4BQTA

Aplysia californica achbp in complex with cytisine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Binding Mode of Smoking Cessation Drugs to Nicotinic Acetylcholine Receptors Through Study of Ligand Complexes with Acetylcholine-Binding Protein.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
molecule tags Receptor
source organism Aplysia californica
total genus 48
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bqtA00
4UXUA 5AFKA 2Y7YA 4TNVA 4QH4A 4LMKA 4QH5A 4HFBA 3ZKRA 2BG9C 2YOEA 4UM3P 5HEHA 4UY2A 3JADA 3U8KA 4AFTA 2Y54A 2PH9A 5AFHA 3U8NA 2X00D 4UM1A 2YN6A 3RQWA 3SIOA 3P50A 5FJVA 4ZJSA 3WTNA 5TVCA 3IGQA 5HCMA 3UU4A 3JAFA 3UQ4A 2XYTA 3GUAA 2BYNA 5BP0A 2ZJUA 4AFHA 2BYRA 2BYQA 4HFHA 3T4MA 2XQ9A 4QH1A 3WTIA 4EZ1A 2PGZA 2WNJA 2XYSA 4UM3A 5LXBA 3RQUA 5KE4A 3RI5A 5CO5A 5HEUA 3RHWA 2WN9A 4X5TA 3C84A 4ZK1A 4TWFA 2BR7A 3UU3A 2BJ0A 2XQ7A 4IREA 4D01A 5AINA 2BYPA 2ZJVA 3C79A 4ZK4A 3JAEA 5L47A 2XQ8A 3U8LA 4ZZBA 5HEJA 5J5IA 4HFEA 5LG3A 5SYOA 5HEGA 2BR8A 2BYSA 4TWHA 3UU8A 3PMZA 2W8GA 3U8JA 4ALXA 3UU5A 4XHEA 3WTLA 3RIFA 2YMDA 3U8MA 4QAAA 4A98A 4COFA 2C9TA 2QC1B 4ZR6A 5AFMA 5J0ZA 4QABA 3WIPA 3WTJA 3TLWA 2XNVA 2XQ4A 2UZ6A 3LSVA 3UU6A 3WTMA 2XNTA 2XQ5A 3ZDGA 1UW6A 2WZYA 3EI0A 5HCJA 3EHZA 3SH1A 3UUBA 3WTHA 3TLTA 4IL4A 5BW2A 2W8FA 2YMEA 4DBMA 3UQ7A 2XZ5A 5JMEA 5J5FA 1UX2A 4TWDA 5IUXA 2BG9E 2XZ6A 3RIAA 4ILBA 4XK9A 4Z90A 4QACA 4LMLA 5L4HA 3SQ9A 4ILAA 4LMJA 4NZBA 3TLSA 3TLVA 4ZJTA 3SQ6A 4ZRUA 3PEOA 2XQ3A 3WTOA 2Y57A 5AFMB 1I9BA 4AFGA 2Y56A 4HFIA 4NPPA 2XNUA 5J5HA 2WNLA 5AFLA 4BFQA 4B5DA 3EAMA 4BQTA 5CFBA 3WTKA 4ILCA 4UM3S 1UV6A 4HQPA 2Y58A 4IL9A 5AFNA 5L4EA 2VL0A 5BRXA 5J5GA 2WNCA 2XQAA 4TNWA 4HFDA 4FRRA 2XQ6A 3TLUA 2YKSA 2BG9B 4WV9A 5HEOA 3ZDHA 2BG9A 2X00A 4PIRA 4A97A 3P4WA 5AFJA 4F8HA 4ZZCA 4HFCA 5KZUA 4Z91A
chains in the Genus database with same CATH superfamily
4UXUA 5AFKA 2Y7YA 4TNVA 4QH4A 4LMKA 4QH5A 4HFBA 3ZKRA 2BG9C 2YOEA 4UM3P 5HEHA 4UY2A 3JADA 3U8KA 4AFTA 2Y54A 2PH9A 5AFHA 3U8NA 2X00D 4UM1A 2YN6A 3RQWA 3SIOA 3P50A 5FJVA 4ZJSA 3WTNA 5TVCA 3IGQA 5HCMA 3UU4A 3JAFA 3UQ4A 2XYTA 3GUAA 2BYNA 5BP0A 2ZJUA 4AFHA 2BYRA 2BYQA 4HFHA 3T4MA 2XQ9A 4QH1A 3WTIA 4EZ1A 2PGZA 2WNJA 2XYSA 4UM3A 5LXBA 3RQUA 5KE4A 3RI5A 5CO5A 5HEUA 3RHWA 2WN9A 4X5TA 3C84A 4ZK1A 4TWFA 2BR7A 3UU3A 2BJ0A 2XQ7A 4IREA 4D01A 5AINA 2BYPA 2ZJVA 3C79A 4ZK4A 3JAEA 5L47A 2XQ8A 3U8LA 4ZZBA 5HEJA 5J5IA 4HFEA 5LG3A 5SYOA 5HEGA 2BR8A 2BYSA 4TWHA 3UU8A 3PMZA 2W8GA 3U8JA 4ALXA 3UU5A 4XHEA 3WTLA 3RIFA 2YMDA 3U8MA 4QAAA 4A98A 4COFA 2C9TA 2QC1B 4ZR6A 5AFMA 5J0ZA 4QABA 3WIPA 3WTJA 3TLWA 2XNVA 2XQ4A 2UZ6A 3LSVA 3UU6A 3WTMA 2XNTA 2XQ5A 3ZDGA 1UW6A 2WZYA 3EI0A 5HCJA 3EHZA 3SH1A 3UUBA 3WTHA 3TLTA 4IL4A 5BW2A 2W8FA 2YMEA 4DBMA 3UQ7A 2XZ5A 5JMEA 5J5FA 1UX2A 4TWDA 5IUXA 2BG9E 2XZ6A 3RIAA 4ILBA 4XK9A 4Z90A 4QACA 4LMLA 5L4HA 3SQ9A 4ILAA 4LMJA 4NZBA 3TLSA 3TLVA 4ZJTA 3SQ6A 4ZRUA 3PEOA 2XQ3A 3WTOA 2Y57A 5AFMB 1I9BA 4AFGA 2Y56A 4HFIA 4NPPA 2XNUA 5J5HA 2WNLA 5AFLA 4BFQA 4B5DA 3EAMA 4BQTA 5CFBA 3WTKA 4ILCA 4UM3S 1UV6A 4HQPA 2Y58A 4IL9A 5AFNA 5L4EA 2VL0A 5BRXA 5J5GA 2WNCA 2XQAA 4TNWA 4HFDA 4FRRA 2XQ6A 3TLUA 2YKSA 2BG9B 4WV9A 5HEOA 3ZDHA 2BG9A 2X00A 4PIRA 4A97A 3P4WA 5AFJA 4F8HA 4ZZCA 4HFCA 5KZUA 4Z91A
chains in the Genus database with same CATH topology
4UXUA 5AFKA 2Y7YA 4TNVA 4QH4A 4LMKA 4QH5A 4HFBA 3ZKRA 2BG9C 2YOEA 4UM3P 5HEHA 4UY2A 3JADA 3U8KA 4AFTA 2Y54A 2PH9A 5AFHA 3U8NA 2X00D 4UM1A 2YN6A 3RQWA 3SIOA 3P50A 5FJVA 4ZJSA 3WTNA 5TVCA 3IGQA 5HCMA 3UU4A 3JAFA 3UQ4A 2XYTA 3GUAA 2BYNA 5BP0A 2ZJUA 4AFHA 2BYRA 2BYQA 4HFHA 3T4MA 2XQ9A 4QH1A 3WTIA 4EZ1A 2PGZA 2WNJA 2XYSA 4UM3A 5LXBA 3RQUA 5KE4A 3RI5A 5CO5A 5HEUA 3RHWA 2WN9A 4X5TA 3C84A 4ZK1A 4TWFA 2BR7A 3UU3A 2BJ0A 2XQ7A 4IREA 4D01A 5AINA 2BYPA 2ZJVA 3C79A 4ZK4A 3JAEA 5L47A 2XQ8A 3U8LA 4ZZBA 5HEJA 5J5IA 4HFEA 5LG3A 5SYOA 5HEGA 2BR8A 2BYSA 4TWHA 3UU8A 3PMZA 2W8GA 3U8JA 4ALXA 3UU5A 4XHEA 3WTLA 3RIFA 2YMDA 3U8MA 4QAAA 4A98A 4COFA 2C9TA 2QC1B 4ZR6A 5AFMA 5J0ZA 4QABA 3WIPA 3WTJA 3TLWA 2XNVA 2XQ4A 2UZ6A 3LSVA 3UU6A 3WTMA 2XNTA 2XQ5A 3ZDGA 1UW6A 2WZYA 3EI0A 5HCJA 3EHZA 3SH1A 3UUBA 3WTHA 3TLTA 4IL4A 5BW2A 2W8FA 2YMEA 4DBMA 3UQ7A 2XZ5A 5JMEA 5J5FA 1UX2A 4TWDA 5IUXA 2BG9E 2XZ6A 3RIAA 4ILBA 4XK9A 4Z90A 4QACA 4LMLA 5L4HA 3SQ9A 4ILAA 4LMJA 4NZBA 3TLSA 3TLVA 4ZJTA 3SQ6A 4ZRUA 3PEOA 2XQ3A 3WTOA 2Y57A 5AFMB 1I9BA 4AFGA 2Y56A 4HFIA 4NPPA 2XNUA 5J5HA 2WNLA 5AFLA 4BFQA 4B5DA 3EAMA 4BQTA 5CFBA 3WTKA 4ILCA 4UM3S 1UV6A 4HQPA 2Y58A 4IL9A 5AFNA 5L4EA 2VL0A 5BRXA 5J5GA 2WNCA 2XQAA 4TNWA 4HFDA 4FRRA 2XQ6A 3TLUA 2YKSA 2BG9B 4WV9A 5HEOA 3ZDHA 2BG9A 2X00A 4PIRA 4A97A 3P4WA 5AFJA 4F8HA 4ZZCA 4HFCA 5KZUA 4Z91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXU A;  5AFK A;  2Y7Y A;  4TNV A;  4QH4 A;  4LMK A;  4QH5 A;  4HFB A;  3ZKR A;  2BG9 C;  2YOE A;  4UM3 P;  5HEH A;  4UY2 A;  3JAD A;  3U8K A;  4AFT A;  2Y54 A;  2PH9 A;  5AFH A;  3U8N A;  2X00 D;  4UM1 A;  2YN6 A;  3RQW A;  3SIO A;  3P50 A;  5FJV A;  4ZJS A;  3WTN A;  5TVC A;  3IGQ A;  5HCM A;  3UU4 A;  3JAF A;  3UQ4 A;  2XYT A;  3GUA A;  2BYN A;  5BP0 A;  2ZJU A;  4AFH A;  2BYR A;  2BYQ A;  4HFH A;  3T4M A;  2XQ9 A;  4QH1 A;  3WTI A;  4EZ1 A;  2PGZ A;  2WNJ A;  2XYS A;  4UM3 A;  5LXB A;  3RQU A;  5KE4 A;  3RI5 A;  5CO5 A;  5HEU A;  3RHW A;  2WN9 A;  4X5T A;  3C84 A;  4ZK1 A;  4TWF A;  2BR7 A;  3UU3 A;  2BJ0 A;  2XQ7 A;  4IRE A;  4D01 A;  5AIN A;  2BYP A;  2ZJV A;  3C79 A;  4ZK4 A;  3JAE A;  5L47 A;  2XQ8 A;  3U8L A;  4ZZB A;  5HEJ A;  5J5I A;  4HFE A;  5LG3 A;  5SYO A;  5HEG A;  2BR8 A;  2BYS A;  4TWH A;  3UU8 A;  3PMZ A;  2W8G A;  3U8J A;  4ALX A;  3UU5 A;  4XHE A;  3WTL A;  3RIF A;  2YMD A;  3U8M A;  4QAA A;  4A98 A;  4COF A;  2C9T A;  2QC1 B;  4ZR6 A;  5AFM A;  5J0Z A;  4QAB A;  3WIP A;  3WTJ A;  3TLW A;  2XNV A;  2XQ4 A;  2UZ6 A;  3LSV A;  3UU6 A;  3WTM A;  2XNT A;  2XQ5 A;  3ZDG A;  1UW6 A;  2WZY A;  3EI0 A;  5HCJ A;  3EHZ A;  3SH1 A;  3UUB A;  3WTH A;  3TLT A;  4IL4 A;  5BW2 A;  2W8F A;  2YME A;  4DBM A;  3UQ7 A;  2XZ5 A;  5JME A;  5J5F A;  1UX2 A;  4TWD A;  5IUX A;  2BG9 E;  2XZ6 A;  3RIA A;  4ILB A;  4XK9 A;  4Z90 A;  4QAC A;  4LML A;  5L4H A;  3SQ9 A;  4ILA A;  4LMJ A;  4NZB A;  3TLS A;  3TLV A;  4ZJT A;  3SQ6 A;  4ZRU A;  3PEO A;  2XQ3 A;  3WTO A;  2Y57 A;  5AFM B;  1I9B A;  4AFG A;  2Y56 A;  4HFI A;  4NPP A;  2XNU A;  5J5H A;  2WNL A;  5AFL A;  4BFQ A;  4B5D A;  3EAM A;  4BQT A;  5CFB A;  3WTK A;  4ILC A;  4UM3 S;  1UV6 A;  4HQP A;  2Y58 A;  4IL9 A;  5AFN A;  5L4E A;  2VL0 A;  5BRX A;  5J5G A;  2WNC A;  2XQA A;  4TNW A;  4HFD A;  4FRR A;  2XQ6 A;  3TLU A;  2YKS A;  2BG9 B;  4WV9 A;  5HEO A;  3ZDH A;  2BG9 A;  2X00 A;  4PIR A;  4A97 A;  3P4W A;  5AFJ A;  4F8H A;  4ZZC A;  4HFC A;  5KZU A;  4Z91 A; 
#chains in the Genus database with same CATH topology
 4UXU A;  5AFK A;  2Y7Y A;  4TNV A;  4QH4 A;  4LMK A;  4QH5 A;  4HFB A;  3ZKR A;  2BG9 C;  2YOE A;  4UM3 P;  5HEH A;  4UY2 A;  3JAD A;  3U8K A;  4AFT A;  2Y54 A;  2PH9 A;  5AFH A;  3U8N A;  2X00 D;  4UM1 A;  2YN6 A;  3RQW A;  3SIO A;  3P50 A;  5FJV A;  4ZJS A;  3WTN A;  5TVC A;  3IGQ A;  5HCM A;  3UU4 A;  3JAF A;  3UQ4 A;  2XYT A;  3GUA A;  2BYN A;  5BP0 A;  2ZJU A;  4AFH A;  2BYR A;  2BYQ A;  4HFH A;  3T4M A;  2XQ9 A;  4QH1 A;  3WTI A;  4EZ1 A;  2PGZ A;  2WNJ A;  2XYS A;  4UM3 A;  5LXB A;  3RQU A;  5KE4 A;  3RI5 A;  5CO5 A;  5HEU A;  3RHW A;  2WN9 A;  4X5T A;  3C84 A;  4ZK1 A;  4TWF A;  2BR7 A;  3UU3 A;  2BJ0 A;  2XQ7 A;  4IRE A;  4D01 A;  5AIN A;  2BYP A;  2ZJV A;  3C79 A;  4ZK4 A;  3JAE A;  5L47 A;  2XQ8 A;  3U8L A;  4ZZB A;  5HEJ A;  5J5I A;  4HFE A;  5LG3 A;  5SYO A;  5HEG A;  2BR8 A;  2BYS A;  4TWH A;  3UU8 A;  3PMZ A;  2W8G A;  3U8J A;  4ALX A;  3UU5 A;  4XHE A;  3WTL A;  3RIF A;  2YMD A;  3U8M A;  4QAA A;  4A98 A;  4COF A;  2C9T A;  2QC1 B;  4ZR6 A;  5AFM A;  5J0Z A;  4QAB A;  3WIP A;  3WTJ A;  3TLW A;  2XNV A;  2XQ4 A;  2UZ6 A;  3LSV A;  3UU6 A;  3WTM A;  2XNT A;  2XQ5 A;  3ZDG A;  1UW6 A;  2WZY A;  3EI0 A;  5HCJ A;  3EHZ A;  3SH1 A;  3UUB A;  3WTH A;  3TLT A;  4IL4 A;  5BW2 A;  2W8F A;  2YME A;  4DBM A;  3UQ7 A;  2XZ5 A;  5JME A;  5J5F A;  1UX2 A;  4TWD A;  5IUX A;  2BG9 E;  2XZ6 A;  3RIA A;  4ILB A;  4XK9 A;  4Z90 A;  4QAC A;  4LML A;  5L4H A;  3SQ9 A;  4ILA A;  4LMJ A;  4NZB A;  3TLS A;  3TLV A;  4ZJT A;  3SQ6 A;  4ZRU A;  3PEO A;  2XQ3 A;  3WTO A;  2Y57 A;  5AFM B;  1I9B A;  4AFG A;  2Y56 A;  4HFI A;  4NPP A;  2XNU A;  5J5H A;  2WNL A;  5AFL A;  4BFQ A;  4B5D A;  3EAM A;  4BQT A;  5CFB A;  3WTK A;  4ILC A;  4UM3 S;  1UV6 A;  4HQP A;  2Y58 A;  4IL9 A;  5AFN A;  5L4E A;  2VL0 A;  5BRX A;  5J5G A;  2WNC A;  2XQA A;  4TNW A;  4HFD A;  4FRR A;  2XQ6 A;  3TLU A;  2YKS A;  2BG9 B;  4WV9 A;  5HEO A;  3ZDH A;  2BG9 A;  2X00 A;  4PIR A;  4A97 A;  3P4W A;  5AFJ A;  4F8H A;  4ZZC A;  4HFC A;  5KZU A;  4Z91 A; 
#chains in the Genus database with same CATH homology
 4UXU A;  5AFK A;  2Y7Y A;  4TNV A;  4QH4 A;  4LMK A;  4QH5 A;  4HFB A;  3ZKR A;  2BG9 C;  2YOE A;  4UM3 P;  5HEH A;  4UY2 A;  3JAD A;  3U8K A;  4AFT A;  2Y54 A;  2PH9 A;  5AFH A;  3U8N A;  2X00 D;  4UM1 A;  2YN6 A;  3RQW A;  3SIO A;  3P50 A;  5FJV A;  4ZJS A;  3WTN A;  5TVC A;  3IGQ A;  5HCM A;  3UU4 A;  3JAF A;  3UQ4 A;  2XYT A;  3GUA A;  2BYN A;  5BP0 A;  2ZJU A;  4AFH A;  2BYR A;  2BYQ A;  4HFH A;  3T4M A;  2XQ9 A;  4QH1 A;  3WTI A;  4EZ1 A;  2PGZ A;  2WNJ A;  2XYS A;  4UM3 A;  5LXB A;  3RQU A;  5KE4 A;  3RI5 A;  5CO5 A;  5HEU A;  3RHW A;  2WN9 A;  4X5T A;  3C84 A;  4ZK1 A;  4TWF A;  2BR7 A;  3UU3 A;  2BJ0 A;  2XQ7 A;  4IRE A;  4D01 A;  5AIN A;  2BYP A;  2ZJV A;  3C79 A;  4ZK4 A;  3JAE A;  5L47 A;  2XQ8 A;  3U8L A;  4ZZB A;  5HEJ A;  5J5I A;  4HFE A;  5LG3 A;  5SYO A;  5HEG A;  2BR8 A;  2BYS A;  4TWH A;  3UU8 A;  3PMZ A;  2W8G A;  3U8J A;  4ALX A;  3UU5 A;  4XHE A;  3WTL A;  3RIF A;  2YMD A;  3U8M A;  4QAA A;  4A98 A;  4COF A;  2C9T A;  2QC1 B;  4ZR6 A;  5AFM A;  5J0Z A;  4QAB A;  3WIP A;  3WTJ A;  3TLW A;  2XNV A;  2XQ4 A;  2UZ6 A;  3LSV A;  3UU6 A;  3WTM A;  2XNT A;  2XQ5 A;  3ZDG A;  1UW6 A;  2WZY A;  3EI0 A;  5HCJ A;  3EHZ A;  3SH1 A;  3UUB A;  3WTH A;  3TLT A;  4IL4 A;  5BW2 A;  2W8F A;  2YME A;  4DBM A;  3UQ7 A;  2XZ5 A;  5JME A;  5J5F A;  1UX2 A;  4TWD A;  5IUX A;  2BG9 E;  2XZ6 A;  3RIA A;  4ILB A;  4XK9 A;  4Z90 A;  4QAC A;  4LML A;  5L4H A;  3SQ9 A;  4ILA A;  4LMJ A;  4NZB A;  3TLS A;  3TLV A;  4ZJT A;  3SQ6 A;  4ZRU A;  3PEO A;  2XQ3 A;  3WTO A;  2Y57 A;  5AFM B;  1I9B A;  4AFG A;  2Y56 A;  4HFI A;  4NPP A;  2XNU A;  5J5H A;  2WNL A;  5AFL A;  4BFQ A;  4B5D A;  3EAM A;  4BQT A;  5CFB A;  3WTK A;  4ILC A;  4UM3 S;  1UV6 A;  4HQP A;  2Y58 A;  4IL9 A;  5AFN A;  5L4E A;  2VL0 A;  5BRX A;  5J5G A;  2WNC A;  2XQA A;  4TNW A;  4HFD A;  4FRR A;  2XQ6 A;  3TLU A;  2YKS A;  2BG9 B;  4WV9 A;  5HEO A;  3ZDH A;  2BG9 A;  2X00 A;  4PIR A;  4A97 A;  3P4W A;  5AFJ A;  4F8H A;  4ZZC A;  4HFC A;  5KZU A;  4Z91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...