARKA 3H0EA 1AKTA 3VPDA 4CQJA 3KQLA 3Q41A 4DLNA 5BVGA 4CKEA 3ZNOA 3W7AA 4A1FA 5DYWA 3V46A 2QJFA 4UDNA 1IWPB 2VNKA 4JQYA 4QATA 3RGGA 4LJ5A 3W3ZB 5BSHA 3K20A 3FVTA 3MCVA 3N0WA 4AY3A 1ZCFA 3ZCXA 1N6KA 4Z0TA 2CEAA 2UXCB 1RXUA 2FQYA 3T34A 2HYDA 1D6NA 1YCDA 3UWKA 4EPWA 2DWOA 4CG0A 5EVCA 2OT3B 1CY2A 3JWJA 3KXIA 3ZUGA 4RTKA 5HIJA 4KR0A 1QQTA 5ITZB 3LT4A 3NETA 3V1NA 4ZI5A 5DWDA 5I7HA 3O47A 4KRGA 1XP8A 2AVDA 3FW1A 1RMYA 5A2GA 3CEJA 3N3BC 1YE3A 2C8JA 4JYAB 4NCAA 1I5OA 3PGA1 3X43A 4BX3A 2WFLA 4UVEA 1Z17A 4OXYA 1YS2X 1Z08A 2DBQA 2OL4A 3KV3O 1QPZA 3E7DA 2ZKLA 4B43A 2KMLA 3MS7A 2PYZA 1QCZA 2B7BA 1ZNQO 4PGGA 5JC8A 3VHRA 1TC1A 3FWPA 2JJYA 4JP1A 3THWA 2F8SA 1ZFNA 2R62A 1HZZA 3W1VA 1M6VB 2YXNA 3AEYA 4LF5B 3LSTA 2HR1A 4CF3A 5LUAA 3LX5A 4Z4EA 2DWPA 3HWSA 5H16A 3O0DA 3OQ1A 5ESXA 5TPZA 3JTMA 3SDSA 3EVFA 4Z54A 3FWHA 4HWPA 4JJ6A 5EMMA 2Z09A 1TVEA 3PHGA 1QHFA 3AB8A 3GDGA 3GJZA 4GM4A 4UCFA 3U40A 2VNHA 2Z83A 3IPCA 3AJEA 4MR7B 5BSVA 2RAFA 2VP2A 3BJEA 3PX7A 1D2CA 4C4TA 4BLTA 4Q9JA 3WGHA 2BMVA 4XPIA 5FULA 2APJA 2OOSA 1KO5A 5DXFA 3D5QA 1YOVA 2J41A 5KVVA 1D4OA 4YASA 1E79D 1L1RA 4KWTA 4M22A 2ZSBA 4LCEA 3P96A 3U19A 1ECPA 1E5TA 3F5QA 1U0LA 1R6AA 4U3JB 4XWGA 3LUKA 5G53C 2X9GA 4C0BA 4MUHA 1PW7A 2HLPA 3LQFA 3FCYA 5CB8A 4XM1A 5K0FA 1G6HA 3CUUA 1Z7EA 3BKWA 3MWKA 4TYMA 4W5QA 3SFZA 1ZOIA 3DZDA 3O2JA 3VYTB 3IMGA 1XU7A 2XIJA 2Z98A 3HUEA 3D4NA 1OH7A 1Q57A 4XJXA 1XPRA 1MH9A 5F2KA 2CNNA 1V8BA 3K0FA 1UM8A 2PO7A 4NU0A 1VL1A 3Q6NA 1QANA 4QL3A 5AXCA 4LSMA 5U9CA 2WUEA 2I7DA 2VHVA 1YMQA 3GUUA 2GJ8A 4JBWA 2WG0A 4QPDA 1XRRA 4TL6A 3F3KA 1KI4A 1GARA 3FLBA 4GE0A 3TQHA 3KQSA 4U0KA 4IIHA 3EXHA 3STWA 1OTYA 3L8ZA 1FFXB 5A6SB 4JEHA 4OB8A 2E0IA 4KSBA 1R27A 4BMZA 3QU5A 1I2ZA 2FUNB 2Q4EA 1NRWA 3OLWA 4BO2A 3L1VA 3E61A 1Q0UA 3KPYA 4ABTA 4ZVNA 1BGVA 1IDN1 1DRWA 2QMYA 3U7HB 5AJVB 4FMPA 2P9HA 3K7EA 1Q1ZA 1B8NA 1BCRA 3FJYA 3PKIA 5E6RA 4DIUA 1UR5A 2R6FA 2GM4A 3EODA 3HYRA 3AV3A 3QKRA 4HS4A 5FXMA 4F7DA 4EG1A 1M0TA 2A78A 2I2FA 3GJ3A 3QVVA 4NU5A 3PD0A 2O7QA 3UO8B 3ZTWA 4Q24A 4Y6LA 2X0DA 3KJQA 4Q0MA 4D44A 1A76A 3BFPA 1DDIA 2M2IA 5D3QA 1L4UA 1YUMA 3CNLA 1DG1G 3ONWA 4EO4A 2VP4A 3HB1A 2A0YA 5LU8A 1CSEE 1USUA 4A1OA 2R9VA 2J9ZB 2Q27A 1E2MA 4PLYA 1UPUA 2PWZA 2XVYA 3A6JA 4IAOA 1OE0A 4P4SB 1PDWA 5ESRA 3IVXA 3G0GA 1RI3A 2AR9A 1I3KA 2O3RA 1HKUA 1ISHA 1EWTA 2QZ9A 1YDEA 5A4MS 1NYTA 5IKEA 1NY6A 1U5CA 1X9IA 2YQ5A 5E9WA 1JQ3A 5JMPA 2JJ2A 2GCPA 3S70A 4LXYA 1PT9A 4WZBB 3V2GA 4EEXA 4EI8A 4RL4A 3IVRA 3R5JA 4QPCA 2A33A 2K5UA 2VUUA 3K4QA 4BV2A 4WCFA 1M2EA 4ZOQI 1NLMA 1NC3A 3AILA 3LV8A 3PIDA 4LVOA 3WBBA 1P2FA 2QTWB 3R0QA 2XNKA 3T54A 4AROA 2Q4TA 4IL5A 1ZOSA 4WJKB 2CT8A 3MA0A 2AI3A 4S1OA 4C0HA 3HHPA 1JP7A 2QUJA 1L3BA 2V98A 1HYBA 2YJNA 4QUKA 4XUEA 4IILA 2R6GA 1FTSA 3PDHA 4N6OA 5JATA 3N2EA 5EIHA 1E63A 1PR5A 1HQKA 2Q3BA 3OIVA 3T3EA 5MN5A 3HDTA 2YIDA 3N8DA 5DGHA 5FRDA 5JSUA 4B4OA 1PP4A 1V2GA 2G9RA 2CXOA 4WK2B 1CNFA 5EE9A 4GC5A 4ZJZA 3I2IA 4Z7QB 4LGVA 4K9PA 3TOXA 4XWWA 1WE2A 1KAGA 2ON6A 3NRCA 4BVEA 3MUFA 5G1NA 1T0HB 2YTZA 4B7ZA 4BP3A 1WSWA 3M4JA 3E5HA 3G5LA 4JB0A 5IABA 4H08A 4PLFA 4C3VA 1ZO8A 1LSJA 1NE7A 4LDNA 1CQPA 2AWNA 1VHWA 2QM7A 1I6KA 2VDJA 2WNSA 1WBBA 5JALA 4TVOA 2DUUA 1Q2UA 3ZX4A 5FH9A 4Y2TA 4MR9A 4LC1A 1NNSA 3OM1A 2CUZA 1ZW6A 4AD8A 4LBYA 3IP1A 2EW1A 4JI3B 1CG6A 1QAOA 1VKJA 3OZSA 3QMMA 5KVAA 4TUYA 1U63A 2JVJA 1L4HA 4ZVLA 3JALB 4OFBA 2ISCA 5BN4A 3FLMA 3HCRA 3MCAA 3PXXA 2JCGA 3SR0A 5JAOA 5FUYA 1M3SA 1JH9A 1FQWA 1XVUA 4C4ZA 2VTBA 1CF4A 2AOVA 2IYYA 5PGMA 3T1TA 3EA4A 4E4TA 3L0SA 4ZWNA 4XRGA 5CLJA 3GLGB 3C45A 2ZRFA 2Q46A 2Z1DA 5EJ9A 2PT5A 2XVMA 3CB2A 4F46A 4HVCA 2W4IA 3ZDFA 3ZHOA 2XF2A 1N7GA 1OX4A 1DO2A 1HC7A 2ZYDA 4RFLA 3SJAA 4NBUA 1R3UA 1HDEA 3GFSA 5IBQA 3V00A 4CM3A 4DM3A 2FN9A 1KI6A 3EIQA 2M98A 2FMKA 2I6FA 4D42A 4C7MA 4FYYA 4PG5A 1PJ8A 2DUJA 1Y34E 3CC8A 3WICA 3WL7A 2JATA 3JPYA 1JPNA 2AJDA 2VHTA 3BH6A 3PNYA 4PO3X 3ZDYB 4DABA 4EW1A 1AKMA 4R2MA 1LD3A 3GGDA 4R1PA 1FYEA 2J46A 3WQSB 4I81A 2QBYA 2AN9A 2EP8A 5CPBA 4EMSA 4OD0A 2VYQA 1V45E 3FROA 5IHPA 5JFTA 1OQAA 2VPWA 4KR9A 1KPIA 4O2AA 2QUHA 2FW7A 2GDJA 4MYDA 4V0QA 3FPBA 4JGGA 3AU8A 4EUNA 2AFIE 2IPMA 2Z1NA 3QXHA 1R5NA 4EF5A 1D7AA 1YZUA 1U8CB 3OHSX 4O3FA 3DAYA 4FR0A 3S99A 3VOBA 1KNXA 2A9JA 5DBIA 3OEHA 3S27A 3UG7A 3WG9A 4D3ZA 3LFHA 1J0XO 1NJ2A 3PITA 3TG2A 1A8PA 2VZEA 2AV6A 7REQB 5B6PA 1G8MA 1L7OA 2QIPA 1B1CA 1LLUA 1TA0A 4JJ7A 2O14A 2PM8A 4OHWA 3OSUA 5LM3A 3D7SA 1XAHA 5J59A 5KOHB 3D0KA 2G17A 2HA7A 2G0TA 4LKOA 2IHJA 1T4MA 2Q7XA 3ET4A 5EZYF 4DDHA 2EP5A 4BO0A 3V3KA 1RVDA 3F6YA 4IS2A 1E2IA 5T6BA 3ZJ5A 2IYAA 3HU3A 3GLIA 2YXPX 1P0FA 3GCDA 4LA4A 4XX0B 2IZ5A 2OORC 4FSHA 2BGJA 4UM7A 2HKIA 4J94A 1W85A 1ILWA 4B4DA 3BERA 3P1JA 1KBZA 2CVHA 4KQCA 4YAIA 1UBOS 4RY8A 2Y05A 3BH0A 4FR5A 3P26A 1SVNA 3ROZA 1GA6A 1T2FA 2VRCA 2WRZA 4TQAA 1KFKB 5IX8A 1W94A 1NKSA 2VOEA 3H16A 1DAMA 3ITEA 2I91A 3PVCA 3NBXX 1E3EA 3WQHA 5J1SB 3FB4A 4RH0A 3KEOA 4X63A 2PH3A 3O9VA 4H2DA 3K0KA 4YNBA 3FDZB 1XRPA 1T34A 4ZTUB 1EUZA 3HADA 3MYRA 3FRIA 2YY7A 3UOGA 2V4UA 4JXJA 4E03A 1WW2A 2XE8A 1G8GA 3TAXA 2FX2A 3GLRA 5LQUA 2ZUUA 4IRUB 2Q5JA 1N5KA 1U2SA 2Z2YA 4ON9A 1FFWA 3FYUB 3TEJA 5AUNB 2VTBB 5BSWA 3MHTA 4PGAA 4L16A 1NX6A 1SQFA 4M2LA 5CFLA 2XGJA 4ESOA 2P9EA 1QO0D 4JI0B 5FORA 4BZQA 3DFIA 4PYRA 1IBCA 1M1YB 5LXTF 2WB2A 4GMGA 2GYUA 3WL6A 4LOLA 3CX4A 4CIVA 4F86A 2JHAA 1RKXA 4IXDA 1GQRA 2B2XA 1RZ3A 1V4VA 1E9AA 1E7QA 2WC1A 3QPUA 4ZVUA 3FDJA 2Q1TA 2XYQA 4HPWA 1NFQA 4M9SA 5DLEA 1L5NA 4ND2A 3TZBA 3R3JA 5ELXA 4OX9Y 1D2HA 3O31A 4PX9A 3QMWA 3RBZA 4CEJB 4F2PA 1E1NA 2ZUCA 1YRHA 1ODJA 3GB9A 4QHYA 1RP7A 2ODTX 4MI3A 4AO7A 1YK0A 4C87A 3ODPA 4BQNA 5JI2E 1AZWA 3R4CA 5AM2A 2XT9A 1ZMTA 1G3MA 2XQIA 5TX7A 1BNCA 2RAUA 2YWEA 4L85A 4ND5A 3J7TA 1Z6QA 1XPOA 1XMOB 1P5ZB 2GN4A 1FJXA 2UYGA 3QFSA 1RZRA 2BFCB 2L17A 4QQKA 4LI0A 1XALA 2BFWA 2JCYA 4O2AB 4AIIA 2B9VA 4ECEA 1IXYA 3I1JA 2A9VA 2FRDA 4MGHA 1BE0A 3IUSA 4HUTA 2ZWIA 4DREA 1FMTA 4N8DA 3UJ6A 5ED4A 4CTJA 2I6QA 3GR6A 1MENA 3THXB 3FG9A 3KELA 2XSZD 4HS9A 4TV8A 1OV6A 5HYVA 3ZVNA 1U2QA 3MRVA 1XQ6A 4NY1A 3L84A 8AT1A 4M83A 1NY5A 4IRXA 4K5QA 1A9XB 1RVV1 3OZXA 1C9DB 4Z4FA 2I2XB 4DIFA 4X00A 1Z4PX 4PCLA 4UREA 4V0LA 2JAPA 2FF5A 3PUHA 4H7IA 2VTVA 4NZMA 2HEIA 5EKDA 4UCXA 3TTVA 1ETHA 1JR4A 3LOPA 4J91A 4D79A 4E2YA 5BRJA 4AS1A 2FG6C 1IN6A 1VPLA 1WIWA 2C9ZA 4R8MA 3UKOA 6REQA 1CY0A 4JC5A 1UT8A 1PJ4A 2IYVA 1W52X 3EZ6A 1NULA 3JQFC 4IKEA 3HNPA 4HNGA 1XD9A 3TTYA 3U7EB 3P2YA 1A5ZA 2I2CA 4YP7A 1QV9A 1Q21A 1XLWA 5DX8A 3KQWA 4EHKA 4HNAA 4FFLA 3KP1A 4QO7A 1F0NA 4GI5A 2WW8A 2XMZA 4OJYA 1QAQA 5EXEA 1TJNA 2PKXA 5EMLA 3DC7A 3ES9A 4X92A 2O8EA 5A3SA 4P8RA 2XB8A 3CCCA 4F4CA 1Y33E 1TXGA 1SUWA 3KD2A 3LOQA 3PTLA 2GJ9A 4UC0A 4XH9B 5DYNA 3ZE7A 4AJ9A 4F4DA 3MUNA 1KC1A 5GVSA 4HXFB 5DSXA 1NVEA 1BYUA 2ZYHA 2HBYA 4N76A 4DBLC 1JQBA 3D81A 1EUCB 2J31A 1DUIA 4KK3A 4NJMA 4XVHA 3KVOA 5JR3A 1KJ8A 1XRJA 4YRBA 4PAMA 5AHKA 4RFSA 4W8HA 1ITZA 3AEZA 1EK5A 1ES9A 1OFIA 1X1EA 1YS1X 4KMSA 2ZEJA 2EWMA 2Y77A 2HDOA 4L4RA 5JNVA 2OV2A 4COOA 1ZGBA 5DHUA 1R6XA 3H9UA 3ND7A 4JP3A 1QO0A 5DSTA 4BX8A 5CEEA 4D26A 5IFKA 2QY6A 3D2AA 3KKPA 3QBDA 4P3KA 3PQ3A 1U2PA 4AJKA 5JSHA 3VJRA 1KYXA 3H3FA 1XUOA 4MQLA 2WT9A 1PFWA 4NCKA 3T9CA 2UUBB 2NTVA 4Q4JA 4R3UC 1JEYB 3OICA 2H1RA 2P1DA 3N5KA 1XD2B 4EX7A 3K70B 2CNBA 4YFVA 4CLOA 1TC2A 2FWPA 2O57A 2P4QA 5HF9A 1JG4A 4B3IA 3RG2A 2P9QA 3UANA 4CG1A 1O94C 3DEIA 1KQFA 3NEPX 5J2TB 2Y2UA 1PGPA 2C2XA 4FEGA 4QTYA 1TVMA 3VM6A 2JJ1A 3E9NA 3I04M 1E1RA 3EEQA 3MMPA 4ZAWA 2QVYX 2V54A 2XSZA 3B3JA 3PRYA 2OHJA 2RI6A 1W96A 3QEJA 3GJYA 4HO1X 1O4WA 1NQOA 3WNZA 4BB0A 3FDZA 3ZXXA 3UG6A 1Z8HA 1WKVA 2NU7A 2ZYGA 3PQ6A 3G0IA 4NYIR 4TMYA 3AJ8A 1E3JA 1A4IA 1DTWB 2Z2JA 1TKBA 4EUSA 1MC5A 1DQZA 1SKMA 2VJYA 3LPLA 5BPFA 1YQXA 3TEMA 2N42A 2IEIA 3AX6A 1KO7A 1N8TA 1IBMB 1JHZA 1Y9JA 3ZI0A 3AJRA 2XW6A 5C7LO 2UXDB 3O0TA 3VC2A 5H3CA 3CMMA 4XYBA 3JAWB