4BQTA

Aplysia californica achbp in complex with cytisine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
206
structure length
206
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Binding Mode of Smoking Cessation Drugs to Nicotinic Acetylcholine Receptors Through Study of Ligand Complexes with Acetylcholine-Binding Protein.
pubmed doi rcsb
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bqtA00
4UM3A 4QACA 3UU8A 2XQAA 5CFBA 2YMEA 4XHEA 4QABA 2BYNA 3P4WA 4XK9A 5HEHA 4AFHA 2PGZA 3PEOA 4ALXA 5LG3A 4B5DA 3UQ4A 2WNLA 5HEOA 3RI5A 4ZJTA 4NPPA 2PH9A 2XQ9A 2W8GA 5J5IA 4QH4A 3RIFA 2QC1B 2Y58A 3WTNA 3WTMA 5J5HA 2WNCA 3UU3A 3RQWA 5J0ZA 4COFA 3UUBA 2XNTA 2Y54A 4ZK1A 4X5TA 3C84A 3ZDHA 4TWFA 4A98A 5HCJA 5LXBA 1I9BA 3SQ9A 4HFEA 3WTLA 2VL0A 4PIRA 5AFMB 2Y56A 3TLVA 4AFTA 4AFGA 4ZK4A 2XQ3A 2WNJA 4UM1A 2BYPA 3ZKRA 4BQTA 3TLTA 2ZJVA 4HFBA 5SYOA 5AFMA 2XQ8A 4LMJA 4HFIA 3IGQA 3JAFA 3EI0A 5HEGA 4HQPA 3WTIA 4ILBA 2XZ6A 2YN6A 3RIAA 2ZJUA 2BR8A 3JADA 4WV9A 4F8HA 4Z91A 2XYTA 4ZZBA 4TNVA 5L4EA 4D01A 3LSVA 3WTJA 4ZR6A 4LMKA 5BRXA 5HEUA 5KE4A 3U8JA 2XNVA 3P50A 5IUXA 4TWDA 3TLSA 2WZYA 4LMLA 2YMDA 3WTHA 3TLUA 2C9TA 3SH1A 5J5GA 4FRRA 2X00D 2YKSA 3SQ6A 3ZDGA 3UU5A 5CO5A 1UX2A 4HFDA 1UW6A 2BG9B 4IL4A 4UM3S 3U8NA 2YOEA 5HEJA 4ZZCA 5AFKA 2XQ7A 2BYSA 2W8FA 2XYSA 3C79A 3T4MA 5L47A 4QH5A 4HFCA 2WN9A 4TNWA 1UV6A 4IL9A 4UXUA 4EZ1A 2XQ5A 4A97A 5JMEA 3EAMA 5J5FA 3GUAA 4IREA 2XZ5A 4QAAA 4DBMA 2BG9E 2XNUA 5AFJA 2BR7A 3SIOA 3WTKA 2XQ4A 3WTOA 4QH1A 4UM3P 5AFLA 4BFQA 4ILCA 3UQ7A 5AFNA 5FJVA 3RQUA 2XQ6A 2X00A 3PMZA 5AFHA 4ILAA 5BP0A 5BW2A 2UZ6A 5TVCA 3U8KA 2Y57A 4HFHA 4UY2A 3JAEA 4ZRUA 3U8MA 4Z90A 2BYQA 4TWHA 5L4HA 5KZUA 3WIPA 2BJ0A 3EHZA 4NZBA 5HCMA 3U8LA 5AINA 2BYRA 3UU6A 3UU4A 2Y7YA 2BG9A 2BG9C 3RHWA 4ZJSA 3TLWA
chains in the Genus database with same CATH superfamily
4UM3A 4QACA 3UU8A 2XQAA 5CFBA 2YMEA 4XHEA 4QABA 2BYNA 3P4WA 4XK9A 5HEHA 4AFHA 2PGZA 3PEOA 4ALXA 5LG3A 4B5DA 3UQ4A 2WNLA 5HEOA 3RI5A 4ZJTA 4NPPA 2PH9A 2XQ9A 2W8GA 5J5IA 4QH4A 3RIFA 2QC1B 2Y58A 3WTNA 3WTMA 5J5HA 2WNCA 3UU3A 3RQWA 5J0ZA 4COFA 3UUBA 2XNTA 2Y54A 4ZK1A 4X5TA 3C84A 3ZDHA 4TWFA 4A98A 5HCJA 5LXBA 1I9BA 3SQ9A 4HFEA 3WTLA 2VL0A 4PIRA 5AFMB 2Y56A 3TLVA 4AFTA 4AFGA 4ZK4A 2XQ3A 2WNJA 4UM1A 2BYPA 3ZKRA 4BQTA 3TLTA 2ZJVA 4HFBA 5SYOA 5AFMA 2XQ8A 4LMJA 4HFIA 3IGQA 3JAFA 3EI0A 5HEGA 4HQPA 3WTIA 4ILBA 2XZ6A 2YN6A 3RIAA 2ZJUA 2BR8A 3JADA 4WV9A 4F8HA 4Z91A 2XYTA 4ZZBA 4TNVA 5L4EA 4D01A 3LSVA 3WTJA 4ZR6A 4LMKA 5BRXA 5HEUA 5KE4A 3U8JA 2XNVA 3P50A 5IUXA 4TWDA 3TLSA 2WZYA 4LMLA 2YMDA 3WTHA 3TLUA 2C9TA 3SH1A 5J5GA 4FRRA 2X00D 2YKSA 3SQ6A 3ZDGA 3UU5A 5CO5A 1UX2A 4HFDA 1UW6A 2BG9B 4IL4A 4UM3S 3U8NA 2YOEA 5HEJA 4ZZCA 5AFKA 2XQ7A 2BYSA 2W8FA 2XYSA 3C79A 3T4MA 5L47A 4QH5A 4HFCA 2WN9A 4TNWA 1UV6A 4IL9A 4UXUA 4EZ1A 2XQ5A 4A97A 5JMEA 3EAMA 5J5FA 3GUAA 4IREA 2XZ5A 4QAAA 4DBMA 2BG9E 2XNUA 5AFJA 2BR7A 3SIOA 3WTKA 2XQ4A 3WTOA 4QH1A 4UM3P 5AFLA 4BFQA 4ILCA 3UQ7A 5AFNA 5FJVA 3RQUA 2XQ6A 2X00A 3PMZA 5AFHA 4ILAA 5BP0A 5BW2A 2UZ6A 5TVCA 3U8KA 2Y57A 4HFHA 4UY2A 3JAEA 4ZRUA 3U8MA 4Z90A 2BYQA 4TWHA 5L4HA 5KZUA 3WIPA 2BJ0A 3EHZA 4NZBA 5HCMA 3U8LA 5AINA 2BYRA 3UU6A 3UU4A 2Y7YA 2BG9A 2BG9C 3RHWA 4ZJSA 3TLWA
chains in the Genus database with same CATH topology
4UM3A 4QACA 3UU8A 2XQAA 5CFBA 2YMEA 4XHEA 4QABA 2BYNA 3P4WA 4XK9A 5HEHA 4AFHA 2PGZA 3PEOA 4ALXA 5LG3A 4B5DA 3UQ4A 2WNLA 5HEOA 3RI5A 4ZJTA 4NPPA 2PH9A 2XQ9A 2W8GA 5J5IA 4QH4A 3RIFA 2QC1B 2Y58A 3WTNA 3WTMA 5J5HA 2WNCA 3UU3A 3RQWA 5J0ZA 4COFA 3UUBA 2XNTA 2Y54A 4ZK1A 4X5TA 3C84A 3ZDHA 4TWFA 4A98A 5HCJA 5LXBA 1I9BA 3SQ9A 4HFEA 3WTLA 2VL0A 4PIRA 5AFMB 2Y56A 3TLVA 4AFTA 4AFGA 4ZK4A 2XQ3A 2WNJA 4UM1A 2BYPA 3ZKRA 4BQTA 3TLTA 2ZJVA 4HFBA 5SYOA 5AFMA 2XQ8A 4LMJA 4HFIA 3IGQA 3JAFA 3EI0A 5HEGA 4HQPA 3WTIA 4ILBA 2XZ6A 2YN6A 3RIAA 2ZJUA 2BR8A 3JADA 4WV9A 4F8HA 4Z91A 2XYTA 4ZZBA 4TNVA 5L4EA 4D01A 3LSVA 3WTJA 4ZR6A 4LMKA 5BRXA 5HEUA 5KE4A 3U8JA 2XNVA 3P50A 5IUXA 4TWDA 3TLSA 2WZYA 4LMLA 2YMDA 3WTHA 3TLUA 2C9TA 3SH1A 5J5GA 4FRRA 2X00D 2YKSA 3SQ6A 3ZDGA 3UU5A 5CO5A 1UX2A 4HFDA 1UW6A 2BG9B 4IL4A 4UM3S 3U8NA 2YOEA 5HEJA 4ZZCA 5AFKA 2XQ7A 2BYSA 2W8FA 2XYSA 3C79A 3T4MA 5L47A 4QH5A 4HFCA 2WN9A 4TNWA 1UV6A 4IL9A 4UXUA 4EZ1A 2XQ5A 4A97A 5JMEA 3EAMA 5J5FA 3GUAA 4IREA 2XZ5A 4QAAA 4DBMA 2BG9E 2XNUA 5AFJA 2BR7A 3SIOA 3WTKA 2XQ4A 3WTOA 4QH1A 4UM3P 5AFLA 4BFQA 4ILCA 3UQ7A 5AFNA 5FJVA 3RQUA 2XQ6A 2X00A 3PMZA 5AFHA 4ILAA 5BP0A 5BW2A 2UZ6A 5TVCA 3U8KA 2Y57A 4HFHA 4UY2A 3JAEA 4ZRUA 3U8MA 4Z90A 2BYQA 4TWHA 5L4HA 5KZUA 3WIPA 2BJ0A 3EHZA 4NZBA 5HCMA 3U8LA 5AINA 2BYRA 3UU6A 3UU4A 2Y7YA 2BG9A 2BG9C 3RHWA 4ZJSA 3TLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 A;  4QAC A;  3UU8 A;  2XQA A;  5CFB A;  2YME A;  4XHE A;  4QAB A;  2BYN A;  3P4W A;  4XK9 A;  5HEH A;  4AFH A;  2PGZ A;  3PEO A;  4ALX A;  5LG3 A;  4B5D A;  3UQ4 A;  2WNL A;  5HEO A;  3RI5 A;  4ZJT A;  4NPP A;  2PH9 A;  2XQ9 A;  2W8G A;  5J5I A;  4QH4 A;  3RIF A;  2QC1 B;  2Y58 A;  3WTN A;  3WTM A;  5J5H A;  2WNC A;  3UU3 A;  3RQW A;  5J0Z A;  4COF A;  3UUB A;  2XNT A;  2Y54 A;  4ZK1 A;  4X5T A;  3C84 A;  3ZDH A;  4TWF A;  4A98 A;  5HCJ A;  5LXB A;  1I9B A;  3SQ9 A;  4HFE A;  3WTL A;  2VL0 A;  4PIR A;  5AFM B;  2Y56 A;  3TLV A;  4AFT A;  4AFG A;  4ZK4 A;  2XQ3 A;  2WNJ A;  4UM1 A;  2BYP A;  3ZKR A;  4BQT A;  3TLT A;  2ZJV A;  4HFB A;  5SYO A;  5AFM A;  2XQ8 A;  4LMJ A;  4HFI A;  3IGQ A;  3JAF A;  3EI0 A;  5HEG A;  4HQP A;  3WTI A;  4ILB A;  2XZ6 A;  2YN6 A;  3RIA A;  2ZJU A;  2BR8 A;  3JAD A;  4WV9 A;  4F8H A;  4Z91 A;  2XYT A;  4ZZB A;  4TNV A;  5L4E A;  4D01 A;  3LSV A;  3WTJ A;  4ZR6 A;  4LMK A;  5BRX A;  5HEU A;  5KE4 A;  3U8J A;  2XNV A;  3P50 A;  5IUX A;  4TWD A;  3TLS A;  2WZY A;  4LML A;  2YMD A;  3WTH A;  3TLU A;  2C9T A;  3SH1 A;  5J5G A;  4FRR A;  2X00 D;  2YKS A;  3SQ6 A;  3ZDG A;  3UU5 A;  5CO5 A;  1UX2 A;  4HFD A;  1UW6 A;  2BG9 B;  4IL4 A;  4UM3 S;  3U8N A;  2YOE A;  5HEJ A;  4ZZC A;  5AFK A;  2XQ7 A;  2BYS A;  2W8F A;  2XYS A;  3C79 A;  3T4M A;  5L47 A;  4QH5 A;  4HFC A;  2WN9 A;  4TNW A;  1UV6 A;  4IL9 A;  4UXU A;  4EZ1 A;  2XQ5 A;  4A97 A;  5JME A;  3EAM A;  5J5F A;  3GUA A;  4IRE A;  2XZ5 A;  4QAA A;  4DBM A;  2BG9 E;  2XNU A;  5AFJ A;  2BR7 A;  3SIO A;  3WTK A;  2XQ4 A;  3WTO A;  4QH1 A;  4UM3 P;  5AFL A;  4BFQ A;  4ILC A;  3UQ7 A;  5AFN A;  5FJV A;  3RQU A;  2XQ6 A;  2X00 A;  3PMZ A;  5AFH A;  4ILA A;  5BP0 A;  5BW2 A;  2UZ6 A;  5TVC A;  3U8K A;  2Y57 A;  4HFH A;  4UY2 A;  3JAE A;  4ZRU A;  3U8M A;  4Z90 A;  2BYQ A;  4TWH A;  5L4H A;  5KZU A;  3WIP A;  2BJ0 A;  3EHZ A;  4NZB A;  5HCM A;  3U8L A;  5AIN A;  2BYR A;  3UU6 A;  3UU4 A;  2Y7Y A;  2BG9 A;  2BG9 C;  3RHW A;  4ZJS A;  3TLW A; 
#chains in the Genus database with same CATH topology
 4UM3 A;  4QAC A;  3UU8 A;  2XQA A;  5CFB A;  2YME A;  4XHE A;  4QAB A;  2BYN A;  3P4W A;  4XK9 A;  5HEH A;  4AFH A;  2PGZ A;  3PEO A;  4ALX A;  5LG3 A;  4B5D A;  3UQ4 A;  2WNL A;  5HEO A;  3RI5 A;  4ZJT A;  4NPP A;  2PH9 A;  2XQ9 A;  2W8G A;  5J5I A;  4QH4 A;  3RIF A;  2QC1 B;  2Y58 A;  3WTN A;  3WTM A;  5J5H A;  2WNC A;  3UU3 A;  3RQW A;  5J0Z A;  4COF A;  3UUB A;  2XNT A;  2Y54 A;  4ZK1 A;  4X5T A;  3C84 A;  3ZDH A;  4TWF A;  4A98 A;  5HCJ A;  5LXB A;  1I9B A;  3SQ9 A;  4HFE A;  3WTL A;  2VL0 A;  4PIR A;  5AFM B;  2Y56 A;  3TLV A;  4AFT A;  4AFG A;  4ZK4 A;  2XQ3 A;  2WNJ A;  4UM1 A;  2BYP A;  3ZKR A;  4BQT A;  3TLT A;  2ZJV A;  4HFB A;  5SYO A;  5AFM A;  2XQ8 A;  4LMJ A;  4HFI A;  3IGQ A;  3JAF A;  3EI0 A;  5HEG A;  4HQP A;  3WTI A;  4ILB A;  2XZ6 A;  2YN6 A;  3RIA A;  2ZJU A;  2BR8 A;  3JAD A;  4WV9 A;  4F8H A;  4Z91 A;  2XYT A;  4ZZB A;  4TNV A;  5L4E A;  4D01 A;  3LSV A;  3WTJ A;  4ZR6 A;  4LMK A;  5BRX A;  5HEU A;  5KE4 A;  3U8J A;  2XNV A;  3P50 A;  5IUX A;  4TWD A;  3TLS A;  2WZY A;  4LML A;  2YMD A;  3WTH A;  3TLU A;  2C9T A;  3SH1 A;  5J5G A;  4FRR A;  2X00 D;  2YKS A;  3SQ6 A;  3ZDG A;  3UU5 A;  5CO5 A;  1UX2 A;  4HFD A;  1UW6 A;  2BG9 B;  4IL4 A;  4UM3 S;  3U8N A;  2YOE A;  5HEJ A;  4ZZC A;  5AFK A;  2XQ7 A;  2BYS A;  2W8F A;  2XYS A;  3C79 A;  3T4M A;  5L47 A;  4QH5 A;  4HFC A;  2WN9 A;  4TNW A;  1UV6 A;  4IL9 A;  4UXU A;  4EZ1 A;  2XQ5 A;  4A97 A;  5JME A;  3EAM A;  5J5F A;  3GUA A;  4IRE A;  2XZ5 A;  4QAA A;  4DBM A;  2BG9 E;  2XNU A;  5AFJ A;  2BR7 A;  3SIO A;  3WTK A;  2XQ4 A;  3WTO A;  4QH1 A;  4UM3 P;  5AFL A;  4BFQ A;  4ILC A;  3UQ7 A;  5AFN A;  5FJV A;  3RQU A;  2XQ6 A;  2X00 A;  3PMZ A;  5AFH A;  4ILA A;  5BP0 A;  5BW2 A;  2UZ6 A;  5TVC A;  3U8K A;  2Y57 A;  4HFH A;  4UY2 A;  3JAE A;  4ZRU A;  3U8M A;  4Z90 A;  2BYQ A;  4TWH A;  5L4H A;  5KZU A;  3WIP A;  2BJ0 A;  3EHZ A;  4NZB A;  5HCM A;  3U8L A;  5AIN A;  2BYR A;  3UU6 A;  3UU4 A;  2Y7Y A;  2BG9 A;  2BG9 C;  3RHW A;  4ZJS A;  3TLW A; 
#chains in the Genus database with same CATH homology
 4UM3 A;  4QAC A;  3UU8 A;  2XQA A;  5CFB A;  2YME A;  4XHE A;  4QAB A;  2BYN A;  3P4W A;  4XK9 A;  5HEH A;  4AFH A;  2PGZ A;  3PEO A;  4ALX A;  5LG3 A;  4B5D A;  3UQ4 A;  2WNL A;  5HEO A;  3RI5 A;  4ZJT A;  4NPP A;  2PH9 A;  2XQ9 A;  2W8G A;  5J5I A;  4QH4 A;  3RIF A;  2QC1 B;  2Y58 A;  3WTN A;  3WTM A;  5J5H A;  2WNC A;  3UU3 A;  3RQW A;  5J0Z A;  4COF A;  3UUB A;  2XNT A;  2Y54 A;  4ZK1 A;  4X5T A;  3C84 A;  3ZDH A;  4TWF A;  4A98 A;  5HCJ A;  5LXB A;  1I9B A;  3SQ9 A;  4HFE A;  3WTL A;  2VL0 A;  4PIR A;  5AFM B;  2Y56 A;  3TLV A;  4AFT A;  4AFG A;  4ZK4 A;  2XQ3 A;  2WNJ A;  4UM1 A;  2BYP A;  3ZKR A;  4BQT A;  3TLT A;  2ZJV A;  4HFB A;  5SYO A;  5AFM A;  2XQ8 A;  4LMJ A;  4HFI A;  3IGQ A;  3JAF A;  3EI0 A;  5HEG A;  4HQP A;  3WTI A;  4ILB A;  2XZ6 A;  2YN6 A;  3RIA A;  2ZJU A;  2BR8 A;  3JAD A;  4WV9 A;  4F8H A;  4Z91 A;  2XYT A;  4ZZB A;  4TNV A;  5L4E A;  4D01 A;  3LSV A;  3WTJ A;  4ZR6 A;  4LMK A;  5BRX A;  5HEU A;  5KE4 A;  3U8J A;  2XNV A;  3P50 A;  5IUX A;  4TWD A;  3TLS A;  2WZY A;  4LML A;  2YMD A;  3WTH A;  3TLU A;  2C9T A;  3SH1 A;  5J5G A;  4FRR A;  2X00 D;  2YKS A;  3SQ6 A;  3ZDG A;  3UU5 A;  5CO5 A;  1UX2 A;  4HFD A;  1UW6 A;  2BG9 B;  4IL4 A;  4UM3 S;  3U8N A;  2YOE A;  5HEJ A;  4ZZC A;  5AFK A;  2XQ7 A;  2BYS A;  2W8F A;  2XYS A;  3C79 A;  3T4M A;  5L47 A;  4QH5 A;  4HFC A;  2WN9 A;  4TNW A;  1UV6 A;  4IL9 A;  4UXU A;  4EZ1 A;  2XQ5 A;  4A97 A;  5JME A;  3EAM A;  5J5F A;  3GUA A;  4IRE A;  2XZ5 A;  4QAA A;  4DBM A;  2BG9 E;  2XNU A;  5AFJ A;  2BR7 A;  3SIO A;  3WTK A;  2XQ4 A;  3WTO A;  4QH1 A;  4UM3 P;  5AFL A;  4BFQ A;  4ILC A;  3UQ7 A;  5AFN A;  5FJV A;  3RQU A;  2XQ6 A;  2X00 A;  3PMZ A;  5AFH A;  4ILA A;  5BP0 A;  5BW2 A;  2UZ6 A;  5TVC A;  3U8K A;  2Y57 A;  4HFH A;  4UY2 A;  3JAE A;  4ZRU A;  3U8M A;  4Z90 A;  2BYQ A;  4TWH A;  5L4H A;  5KZU A;  3WIP A;  2BJ0 A;  3EHZ A;  4NZB A;  5HCM A;  3U8L A;  5AIN A;  2BYR A;  3UU6 A;  3UU4 A;  2Y7Y A;  2BG9 A;  2BG9 C;  3RHW A;  4ZJS A;  3TLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...