4BQSA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with adp and a shikimic acid derivative.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
169
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis shikimate kinase inhibitors: design and simulation studies of the catalytic turnover.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 60
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4bqsA00
1II0A 3CF2A 4GOKA 3KQLA 3L0IB 4OHWA 4B2PA 1G4AE 3HYTA 3AF2A 4Q5IA 5GVRA 1NNEA 5EP3A 4RFVA 4JIMA 5FL7D 1M8PA 3MFYA 1E0KA 4A0FA 1M7HA 2MSEB 4U00A 3LLMA 3E1SA 4LJ4A 5HR5A 3W8NA 1G7RA 2YC2C 1WF3A 3UIEA 3U44A 1NG1A 4OHYA 2ONKA 3EZ7A 2GKSA 2ZI4A 2IUTA 4AURA 3PIRA 5GJWC 2QQ0A 3OHMA 1NBMD 2QA5A 4EPWA 1FMLA 3R8FA 1A2BA 5C4GB 1ZYUA 1N0UA 4MQBA 4DLTA 3CRW1 1HE8B 1VYVA 1X86B 5AJZA 1ZRHA 1VCIA 3ND8A 4LOAA 4NP6A 4QC2A 3ADDA 1N5JA 3SZRA 4Q9LA 4BLOA 1UAAA 3DHWC 1Z0AA 1KZ7B 3TLXA 2VF7A 3KFXA 2G0NA 1DOAA 2FSGA 3BFXA 3BXZA 2AFHE 1TQ6A 4LWZA 4WOPA 5FTLA 5KO2A 1XTIA 1SVSA 2BBOA 1HY3A 5GJVC 3GLFB 4G0NA 1Z8FA 3HJNA 3WYFA 1NN0A 2IS6A 2J3EA 1P9RA 4IFBA 3RNLA 3TIFA 1KSJA 4NZYA 2RGCA 3D31A 1OH7A 1E2JA 4IFEA 5JCPA 3GPLA 4JLJA 2OO7A 4B75A 1NN3A 2FSFA 1DO2A 2PLRA 4P33A 1Z5ZA 2ZEJA 3TK1A 1WE2A 4NYJR 4RZUA 4DIDA 1T5IA 2NTYC 1R5NA 2EU8A 2QMOA 5CK5A 2CE7A 2ZRGA 3FWYA 2CHVA 3KJEA 4Q9KA 2J41A 2JLYA 2C98A 2K5UA 1FUKA 1X1RA 4BZXA 3CRVA 2I1VB 2CK3D 4EJSB 2C96A 3LLUA 1HV8A 2F6RA 3Q85A 2OZEA 3UMRA 3R9XA 1SVMA 2JLXA 4LHXA 2F3TA 1ZCAA 1XMJA 4ZDIA 2CHGA 3B7GA 5FL7A 3NTUA 2HCBA 1EFRA 1FP6A 2RGNA 1U81A 3LV8A 2CCJA 3FKQA 3M6AA 2R6GA 4C3ZA 1W36B 3NH9A 2W0SA 1G3IA 2O8FB 5JI3E 3AF4A 1E2GA 4NMMA 1Z0DA 1NMXA 3AP3A 4N3NA 3H4MA 4G5GA 3GMTA 5DIFA 1SVIA 3LX8A 5DN6D 4HLUA 4DC9A 4HAXA 5DN6A 2WVJA 5KPJA 4F91B 2V7QD 4H1VA 1AS0A 2QI9C 4GRAA 4BFVA 2LKCA 2ZRJA 1XCMA 2ZI5A 3KB1A 2HF9A 4BLPA 3AKDA 3C14C 2IWRA 1BMFA 2HDNB 3RSLA 2ZJYA 4KCGA 4PPNA 4RD0A 3QKSB 2F9LA 1ZC3A 2OEPA 2O0JA 3LQQA 2L0XA 3UK6A 2E87A 2ZVPX 4LYAA 2ZSFA 3IEVA 1IBRA 4YXWA 5EXSA 1XNJA 4BEBA 2ODNA 2CE2X 2IXEA 4HLQB 4CEHB 1T8UA 1E9EA 2DPXA 2PT7A 3A1WA 4AYWA 4TL8A 1Z6TA 2WAXA 1WDTA 4HEJA 1ZD9A 4JT4A 1KK0A 2QSZA 3NXSA 4PANA 4B34A 2HYIC 1DELA 1IXRC 2OCYC 4IDOA 4PQYA 2C9YA 3SU8A 4EFLA 4HUTA 1CR0A 2BV3A 3OEED 1IY0A 4KFSA 3PXGA 2O8CB 4HB3A 3ASYA 2G6BA 2FEOA 5IHPA 2WWIA 3U7HB 1Z08A 3THYB 1KK2A 2ZYVX 4BWYA 4XWAA 3RANA 3QPWA 3I1FA 3Q9LA 1MRSA 1VG8A 2E1RA 5SZHB 3N2EA 4B6EA 3MMPA 1GWNA 2GTPA 1NVVQ 2A3RA 4JLVA 2BM0A 4P31A 5B58C 1YZNA 4LBYA 3B5JA 1XTSA 3SFVA 2C78A 2V54A 2WMOB 2QN6A 5TMPA 1KMHB 2IUUA 2QY9A 1CEEA 3QF7A 1K5GA 2Q6TA 4BRWA 3ICQB 4L9SA 2YOFA 3AGPA 1XEXB 4RSGA 4GPTA 4IVRA 3Q7QA 3GEIA 4XD7A 2AK2A 5CDFE 1XEFA 2W2XA 2OSBA 3H2YA 2JJ1D 3EARA 3B82A 1QHHA 2YZ2A 2F1RA 4EJSC 2ZRBA 4PO9A 3QXHA 3R7WB 3SYKA 1P9WA 1J8YF 3AUYA 2IYVA 2VA8A 4MUAA 5EP4A 1V43A 1XMSA 1OIWA 1JQJC 2ECKA 3B85A 2IBMA 1H65A 2R6DA 3MRSA 3T61A 1KDRA 3THYA 2XXAB 4KITB 2ZXUA 4HYYA 5FR2A 3TW8B 2ZRNA 3LY5A 2HJGA 4PR0A 5JI2E 1JR3E 5H1YA 3SN6A 1KI4A 1E2MA 3CW2A 3K09C 1ODFA 3IUYA 1Z63A 3SFZA 2RGBA 3QXCA 5AUQA 2OXRA 1E9SA 1FTNA 3IPXA 3EZ6A 2BEJA 1NVUQ 4TZ0A 1U9IA 3ASZA 1E99A 4R2IA 5FOTA 5FPYA 1ZP6A 5JSZA 4C7OB 1OW3B 3QG1A 4HDOB 3SI7A 4DT1B 1CIPA 2GESA 3QKSA 4GNKA 1KK1A 3DZ8A 3N5CA 1UBGA 421PA 1S9HA 1UKYA 4TMVA 3NEYA 1B0UA 4US0R 3SOPA 2GCOA 2Q21A 3B2EA 2BMDA 3A36A 2GHIA 2ZYTX 2C5LA 3GFTA 1P9NA 2I1QA 3MJRA 3IQXA 3OFNA 1ZM4A 4TQUS 5FPSA 1AIPA 1TL7C 3IIKA 1CU1A 2D2EA 1RJ9B 1S4QA 4M9ZA 3THOA 3QKRA 3RC3A 3THXA 1UF9A 3DPUA 4B76A 2GBLA 4D2IA 4LRWA 1A1VA 1GKIA 1FL9A 3VNVA 2J7PD 3FKSA 1KI3A 5FTKA 5DO9A 2Z5FA 4ZIRA 1VYTA 3L0PA 4B2IA 2ZJ2A 1E79A 4QGHA 4ZKDA 4DCTA 1BO6A 1VDZA 2YWGA 1JJ7A 2D06A 3SBDA 3BS4A 3QE0A 4DSNA 2GF9A 4FMCB 4QGFA 1W1WA 2ZQ5A 4MH0R 2O8EB 2N42A 1G8FA 1MO5A 3UMFA 3KB2A 2ZRHA 2JGNA 4A2WA 2GCPA 1E2LA 1D6JA 4FIDA 4DSTA 1Q3TA 2P6NA 1IM2A 1KI8A 3TSWA 1IQPA 2A2ZA 2DFTA 1U0LA 3IHLA 4OI0A 2SHKA 4TL6A 1DADA 5FOUA 2EFCB 2NO9A 1CRPA 1CJMA 1FQKA 3CRRA 1E69A 3I32A 1WP9A 3K70C 3O47A 3CWQA 1VCNA 1JXMA 2YNMA 1K6MA 3G5UA 3PG5A 3TE6A 1XWIA 1AGPA 1VG1A 3E5HA 2P67A 1TUEA 1YZGA 4MRVA 2HYDA 1CJVC 1XEWX 4L15A 4V03A 4HAWA 4B33A 2PCLA 2QMUA 4D0NA 5EE5B 2XTZA 2ZRAA 5J40A 1SXJB 1UBEA 5JHGB 4OQLA 3T1VA 3A37A 4US2R 3QNUA 2GETA 1M74A 4PQRA 4Q1BA 4BLQA 1LB1B 4TMKA 4OQFA 4S2EA 3U3OA 2AXNA 2MMGA 5G3YA 3RAPR 2OUKA 5EXPA 3OAAA 2VHJA 3CIOA 1Y63A 4Q02A 2EFEB 4A0GA 4POAA 1OXSC 3LAWA 4L5BA 1VMAA 3ZYCA 3W6PA 3NG1A 3OFND 1EG7A 1SXJC 4ZIRB 3SHFA 3BJIC 1KI6B 4NDZA 4URUR 5HZKA 2HJVA 3K0FB 1CR2A 3T34A 5C46F 2GJKA 4LHYA 2ZU6A 3AVUA 4AY2A 1SHZA 1X8KA 5FUVA 1T3HA 4NKRA 2B8WA 4DXAA 4ARZB 2OCPA 3ZZUA 3FGNA 2QT1A 3IKJA 4LGMA 3VR2A 4MKFA 2V8OA 1ZD8A 4WZAE 4A6XA 2WJJA 1Q1ZA 4K81B 1UKEA 2CDNA 2IT1A 2LWIA 4OQNA 5DGXA 2G3YA 1KDOA 5E3HA 3IBGA 4CDGA 3C5HA 5DI3A 1ZIPA 5JJIA 5J4LA 1T3SA 3BH7A 3K0AB 2BWJA 2Q9BA 3AGQA 4MKIA 3ZQJA 1ETUA 1JBKA 3RS4A 5IT5A 5FPHA 4LC0A 1NVXQ 2XAUA 4EFMA 1RC8A 2J0SA 4WZBE 4TLEA 2XSZD 2HT6A 1KI7A 1DVRA 4Q7LA 4TLCA 1R10A 3PENA 2VEDA 4OK6A 2WJIA 3PUYA 3K9GA 3HYRA 2JIZA 5KSPA 2IYQA 1TADA 2P5TB 3CONA 5AJYA 121PA 3EZFA 1FX0A 2RH5A 1Z3IX 3L8ZA 4D81A 1VHLA 4KO8A 4PC6A 4F92B 4TLAA 1E1QD 4S35A 3LVQE 3NWJA 3K0EA 4RD1A 1N6IA 1G8YA 1XD2A 2Q3HA 2V55B 3REFA 4DEYA 2J7KA 4IXMA 4PAMA 4TTPA 4RKEA 2NOAA 3EZ9A 4JVMA 3UWKA 3EXAA 3DM9B 5J4KA 1BMFD 1AS3A 1KZGB 1EFCA 3PV0A 1N5KA 1T0JB 3GJ5A 5EZ5A 2E9SA 2PBRA 3KTAA 1G18A 2BBSA 4RJLA 1D8TA 2B6HA 2ORWA 1E4VA 4Q48A 4C9BA 5C4MA 4OL0A 2RKOA 5HTKA 4PZYA 1FNNA 3CKLA 3U44B 1G64A 4B47A 4DBLC 3FYHA 2QM7A 3BB4A 2EFDB 4KFUA 3WBKA 1KGDA 1NKSA 1J8MF 2P65A 1HUQA 1SVOA 1JAHA 4Q4AA 1YKSA 2FPKA 3LWNA 4UJ5A 2QP4A 2A5FA 2GJ9A 4BUJA 4HB2A 4YLGA 4M1YA 2QRNA 1XXHA 4NONA 4JLDA 4OBEA 2O0KA 4HDCA 2AKAB 1YR8A 1QG2A 3OIVA 1M7GA 4LHZA 2Q9CA 4URXR 1G20E 2JLSA 4LV5B 2AXPA 5CK4A 5CDFA 1GKUB 3B1VA 1ZUIA 2IXGA 5FPTA 1RKBA 2ZJ5A 3W3ZB 2YWHA 3SS8A 1COWD 2CVHA 2GRJA 4UKDA 4ZI2A 1EWRA 2CCKA 2CL0X 5KNBA 4XWOA 3EPLA 4LJ7A 2NG1A 2ZE7A 4C0JA 5J4VA 2HLDA 1FUUA 5IK2A 2G1KA 1U9IC 1LTQA 2NGRA 4TYPA 3U3KA 4URYR 3RRYA 4KFTA 1VPLA 5FBVB 4OHVA 4JJKA 5FFMA 4JZKA 5JWRA 3ZH9B 2QGNA 2BBTA 1TF5A 3K9LA 1L2TA 4IOLA 4X8OA 4A4DA 2VPPA 3P26A 4MGYR 2ZUCA 1KMQA 4QHTA 3AKEA 4TMWA 1H8ED 2EWWA 4IDPA 2PT5A 2BCJQ 1JI0A 2WKPA 4DDTA 4MRPA 1TF2A 1NN5A 1XTQA 1N6OA 2WICA 3AEZA 3SC3A 4D4JA 2WWXA 1G7TA 1VTKA 1LNZA 3RVBA 1R0WA 4JSYA 1AGRA 1FTSA 3CRMA 1SXJD 2ZSAA 3EA5A 4DRZA 1ZD1A 3HWSA 3KJIA 5CJPA 5KU1A 5CM8B 2IF0A 3X1ZA 4LJ6A 4NCKA 5AWFC 1CJKC 5GADl 2PEZA 3KKQA 2C95A 1P4SA 1FOEB 1UKZA 3K9HA 3CNLA 4B73A 3A6PC 4IDNA 4D4MA 4BASA 2J5XA 4GI7A 1FPMA 1UJ2A 3PR1A 1I2DA 2ZITA 4HLDA 4EPYA 1OIXA 2CLCX 2QBYB 4RZXA 4WAUA 3EW9A 5J4HA 2NO1A 5H68A 4QRHA 3QEJA 3AH8A 4YQFA 5JLJA 3AVQA 2IYXA 3T06B 1QVAA 1CR4A 1HURA 4B6FA 1E9RA 1YZTA 1P62B 2B7CA 5JECA 1S1CA 1Q12A 4US1R 2GCNA 3ZS9A 1SHKA 1RPZA 4OI2A 3FPAA 3TR0A 4C2UA 3EIHA 2RMKA 1W0KA 2W2TA 3SR0A 1BYUA 1Z06A 1XX6A 5JEEA 1G3UA 1SKQA 2VL7A 3CUEF 2J87A 3F8TA 1G5TA 3L43A 4PSVA 2GBLC 4WXPA 4B3DA 5DNYB 5HCNA 3GEEA 4PO8A 1N0VC 1D2NA 1KI1A 1G21E 2IWHA 4RKFA 2XB2A 5BYKA 3EIEA 1I2MA 2PZFA 2X19A 3NC0C 3GJ8A 1XPOA 4QHSA 4C4PA 5FL3A 2ZAMA 1P2VA 1JEDA 2JLQA 4LBZA 4AK9A 3GJ6A 5HKKA 2ZPTX 1ZUNB 4Q4JB 3HPRA 3NDPA 3BK7A 4J0QA 1H8HD 4H9GA 5DYGA 3O8BA 2XX3A 4TZ6A 4UNNA 4NYJQ 1QHSA 4M0LA 1QHHB 2YV5A 4FCWA 2J45A 4DSOA 1RYHA 4TN1A 3KX2A 3QG5A 3IEUA 1Q22A 4G5RA 4LJYA 2RHMA 4QNRA 2HCJB 2BMEA 5KYKA 1EGAA 4A8JA 1JR6A 1YU9A 4PX9A 5K8IA 2NQ2C 1NY6A 5A0FA 2KJQA 2Q3MA 2OILA 3AVWA 4D0LB 3Q5EA 3KL4A 3M4YA 5KDLA 1OB5A 3PFIA 3OIYA 3AUXA 4L8GA 3IO5A 1N6LA 2GCOB 2FEMA 1E2QA 4ITRC 1W4RA 1P61B 4O25A 4L4UA 3I5YA 1X1SA 1R4AA 3JVUA 1L4YA 2CXXA 3U5ZB 1LFDB 1M7BA 4LUCA 2DWQA 1XMVA 4JL6A 4CT5A 3WNBA 3VR4A 2FG5A 4IOMA 3EA0A 1TQ4A 1E1QA 2FA9A 1CS4C 1E9FA 4FCTA 1LW7A 3PUVA 1ZM2A 2XOKD 3VR6A 1OH8A 2XGJA 4NL4H 2IYUA 1OH5A 4PAOA 1XEWY 2QNRA 2C9OA 3FFBA 4QJ5A 4G5QA 1JB1A 1L7VC 3J81k 2IL1A 3P4XA 1MR3F 2IEYA 5DE3A 3WXMA 1E0SA 4M53A 4DLRA 1ZNWA 1CF4A 4DJTA 1ZM7A 4TT3A 1QF9A 1YZKA 2CK3A 4CF7A 3SE0A 4IDQA 4HZUA 2KSQA 1G291 4TT3D 4CYMA 3QXSA 1EX6A 5J47A 4KODA 4A15A 2GJSA 2WMNB 4N0DA 4OI4A 3TVDA 4LYFA 1ESNA 3FMFA 1P7CA 1WXQA 1XZPA 1G6HA 2OCBA 4G3XA 4WXRA 4PC1A 2DCUA 3MAAC 3A1UA 3TH5A 1XD8A 4FD2A 2BC9A 3F0TA 2W58A 4A0HA 2IX3A 4A9AA 4JJZA 1RJ9A 4W7SA 3KQUA 2P6UA 2ZAOA 1UM8A 1G6OA 1UBCA 4DLWA 4D0GA 2WJGA 3ZIAD 4ABYA 4ZCIA 4XD7D 3T1OA 3T15A 4NPHA 2QZ4A 3K09A 4XWKA 3ZLJA 2ZI6A 3VNUA 1JR3A 1NJGA 2GK7A 2FPLA 1L8QA 2MMCA 1S8FA 2FWRA 3KUCA 2RB4A 3AB3A 2YINC 5EE1A 2WPDD 5BN5A 3A4LA 4C0KA 4DHEA 2PZGA 1IY1A 2P3SA 1IHUA 1PUJA 1RZ3A 1RW4A 2ZJAA 4QGAA 4YMSA 3TKLA 1GZSA 4V0KA 3VU9A 3SQWA 1E9BA 4XIGS 2X1VA 2QORA 4CZ2A 1N0WA 1X8LA 3HU2A 2JLWA 5DYIA 1GFIA 4TQ9A 3ZZ0A 5JRZA 1DPFA 3A4NA 5SZIA 1N2CE 2PMKA 3TQFA 1E0JA 2ZR7A 1W0JD 1YQTA 2F43A 2YHSA 1NBME 1TQDA 1MRNA 3W90A 4RD4A 2KE5A 1N6PA 2V6JA 2J46A 1ZU5A 3W5JA 1E2IA 3ZVNA 1IJFA 1MO4A 1HT1E 2B92A 3I72A 2W00A 3K0AA 4L16A 4BQSA 3L0OA 4YDSA 4HDQB 2XZLA 4FMCF 5FI0B 3U7GA 4KAXA 3TSZA 2NO6A 4BZPA 2GAAA 3UMSA 2ZTSA 3ZVLA 1ANKA 2FU5C 1OXXK 4C0QC 5KSZA 1T4GA 1VECA 1KO1A 1GUAA 4AWXA 4I4LA 5JEDA 4UNQA 1GOTA 2LCFA 4FWTA 1FW6A 2GZHA 2QP9X 3ZGXA 1QBKC 2J0UB 1KIMA 2REBA 3FKSD 1OXUA 3GQBA 3RS5A 3MWKA 4FINA 1F2UA 1Z6GA 2WTUA 4BFYA 4DVGA 1U98A 2Q9AA 4LYJA 2QMHA 3KZ1E 1E79D 5BQ5A 1W2GA 3GLHE 5JRJA 4P4TA 3RHFA 3U6BA 4V0LA 2FF7A 2UZ3A 4NCHA 4RVCA 3KQKA 3SYNA 2FX3A 3VTKA 1WA5A 1KKMA 5CLQA 1LY1A 1XDBA 3LVRE 4HZIA 3ZZTA 3WMFA 5A5GA 2FZLA 1JALA 2Z0MA 4CIDA 2XNSA 2O8BA 2ZYWX 3ADKA 3IIMA 1NIJA 1NRJB 5FBWB 2WKQA 4NYMR 5JWOA 5F98A 5DLQC 1OH6A 3THWB 3HR7A 3KKOA 4PPQA 3FE2A 5FBRB 3RWOA 2TMKA 3K1JA 2IXFA 2OBNA 3D6TB 2QSYA 1D9ZA 1NMYA 3C4JA 3HPQA 4JLBA 1XXHB 1CP2A 3U4QA 1KY2A 2ZRKA 4RCZA 3TJZA 3BB3A 4Q19A 1IJEA 4BFSA 2BIFA 1DO0A 3I62A 4Z51A 3QPVA 4KHZA 2ZYUX 1U8AA 2IYSA 3T35A 2C77A 3CZQA 1N6NA 1P72A 1R2QA 5K8TA 4XSGA 1GRNA 1FQJA 4KYIB 1AS2A 3RS7A 3VR3A 2OAQ1 5EP2A 1J99A 3GLGB 2RGXA 3WNCA 4A82A 5JHHB 4B3GA 2RGNC 5G41A 3UWOA 4U02A 2XZPA 3RDPA 5LB2A 1H8EA 3OEEA 3RRZA 4MGIR 3RWMB 4G01B 3EC1A 2O5VA 4HLCA 1ZM9A 2J0VA 1R5BA 4QXAA 3A1TA 5L3RA 2OE2A 1U90A 2ODBA 1AQYA 2ZRCA 4Q01A 4QJ4A 1E32A 3WHKA 5FPKA 2Q0HA 2BMJA 1OPXA 1W36D 1XPUA 4I1OA 3AVOA 4XVRA 2LKDA 3IHWA 4LJ5A 1GG2A 2A7QA 4Q1EA 4Q4JA 3GLFE 2GJ8A 3GLGE 1IONA 3Q5DA 5CB8A 3TUZC 2FV8A 4NCJA 2NZ8A 4R9UC 1F48A 2ANCA 2WHXA 3AQ4A 3VKWA 2C8VA 2FJUA 2GDJA 3T5GA 1CJUC 4B2LA 1EWQA 3SBEA 1ZBDA 5HE8A 4URVR 1KKLA 6Q21A 4UNPA 1VCMA 4C0SA 2DFKB 3MD0A 3U61B 4WBSA 1JQLB 2H7VA 2JJ2A 1V5WA 1W36C 1TTTA 1EX7A 1T9HA 2H5EA 3CB4A 4JLNA 3TSOA 4D6PA 5G3ZA 4Q1DA 1MKYA 1FMJA 2BKEA 4JLAA 4JYBA 3I73A 4M1KA 1QRAA 2JLZA 1II9A 4IXNA 2NO0A 1FX0B 4QOSA 2EYQA 4PHTA 5AR1A 3GLHB 4Q18A 4O3MA 3PCRB 4GOJA 4CEJB 1OLOA 3HDTA 4LCBA 1S3SA 1CR1A 3OE7A 1WB9A 3PEVA 5E4FA 2VHQA 2IEZA 4D4LA 4MYCA 3TUIC 4MDFA 2GVZC 1IN6A 5AUNB 4E22A 2Q3FA 2ORVA 3RABA 2ZRIA 3CX8A 2XJ4A 1U8ZA 2OCAA 4CGZA 4QFMA 2AX4A 1G1MA 1NP6A 2G1JA 2IYRA 2ZE6A 2Z83A 4KVAA 3O8RA 1J2JA 2ZS7A 2I3BA 2QAGB 4ZKEA 1IN7A 3AF3A 1Q0UA 4A0RA 4EFNA 3B6EA 5DSZA 3UXMA 4D80A 4JLPA 1M34E 2V6IA 3QY0A 4LPSA 4EPXA 1JR3D 3ADCA 4GL2A 5AJWA 4AYXA 4ACAA 1RFLA 2P0EA 3K9NA 4IJMA 2OXCA 2W6ID 4UNSA 4DCUA 5GVSA 2PMDA 3QIAA 3U3JA 3CBQA 3T1QA 5CYOA 4IHQA 1D2MA 4KV9A 3E70C 3I61A 1E2PA 3PQCA 2GILA 1G8HA 1XMIA 2PL3A 3V00A 1T91A 5J4YA 2YJTD 1E2FA 2WBLC 3EG5A 3QVVA 5TY0A 4DB2A 1BOFA 2N46A 1QVRA 1LVGA 2EWVA 5CIWA 1XPRA 4EQ6B 4O2RA 4YMUA 1BH2A 4BEJA 4Z54A 1A5TA 5BN4A 3X1XA 2ZI7A 4Z1MD 1KSHA 4Q1CA 5CM9C 1QHIA 4C0AC 5LD2C 2AD1A 3MWJA 4E07A 1TEXA 1Z07A 1RYFA 2QAGA 3K0CC 1LV7A 3LX5A 4LV8B 4DUGA 1E3MA 2GEUA 1IN5A 1E2EA 3DZDA 2I4IA 3NKVA 2H92A 4Q00A 4MKHA 1TNDA 1W46A 2FZ4A 3OESA 4FW9A 1ZJ6A 4TYQA 4OJQA 1R8QA 3UANA 1E94E 2ZREA 4HUQB 1A82A 2VSFA 1PVOA 1W4AA 3SQXA 1N6KA 3BFKA 4EIWA 2OG2A 1W0KD 4HAZA 4Z8YA 1G41A 2ZI9A 4K46A 1MOZA 3NHBA 2O0HA 2DY1A 1KO5A 2ZIAA 2CL7X 4CVNA 4I1UA 2NZJA 5E95A 2Z4RA 1DAEA 2VP6A 3P20A 5H8WA 2O8EA 3QBTA 5EJEA 4PC3A 4ZPXA 1II8B 4DLVA 1ZMXA 1OXTA 1UDXA 2HLDD 4Q7JB 1TEVA 2YWFA 1S96A 3PEYA 2V1UA 1MABA 3C5CA 2OFWA 1U0JA 3VU9B 4FCVA 4PZZA 2RGGA 1QHNA 4I99A 4JBWA 4GT1A 2F3RA 5AUPB 4P3YA 2UKDA 4AKEA 1J70A 4RD2A 1AZTA 3I5XA 3VMFA 3R9IA 2VHUA 1NBMA 3FFAA 1UPTA 4GZLA 1NVVR 1ONBA 1S0UA 3R7WA 1AKEA 2VHTA 3F5FA 3IILA 3QOFA 2OESA 1U94A 1NG9A 1KMHA 4M1TA 2ZR0A 2GVDC 5ANRB 1YE8A 1JECA 2QPAA 2XB4A 4FN5A 4YONB 3B60A 4N0EA 2VSXA 4XH9B 1PV4A 1ZM3A 2PX0A 1G7SA 4GBMA 2AFIE 3KKNA 4P4SB 2PJZA 2OFOA 4MGZR 2WJHA 3U3MA 1I4TD 2FFAA 2ZE5A 3U60B 1AKYA 1E9DA 1G5RA 1TU4A 1F6BA 5JBQA 2CJWB 4Z1MA 4AKIA 1AJEA 2IS1A 2AK3A 3I3SR 3GJ4A 3X1YA 2WJYA 2VTKA 4IOKA 5JSZB 3BORA 4C7OA 3TMKA 1E96A 3A58B 3VR1A 4MITA 1SGWA 1RVDA 4B3FX 4BFZA 1T6NA 1JJVA 2R6CA 4PFSA 2A78A 3ZD7A 2BVNA 5HZHA 3PEWA 1QDEA 4HB4A 2A9KA 4V02A 1KJYA 4Q4HA 4GOXA 1W7AA 4RZ3A 4BE7B 3U2QA 3UPUA 3REGA 4LY6A 5B30A 3AF1A 2OLKA 1DAIA 1R8SA 1DE0A 1D5CA 1SVWA 2CNWA 1NLZA 2XNDD 4QHYA 2QMEA 3BFVA 1TUIA 3Q3JB 4ZCMA 4L9WA 2OBMA 4ARZA 5TB5A 1ZUHA 1VYUA 3VR5A 2JATA 4F4JA 1W2HA 5HPYB 5JMTA 4A1FA 4MUBA 2YYZA 3G0HA 4NYIQ 1EFRD 3THXB 2J7PA 3CM0A 1IY2A 4JVLA 3KKPA 4KXFB 1H8HA 4IW3B 1C4OA 4O0MA 5C18A 1Z6YA 1SKYE 4PQFA 3NBXX 2JDID 3A1VA 1GP2A 2VP0A 1YZQA 2YKGA 2FPMA 2ZETA 4EDHA 1S3GA 4M9SA 1T3LA 2WOJA 1CJTC 4MA4A 5AJVB 4E09A 1D9XA 3D8BA 2W6IA 2ZR9A 4FWIB 2WWYA 4FXPA 1ZAKA 1YRBA 4X8MA 4XVQA 4XJXA 2RGAA 2ONJA 4EPTA 1IXZA 4M8NE 3NBZC 4R98A 3CH5A 1N6HA 3LRPA 3H1TA 5F3WB 1SXJA 4DT1A 4QL3A 1UFQA 5LDDC 3NDBB 2V4ZA 4EKDA 2O8FA 3ADBA 3VAAA 1US8B 1KY3A 4AG6A 2FN4A 4II7A 4D82A 1R0ZA 5KDOA 4YXWD 1F2TB 1MO3A 3EPKA 3UATA 3E2IA 3BBPA 5C1BA 3B1XA 2YC4C 1J90A 3W6NA 3M1IA 4R71A 1A7JA 3IGFA 1C1YA 4C0BA 2VH5R 1M2OB 3CF0A 3ECCA 5FUWA 2EYUA 3AM1A 4LI0A 3B9QA 3R8CA 1GITA 3CPEA 4GMDA 3THWA 1DG1G 3AF0A 4DLUA 3EZ2A 5GJBA 3LO5A 2ZS8A 3LA6A 3I8XA 4NH0A 1KI2A 4FMDB 3W8RA 1F2TA 4BFWA 1P2TA 2Z4SA 3WMEA 4PPGA 2GXQA 4MYUA 1XEXA 3KXLA 1XB2A 2H8KA 2VIIA 2X2FA 2FOLA 3CNOA 3L82B 1R0XA 1COWA 2D2FA 4V0MA 5FI1B 2GEVA 2PH1A 3CPJB 3CF6R 5EUQB 3GJ7A 1WCV1 3QUSA 3NEJA 1Q1QA 4R7ZA 1LS6A 1HQYE 2XEXA 3NC1C 4DLZA 4KLZA 2NMVA 1TX4B 2IHYA 4HZUB 4JKIA 2X2EA 5CLLA 4C0HA 4IVQA 2BCGY 4WW0A 3VHXA 1NN1A 4DLXA 1OV4A 1W5SA 1HTWA 2QROA 3RRNA 4BFXA 1F60A 1VKJA 1W47A 2C04A 3MJHA 4E03A 3FOZA 1U0HC 1XU4A 1LF5A 3JVVA 3ZS8A 4NCIA 1NSFA 1P75A 1UADA 1OHHA 4EPVA 3RC8A 1R7RA 2YOHA 1LS1A 1J7KA 1GVNB 1E9AA 3LNCA 4KU4A 1R6BX 3BIFA 5KTYA 4DSUA 1Z29A 4I1SA 3ND9A 4TQAA 1II8A 4LHVA 3LBHA 1G5PA 2YVUA 1AK2A 5M04A 3RS0A 2QL6A 5P21A 4JYCA 3PEUA 3LH5A 4Q4HB 4PXAA 1E2HA 2ASEA 2H18A 5TVKA 3S1AA 2VSOA 1TF7A 5FBQB 1W44A 1Q3HA 2IYLD 1OKKA 5EE3A 5FTMA 3AP2A 3CZPA 1NIPA 3IO3A 5EE0A 2DB3A 4HUQA 3EASA 4HAYA 2XZOA 1JPJA 1S1MA 2BJVA 4PHFA 5HE9A 1XCPA 1G3QA 3I92A 3QBVA 1XP8A 4U5XA 4OK3A 2JLRA 3GLIA 1XJ0A 4Q4AB 1YR7A 3H0KA 5D3QA 3LD9A 3ZVMA 4GZMA 3IDQA 4JT2A 3TBKA 1B23P 2ANBA 2R44A 1NVWQ 2FGKA 2VYFA 3IPYA 3H84A 4GP6A 2ZSBA 2A5GA 2YOGA 5JZVA 1G3RA 3T1TA 4A8JC 3HR8A 3QKUA 2HEIA 5JS8A 4G5SA 3AKCA 4MKGA 1U2RA 1CBUA 2IF2A 3ZVRA 3PVSA 3CRQA 3EWAA 1OT3A 4PPFA 4KVGA 1O87A 1EFUA 4M1SA 1NF3A 1G7CA 4B74A 2IS2A 2IW3A 4F93B 1GSIA 2Z43A 3BGWA 5IRCD 3KFVA 4H1UA 1G4UR 3P27A 2ZRMA 5FTNA 1RIFA 3KQNA 3FB4A 5EXTA 2PEYA 3ONWA 2IYYA 3AKYA 2PJRA 2QAJA 1OHHD 3BC1A 4NTZA 1OYWA 2BDTA 5FUYA 5LBIA 3C16C 1Z2CA 3H86A 5FH9A 1XFAA 4A2QA 5L3SA 4TWZA 1E98A 3WBJA 4M9XA 2ERXA 1GNQA 1E2NA 3B13B 3VKHA 1GILA 1HYQA 4XSHA 1E0AA 4W5HA 2IS4A 3X1WA 2EQBA 1SKYB 2CVFA 2BJWA 1I4LD 1OFIA 1PLKA 2VLIA 3L8YA 1WBDA 4Q9HA 1ELOA 2X8AA 1Z28A 3K53A 4BGDA 5AK0A 2YWEA 5F9HA 1QZXA 4DCVA 2QUZA 4M22A 4CEIA 4KSBA 3X1DA 3CPHA 5DHFA 2D74A 3GLHA 2P5SA 3LW8A 2O8BB 4NYMQ 3GEHA 2BKUA 4JVSB 3GLFA 2FH5B 4DKXA 5EZ6B 2HXYA 4A8JB 4E5UA 3L2OB 4W5WA 4P4UA 3ZQ6A 5FUXA 1KHTA 1Z47A 1RRFA 2H1LA 4LJ8A 3HU3A 2AL7A 1GM5A 1TAGA 3QENA 1PUIA 1SZPA 4QBFA 3CX7A 1QHYA 4EQ6A 4EUNA 1G17A 3WRYC 2KI5A 2A5YB 1MABB 2XTMA 3NVAA 1VCOA 4RFSA 4IEIA 1Y3AA 3WHLA 2G0TA 2DFNA 3KKMA 2NPFA 4ESHA 1RRGA 4Q7MB 4OHZA 4YMVA 1OFHA 2ZROA 1JEEA 2NO7A 4OJKA 3FMPB 1ZINA 4V0OA 2FE4A 3GJ3A 3TNFA 1G9XA 3D3QA 3DOFA 1ZVQA 3ZIAA 4Y0AA 2IA5A 1O3YA 4XTRA 1E1RA 1I4DD 3RS3A 3MLEA 5IF9A 1DAGA 1ZNXA 4R2HA 1ZW6A 1Q21A 1Z2AA 1XBTA 3GCGA 4DZZA 2ZJBA 4KJZA 2R62A 2DWPA 2FMXA 1KI9A 4K8OA 1XJCA 4D26A 3DEFA 2PX3A 1CULC 2QE7D 2W6JD 1HQCA 2XNDA 3U4QB 4JLMA 1P5ZB 2GJAA 5BWMA 2XITA 4ZO4A 4V0NA 5L3SB 4ZV4A 4EAQA 2D3WA 5FOXA 1FNMA 3B9PA 2QBYA 2CMKA 4B3XA 3IQWA 3TQCA 2J59A 1OB2A 2QTHA 4JLKA 3W5IA 1KJZA 2ZRDA 2OM2A 3DKPA 4Q47A 3EWSA 1GL6A 1DAHA 2D62A 3GFPA 4A2PA 4IRUB 1G19A 1XTRA 2QP3A 1RRPA 3B1ZA 3QSYA 4F38A 4KBGA 3NBFA 2VRWA 2WSSA 1R5OA 1BS1A 2BM1A 2IYTA 1SVLA 2ZUBA 2R9VA 4MYHA 3A4MA 4OYHA 4F4CA 4LJ9A 4MYTA 4Q21A 2QG6A 2FNAA 4XVUA 1W49A 3QKRB 4TL9A 1KO4A 1Z0JA 3KDSE 4HB0A 3QXJA 2IYZA 4URWR 4DEXA 3CNNA 1QG4A 1KSGA 2P2LA 2PLFA 3I8SA 4B35A 1XJQA 4JS0A 4LBVA 3EX7C 1OYYA 2CL6X 2AWNA 2WWGA 1CLUA 5FR1A 3K70D 4B3CA 2B7BA 4KLNA 3B78A 3SDZA 2J0UA 1YVDA 2H16A 2A5JA 3RRMA 1QHXA 1KNXA 1NY5A 3W6OA 1Z22A 1E6CA 2FFQA 4AKHA 1XCGB 4BFTA 3V9PA 3GLIB 2EVWX 2ATXA 5EP1A 2O8DB 1E1RD 4CEIB 5KUTA 2GEDA 1VIYA 2DYKA 2GAOA 2N1BA 3W3AA 1ZNYA 4QBHA 4PZLA 3BWDD 8OHMA 1DBSA 4TTQA 4OHXA 2EW1A 4PHGA 4DCSA 5CJ2A 1HH4A 4UJ3A 2JJ8A 3SNHA 4LZZA 1EESA 2QE7A 2W6JA 3BAFA 3B8HA 3OE7D 4IOJA 4TL7A 4CEJA 4MRRA 1NLFA 2R2AA 2FSIA 2HUPA 2KBEA 2W2VA 2KB0A 1E4YA 3DMNA 5KNCA 5TV2A 3RLFA 3GJXC 5KSYA 4NHOA 4TTRA 3WMGA 1NL3A 4NBSA 2CHQA 1S9DA 3BD9A 4A92A 1GKYA 4LV6A 2HF8A 2BMFA 1RE0A 4KI0A 2NIPA 721PA 3ICEA 1Q1EA 4GFDA 2IC5A 2JAQA 3LBNA 3CX6A 3QPUA 2XXAA 1XZQA 2QAGC 1PLJA 4PC2A 2OBLA 2AD5A 4P32A 2WSSD 4LC1A 4KSCA 1XTJA 2F55A 5GJCA 3FDIA 4YDHB 4RY2A 1Q1BA 2ZUDA 2WJVA 5B2ZA 5IDVA 3FHCB 2D7DA 2IYWA 3KJGA 4BLSA 1IAQA 2JLUA 4F7WA 2ZS9A 1VG0B 1OJLA 1G8GA 1P3JA 3TW4A 3VX4A 4CT4B 2CLSA 3B1YA 2BEKA 4HSEA 2QTVB 2CLDX 2EFGA 2AKYA 2DFLA 3MCAA 3SEAA 1OSNA 1SVKA 1VHTA 2IK8A 4PSAA 3VFDA 2B8TA 4DB4A 3OEHD 3WY9A 2V3CC 2C03A 1G8PA 2MSCB 3X2SA 1ESMA 1NJFA 2R8RA 4OK5A 3ZJYA 1KNQA 4TYYA 2MSDB 2O8CA 4YC7A 1GDDA 1A4RA 2AWOA 2ZU0C 5CYPA 5D3MA 3AP1A 2G88A 1EFTA 4RD3A 1X3SA 1KK3A 2QGZA 5BYJA 4LSGA 3S1AB 2GXAA 4W5JA 1U8YA 4NE2A 1KO8A 2VF8A 5FTJA 3TUJC 4AC9A 1IXSB 1NLYA 2FFBA 1YR9A 3Q72A 2ZRPA 4TMXA 1AZSC 1UBFA 5ELXA 2NPIA 2QPTA 2J9RA 3QF4A 4C2TA 4NCNA 1NKTA 3L0SA 1JNYA 5E7MA 4BRUA 3P32A 4LYHA 1TPZA 3AV0B 1K8RA 1N6RA 3BOSA 3OF5A 3VKGA 1GL9B 5KOYA 1M6NA 5TDHA 2C9CA 4B71A 4RFSB 4ACBA 3C15C 3A1SA 5E7IA 1WBBA 1YJ5A 2JJ2D 4Q9IA 4D4KA 2A5DA 2WIBA 4XTCS 1TMKA 4U7DA 5F2EA 3DDCA 3K0FA 2GZAA 2XTNA 3N2IA 1XXHE 1OIVA 2H17A 2P6RA 1KJWA 4TLDA 1K5DA 5FBLB 4BFUA 1WMSA 4P0TA 4BLTA 3SJAA 4ZI3A 3K70B 4ASUA 1GRRA 1DG3A 1OFUX 2OLJA 1P6XA 2V9PA 3HP1A 4IKEA 4M9QA 2QPOA 3QJYA 2WPDA 3IBYA 3OAAD 3ZD6A 4DLSA 3KJHA 3LBIA 4JMPA 2QM8A 5SZKB 5FOSA 2ZRLA 3QF4B 3BH6A 4JSTA 4WZ6A 3LFUA 3KQHA 2PCJA 1ZU4A 4OQXA 2IHBA 1Z6AA 1A2KC 2FFHA 3U3RA 1W5TA 4Q1AA 3PJRA 4W9MC 1EFHA 5CIQA 5DISB 3UG6A 3NHAA 2JASA 1FFHA 4AIIA 2ZE8A 1W4BA 1W4CA 2R6AA 1MT0A 2F43B 4OI1A 1Z0FA 5EQTA 4TYNA 2OT3B 2EFHB 2JEOA 3FHOA 5J5CA 4JVNA 1YZUA 2VQSA 1MH1A 4M4SA 5C2JB 3TGPA 5LD2B 4BECA 1PZNA 3SYLA 4TYWA 4TSFD 5JFGA 2FDCA 2VBCA 3BB1A 3AVTA 3HU1A 3CWZA 1CKEA 3QXXA 3QKTA 4QNMA 4CEHA 1UEJA 3U7FB 2CNWD 1N25A 1FZQA 1US8A 5D3MB 1ZCBA 1KDPA 2F9MA 3DOEA 3EC2A 4Z8XA 4DDUA 2GZDA 4M1WA 2Z6VA 3TVTA 3R9WA 1XTKA 4JL5A 5DI9A 4C30A 521PA 2JCSA 2XSZA 1SXJE 2CJWA 4N1AA 4ZCLA 1ZIOA 2ZANA 3F3YA 4ZDKA 4M21A 4IEEA 1YZLA 4OKSA 5HKKD 2GK6A 3Q7PA 3C7KA 5KNDA 5A4JA 2RHDA 2F1IA 1OE0A 4JL8A 2JDIA 4LJAA 3DL0A 4MGKR 4QBGB 3I4LA 3OIWA 1EK0A 5B64A 2DR3A 3EIQA 1S2MA 1DEKA 2G77B 2JJ1A 1AM4D 1HA3A 4B48A 1P60A 2RAPA 2RGEA 2CCGA 3BH0A 1F5NA 4LHWA 3O8DA 3JZMA 3ZDQA 4B44A 2Y8EA 4Q9JA 3G82C 4UXHA 2ZI3A 5L3VA 3TR5A 4G5OA 3TAUA 2O52A 4QGGA 2JLVA 5JJLA 4M1MA 4DLYA 2FGJA 5JCZA 5UKDA 3WP1B 1E2KA 1YR6A 2WIAA 4QKQA 4FI3C 4EJSA 2VHCA 4DDWA 3BE4A 1D2EA 5KDDA 3U6KA 1HE1C 4MDEA 5E7JA 2ZM5A 1PJRA 4UNRA 5LB4A 1FP7A 3NH6A 3LXRA 1HT2E 1U99A 2W0MA 3FMOB 3K0CA 3PUWA 3PUXA 4Q66C 1UKVY 4ZDJA 2J1LA 3QVUA 2OV2A 2GF0A 4D25A 2DBYA 5F9FA 5L8VA 2R65A 1AA9A 3DMDA 2JA1A 3CR8A 4P4SA 4TSFA 4DWJA 4HATA 2AHOA 1DS6A 621PA 3BRWD 1Z6XA 4HAUA 2QT0A 3UKDA 4MRNA 4JKYA 1DTSA 4X8LA 5G40A 3WNDA 2ZSEA 4XOIA 1MV5A 2WWHA 1Z83A 2QQEA 3W34A 1NI3A 3KXKA 4A36A 1P73A 3DVLA 4ON9A 5EUMA 2ZRFA 5AUOB 1XD9A 2D7CA 3JZAA 2AR7A 2QENA 2BBWA 2ODEA 2KBFA 2ERYA 2ZJ8A 2VP9A 1YHNA 1Q57A 2F1HA 2WWFA 1DAFA 4PHHA 4QBIA 4IDHA 3DKVA 4F4IA 2BOVA 1BYIA 1UEIA 4HLUC 1PLLA 1DAMA 5CITA 2OFXA 5FOWA 3A8TA 3PUZA 1GAJA 2PZEA 5H70A 3AVYA 4GSYA 1ZNZA 1SULA 3FTQA 3FMIA 1BIFA 3LQRA 3ETLA 1DAKA 1R0YA 3RYTC 1KTVA 5SZJA 1Q20A 4QJ3A 2WZQA 1T0HB 4PAQA 3GLGA 1AN0A 2DHRA 3V4RA 1IOZA 4FMDF 2GXUA 2CEAA 2FSHA 2VP2A 4O2LA 3W9YA 5K8LA 1GRQA 1X8JA 1CRQA 3N70A 4IVPA 1E9CA 4Q7KA 2GNOA 4FMBB 3Q8XB 4Q4LA 2OHFA 3VX3A 4X8HA 5KSOA 2O8DA 1Q44A 3C41J 4JLOA 1JAIA 1KAGA 4MRSA 4AG5A 3OEHA 4CRWB 1GNPA 1KSFX 2QU8A 1W0JA 3QEOA 3C8UA 2HV8A 5DI3B 4AYTA 4KBFA 4BLRA 2HT1A 1KO7A 2WKRA 2GWHA 3SHWA 1G3MA 4GDFA 4LBWA 2WV9A 1KAOA 4ZDWA 2RCNA 2V7QA 5TARA 5BN3A 4JBYA 3K0SA 3B1WA 4YMWA 1HEIA 4TMZA 2IUSA 3P1JA 4M2LA 3LDAA 3DM5A 4KFRA 1X6VA 5HCIA 3SJBA 1NSTA 4A6PA 1NMZA 3D7MA 4LK2A 3SJZA 4C0LA 5JS7A 5CB6A 1EXMA 2UZIR 3LW7A 1JPNA 2ATVA 2D4HA 3GP8A 3RSOA 3VQTA 3CO5A 2ZJZA 3P4YA 3PITA 2X77A 1CTQA 4WA7A 3UG7A 2UVQA 1KOFA 1XF9A 5EXXA 5AJXA 5KPDA 1KI6A 1VG9B 1VIAA 3R20A 3MWYW 4UXJA 2C99A 1AQUA 4YMTA 3QI2A 1T8TA 2ZJOA 1T5LA 4JBXA 4AD8A 3NBYC 821PA 2WOOA 4KYUA 1M1YE 4PC7A 2OAP1 4WVFA 5LPNA 5JJKA 4Q1FA 5B57C 4RZ2A 2WM9B 2XOKA 5G53C 3VHLB 3V4FA 2ORIA 4AKGA 4LDJA 3KXIA 4DCNA 2W83A 3GFOA 3CR7A 5BXQC 2AN9A 1P2SA 3FHTA 2BHRA 4URZR 4QM6A 3EPJA 1JXOA 3AVVA 1G16A 4I1VA 2ODWA 2WSMA 3SJCA 4HI0E 4GP7A 2VP5A 3TAHA 4ASUD 1TU3A 1RRCA 4V0ME 3IIJA 2H57A 1ZC4A 2DWOA 2KWIA 4QG7A 1W48A 3OZXA 4ILEA 1SQ5A 3K8YA 4B32A 1LF0A 1Z0IA 5BW8A 1N3BA 2F7SA 3GJ0A 4BZQA 3EPHA 1BKDR 2JIZD 1KYIA 2REOA 2G9NA 4RCYA 4GMXA 3CH4B 3AVXA 5DH9A 5K8UA 4RD6A 4NU0A 2GXSA 4DIEA 5IK2D 5L3QA 4QM7A 1E2DA 4HAVA 1UDWA 3WYGA 1GL7A 2QTFA 4TLBA 4OQMA 2G83A 3EAQA 2RGDA 3MSXA 4I81A 3KTAB 4WIAA 3KUDA 3GD7A 3RS2A 4M1OA 1Z0KA 1OF1A 3MGCA 4LX0A 3MWLA 3TRFA 4B3BA 3GLIE 4ERNA 1F2UB 2QEQA 1YRAA 3T5DA 1L4UA 3FVQA 3MG9A 2WAYA 3CLVA 4LPKA 2ZSDA 4NYIR 2C2HA 3OIUA 3WP0A 4DDVA 2VP4A 1TQ2A 1GIAA 4G1UC 5KHOC 3DO6A 2QRZA 4AI6A 2REXB 4PO1A 4Y0VA 2XJ9A 2WWWA 5EE9A 1F3OA 4Q03A 2F1JA 1OXVA 5DHAA 3U7EB 1XD2B 221PA 1DARA 1IN8A 1WQ1R 2A30A 4CW7A 4BPBA 2HXSA 3WRXC 4B43A 3AVPA 3MUFA 2R6FA 3BERA 1WRBA 5FOVA 5TXGA 4UQOA 3T12A 3QQ5A 1IN4A 2J0QA 5L3QB 2VO1A 4PSKA 4DUGD 1KDTA 4TMTA 2CBZA 3NIBA 5JWHA 1OFTA 1OKKD 2B21A 1C9KA 1N5IA 1N5LA 2ZVQX 1MO6A 3O8CA 2V1XA 3WYAA 1CXZA 1XRJA 1QHGA 4EPRA 2GA8A 3M0EA 1GNRA 3LXXA 4ESVA 4PTLA 1P2UA 4UXIA 1GTVA
chains in the Genus database with same CATH superfamily
4UTZA 3SS7X 3G1WA 2G25A 3CF2A 4B6JA 3PXDA 3FZNA 1YS7A 3IPCA 3UO8B 3KQLA 3W5AA 1G4AE 1PKXA 2QF7A 3RS8A 3K6SA 1U7PA 3GG2A 5G0SA 4H3VA 4NK5A 4FE4A 4Q5IA 1G9TA 1TZMA 1BX3A 1M8PA 2OHOA 4BQRA 3AYZB 1E0KA 3M70A 4DA6A 2IU3A 5P8WA 3TNYA 3LLMA 5FA8A 1VPWA 1WNTA 2ZZNA 1CUHA 3FCXA 5F3DA 3SWWA 1G7RA 2P4SA 2QLNA 2YC2C 2PBZA 2Q6VA 1KRWA 1AF4A 3UIEA 1GUFA 1C7FA 3FVWA 4FYXA 3TSCA 3EZ7A 5EIBC 1J39A 2GKSA 1LRKA 2YNMC 5A3VA 2IUTA 2O50A 4II3A 4UHCA 1V25A 3PIRA 5HQTA 2HMSA 3OHMA 3E61A 2G40A 1NBMD 1RWQA 1XZNA 3IC5A 4MKRA 4LZPA 1J07A 1ZYUA 1N0UA 2ZWMA 2JI9A 5IJ0B 4RHXA 1HE8B 1RABA 1U2GA 3X2FA 5HXAA 1Y5NA 1X86B 1MIHA 4PGHA 3ZIDA 1X94A 4C78A 2F3PA 2NTJA 2WIKA 3DE2X 3PXUA 3R6WA 1J0CA 2XMCA 4HXFB 4QC2A 2YN0A 3NTQA 4ZO7A 5JC8A 1N5JA 3ZNPA 1WDWB 4IZOA 4DIBA 4ZMBA 1XLTA 4MGEA 4YJFB 3DHWC 4WGFA 3N8KA 1E59A 1JIIA 1MG5A 1C29B 1VLMA 2JS7A 2PFGA 2G0NA 1DOAA 2VF7A 3TLXA 3AW9A 4TV8A 1JZQA 2OBBA 3N0WA 3NPAA 1OU4A 1WS6A 3UTCA 2R8YA 2BBOA 3L6OO 2Q5OA 4FW8A 4C04A 3FYTA 1NFQA 2HLNA 1HDOA 1Z8FA 2J5QA 5FX2A 1BU5A 2Q5QA 3QEBZ 2Z2KA 4IFBA 3UOGA 3IVXA 4IILA 4CN8A 1N36B 1DAOA 3DEHA 3RNLA 2GEBA 3D7KA 2FJ0A 2PMFA 5E0KB 2GT1A 2I2FA 5JCPA 5JASA 2XVYA 2J9XB 3D7NA 3PPVA 1JEJA 4AWAA 3P9KA 3NM5A 4NBLA 4ZVQA 1F4VA 3UK7A 2ERCA 4TKVA 1N0IA 1FYWA 3P4UA 4P33A 3M2PA 3ZUPA 4NYJR 4KDEA 5GM1A 3ONVA 1L1QA 4TKLA 1U1EA 5DM2A 1A5SB 1AY0A 3OTQA 3GEPA 4CCYB 1CEQA 3KJEA 4KE6A 2BE7A 1LSSA 2J41A 4OXIA 2C58A 5D8DA 3V8BA 4BZXA 3OHPA 2QVYX 2E37A 4KW7A 1WUYA 3N07A 4QATA 2F6RA 3V2GA 3HO8A 3Q85A 3UYLA 3UMRA 2R48A 4IH1A 4F60A 3R9XA 4BBPA 4LHXA 2F3TA 2ZVJA 1P0FA 4P38A 2XNHA 3CGWA 2CHGA 5FL7A 3ABZA 1DWQA 1EFRA 2DH6A 2G08A 2RGNA 1B8PA 4OF4A 3WFJA 5EY5B 3KVNA 1JIVA 2VDVE 3K9CA 3COYA 4MK4A 4Y30A 4ZV7A 3NH9A 2Q50A 1RXUA 1THTA 1ZJYA 2O8FB 1Z7WA 4J6FA 1V4NA 3OUTA 4RQAA 1L5RA 2Y05A 3GVXA 4E6PA 3AP3A 2I8CA 1PZFA 4BVGA 1NLMA 1J2TA 5DN6D 4FHEA 2ZIVB 1IQ0A 4ERXA 5KTTA 2J5RA 4C6HA 2JJYA 3FGZA 2I7XA 3X1KA 2G4CA 2RARA 4O4JB 3OX3A 1AS0A 2JI4A 4MPDA 2QI9C 2O8VA 1KWGA 2LKCA 4J1TA 5FYDA 1U0NA 3AR6A 2QTLA 4CL0A 2ZCJA 3KB1A 4C29A 2HF9A 3GGOA 4BYGA 2IWRA 3RSLA 2ZJYA 5D5QA 3AONB 1M9NA 1QX3A 5IT9A 5ALDA 4KCGA 4DXHA 2JGMA 4RD0A 5BV7A 5BSTA 2H1FA 3DJFA 3EBOA 4R5MA 2O0JA 4AJPA 3ICVA 1TVKB 3C5VA 4HRYA 1PDOA 1M2HA 1Y3DE 2EBHX 2P3LA 3DQZA 3CNHA 2QUIA 1GEGA 2BFPA 3FPJA 4I2VA 3OT1A 4PINA 3C6MA 3NNNA 1GRVA 2PXXA 2I62A 1P9OA 5BQOA 2ODNA 1UK7A 4HLQB 4MVJF 4MLPA 4BO9A 5JISA 3I42A 3ROPA 5GOZA 4NNOA 3H5TA 3IAXA 4I36A 4X7PA 3A1WA 3PJFA 1Z6TA 2WAXA 2H1SA 4I55F 4BRSA 4MCIA 3JASB 1WXDA 2WYOA 4WN9A 5EJAA 4PANA 5JPIA 2HYIC 1JJFA 3OIFA 1VJ1A 5GGYA 2HN9A 3FLAA 2OCYC 4C6SA 1JDSA 4Z9FA 4PQYA 1SXQA 2C9YA 2RBKA 2RJNA 1CR0A 3BRQA 4HUTA 2BV3A 1TJ3A 3OEED 5ENZA 2QX4A 4ZEVA 2O8CB 3COVA 8ABPA 4DV0B 2FEOA 1OBFO 3A9SA 4MUHA 1CUZA 1Z45A 3THYB 1QIJA 1DO8A 3QPWA 1USIA 2J9ZB 4AG5A 5EKSA 1VG8A 2OCGA 2IV3A 1Y6JA 3N2EA 4JYZA 5IN5A 2IZ7A 2EZ4A 1XV5A 1WPRA 4JLVA 4AJNA 1SPBS 2GN2A 4C1NA 4H16A 1J8VA 5LQUA 1XTSA 1GZ4A 1T6ZA 2WMOB 4FJ2A 4OL9A 5TMPA 1KMHB 1PBTA 5AICA 1Y82A 2XBUA 3GDOA 1P81A 4PW0A 4TM8A 1K5GA 2QRJA 3BD6A 4ZQBA 4C6TA 3L1UA 5FJJA 3ICQB 4OB6A 3DYVA 3UAGA 3U7QB 3I01M 4KWHA 4RSGA 3ZX4A 3R6LA 4UREA 4UM8B 1EXNA 4XD7A 1BGXT 1XEFA 4TUYF 3UK1A 5GIOE 2A1IA 3A6EA 3RTCA 2JJ1D 3B82A 4M49A 3FI0A 4Q7EA 2HC9A 2ZRBA 1QIKA 4P54A 1RLIA 2R5FA 5F3RA 1C3OA 1WF6A 3COSA 2F00A 2EIXA 3AUYA 4QUEA 3UMBA 2FZKA 2WD7A 2A14A 4MUAA 4QDUA 5J59A 3UGQA 1PZMA 3BTSA 1V43A 1JQJC 1A72A 3ZUGA 3MRSA 2BI7A 3B89A 2R6DA 3C98A 3NRCA 1OX4B 3ON5A 4UDXX 3THYA 1G5IA 3C3EA 3KVRA 4ZVLA 2ZXUA 3HCNA 4HYYA 5FR2A 5IF3A 2ZRNA 3UW1A 5JI2E 2H1VA 5H1YA 3SN6A 3OZIA 1S4MA 4HWOA 1KFEB 4O4IB 3IUYA 1XZCA 3MBOA 5D7NA 1L5YA 2MHCA 5E9AA 1ZO8A 4ZD6A 2RGBA 3QXCA 5AUQA 2WTBA 5LYJB 4RK6A 1C9DB 1VJTA 1L9KA 4XUDA 4G4SO 2BEJA 4TZ0A 1U9IA 2W7TA 1JA1A 5FPYA 2I4OA 1OW3B 3DEYX 4NBWA 1LZKA 3E9MA 3FUUA 1P91A 3AI7A 1RTTA 4GNKA 4GC9A 4W63A 1FFGA 4ZWNA 1CDZA 1UBGA 5IMBA 421PA 1LV8A 5HA5A 1L5SA 4C5CA 4IV8A 1FQWA 2R1ZA 4E5PA 1R6DA 4J0FA 2R00C 3NEYA 2ZIWB 4GXTA 1GSHA 3HJGA 1UC8A 4P4NA 4QU0A 2ZG6A 2GCOA 4U2BA 2Y6VA 4Z7NB 2GK4A 4WBNA 1HEYA 2IHJA 2VF2A 3GAAA 1AC5A 1L4KA 1J5PA 2C61A 1F2DA 1KGSA 2WTXA 3WQRA 9LDBA 5JZSA 1Y4ZA 1RHUA 3MJRA 3IQXA 4OUDA 3OZVA 4ZCQA 1RJEA 4GH5A 5CAEA 1UXHA 3K92A 3MJVA 5JZOA 1EUDB 1HMPA 1RKXA 3R7FA 4M3NA 1UFKA 3PQ3A 4PQEA 2P79A 3DWIA 1RJ9B 4M9ZA 2B8EA 2O7SA 3RC3A 4CMHA 4E5NA 2P4QA 2OYCA 1UMDA 3NIFB 1QRRA 2HSWA 2HK6A 1GKIA 3G59A 3VNVA 1BCRA 3FKSA 2NSJA 4LCEA 2BZ1A 5FTKA 3RUHA 3R3YA 1OCEA 3U80A 3G49A 5JSKA 3PNPA 4HN4B 3TZEA 2PG3A 2XMGA 3V2IA 4QGHA 4XEHA 3DVSX 4ZKDA 1C7QA 4DCTA 1VDZA 2YWGA 4WLFA 3SBDA 3QE0A 1PSZA 5K0NA 1EVEA 1C80A 4FMCB 2IVFA 3BREA 3PGKA 4OYYA 4QGFA 3U37A 4CMCA 1G8FA 4N39A 1K8YB 3KB2A 4UE3S 4W5RA 2ZRHA 3I04M 2JGNA 3O95A 1SQ6A 3NYWA 2GCPA 1IMJA 1ECCA 4NQRA 3NWOA 4NZNA 4C89A 1PJQA 1QLWA 4R16A 3TSWA 2DFTA 3O1JC 4EF6A 1UPFA 1U2GC 3PGMA 2R85A 2SHKA 5EQJB 4DPMA 1JHMA 5EMHA 5K0EA 5DXJA 1E3WA 1NURA 2EFCB 2O4CA 3DUWA 2NO9A 4ZAVA 1CJMA 2C1XA 2OFPA 1BWPA 2PVCA 3BQ9A 3CRRA 2ZSJA 3F9IA 3HZHA 1OAOA 3I32A 5BOVA 1KRHA 3PXCX 4MLCA 2GD1O 3DMGA 4K9PA 1E64A 1JEAA 4DZRA 4PZAA 3G5UA 5LNK6 1W36D 4YROA 3E5HA 1TUEA 3T7AA 2C5SA 4MRVA 4X93A 3FPSA 3WR5A 2NVOA 3BF8A 1J09A 1XEWX 4BO1A 5MDHA 5DLDA 4V03A 4HAWA 3DF9A 2QMUA 3JSXA 1HR0B 1ZN7A 2QLFA 4BQEA 3SJ7A 4YJHA 4P4LA 4JQYA 3ZPXA 5J40A 1UBEA 4I6JA 2Y27A 4BNLA 4US2R 2HNKA 5ECWA 4PQRA 4XB2A 4NBUA 5FXMA 1KVQA 1LB1B 4RMHA 2AMLA 4OMCA 5DBEX 5A71A 4BV8A 4F6RA 5LP1A 2C59A 4TMKA 4OQFA 3B70A 1H2ZA 4S2EA 3WLNA 1Q2UA 5C7YA 2I2DA 1GGHA 4QPJC 4YRNA 4A0GA 4JZYA 1DKNA 1OXSC 3F6YA 3K16A 3LYUA 3OOSA 3W6PA 1HYGA 2R6ZA 1RZRD 2FFJA 1KI6B 2AOWA 3T34A 2P11A 5EZYB 5C46F 1RZRA 3K4HA 2NXWA 2H9AA 2HJSA 1VI5A 2ZU6A 1OBCA 5AVKA 3RD5A 3I9MA 1GQ2A 2FXIA 3WE7A 1T3HA 1QOZA 4KQIA 5HIKA 2IYFA 1YVUA 5EMNA 5BSUA 2B8WA 3OKCA 2ODQA 4HN2A 4DCGA 1EX9A 4UU7A 4MYSA 4J94A 2HHJA 1WDLA 3DDOA 1F4PA 1XK6A 4BTEA 1Q7TA 2QTBA 1C4WA 3ZZUA 4ARZB 2I4TA 2QT1A 3DLPX 2CNLA 3ZTYA 4ZJPA 1L8OA 3FETA 3FPEA 3LUFA 4CQMA 4YT8A 1ZD8A 4RGBA 4WZAE 2WJJA 3JW8A 4PWZA 5AI8A 4ZK6A 1TIKA 2CDNA 1J0DA 2G3YA 3NDIA 1UJCA 5FWAA 4GW3A 5I4IA 4N8SA 1E5DA 4XDGA 1OLXA 2K2QB 3BH7A 3HJRA 1VOTA 4GLJA 1M2EA 4JI5B 3H19A 3M5CA 4MKIA 4TXNA 1FXWF 2WU3A 1JMKC 2FI1A 2UUPA 5FPHA 4LVCA 1NAIA 1VHDA 1NVXQ 4E15A 2B9VA 3S40A 1P1KA 3VOSA 3DE4X 4Q3OA 5C8DA 4TLEA 2HT6A 1KI7A 1DVRA 3EDYA 1R10A 4F97A 5CP8A 3T54A 5DLEA 4YGXB 5ED4A 4O4LB 3T9CA 2JIZA 5KSPA 2Q29A 2WD9A 1OUMA 1RQXA 3CONA 3CLKA 121PA 5AJYA 4CU5A 5F7ZA 1T34A 4KO8A 3WLOA 2CFCA 5HJ7A 1T1EA 1VLQA 2H07A 2J9YB 3PSHA 4YRIA 1Z2DA 4OHBA 3GARA 4TLAA 1YR3A 3L49A 1NV9A 1JJBA 3LVQE 1Y8AA 2X3FA 1SU4A 3NWJA 4RD1A 1EB9A 3JQFA 3A1CA 1O97D 2B3DA 3GWGA 4OM8A 2E4YA 2QR5A 4R3NA 4UASA 4DEYA 4FYKA 3OQHA 4PLZA 5A04A 3UH0A 3SYRA 3DM9B 3IT3A 1BHO1 1T13A 4MAMA 1KZGB 1GUYA 3AL3A 1WM1A 5DCLA 5DWVA 5JY6A 3BZWA 3K20A 4RTQA 1ZXLA 3PNQA 1EVLA 5C4MA 1GPNA 1NQ5A 4B7AA 1CUYA 1IEXA 2EJWA 2H6EA 4GU5A 1TRKA 1FNNA 1WB5A 1FIUA 3L7JA 2ES4A 2PRSA 2G4VA 4EYQA 1U8EA 1Q19A 2E4ZA 1YRHA 3KZOA 4C06A 4KP7A 2OO3A 3IMGA 4B47A 1IK4A 4FCCA 3AZPA 4JX9A 2QWXA 4MQEB 1BD4A 3BB4A 3WQBA 2ZYGA 3KBBA 2P9EA 4KFUA 3WBKA 2JC3A 1KGDA 2P65A 4PZ9A 1HUQA 1SVOA 1CIVA 1JAHA 1YKSA 4MNTA 3QVTA 5EC8A 3FF1A 3NT5A 4UJ5A 2A5FA 1USUA 3D7RA 4YECA 4KLCA 4ETMA 4YLGA 4P2GA 1L1FA 3HI4A 4KN5A 4M1YA 2QRNA 1YE5A 4NONA 3SZGA 4ETWA 5BN1A 2QD1A 3I8OA 3NASA 1QR6A 1JG7A 2XQVA 3IV6A 4G4GA 4LNUA 4QT4A 2AKAB 1WJGA 2ZYDA 2YW2A 1V6AA 2Q9CA 1JA9A 3B3JA 3DUFA 3RE1A 5FP0A 1G20E 2XZTA 2JEZA 2JLSA 4NY1A 5CJJA 2R1VA 4U9HS 1L7PA 3N3BC 5CK4A 3ZHCA 1KH3A 5FPTA 3U56A 2OAGA 2OV1A 3CR3C 3FM9A 3CBGA 3W3ZB 3AY7A 1XKXA 3H8JA 2YWHA 3LUKA 3OZCA 4G23A 4R7GA 3QITA 3SS8A 4DUZB 3CW8X 2P8JA 4LY0A 3E22A 4MAFA 1EGVB 5AKKA 2B2NA 2B83A 4FFNA 4JB3A 4ZI2A 2HSJA 1TA0A 2O1SA 5JO0A 1T43A 2FMIA 4BFLA 2H51A 2SKEA 2QN1A 3QGMA 5CDHA 2HLDA 1FUUA 2G1KA 1U9IC 2XMDA 5GZ6A 3CB2A 4TYPA 3W6ZA 3CVXA 1QU3A 2VOJA 1JHAA 4XYBA 3P9ZA 4H6PA 1E2UA 1M73E 1TCUA 2PRKA 4JZKA 1JXAA 3UT5A 5KQPA 1RHJA 4QEDA 3OOYA 1PF7E 2BBTA 2OYSA 5DP2A 5AP9A 4G5HA 5ICFA 1KDYA 4TQGA 2VJQA 3U19A 1QAQA 1L2TA 3Q2OA 5FOQA 3CJTA 2XDQA 1QYXA 4WZAB 4MUYA 2BGNA 3LIIA 1UWKA 3AKEA 3A9TA 1LDYA 4JC5A 3WIBA 4ZAWA 2Q0SA 3DAYA 2WKPA 2WILA 1T10A 1FXSA 3O3CA 2GUGA 2CV2A 1QZTA 2WICA 1MC4A 3AEZA 1NONA 4Z0PA 1Y8QA 4XWWA 3PXAA 3TLCA 3NVKI 2WWXA 4C4XA 3ESRA 3GJRA 4YVFA 4MO2A 1S6YA 3JALA 3KJIA 3IQZA 1Y8ZA 4F3NA 3DCYA 1QFYA 1RWBA 3NATA 4M7WA 5CM8B 5KAMA 4CQNA 3RYCB 2YS7A 1N1MA 4KR7A 3DLTA 2OZLB 2O2GA 3F9RA 4RORA 1U0OC 2PNFA 1B2LA 1MA0A 3EQ7A 1YS6A 1YDHA 1JQAA 3DAGA 3R0QA 4KO2S 2QNBA 3WWZA 4AO8A 1FTYA 4BASA 3O4HA 1NZFA 1UJ2A 1EDEA 1BVUA 3OCUA 1C7IA 2PTGA 4RZXA 3EW9A 3BWBA 1HDXA 1DDGA 1VLJA 4IZIA 3AH8A 3DE6X 4V2IA 4CV2A 5C9ZA 2EKDA 1L7DA 4IP0A 4PN7A 5K3CA 1RAAA 2D5BA 1QVAA 4HH1A 1HURA 4B6FA 1XZJA 1EJ6A 2RC5A 1QNFA 4Y2GA 4I4CA 3HSYA 2AEJA 2NUBA 2W43A 1G4HA 1H9BA 4BVHA 1SHKA 1T5SA 3PFWO 4PG8A 3TR0A 4LX8A 4CDNA 5KTNA 1KMCA 2RMKA 4YUVA 1QAMA 4JHLA 3ZKAA 5CEJA 1BYUA 1G3UA 1SKQA 3CT6A 3CN7A 3F8TA 1DBQA 1U5BB 3FDZB 4WXPA 1CUWA 3T0IA 1EBFA 1EWTA 1H2BA 1YTLA 1N0VC 4P36A 5IS2A 2XB2A 1X7ZB 3EIEA 4P7FA 4RZSA 1I2MA 2DX7A 2PZFA 3F1LA 5EKUA 2V7EA 2B4YA 2DY0A 3GJ8A 1XPOA 1E58A 3R3VA 4QQFA 1TMGE 4BP8A 5TIIA 1LKZA 1R12A 1T36B 1V39A 1P2VA 1U02A 3GJ6A 3NONA 2POQX 1B26A 1R5JA 3TX2A 5HKKA 1I9CA 1XDGA 4H15A 3HPRA 4H9GA 4K9RA 3O8BA 4TZ6A 2QW8A 2WD8A 3NHPA 4NYJQ 3AEUB 1QHSA 4IGEA 3G02A 3D7SA 4LISA 4ALLA 2OORA 1RYHA 1WXFA 1T35A 1D1PA 1L4NA 2HCJB 2WI8A 4IAOA 1OGJA 1GT6A 3LTEA 2PUCA 1H4QA 1IIBA 1VJGA 3FPLA 4Y7CA 4JEIA 4A3SA 5K8IA 1Q5PA 3O93A 5A0FA 1EE9A 1Q7EA 2ABWA 1B4DA 4E1AA 3NHJA 3I2IA 3RARA 3CEPB 2BSAA 3DFMA 3KL4A 3M4YA 4YREA 1ENOA 3A14A 4L8GA 3AUXA 1F1BA 2SCUB 3OLXA 1FSZA 1T4CA 3OX2A 1W52X 4X3PA 4BWGA 1N6LA 1F5SA 3BIJA 4DR6B 1P61B 4XR9A 3T0GA 3WS7A 1AGXA 1AD2A 1QDUA 1XWWA 3EXEB 2CMGA 1XZFA 2F3SA 1X15A 2QUBA 5FLXA 4YJGA 3S2EA 1LFDB 2QRPA 1PYDA 3GLQA 2DWQA 4LUCA 2DLDA 1OROA 1WXEA 2JI7A 2VDUE 3DS8A 1F6WA 3G5LA 4CT5A 5K0BA 4Z0HO 3UCEA 4TKUB 4Q4DA 2FA9A 4OGLA 1LW7A 2R7MA 1ZM2A 1MUUA 2XOKD 4BFCA 1J8DA 3HA7A 3ROZA 2BFBB 1C30A 2QNRA 2OECA 1M2OA 1FDTA 3ZW7A 3FYSA 1TVCA 4QJ5A 1NFRA 4G5QA 1L7VC 2J85A 3C85A 3I9LA 3KUXA 3JZIA 3RUEA 3J81k 3KSBC 2IL1A 1HFWA 5K01A 4X66B 1GPKA 2MJLA 2Y1FA 4K6FA 2WP0A 3PTLA 1IG0A 3Q41A 4YFVA 1QF6A 1D0SA 1ZNWA 5JDCA 4DJTA 1ZM7A 2BFCA 2ORED 4P84A 4P0PB 1VPTA 4WINA 3WDLA 1PTJA 4CKEA 2R96A 2PYIA 4TT3D 3ZBQA 2W2KA 4FDTA 4YS6A 3TB4A 3CUVA 2VQ6A 2JH9A 2XOEA 4E2XA 4JI2B 2BCEA 1ZRNA 3EGVA 1RXYA 1T4CB 2WA1A 1V2HE 1P1HA 2WMNB 4N0DA 3TVDA 2P9TA 4IUBS 3AI2A 4LYFA 3FMFA 5K8VA 3MF4A 5AVZA 5DGIA 2FQQA 3R0XA 4JP1A 1J21A 1Y1LA 4PC1A 4F1KA 1XD8A 1BA2A 1NHWA 3CEJA 1H2RS 4C7BA 2A57A 1U3VA 4A9AA 4M8KA 1PL8A 3ZDCA 1RJ9A 4W7SA 4B80A 1LLQA 4RWZA 4LRSB 4AMYA 4MV7A 2ZAOA 4FEGA 4R1TA 1MTZA 5ICCA 4C7XA 5IJ9B 1YFJA 2B4KA 3PT9A 4YAGA 5F5NA 3ZIAD 4B6OA 2NADA 2R3SA 4MB0A 4A5OA 3U49A 4U6QA 2XLBA 4GZ3A 5FO1A 1OI3A 3QA9A 4B84A 1LZLA 1LK7A 3LP6A 5HFNA 1JR3A 2FPLA 2GK7A 4MPRA 2IELA 3FYUB 4AY4A 5F2NA 2WTNA 5ALHA 2FWRA 1F0NA 1Z4PX 2RB4A 2YJ5A 3SF8B 4ZYXA 3I2KA 3S68A 1EG2A 3A4TA 3D54D 3NIGB 2YINC 5ELLA 4HDNA 2PMEA 4MWDA 1Z73A 4C0KA 2G71A 4P92A 2C1EA 3OOWA 1U1CA 2ZT7A 4QOGA 1HK7A 1PJTA 5H4GA 2PZKA 4QGAA 1RW4A 3NU1A 4YMSA 3TKLA 3ORYA 4MV3A 2Z1MA 3G2KA 4XIFA 1BWQA 1E9BA 4XIGS 4LGVA 3VU9A 3SQWA 1N0WA 3F78A 3V5NA 1DQNA 3L0DA 4ZI7A 3HU2A 4AS3A 2JLWA 4MPTA 2VPIA 1N4AA 3ZZ0A 2PRZA 4JYPA 1N57A 3AF6A 1UWCA 5IJWA 3A4NA 1HQKA 4B40A 3TQFA 4IS3A 3IOYA 3MTIA 2D1SA 1Q74A 4IH4A 1NJ1A 4I4IA 4OXYA 3S2SA 3W90A 1PG5A 4RD4A 3A2KA 1IZ8A 2C4MA 4D3YA 4LOHA 3W5JA 1LDBA 3ODGA 2DU8A 1IJFA 2ZAYA 1U7HA 2PA3A 2W00A 3K0AA 3OKAA 1JLMA 4BX2A 1TU0A 4F72A 4DMMA 3RTEA 5FI0B 2NP6A 1ODSA 1WB4A 5HJEA 4ZJZA 3DR5A 3MTGA 1ZVKA 2I7VA 3I9JA 4JXXA 4LECA 1W2WB 1FJ2A 3Q7TA 4OYLA 2GBPA 1O4VA 2IYOA 3D5TA 4KRXA 1N7JA 4FZJA 3RGGA 3VQTA 3E82A 1BVRA 4BMZA 3FOCA 1DXYA 4BNKA 1NSYA 3D81A 3H5LA 1GZ5A 3D5QA 1BN6A 3V34A 3WZ2A 3E27A 3NM6B 1P1BA 1R27A 3MJTA 4P6VF 4AWXA 1PJ4A 3HP4A 1GOTA 1KZ1A 2JJMA 5JMOA 3LX4A 3JALB 4K26A 2QP9X 4GM1A 1RT9A 2BUBA 1SUIA 5BOSB 4J1TC 3H5VA 2DTXA 1T15A 1CVLA 3GQBA 5E8JA 1F2UA 2WTUA 5AMXA 2G1PA 2JJQA 3T3EA 3IRVA 2DBRA 1E79D 2WSYB 3I5AA 2ZSUA 5EINA 5BQ5A 4JGBA 4B45A 3U6BA 2O4UX 4FC6A 5E4TA 1FE8A 4L3VA 3RYFA 1WUKS 5K2MA 5CDTA 1KBOA 3ZY3A 3VTKA 1KKMA 5C8YA 3ACDA 3A7EA 1P0MA 4HWRA 3BE6A 3P9QA 2N3ZA 2Q4DA 3F4KA 4CIDA 1IVSA 3JWPA 3PS9A 4FR2A 4M88A 5KZMB 2XYPA 3ADKA 1NRJB 1ZN2A 2H1IA 2WUGA 4HC4A 4NYMR 1W87A 5FBWB 3DZIA 4IM7A 3HUFA 5B58T 4EDFA 2FPPA 5M3BA 3F7NA 1UMBA 4QLBA 5C81A 4PPQA 5FBRB 3FE2A 3THWB 5CTJA 2TMKA 4LZNA 2WYVA 4H3KB 2OBNA 5JH7F 4TRRA 3S1SA 4RQUA 4JLBA 4JJFA 1JH8A 5AOCA 1ECBA 3TNJA 3AEXA 2WY2D 2IH5A 3UUWA 5DHPA 2VA9A 1IJEA 3E6AA 3BK1A 3BGOS 3FROA 2DPMA 5AVTA 2D59A 3IS3A 3I62A 2ZYUX 1HMYA 1UK8A 1O95A 1WZIA 5ECDA 1N6NA 1R2QA 1R74A 2D2IA 5K8TA 2ENWA 5HS6A 4XSGA 3FWNA 4KYIB 3VR3A 4RV4A 4I50F 2W4IA 4AROA 4YA6A 2NZWA 4UVGA 4F04A 3HV2A 3K4PA 2BISA 2RGXA 4GPD1 5IJZA 3ABRB 5AQEA 4E31A 4A82A 1Z4NA 5G41A 3F71A 3UWOA 4LYDA 2XZPA 3A3YA 3BDIA 4YNBA 3RDPA 1H8EA 4MGIR 4P22A 4EMUA 4RADA 1KFKB 2AR9A 3EQ2A 4K3VA 4MVJE 3QY9A 4EVRA 2VDPB 4F3KA 3ZOZA 3M6FA 2O5VA 3Q1KA 4G63A 4DNXA 2J0VA 3UBMA 1XNHA 3Q0EA 4PO3X 1DC7A 2ODBA 3MIZA 4JU8A 4Z7QB 1GCAA 4LQLA 5J2TF 1G8MA 2G17A 1QOPB 1BG6A 1OPXA 5KC8A 2GZ1A 3IHWA 1GG2A 1Y7PA 3U61B 3M89A 1N9ZA 3GLGE 1CLEA 3WGZA 3I6YA 4U9UA 4E2ZA 2FV8A 5D1HA 1VRWA 1UXGA 4NVRA 5I8ZA 1F48A 1OGYA 2A0KA 3A04A 3AQ4A 4GYYA 1JFLA 3GMIA 1JEQB 2FJUA 3F8WA 4GICA 1WZNA 4B2LA 4JI8B 1IIRA 1D4ZA 1ZBDA 1QO7A 4ZAZA 1E5VA 3KDAA 1C5KA 3HFSA 5D01A 1TFUA 4C0SA 3LUAA 3M83A 4Z49A 2H7VA 3I1YA 2WB4A 4V39A 4AN4A 4JUDX 1AUPA 2C4TA 3GT4A 1M34B 1T9HA 4L6AA 3BM5A 5E1MA 4PYJA 1ORTA 4JLAA 1E5TA 1R4MA 1UZLA 2JBAB 3FVRA 1N7IA 4PQGA 3ZXIA 4V1CB 5A9SB 1H1LA 2PZJA 3MINA 3W8FA 1E2BA 2Q4RA 3PHIA 4O3MA 3QWFA 4WNAA 1GZUA 1EFKA 3FLBA 1D2CA 1OLOA 1JN0A 2CMFA 2FZGA 1S3SA 5FV4A 4EEZA 4Q4CA 1CR1A 5JSUA 1PWYE 1WB9A 5EHXA 4AXBA 1O8BA 2CKMA 2IEZA 5CT5A 4MYCA 3TUIC 4D4LA 4MDFA 1VGQA 2GVZC 2ZAGA 2OK7A 5JQGF 2LIPA 2VWHA 4YPFA 1J24A 4UTXA 4EFDA 1Q95A 3CX8A 1Y6FA 5HRAA 2R1TA 2QIPA 4CGZA 4QFMA 5L51A 1UUFA 2A9OA 2AX4A 2F90A 1OA1A 5FPQA 4PN3A 1EQAA 4HX2A 2ZE6A 5A7HA 2UZ4A 3BWXA 3GGGA 2Q1XA 2JFQA 5CLIA 5KYGA 2QAGB 4RUKA 3NETA 3NLLA 1AURA 3AF3A 3O38A 2NQ8A 5FAXA 3WLKX 4EFNA 5CFOA 4CJXA 5ESRA 3W5HA 3UXMA 4D80A 3F5DA 4YDRA 2V6IA 3QY0A 3X1JA 4LWOA 1PNRA 2BRUA 3GFFA 2CYAA 3PQFA 4FB5A 4ACAA 4HYEA 1RFLA 3R5JA 3K9NA 3C3YA 4E7PA 2OXCA 1VMDA 3KNZA 4UNSA 3E2PA 2WK1A 5HCUA 1ATIA 2QSJA 5E2IA 3I2FA 3T1QA 5CYOA 4IHQA 4L5AA 4NAUA 3H7IA 5FCDA 5GOTA 1FPQA 1JVBA 2TS1A 1G42A 1K97A 4ENRA 3LWDA 1EGQA 1T4DA 1T91A 5DW0A 3ZXSA 5J4YA 1DV2A 1E2FA 2WBLC 3DTVA 1O6BA 1RI3A 4O2AA 2WNIA 1BOFA 5TY0A 1U1IA 3H9UA 1LVGA 5EZYA 5JAUA 1ADFA 1JV2B 2HQRA 4BEJA 4LJLA 1IM8A 2ESRA 4ZVOA 5FEMA 4C14A 1Q7RA 2JANA 2Y1OA 1RLTA 4DQKA 3HADA 1KSHA 2QN9A 1FYVA 3OICA 1QHIA 4Q1CA 2FN8A 1C3XA 3JQRA 4TXLA 4RESA 2X5JO 2MTBA 4C0AC 4FM9A 1Z07A 2QAGA 3K0CC 3LX5A 4MV6A 4CF6A 2X0KA 4TVBA 1GLNA 2IZZA 4DBLE 4DUGA 1N2XA 1S5PA 1RJFA 2B1GA 2I4IA 3ICCA 1QB7A 3EUEA 3O82A 2FLKA 1TNDA 3OQIB 3OJXA 4TYQA 13PKA 1UPUA 4KBYA 3KTOA 1E1MA 1YULA 2ZREA 5ICMA 2ZWOA 2C2KA 4ZTZB 1A82A 1QPBA 3UMJA 3FPGA 3E7XA 3TGWA 3D4OA 4OG2A 4H0NA 3K31A 1KE2A 1K75A 4YRBA 2NYVA 3A10A 1X7XB 1W0KD 4JA2A 1G41A 4U0JA 3A6DA 2O0HA 1RPAA 2DY1A 1ZONA 4PXSA 4DW8A 7AT1A 1KO5A 1MQSA 1O6CA 1U0EA 3I0NA 3RYHA 3TRIA 4A6EA 5DU2A 2WKWA 3QNWA 3UFXB 4I5DA 3RSCA 4G81A 5E95A 4PG7A 1DAEA 1FRQA 4IY1A 4HNHA 3HM9A 2VHYA 2QYTA 4IHJF 1II8B 4AM8A 4CLOA 2GX6A 1K7SN 1UDXA 1ZDMA 3CG0A 2HLDD 4Q7JB 3VDQA 1PGJA 3HVIA 4FFVA 3PEYA 2JAOA 3R9KA 5CPFA 3IR5A 2VF4X 3RR2A 2RGGA 2NACA 3LCCA 4RNCA 3UAOA 4S1PA 5K3DA 4WFIA 3GNLA 3S2IA 5LQDA 4KXXA 1NWCA 4P3YA 4YQZA 2DHQA 2HU7A 3WDMA 4CV3A 4AKEA 4E2FA 3RSZA 2F8SA 1AZTA 5DT9A 5HG0A 1X80A 3QV2A 3ROQA 1L7NA 5CA1F 1YJCA 3CO0S 3FPHA 3OCJA 3FFAA 3R9IA 3CJQA 1E3TA 1T1GA 2VK8A 3PFFA 2NU9B 5CG1A 4ENWA 4OQZA 2XRZA 1CHDA 1ONBA 1GA1A 2J4FA 1AKEA 5DOZA 4N3GA 3R7WA 3WLLA 3AY6A 2OESA 1M0TA 1NG9A 2HIGA 2ZR0A 1GZ6A 4OJTA 2P4EA 5ANRB 3B3FA 2RBEA 1JEOA 2VBGA 2XB4A 4X1KA 4YONB 4XH9B 3VH4A 1ONNA 1I80A 4NCXA 2AJBA 4GBMA 1SHUX 1U9JA 2AFIE 2EL7A 4BU1A 4NJMA 3DWGA 3PQEA 4PCVA 1N9KA 4MGZR 1A7UA 2FFAA 3GNSA 3EMVA 3HMQA 2DFDA 2XPCA 4D7AA 1U9ZA 3OLVA 5KJ6A 3U60B 1TU4A 2HMVA 5JBQA 3OU6A 2IS1A 5CDSA 3BULA 1P45A 2WJYA 3TLBA 2UUAB 3BA1A 2VPWA 4IOKA 5EJMA 4C7OA 4YAOA 4G0MA 2RHCA 1E96A 5CVJA 3VTFA 3HDQA 2WF5A 4BZWA 5HTOA 3R7LA 3EVTA 5KTKA 1JJVA 3GHYA 3W78A 1UBUS 4PFSA 2Y67A 2BVNA 4X92A 5KQSA 3LDFA 1QDEA 2FWBA 2A9KA 3DEIA 4HB4A 1KJYA 4I9GA 4MR9A 4YRDA 3RJ9A 5IHXA 3FGOA 3IMEA 1QQ7A 1EVYA 1BHJA 2ET6A 3BRWA 3DL4A 3L7MA 3U2QA 4BE7B 5I7RA 2ZUFA 2BMWA 5B30A 1YBAA 3AF1A 2CJYA 1HZZA 1DAIA 2WFZA 4ZQFA 1R8SA 2O5RA 4Y1EA 1D5CA 2IGBA 2CNWA 5K3FB 3IA2A 2Z08A 3DBLA 5T6BA 3CVVA 4CQLB 3SICE 5BUZA 5L53A 1TUIA 4AP6A 5LP6F 2C9DA 3ESCA 3QYAA 4L9WA 1O2DA 4WESB 2G63A 3EISA 5TB5A 4PYOA 2JAPA 2RSLA 5B1SA 2XUIA 2OHIA 4D43A 1GN9A 3GCWA 4UPVA 1EZ4A 2E5FA 2YYZA 3B38A 2IXDA 1SC3A 4MW7A 4EWLA 2DXIA 5AHOA 5J63A 1AG9A 5L40A 4GMHA 3O21A 4AFNA 4BOYA 4O0MA 3BFJA 5LSAA 4QPCA 3O83A 1WU8A 2HFJA 3F74A 4OGWA 3CG4A 1LFAA 2VP0A 3NWBA 1QGYA 1KP3A 4BB9A 4EDHA 1GPJA 1KYTA 1S3GA 4M9SA 1ZKMA 1MIOA 2HMWA 1CJTC 2X2OA 1E7WA 5EHNA 1EVJA 4BN5A 4RJIA 4H6XA 5EJ9A 4E09A 5CD1A 3LRTA 2ZR9A 3ENQA 5JXGA 4CLRB 2IHKA 1CQPA 2BDUA 2GTHA 4ZO8A 5AVQA 5KKNB 4BNDA 2Q5LA 4E7OA 3JQ9A 3LRPA 1RMTA 1ZVMA 4DT1A 3NDBB 4IMJB 2AX3A 2P41A 4FC7A 1P17A 4O6VA 2VPYA 3SP1A 4EKDA 1H9AA 1GDTA 9MHTA 2PLWA 3CU5A 3PGLA 4G0XA 3F3MA 4MVJA 4E1BA 1OAKA 1LXCA 4L85A 3R75A 3C39A 3UATA 4CMJA 4K6HA 5K8JB 5LL6P 3I1IA 1W85B 1RAEA 2P9JA 2YC4C 3B1XA 3GPBA 3T7RA