4BQUA

Japanin from rhipicephalus appendiculatus bound to cholesterol: orthorhombic crystal form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
152
structure length
152
Chain Sequence
PSMPAINTQTLYLAGHSSKLFERNVGCVKTRYLNQTGDWVTRSLIYVFTFDTEPWVTQAGAFQVKWEPYSPLLRVKASDYVRDNLGAKPDYFIRTYDNDFLLLSDLKEVRSTCSLWVTLKYVDRIPETINRTFYTICPDPVPVPFDERCYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JAPANIN
publication title Structural basis of cholesterol binding by a novel clade of dendritic cell modulators from ticks.
pubmed doi rcsb
source organism Rhipicephalus appendiculatus
molecule tags Cholesterol-binding protein
total genus 32
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4bquA00
2MJIA 1SXUA 3BY0A 5L8IA 1IKJA 2K23A 4DQ3A 5L8NA 2WWPA 1DZMA 3FR5A 3PEDA 1CBIA 3EBWA 3WJCA 2PY1A 4NYRA 1D3SA 5AQ6A 1YP6A 2NNDA 1YUPA 4CK4A 2A3FX 1HN2A 2ASNX 3KFIA 1QY2A 3FA8A 1ZNDA 2O62A 4HPAA 1S7DA 1E5PA 5LJGA 4EXZA 4EDEA 4YFPA 1T8VA 1IKEA 2IFBA 3KFHA 4QZTA 4XMGA 4Y0QA 4NLJA 3BSZE 1BSYA 1LF7A 3ZQ3A 3CQRA 1T68X 4UU2A 4A1YA 1R0UA 4ORRA 1AQBA 1QY0A 4RUNA 3U0DA 3OJYC 1NGLA 1EXSA 3IA8A 5B29A 3UEWA 4OS3A 1CBSA 1ZNGA 3FA9A 3TGAA 2WEWA 1D2UA 2JOZA 2XSTA 1SXYA 4NLIA 4AW8A 5HA1A 4YCHA 4GNWA 3PH6A 1IFCA 1XCAA 2AT6X 4HFOA 5EEEA 4ZH6A 1N0SA 5HTEA 5F7GA 1I04A 4BOEA 1CBQA 5FENA 5HZ6A 3VG4A 1LIDA 4YDAA 2LFOA 4MVKA 4I3BA 3I0AA 1ZNKA 1OEKA 4NYQA 2LKKA 4ZHGA 2AT3X 1EW3A 4MVLA 4D6BA 4ARHA 4ZGUA 1I4UA 5EEDA 2WUTA 1MUPA 1BBPA 2RA6A 2OZQA 4LKTA 4XMCA 2JU3A 3NADA 1SY0A 1OBPA 4YMYA 2E4JA 4IMNA 1DZJA 3BU1A 4YGHA 2W2FA 3P6EA 4IB9A 1EPBA 3Q6LA 3VG5A 5LKEA 1L6MA 2JU7A 4YGZA 4GH7A 4YBPA 1EIIA 2X46A 3L4RA 5LJEA 1SY3A 1X8QA 4K19A 1VYFA 1KT7A 4NNTA 1HQPA 5B27A 2ALLX 3T1DA 4ALBA 5LJHA 1YWCA 2MM3A 2QO4A 4ORSA 1SY2A 1B4MA 4QAEA 4TJZA 5F58A 2R73A 3APXA 4WFVA 2R56A 4YFRA 3FA6A 1ALBA 4A8ZA 1GXAA 4I9RA 4TQ2A 1U18A 4GETA 1YWDA 5IO7A 1ERBA 4YKMA 2WSJA 3S26A 4MVIA 4AZPA 1LIBA 4ZFXA 1X8UA 1IIUA 4AZQA 3STKA 3PH5A 3MBTA 4ZCBA 4XMDA 4XMFA 4AZOA 3I17A 3MVFA 1FENA 5C0NA 1JZUA 4ODDA 2Q4NA 4TNNA 1I06A 3SAOA 1ADLA 2FS7A 1FE3A 1PEEA 3VG2A 3WXQA 1TOUA 4QZUA 2MO5A 1X8PA 3BLGA 2OVEA 4QYPA 5LJCA 1CBRA 3P6CA 1HBPA 3B2KA 5H9AA 2NNQA 3KQ0A 3P6FA 2CM4A 1KQXA 3FENA 5H9KA 2L9CA 3STNA 4WFUA 4YKOA 1OBQA 1X8OA 1GKAB 1EQDA 5HCCC 1IFBA 2QOSC 4GKCA 3DSZA 3D95A 3B2JA 1OBUA 1MDCA 1FELA 2JU8A 3QKGA 2G78A 3HWEA 4M6SA 5D47A 3B2HA 5D45A 3U9PC 3BS2A 5CE4A 1JYJA 3WJFA 2RQ0A 1QY1A 3D96A 3STMX 1U17A 2CZTA 1TW4A 2Q39A 5K06A 3WJGA 1S2PA 4AZMA 4I3DA 1TOWA 1O8VA 3BX7A 1GX8A 5DPQA 1SXXA 5HZQA 4A1HA 5BVQA 4IB7A 1KXOA 3PECA 4ALOA 1SY1A 1TXLA 1DFVA 2QO6A 3VG6A 5HBSA 3BDRA 4KIIA 1ML7A 2AH7X 2Q2MA 1GT1A 1O1UA 2A0AA 4HPDA 1BJ7A 1DZKA 2K62A 4OS8A 4QGXA 5EZ2A 3B2IA 1EUOA 1QWDA 1RBPA 5HAEA 3C76X 1G5WA 3BRNA 1FEMA 2GC9A 3FR4A 1P6PA 3PP6A 4NNSA 3TF6A 3HWDA 1RLBE 3K3LA 5L8OA 3C77X 3FA7A 4Y0PA 2RCQA 1UZ2X 1LPJA 2L67A 3UEVA 1U0XA 3ELZA 2R74A 4GNYA 1IW2A 4YH0A 1OPAA 2AT5X 2N93A 2A2GA 3EMMA 1LIFA 1G74A 1MVGA 1BEBA 2FLJA 1JJXA 5D48A 1KZXA 2FR3A 1KOIA 1LFOA 4ORXA 5H9NA 4ES7A 4WBKA 1HBQA 1BSQA 3HWFA 4IB8A 5DG4A 4BVMA 2AMMX 1QABE 1YP7A 1H91A 1LKEA 4GE1A 1YWAA 4EFGA 1BSOA 3FMZA 4OS0A 4YBUA 5HCDC 1ZNHA 3CBCA 1ICMA 4TKJA 2FT9A 4UU3A 2KTDA 1G85A 1X8NA 4AZNA 1LICA 4ORWA 2G79A 2KT4B 2GTFX 3FR2A 2A2UA 5HZ9A 2WEXA 3NX2A 3AKMA 4N7CA 2OFRX 3NPOA 2G7BA 5EDBA 1OEEA 2WQ9A 5FAZA 2Q9SA 1A57A 3GAQA 2ACOA 3BU9A 5H8TA 3EM0A 2LB6A 2FS6A 1BWYA 2QO5A 3AKNA 4I9SA 4IAWA 1VYGA 3F8AA 4QYNA 3WJBA 1KQWA 3FEKA 1T0VA 3CMPA 2LBAA 1HMSA 4TKHA 2L5PA 3RZYA 2LBVA 5BVSA 5HTDA 4M7MA 1B0OA 5KIDA 1VPRA 1JJJA 1SXWA 2NNEA 3TGBA 1AVGI 1LNMA 1BM5A 1JYDA 5IO6A 1JBHA 3NP1A 4ORUA 1GT5A 4ZJ0A 3VG3A 2FWVA 2CBRA 2HMBA 3ZUIA 1XKIA 5LKFA 4LKPA 1AB0A 1NP4A 5D8JA 3WVMA 4TLJA 3IFBA 4ZHDA 3CBSA 3KFGA 2HZQA 5H9LA 4YCEA 4YGGA 1KT4A 3VG7A 4A60A 1HMRA 1GM6A 2CM9A 3APVA 5HA0A 1BLRA 1QQSA 1DC9A 1QG5A 1YWBA 3C78X 3FW4A 4TKBA 2W2BA 4QGVA 3U03A 4IMOA 4IB6A 4HPBA 5HZ5A 4XMEA 5EPQA 5LJDA 5F1EA 1FDQA 4ZHHA 3WJDA 1A2DA 2AKQA 2CZUA 3KFFA 1KT3A 1E06A 1PBOA 2DM5A 1EALA 5KHPA 5IO5A 1OPBA 2FRSA 1ZNEA 5LJKA 4IAXA 1O1VA 4ORYA 2RD7C 3APWA 5D4AA 2RCTA 4AZRA 3O22A 4ZHCA 1CRBA 1KT6A 1ZNLA 1AELA 3DTQA 2YG2A 4ZR2A 1ZRYA 2XKLA 1B8EA 3PPTA 2JN3A 1X89A 2CBSA 1KT5A 4GRJA 4BQUA 1GGLA 3FLLA 4RUUA 1X71A 2Q2PA 1GX9A 4YDBA 4Y0SA 5HZ8A 3ZUOA 2GJ5A 1B56A 1BRQA 1DZPA 4YFQA 1ACDA 2WR6A 2AT0X 3WBGA 3NR3A 4HPCA 4XMHA 3TGCA 4PSQA 3D97A 1SA8A 4Y0RA 3P6DA 2NP1A 2QM9A 4EEJA 4NP1A 3TZSA 2ACPX 3UEXA 4R0BA 4DQ4A 1A18A 1OEJA 2ANSA 2WQAE 1I05A 3CR6A 4QGWA 1DV9A 4I3CA 3F9DA 1EPAA 1E02A 1KGLA 1LIEA 3WJEA 1DF3A 1NP1A 3RSWA 2W2AA 3O2YA 2EU7X 4IBAA 1KZWA 1A3YA 3B2LA 3FEPA 2A13A 2FR2A 1GT4A 2FTBA 3NX1A 3O19A 1EIOA 1YIVA 1HMTA 2L68A 2AT8X 1E00A 1QFVA 5HCEC 3FW5A 4AYHA 2OVAA 2POAA 1S44A 3BX8A 3P6GA 1CJ5A 3ELXA 2OVDA 3KZAA 3APUA 2BLGA 1ICNA 3G7XA 3NQ9A 3UEUA 3EYCA 2F73A 3HWGA 4OMWA 1QFTA 1ERXA 4LZVA 2HLVA 5FFHA 1MX7A 5F6BA 3CWKA 3FIQA 2P8GA 3NQ3A 5F6ZA 2OFMX 3FELA 1MX8A 5HWZA 3P6HA 2HNXA 1GT3A 1UREA 1GKAA 3CQNA 4O9SA 2HYSA 2AL0X 3HK1A 1PMPA 4ZH9A 4ZHFA 1FTPA 4LZUA 4N7DA 5KICA 1TVQA 4D6AA 5BVTA 5JR8A 1G7NA 2X45A 1JV4A 1Z24A 3JS1A 3EBKA 5LJBA 1BRPA 3JSQA 4OMXA 1PM1X 2HZRA 5EDCA
chains in the Genus database with same CATH superfamily
2I5ZO 2MJIA 1SXUA 3BY0A 3PDFA 1IKJA 2K23A 5L8IA 4DQ3A 5L8NA 2GTLN 2WWPA 3MG5A 1DZMA 3FR5A 3PEDA 1CBIA 3EBWA 3WJCA 2PY1A 4NYRA 2X34A 1D3SA 5AQ6A 1YP6A 2VFCA 3SZJA 2AF5A 2NNDA 1YUPA 4CK4A 2A3FX 1HN2A 2ASNX 3KFIA 1QY2A 3FA8A 1ZNDA 2O62A 1SRJA 4HPAA 2VDFA 1W4TA 1S7DA 1SWCA 1E5PA 5LJGA 4EXZA 3HOEA 4EDEA 2GTLO 4YFPA 4O3YA 1T8VA 3ZW1A 3NBXX 1IKEA 1HXZA 2IFBA 2RN4A 3KFHA 4QZTA 4XMGA 4O49A 4Y0QA 2X56A 3T6LA 3ZI8A 1VWDB 4NLJA 2OF9A 3BSZE 1STSB 1BSYA 1LF7A 4MEEA 3ZQ3A 2OFAA 3CQRA 1T68X 4UU2A 4A1YA 1R0UA 4ID2A 4ORRA 1AQBA 1QY0A 4RUNA 2AVIA 3OJYC 1NGLA 3RDUA 1EXSA 3U0DA 3IA8A 5B29A 3UEWA 1AVEA 4OS3A 1CBSA 1ZNGA 3FA9A 3S5VA 3TGAA 4DNEA 1I9HA 2WEWA 2ZSCA 1D2UA 1PTSA 2JOZA 3GE2A 2XSTA 1SWQA 4FBRA 1SXYA 1N7YA 4GJSA 4NLIA 3RDMA 1GX3A 4AW8A 5HA1A 2OF8A 4YCHA 5BYPA 1SRFA 4BCSA 4GNWA 3PH6A 1IFCA 1XCAA 2AT6X 4HFOA 5EEEA 4ZH6A 1N0SA 5HTEA 3RDSA 4KC7A 5F7GA 1I04A 4KCAA 4BOEA 1CBQA 1SLFB 4KC8A 1LCWA 4L1NA 5FENA 3VG4A 4BJ8A 1LIDA 4JO6A 5HZ6A 1N9MA 2IZFB 4YDAA 2LFOA 4Z28A 2X32A 4C5PA 4MVKA 5K68A 3SLOA 4I3BA 3I0AA 1ZNKA 1OEKA 4NYQA 2LKKA 4ZHGA 2AT3X 1EW3A 4MVLA 3ZW2A 4D6BA 5B5GA 4ARHA 4ZGUA 1I4UA 4JGLA 5EEDA 1NQNA 2WUTA 1MUPA 1BBPA 1RAVA 2RA6A 2RTBB 4CSBA 2OZQA 2BS6A 4LKTA 4XMCA 4CV7A 2JU3A 1LDOA 1NBXA 1SY0A 3NADA 3VE2A 2OFBA 5IRAA 5AJCA 1OBPA 2RTCB 3EC5A 3EW1A 5AJBA 2E4JA 4YMYA 1VWKB 4IMNA 1DZJA 1SWRA 3BU1A 4IRWA 2W2FA 3P6EA 4YGHA 4IB9A 1EPBA 3Q6LA 3VG5A 5LKEA 1L6MA 2JU7A 4YGZA 4GH7A 3WOVA 4YBPA 1EIIA 2X46A 3L4RA 2OY1O 5LJEA 1SY3A 1X8QA 4K19A 5B10O 1VYFA 1KT7A 3RY1A 4NNTA 1RSUB 2RTGB 4O3ZA 4GK9A 1HQPA 5B27A 4CPHB 2ALLX 3T1DA 1HY2A 1OSPO 4ALBA 5LJHA 1YWCA 2MM3A 2QO4A 2ZAGA 1SY2A 4ORSA 4QAEA 4TJZA 1LDQA 5F58A 2R73A 4JNJA 3ZW0B 1B4MA 3APXA 4WFVA 2R56A 4YFRA 3FA6A 1ALBA 4YVBA 4A8ZA 1GXAA 4I9RA 3SOTA 4TQ2A 1U18A 1SLEB 3KVNA 4GETA 1YWDA 4GZVA 4GDAA 5IO7A 1ERBA 4Z2PA 4YKMA 1VWLB 2WSJA 2FKGA 3S26A 1E2TA 1EI5A 2X8FA 3HPEA 4MVIA 4AZPA 1LIBA 4Z6JA 4ZFXA 1X8UA 1IIUA 2OY5O 2FHLA 4I60A 3PH5A 1NC9A 3STKA 4INNA 4AZQA 3MBTA 4ZCBA 4COTA 3Q34A 4XMDA 4XMFA 4AZOA 3I17A 3T2XA 3MVFA 1FENA 3FYFA 5C0NA 1JZUA 1STRB 2RTDB 2Q4NA 4ODDA 4TNNA 1I06A 3SAOA 1ADLA 2FS7A 1FE3A 1SWKA 1PEEA 3VG2A 1SWDA 3VU1A 2JGSA 3WXQA 1SWJA 1TOUA 2FHNX 2GH7A 4QZUA 1SRHA 1X8PA 2MO5A 3BLGA 3P02A 2OVEA 5B3MO 4QYPA 5LJCA 1CBRA 3P6CA 1HBPA 3B2KA 5H9AA 2NNQA 3KQ0A 4NV8A 3P6FA 2CM4A 1KQXA 3UAQA 3FENA 3PQSA 1VWMB 2OL7A 1JMZA 2QMIA 5H9KA 2L9CA 1JJUA 3STNA 3RE5A 2C4IA 2QOMA 4WFUA 4YKOA 1OBQA 4BX6B 1X8OA 1GKAB 1EQDA 2BC3A 1IFBA 2QOSC 4GKCA 5FQ7E 3DSZA 2IZGB 4GGRA 3RKGA 3D95A 3B2JA 4CDDA 1VWHB 1OBUA 1MDCA 1FELA 2KD2A 2RTEB 2JU8A 3QKGA 2G78A 2Z4HA 3HWEA 4M6SA 3B2HA 5D45A 5D47A 3BS2A 5B2AO 3U9PC 5CE4A 1JYJA 4O4SA 3WJFA 2RQ0A 1QY1A 3N91A 1SWFA 3D96A 1U17A 3STMX 2CZTA 1VWBB 1TW4A 2Q39A 3OE3A 4KH8A 2IZKA 2WPUA 5K06A 3WJGA 1S2PA 4AZMA 4FBOA 5L3YA 1W6FA 4I3DA 4O4OA 4BX5A 1TOWA 1O8VA 3WZQA 3RBYA 4OEMA 3BX7A 1FJ1E 1GX8A 5DPQA 1SXXA 5HZQA 4A1HA 5BVQA 2IZDB 4IB7A 1KXOA 3WYQA 2Y3FA 3PECA 4ALOA 1SY1A 1TXLA 4U8UO 1DFVA 2QO6A 3VG6A 5HBSA 2IZEB 3BDRA 4KIIA 1ML7A 2AH7X 3ZZVA 1SMPI 1SWNA 1N9YA 1VWRB 1GT1A 1O1UA 2A0AA 2Q2MA 4HPDA 4NV7A 4QNIA 1SWBA 1SWGA 4U8UM 1BJ7A 1DZKA 2K62A 3EW2A 4OS8A 3V8UA 4QGXA 5EZ2A 3B2IA 3HTYA 4O3WA 1EUOA 1PBYA 1QWDA 1RBPA 2CAMA 2Y3EA 5HAEA 4MIRA 4Z2OA 3C76X 2I5VO 5CSEA 3BRNA 4LQZA 4MVEA 1FEMA 1G5WA 2GC9A 1VWJB 1Y9TA 3FR4A 1P6PA 3PP6A 4NNSA 4FBVA 3HWDA 1RLBE 3K3LA 4PJ2A 3TF6A 5L8OA 4BX7A 2X55A 2FGSA 3C77X 3FA7A 4Y0PA 2RCQA 1UZ2X 4QQ1A 1SRGA 3WYPA 3ZWEA 1LPJA 3H3IA 5B11O 2L67A 1VWFB 3CKFA 4FGIB 3UEVA 1U0XA 3RE6A 3ELZA 2R74A 4GNYA 1IW2A 4YH0A 1OPAA 2AT5X 2MWHA 2N93A 2A2GA 1VWCB 2IZBA 3EMMA 5F2BA 3S60A 1LIFA 1G74A 1MVGA 2C1QA 1BEBA 2BHVA 2FLJA 1JJXA 5D48A 1MEPA 1KZXA 2FR3A 1KL5A 1KOIA 1LFOA 4ORXA 2BT9A 5FQ6E 3S5XA 3OD9A 5H9NA 4ES7A 1K24A 1HBQA 1BSQA 3HWFA 4IB8A 4WBKA 2HKDA 5DG4A 4BVMA 2AMMX 1QABE 1KL3A 4U46A 1YP7A 1H91A 1LKEA 4GE1A 1YWAA 1MM9A 1NQMA 3PK2A 4EFGA 1BSOA 1SWHA 1UYOX 3FMZA 4OS0A 1ZNHA 3CBCA 1ICMA 4YBUA 5HCDC 5IXGA 3F6ZB 3SZIA 2C1SA 2LA7A 4GGTA 4TKJA 1VWNB 1VWEB 4L3RA 2FT9A 5K67A 1SWPA 2A5CA 2KTDA 4OKAA 1G85A 1LUQA 4UU3A 2Y32A 1X8NA 4AZNA 1LICA 4ORWA 2DJFA 1DF8A 2G79A 2JMBA 2KT4B 4QRLA 2X4MA 2X8TA 2GTFX 3FR2A 2A2UA 5HZ9A 3OBLA 2WEXA 3NX2A 2JW1A 3AKMA 3FIDA 4N7CA 2OFRX 3NPOA 2G7BA 3QQ2A 3CKGA 2A8GA 2Z4IA 5EDBA 1OEEA 2WQ9A 4Z2VA 4Y5DA 5FAZA 2Q9SA 4OELA 3VHHA 1A57A 4EQAC 3GAQA 2ACOA 3BU9A 5H8TA 2IZHB 3EM0A 2LB6A 2OYBO 2A5BA 2FS6A 5IRWA 1UYNX 1BWYA 2QO5A 3AKNA 4I9SA 4IAWA 1VYGA 3F8AA 4QYNA 3WJBA 1AVDA 1KQWA 1T0VA 3CMPA 3FEKA 2OL8O 2LBAA 4O3XB 4CPIA 1HMSA 4TKHA 2L5PA 4I6SA 3RZYA 2LBVA 5BVSA 5HTDA 4IABA 1VWGB 1VWIB 4BX6A 4M7MA 1B0OA 5KIDA 2KTSA 1I78A 1VPRA 1JJJA 1SXWA 2NNEA 3AUMO 2YMSA 3WZOA 1AVGI 1LNMA 3TGBA 1BM5A 4WHIA 1JYDA 3D9WA 5IO6A 3NP1A 1JBHA 4ORUA 1GT5A 2RTKA 3LTWA 4ZJ0A 3VG3A 2FWVA 2CBRA 2HMBA 3ZUIA 1XKIA 5LKFA 4I95A 4LKPA 1AB0A 1NP4A 5D8JA 4Z27A 1Y9LA 4TLJA 3WVMA 3IFBA 4CDEA 4ZHDA 4U8UN 3CBSA 4B55A 3KFGA 2HZQA 2RTAA 5B5FA 5H9LA 4YCEA 4HWMA 4YGGA 1KT4A 3VG7A 4A60A 1HMRA 1GM6A 2CM9A 3SLJA 3APVA 5HA0A 2IZLB 2RTMA 1BLRA 1QQSA 1DC9A 1QG5A 1YWBA 3C78X 3FW4A 1KFFA 3JQOA 2W2BA 4QGVA 4TKBA 1VWOB 3U03A 4IMOA 4IB6A 4HPBA 5HZ5A 1SWAA 4XMEA 5EPQA 5LJDA 5F1EA 1FDQA 4ZHHA 4ZGFA 3WJDA 1A2DA 1W5RA 2AKQA 2CZUA 1VYOA 3KFFA 4CDFA 1KT3A 2ZAIA 1E06A 1SWUA 1PBOA 3ZW1B 2DM5A 1SWOA 1EALA 2GTLM 2IZIA 1OPBA 2FRSA 1ZNEA 5IO5A 3MX7A 4IAXA 4CDCA 5KHPA 1O1VA 4ORYA 2RD7C 3APWA 5D4AA 2RCTA 4AZRA 3O22A 4ZHCA 1N43A 1CRBA 3LV4A 2RTRB 1KT6A 1ZNLA 1AELA 1LCVA 3DTQA 4BX5B 2YG2A 4ZR2A 1ZRYA 2XKLA 1B8EA 3PPTA 3PQUA 2JN3A 1X89A 1SWTA 4NW4A 3VHIA 2CBSA 1KT5A 1MOYA 2X8SA 2VFBA 1SWLA 5AEOA 4GRJA 4BQUA 1GGLA 2M4LA 3FLLA 4RUUA 1X71A 2Q2PA 1GX9A 4YDBA 3T2WA 1WBIA 4BGFA 4Y0SA 5HZ8A 3ZUOA 2GJ5A 2RTQB 1B56A 1BRQA 1DZPA 4YFQA 1ACDA 1SLGB 2AT0X 2UZ2A 2WR6A 1HQQA 4GDZA 4GU8A 3NR3A 3WBGA 4GGZA 3WZPA 1JIWI 2RTHB 4HPCA 4XMHA 3TGCA 4PSQA 3D97A 1SA8A 4Y0RA 1NDJA 2NP1A 1SRIA 2QM9A 3P6DA 2OL6O 4NP1A 4EEJA 2ACPX 3UEXA 3TZSA 4O4XA 1SWSA 4R0BA 4DQ4A 1A18A 1OEJA 2ANSA 3X00A 1Y53X 2WQAE 1VWPB 1I05A 3CR6A 3HOLA 4QGWA 5CYBA 4CPHA 1DV9A 3SLTA 2DJGA 3D4RA 2IZJA 5LJKA 4I3CA 2IZAA 1VWQB 3F9DA 4BX7B 1EPAA 1E02A 2RTPB 3ZW0A 1KGLA 1LIEA 4Y59A 3WJEA 1NP1A 3VPJE 1DF3A 3RSWA 2W2AA 3O2YA 2EU7X 4IBAA 1KZWA 1A3YA 3B2LA 1Y52X 3FEPA 2A13A 2FR2A 2QCBA 3WZNA 2BSZA 1GT4A 2FTBA 3NX1A 2BS5A 2MHDA 3O19A 4JHQA 4FQBB 3RDXA 2PI3O 1EIOA 1YIVA 1HMTA 1RXKA 2AT8X 2L68A 3VHMA 1E00A 1QFVA 5HCEC 3T6FA 3FW5A 1Y0GA 2F09A 2OVAA 3VE1A 2POAA 4AYHA 1S44A 2IZCB 3BX8A 3P6GA 1CJ5A 3ELXA 2OVDA 3KZAA 1VWAB 2MF6A 1RXJA 3RY2A 3APUA 2BLGA 2KW1A 1ICNA 1MK5A 4U3QA 3G7XA 3NQ9A 3UEUA 3AEHA 4BBOA 2RTIB 2RTOB 3EYCA 2RTJA 2F73A 3FDCA 2RTNB 3HWGA 4GUZA 4OMWA 3SZHA 1QFTA 3LHNA 5JD2A 2UYWA 3RDOA 1WUBA 1ERXA 5HCCC 4LZVA 2HLVA 1RSTB 1MX7A 2OY8A 5F6BA 5FFHA 3CWKA 4U9CA 4GJVA 1KL4A 4ML7B 2G8CO 3FIQA 2P8GA 2OY7A 3NQ3A 2G5LA 5F6ZA 2OFMX 4EKVA 3FELA 1MX8A 1LCZA 5HWZA 4KT5A 4ON1A 3P6HA 4CPFA 1JMXA 2RTLA 2HNXA 1GT3A 3P24A 1N4JA 1UREA 4CPEA 4MISA 1GKAA 3NQKA 3CQNA 4O9SA 2RTFB 2HYSA 2FKJA 2AL0X 3HK1A 1SWEA 2OVSA 3RDQA 1PMPA 4ZH9A 4ZHFA 2F01A 1FTPA 1RXHA 3E3CA 4LZUA 1K3BA 5IRUA 3VGWA 1SREA 4N7DA 5KICA 1HXLA 1LELA 1SLDB 4DCBA 1TVQA 3RWXA 5CHKA 4D6AA 5BVTA 5JR8A 1Y55X 1G7NA 2X45A 1JV4A 1Z24A 3JS1A 1JQPA 1STPA 4O4UA 5FQ8E 3EBKA 5LJBA 1BRPA 3JSQA 1IJ8A 1PM1X 4OMXA 3MM0A 2HZRA 4GD9A 5EDCA
chains in the Genus database with same CATH topology
2MJIA 1SXUA 3BY0A 5L8IA 1IKJA 2K23A 4DQ3A 5L8NA 2GTLN 2WWPA 1DZMA 3FR5A 3PEDA 1CBIA 3EBWA 3WJCA 2PY1A 4NYRA 1D3SA 5AQ6A 1YP6A 2NNDA 1YUPA 4CK4A 2A3FX 1HN2A 2ASNX 3KFIA 1QY2A 3FA8A 1ZNDA 2O62A 4HPAA 1S7DA 1E5PA 5LJGA 4EXZA 3HOEA 4EDEA 2GTLO 4YFPA 4O3YA 1T8VA 3ZW1A 3NBXX 1IKEA 2IFBA 2RN4A 3KFHA 4QZTA 4XMGA 4Y0QA 4O49A 3ZI8A 4NLJA 3BSZE 1BSYA 1LF7A 3ZQ3A 3CQRA 1T68X 4UU2A 4A1YA 1R0UA 4ID2A 4ORRA 1AQBA 1QY0A 4RUNA 3U0DA 3OJYC 1NGLA 1EXSA 3IA8A 5B29A 3UEWA 4OS3A 1CBSA 1ZNGA 3FA9A 3S5VA 3TGAA 2WEWA 1D2UA 2JOZA 3GE2A 2XSTA 4FBRA 1SXYA 4NLIA 4AW8A 5HA1A 5BYPA 4YCHA 4GNWA 3PH6A 1IFCA 1XCAA 2AT6X 4HFOA 5EEEA 4ZH6A 1N0SA 5HTEA 4KC7A 5F7GA 1I04A 4KCAA 4BOEA 1CBQA 4KC8A 5FENA 4L1NA 5HZ6A 3VG4A 1LIDA 4YDAA 2LFOA 4MVKA 4I3BA 3I0AA 1ZNKA 1OEKA 4NYQA 2LKKA 4ZHGA 2AT3X 1EW3A 4MVLA 3ZW2A 4D6BA 4ARHA 4ZGUA 1I4UA 4JGLA 5EEDA 2WUTA 1MUPA 1BBPA 2RA6A 4CSBA 2OZQA 2BS6A 4LKTA 4XMCA 4CV7A 2JU3A 3NADA 1SY0A 3VE2A 5AJCA 1OBPA 5AJBA 4YMYA 2E4JA 4IMNA 1DZJA 3BU1A 4YGHA 2W2FA 3P6EA 4IB9A 1EPBA 3Q6LA 3VG5A 5LKEA 1L6MA 2JU7A 4YGZA 4GH7A 3WOVA 4YBPA 1EIIA 2X46A 3L4RA 5LJEA 1SY3A 1X8QA 4K19A 1VYFA 1KT7A 4NNTA 4O3ZA 4GK9A 1HQPA 5B27A 2ALLX 3T1DA 4ALBA 5LJHA 1YWCA 2MM3A 2QO4A 2ZAGA 1SY2A 4ORSA 4QAEA 4TJZA 5F58A 1B4MA 2R73A 3ZW0B 3APXA 4WFVA 2R56A 4YFRA 3FA6A 1ALBA 4A8ZA 1GXAA 4I9RA 3SOTA 4TQ2A 1U18A 4GETA 4GZVA 1YWDA 5IO7A 1ERBA 4YKMA 2WSJA 3S26A 1EI5A 2X8FA 4MVIA 4AZPA 1LIBA 4ZFXA 1X8UA 1IIUA 4AZQA 3STKA 3PH5A 4INNA 3MBTA 4ZCBA 4COTA 4XMDA 4XMFA 4AZOA 3I17A 3MVFA 1FENA 3FYFA 5C0NA 1JZUA 4ODDA 2Q4NA 4TNNA 1I06A 3SAOA 1ADLA 2FS7A 1FE3A 1PEEA 3VG2A 3VU1A 3WXQA 1TOUA 4QZUA 2MO5A 1X8PA 3BLGA 3P02A 2OVEA 4QYPA 5LJCA 1CBRA 3P6CA 1HBPA 3B2KA 5H9AA 2NNQA 3KQ0A 3P6FA 2CM4A 1KQXA 3UAQA 3FENA 3PQSA 5H9KA 2QMIA 2L9CA 3STNA 4WFUA 4YKOA 1OBQA 1X8OA 1GKAB 1EQDA 5FQ7E 1IFBA 2QOSC 4GKCA 3RKGA 3DSZA 5HCCC 3D95A 3B2JA 1OBUA 1MDCA 1FELA 2KD2A 2JU8A 3QKGA 2G78A 2Z4HA 3HWEA 4M6SA 3B2HA 5D45A 5D47A 3BS2A 3U9PC 5CE4A 1JYJA 4O4SA 3WJFA 2RQ0A 1QY1A 3N91A 3D96A 3STMX 1U17A 2CZTA 1TW4A 2Q39A 3OE3A 4KH8A 5K06A 3WJGA 1S2PA 4AZMA 4FBOA 4I3DA 4O4OA 1TOWA 1O8VA 3RBYA 3BX7A 1GX8A 5DPQA 1SXXA 5HZQA 4A1HA 5BVQA 4IB7A 1KXOA 3PECA 4ALOA 1SY1A 1TXLA 4U8UO 1DFVA 2QO6A 3VG6A 5HBSA 3BDRA 4KIIA 1ML7A 2AH7X 3ZZVA 1SMPI 2Q2MA 1GT1A 1O1UA 2A0AA 4HPDA 4QNIA 4U8UM 1BJ7A 1DZKA 2K62A 4OS8A 3V8UA 4QGXA 5EZ2A 3B2IA 3HTYA 4O3WA 1EUOA 1QWDA 1RBPA 5HAEA 4MIRA 3C76X 1G5WA 3BRNA 4LQZA 4MVEA 1FEMA 2GC9A 1Y9TA 3FR4A 1P6PA 3PP6A 4NNSA 4FBVA 3HWDA 1RLBE 3K3LA 4PJ2A 3TF6A 5L8OA 3C77X 3FA7A 4Y0PA 2RCQA 1UZ2X 4QQ1A 3ZWEA 1LPJA 3H3IA 2L67A 4FGIB 3UEVA 1U0XA 3ELZA 2R74A 4GNYA 1IW2A 4YH0A 1OPAA 2AT5X 2MWHA 2N93A 2A2GA 3EMMA 3S60A 1LIFA 1G74A 1MVGA 1BEBA 2BHVA 2FLJA 1JJXA 5D48A 1KZXA 2FR3A 1KOIA 1LFOA 4ORXA 2BT9A 5FQ6E 3S5XA 3OD9A 5H9NA 4ES7A 4WBKA 1HBQA 1BSQA 3HWFA 4IB8A 5DG4A 4BVMA 2AMMX 1QABE 1YP7A 1H91A 1LKEA 4GE1A 1YWAA 4EFGA 1BSOA 3FMZA 4OS0A 4YBUA 5HCDC 1ZNHA 3CBCA 1ICMA 3F6ZB 2LA7A 4TKJA 4L3RA 2FT9A 4UU3A 2KTDA 1G85A 1X8NA 4AZNA 1LICA 4ORWA 2G79A 2KT4B 2JMBA 4QRLA 2X8TA 2GTFX 3FR2A 2A2UA 5HZ9A 3OBLA 2WEXA 3NX2A 2JW1A 3AKMA 4N7CA 2OFRX 3NPOA 2G7BA 2Z4IA 5EDBA 1OEEA 2WQ9A 5FAZA 2Q9SA 1A57A 4EQAC 3GAQA 2ACOA 3BU9A 5H8TA 3EM0A 2LB6A 2FS6A 1BWYA 2QO5A 3AKNA 4I9SA 4IAWA 1VYGA 3F8AA 4QYNA 3WJBA 1KQWA 3FEKA 1T0VA 3CMPA 4O3XB 2LBAA 1HMSA 4TKHA 2L5PA 4I6SA 3RZYA 2LBVA 5BVSA 5HTDA 4IABA 4M7MA 1B0OA 5KIDA 2KTSA 1VPRA 1JJJA 1SXWA 2NNEA 3TGBA 2YMSA 1AVGI 1LNMA 1BM5A 4WHIA 1JYDA 5IO6A 1JBHA 3NP1A 4ORUA 1GT5A 4ZJ0A 3VG3A 2FWVA 2CBRA 2HMBA 3ZUIA 1XKIA 5LKFA 4I95A 4LKPA 1AB0A 1NP4A 5D8JA 1Y9LA 4TLJA 3WVMA 3IFBA 4ZHDA 4U8UN 3CBSA 3KFGA 2HZQA 5H9LA 4YCEA 4HWMA 4YGGA 1KT4A 3VG7A 4A60A 1HMRA 1GM6A 2CM9A 3APVA 5HA0A 1BLRA 1QQSA 1DC9A 1QG5A 1YWBA 3C78X 3FW4A 3JQOA 2W2BA 4QGVA 4TKBA 3U03A 4IMOA 4IB6A 4HPBA 5HZ5A 4XMEA 5EPQA 5LJDA 5F1EA 1FDQA 4ZHHA 4ZGFA 3WJDA 1A2DA 2AKQA 2CZUA 3KFFA 1KT3A 2ZAIA 1E06A 1PBOA 3ZW1B 2DM5A 1EALA 2GTLM 5IO5A 1OPBA 2FRSA 1ZNEA 5KHPA 3MX7A 4IAXA 5LJKA 1O1VA 4ORYA 2RD7C 3APWA 5D4AA 2RCTA 4AZRA 3O22A 4ZHCA 1CRBA 3LV4A 1KT6A 1ZNLA 1AELA 3DTQA 2YG2A 4ZR2A 1ZRYA 2XKLA 1B8EA 3PPTA 3PQUA 2JN3A 1X89A 4NW4A 2CBSA 1KT5A 2X8SA 5AEOA 4GRJA 4BQUA 1GGLA 2M4LA 3FLLA 4RUUA 1X71A 2Q2PA 1GX9A 4YDBA 4Y0SA 5HZ8A 3ZUOA 2GJ5A 1B56A 1BRQA 1DZPA 4YFQA 1ACDA 2WR6A 2AT0X 4GDZA 3WBGA 4GU8A 3NR3A 1JIWI 4HPCA 4XMHA 3TGCA 4PSQA 3D97A 1SA8A 4Y0RA 3P6DA 2NP1A 2QM9A 4EEJA 4NP1A 3TZSA 2ACPX 3UEXA 4O4XA 4R0BA 4DQ4A 1A18A 1OEJA 2ANSA 2WQAE 1I05A 3CR6A 3HOLA 4QGWA 5CYBA 1DV9A 3D4RA 4I3CA 3F9DA 1EPAA 1E02A 3ZW0A 1KGLA 1LIEA 3WJEA 1DF3A 1NP1A 3VPJE 3RSWA 2W2AA 3O2YA 2EU7X 4IBAA 1KZWA 1A3YA 3B2LA 3FEPA 2A13A 2FR2A 1GT4A 2FTBA 3NX1A 2BS5A 2MHDA 3O19A 4FQBB 1EIOA 1YIVA 1HMTA 2L68A 2AT8X 1E00A 1QFVA 5HCEC 3FW5A 2F09A 2OVAA 3VE1A 4AYHA 2POAA 1S44A 3BX8A 3P6GA 1CJ5A 3ELXA 2OVDA 3KZAA 3APUA 2BLGA 2KW1A 1ICNA 4U3QA 3G7XA 3NQ9A 3UEUA 3EYCA 2F73A 3HWGA 4OMWA 1QFTA 3LHNA 1ERXA 4LZVA 2HLVA 5FFHA 1MX7A 5F6BA 3CWKA 4U9CA 4ML7B 3FIQA 2P8GA 3NQ3A 5F6ZA 2OFMX 3FELA 1MX8A 5HWZA 4KT5A 4ON1A 3P6HA 2HNXA 1GT3A 3P24A 1UREA 4MISA 1GKAA 3NQKA 3CQNA 4O9SA 2HYSA 2AL0X 3HK1A 2OVSA 1PMPA 4ZH9A 4ZHFA 1FTPA 3E3CA 4LZUA 4N7DA 5KICA 1TVQA 3RWXA 4D6AA 5BVTA 5JR8A 1G7NA 2X45A 1JV4A 1Z24A 3JS1A 4O4UA 5FQ8E 3EBKA 5LJBA 1BRPA 3JSQA 4OMXA 1PM1X 2HZRA 5EDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJI A;  1SXU A;  3BY0 A;  5L8I A;  1IKJ A;  2K23 A;  4DQ3 A;  5L8N A;  2WWP A;  1DZM A;  3FR5 A;  3PED A;  1CBI A;  3EBW A;  3WJC A;  2PY1 A;  4NYR A;  1D3S A;  5AQ6 A;  1YP6 A;  2NND A;  1YUP A;  4CK4 A;  2A3F X;  1HN2 A;  2ASN X;  3KFI A;  1QY2 A;  3FA8 A;  1ZND A;  2O62 A;  4HPA A;  1S7D A;  1E5P A;  5LJG A;  4EXZ A;  4EDE A;  4YFP A;  1T8V A;  1IKE A;  2IFB A;  3KFH A;  4QZT A;  4XMG A;  4Y0Q A;  4NLJ A;  3BSZ E;  1BSY A;  1LF7 A;  3ZQ3 A;  3CQR A;  1T68 X;  4UU2 A;  4A1Y A;  1R0U A;  4ORR A;  1AQB A;  1QY0 A;  4RUN A;  3U0D A;  3OJY C;  1NGL A;  1EXS A;  3IA8 A;  5B29 A;  3UEW A;  4OS3 A;  1CBS A;  1ZNG A;  3FA9 A;  3TGA A;  2WEW A;  1D2U A;  2JOZ A;  2XST A;  1SXY A;  4NLI A;  4AW8 A;  5HA1 A;  4YCH A;  4GNW A;  3PH6 A;  1IFC A;  1XCA A;  2AT6 X;  4HFO A;  5EEE A;  4ZH6 A;  1N0S A;  5HTE A;  5F7G A;  1I04 A;  4BOE A;  1CBQ A;  5FEN A;  5HZ6 A;  3VG4 A;  1LID A;  4YDA A;  2LFO A;  4MVK A;  4I3B A;  3I0A A;  1ZNK A;  1OEK A;  4NYQ A;  2LKK A;  4ZHG A;  2AT3 X;  1EW3 A;  4MVL A;  4D6B A;  4ARH A;  4ZGU A;  1I4U A;  5EED A;  2WUT A;  1MUP A;  1BBP A;  2RA6 A;  2OZQ A;  4LKT A;  4XMC A;  2JU3 A;  3NAD A;  1SY0 A;  1OBP A;  4YMY A;  2E4J A;  4IMN A;  1DZJ A;  3BU1 A;  4YGH A;  2W2F A;  3P6E A;  4IB9 A;  1EPB A;  3Q6L A;  3VG5 A;  5LKE A;  1L6M A;  2JU7 A;  4YGZ A;  4GH7 A;  4YBP A;  1EII A;  2X46 A;  3L4R A;  5LJE A;  1SY3 A;  1X8Q A;  4K19 A;  1VYF A;  1KT7 A;  4NNT A;  1HQP A;  5B27 A;  2ALL X;  3T1D A;  4ALB A;  5LJH A;  1YWC A;  2MM3 A;  2QO4 A;  4ORS A;  1SY2 A;  1B4M A;  4QAE A;  4TJZ A;  5F58 A;  2R73 A;  3APX A;  4WFV A;  2R56 A;  4YFR A;  3FA6 A;  1ALB A;  4A8Z A;  1GXA A;  4I9R A;  4TQ2 A;  1U18 A;  4GET A;  1YWD A;  5IO7 A;  1ERB A;  4YKM A;  2WSJ A;  3S26 A;  4MVI A;  4AZP A;  1LIB A;  4ZFX A;  1X8U A;  1IIU A;  4AZQ A;  3STK A;  3PH5 A;  3MBT A;  4ZCB A;  4XMD A;  4XMF A;  4AZO A;  3I17 A;  3MVF A;  1FEN A;  5C0N A;  1JZU A;  4ODD A;  2Q4N A;  4TNN A;  1I06 A;  3SAO A;  1ADL A;  2FS7 A;  1FE3 A;  1PEE A;  3VG2 A;  3WXQ A;  1TOU A;  4QZU A;  2MO5 A;  1X8P A;  3BLG A;  2OVE A;  4QYP A;  5LJC A;  1CBR A;  3P6C A;  1HBP A;  3B2K A;  5H9A A;  2NNQ A;  3KQ0 A;  3P6F A;  2CM4 A;  1KQX A;  3FEN A;  5H9K A;  2L9C A;  3STN A;  4WFU A;  4YKO A;  1OBQ A;  1X8O A;  1GKA B;  1EQD A;  5HCC C;  1IFB A;  2QOS C;  4GKC A;  3DSZ A;  3D95 A;  3B2J A;  1OBU A;  1MDC A;  1FEL A;  2JU8 A;  3QKG A;  2G78 A;  3HWE A;  4M6S A;  5D47 A;  3B2H A;  5D45 A;  3U9P C;  3BS2 A;  5CE4 A;  1JYJ A;  3WJF A;  2RQ0 A;  1QY1 A;  3D96 A;  3STM X;  1U17 A;  2CZT A;  1TW4 A;  2Q39 A;  5K06 A;  3WJG A;  1S2P A;  4AZM A;  4I3D A;  1TOW A;  1O8V A;  3BX7 A;  1GX8 A;  5DPQ A;  1SXX A;  5HZQ A;  4A1H A;  5BVQ A;  4IB7 A;  1KXO A;  3PEC A;  4ALO A;  1SY1 A;  1TXL A;  1DFV A;  2QO6 A;  3VG6 A;  5HBS A;  3BDR A;  4KII A;  1ML7 A;  2AH7 X;  2Q2M A;  1GT1 A;  1O1U A;  2A0A A;  4HPD A;  1BJ7 A;  1DZK A;  2K62 A;  4OS8 A;  4QGX A;  5EZ2 A;  3B2I A;  1EUO A;  1QWD A;  1RBP A;  5HAE A;  3C76 X;  1G5W A;  3BRN A;  1FEM A;  2GC9 A;  3FR4 A;  1P6P A;  3PP6 A;  4NNS A;  3TF6 A;  3HWD A;  1RLB E;  3K3L A;  5L8O A;  3C77 X;  3FA7 A;  4Y0P A;  2RCQ A;  1UZ2 X;  1LPJ A;  2L67 A;  3UEV A;  1U0X A;  3ELZ A;  2R74 A;  4GNY A;  1IW2 A;  4YH0 A;  1OPA A;  2AT5 X;  2N93 A;  2A2G A;  3EMM A;  1LIF A;  1G74 A;  1MVG A;  1BEB A;  2FLJ A;  1JJX A;  5D48 A;  1KZX A;  2FR3 A;  1KOI A;  1LFO A;  4ORX A;  5H9N A;  4ES7 A;  4WBK A;  1HBQ A;  1BSQ A;  3HWF A;  4IB8 A;  5DG4 A;  4BVM A;  2AMM X;  1QAB E;  1YP7 A;  1H91 A;  1LKE A;  4GE1 A;  1YWA A;  4EFG A;  1BSO A;  3FMZ A;  4OS0 A;  4YBU A;  5HCD C;  1ZNH A;  3CBC A;  1ICM A;  4TKJ A;  2FT9 A;  4UU3 A;  2KTD A;  1G85 A;  1X8N A;  4AZN A;  1LIC A;  4ORW A;  2G79 A;  2KT4 B;  2GTF X;  3FR2 A;  2A2U A;  5HZ9 A;  2WEX A;  3NX2 A;  3AKM A;  4N7C A;  2OFR X;  3NPO A;  2G7B A;  5EDB A;  1OEE A;  2WQ9 A;  5FAZ A;  2Q9S A;  1A57 A;  3GAQ A;  2ACO A;  3BU9 A;  5H8T A;  3EM0 A;  2LB6 A;  2FS6 A;  1BWY A;  2QO5 A;  3AKN A;  4I9S A;  4IAW A;  1VYG A;  3F8A A;  4QYN A;  3WJB A;  1KQW A;  3FEK A;  1T0V A;  3CMP A;  2LBA A;  1HMS A;  4TKH A;  2L5P A;  3RZY A;  2LBV A;  5BVS A;  5HTD A;  4M7M A;  1B0O A;  5KID A;  1VPR A;  1JJJ A;  1SXW A;  2NNE A;  3TGB A;  1AVG I;  1LNM A;  1BM5 A;  1JYD A;  5IO6 A;  1JBH A;  3NP1 A;  4ORU A;  1GT5 A;  4ZJ0 A;  3VG3 A;  2FWV A;  2CBR A;  2HMB A;  3ZUI A;  1XKI A;  5LKF A;  4LKP A;  1AB0 A;  1NP4 A;  5D8J A;  3WVM A;  4TLJ A;  3IFB A;  4ZHD A;  3CBS A;  3KFG A;  2HZQ A;  5H9L A;  4YCE A;  4YGG A;  1KT4 A;  3VG7 A;  4A60 A;  1HMR A;  1GM6 A;  2CM9 A;  3APV A;  5HA0 A;  1BLR A;  1QQS A;  1DC9 A;  1QG5 A;  1YWB A;  3C78 X;  3FW4 A;  4TKB A;  2W2B A;  4QGV A;  3U03 A;  4IMO A;  4IB6 A;  4HPB A;  5HZ5 A;  4XME A;  5EPQ A;  5LJD A;  5F1E A;  1FDQ A;  4ZHH A;  3WJD A;  1A2D A;  2AKQ A;  2CZU A;  3KFF A;  1KT3 A;  1E06 A;  1PBO A;  2DM5 A;  1EAL A;  5KHP A;  5IO5 A;  1OPB A;  2FRS A;  1ZNE A;  5LJK A;  4IAX A;  1O1V A;  4ORY A;  2RD7 C;  3APW A;  5D4A A;  2RCT A;  4AZR A;  3O22 A;  4ZHC A;  1CRB A;  1KT6 A;  1ZNL A;  1AEL A;  3DTQ A;  2YG2 A;  4ZR2 A;  1ZRY A;  2XKL A;  1B8E A;  3PPT A;  2JN3 A;  1X89 A;  2CBS A;  1KT5 A;  4GRJ A;  4BQU A;  1GGL A;  3FLL A;  4RUU A;  1X71 A;  2Q2P A;  1GX9 A;  4YDB A;  4Y0S A;  5HZ8 A;  3ZUO A;  2GJ5 A;  1B56 A;  1BRQ A;  1DZP A;  4YFQ A;  1ACD A;  2WR6 A;  2AT0 X;  3WBG A;  3NR3 A;  4HPC A;  4XMH A;  3TGC A;  4PSQ A;  3D97 A;  1SA8 A;  4Y0R A;  3P6D A;  2NP1 A;  2QM9 A;  4EEJ A;  4NP1 A;  3TZS A;  2ACP X;  3UEX A;  4R0B A;  4DQ4 A;  1A18 A;  1OEJ A;  2ANS A;  2WQA E;  1I05 A;  3CR6 A;  4QGW A;  1DV9 A;  4I3C A;  3F9D A;  1EPA A;  1E02 A;  1KGL A;  1LIE A;  3WJE A;  1DF3 A;  1NP1 A;  3RSW A;  2W2A A;  3O2Y A;  2EU7 X;  4IBA A;  1KZW A;  1A3Y A;  3B2L A;  3FEP A;  2A13 A;  2FR2 A;  1GT4 A;  2FTB A;  3NX1 A;  3O19 A;  1EIO A;  1YIV A;  1HMT A;  2L68 A;  2AT8 X;  1E00 A;  1QFV A;  5HCE C;  3FW5 A;  4AYH A;  2OVA A;  2POA A;  1S44 A;  3BX8 A;  3P6G A;  1CJ5 A;  3ELX A;  2OVD A;  3KZA A;  3APU A;  2BLG A;  1ICN A;  3G7X A;  3NQ9 A;  3UEU A;  3EYC A;  2F73 A;  3HWG A;  4OMW A;  1QFT A;  1ERX A;  4LZV A;  2HLV A;  5FFH A;  1MX7 A;  5F6B A;  3CWK A;  3FIQ A;  2P8G A;  3NQ3 A;  5F6Z A;  2OFM X;  3FEL A;  1MX8 A;  5HWZ A;  3P6H A;  2HNX A;  1GT3 A;  1URE A;  1GKA A;  3CQN A;  4O9S A;  2HYS A;  2AL0 X;  3HK1 A;  1PMP A;  4ZH9 A;  4ZHF A;  1FTP A;  4LZU A;  4N7D A;  5KIC A;  1TVQ A;  4D6A A;  5BVT A;  5JR8 A;  1G7N A;  2X45 A;  1JV4 A;  1Z24 A;  3JS1 A;  3EBK A;  5LJB A;  1BRP A;  3JSQ A;  4OMX A;  1PM1 X;  2HZR A;  5EDC A; 
#chains in the Genus database with same CATH topology
 2I5Z O;  2MJI A;  1SXU A;  3BY0 A;  3PDF A;  1IKJ A;  2K23 A;  5L8I A;  4DQ3 A;  5L8N A;  2GTL N;  2WWP A;  3MG5 A;  1DZM A;  3FR5 A;  3PED A;  1CBI A;  3EBW A;  3WJC A;  2PY1 A;  4NYR A;  2X34 A;  1D3S A;  5AQ6 A;  1YP6 A;  2VFC A;  3SZJ A;  2AF5 A;  2NND A;  1YUP A;  4CK4 A;  2A3F X;  1HN2 A;  2ASN X;  3KFI A;  1QY2 A;  3FA8 A;  1ZND A;  2O62 A;  1SRJ A;  4HPA A;  2VDF A;  1W4T A;  1S7D A;  1SWC A;  1E5P A;  5LJG A;  4EXZ A;  3HOE A;  4EDE A;  2GTL O;  4YFP A;  4O3Y A;  1T8V A;  3ZW1 A;  3NBX X;  1IKE A;  1HXZ A;  2IFB A;  2RN4 A;  3KFH A;  4QZT A;  4XMG A;  4O49 A;  4Y0Q A;  2X56 A;  3T6L A;  3ZI8 A;  1VWD B;  4NLJ A;  2OF9 A;  3BSZ E;  1STS B;  1BSY A;  1LF7 A;  4MEE A;  3ZQ3 A;  2OFA A;  3CQR A;  1T68 X;  4UU2 A;  4A1Y A;  1R0U A;  4ID2 A;  4ORR A;  1AQB A;  1QY0 A;  4RUN A;  2AVI A;  3OJY C;  1NGL A;  3RDU A;  1EXS A;  3U0D A;  3IA8 A;  5B29 A;  3UEW A;  1AVE A;  4OS3 A;  1CBS A;  1ZNG A;  3FA9 A;  3S5V A;  3TGA A;  4DNE A;  1I9H A;  2WEW A;  2ZSC A;  1D2U A;  1PTS A;  2JOZ A;  3GE2 A;  2XST A;  1SWQ A;  4FBR A;  1SXY A;  1N7Y A;  4GJS A;  4NLI A;  3RDM A;  1GX3 A;  4AW8 A;  5HA1 A;  2OF8 A;  4YCH A;  5BYP A;  1SRF A;  4BCS A;  4GNW A;  3PH6 A;  1IFC A;  1XCA A;  2AT6 X;  4HFO A;  5EEE A;  4ZH6 A;  1N0S A;  5HTE A;  3RDS A;  4KC7 A;  5F7G A;  1I04 A;  4KCA A;  4BOE A;  1CBQ A;  1SLF B;  4KC8 A;  1LCW A;  4L1N A;  5FEN A;  3VG4 A;  4BJ8 A;  1LID A;  4JO6 A;  5HZ6 A;  1N9M A;  2IZF B;  4YDA A;  2LFO A;  4Z28 A;  2X32 A;  4C5P A;  4MVK A;  5K68 A;  3SLO A;  4I3B A;  3I0A A;  1ZNK A;  1OEK A;  4NYQ A;  2LKK A;  4ZHG A;  2AT3 X;  1EW3 A;  4MVL A;  3ZW2 A;  4D6B A;  5B5G A;  4ARH A;  4ZGU A;  1I4U A;  4JGL A;  5EED A;  1NQN A;  2WUT A;  1MUP A;  1BBP A;  1RAV A;  2RA6 A;  2RTB B;  4CSB A;  2OZQ A;  2BS6 A;  4LKT A;  4XMC A;  4CV7 A;  2JU3 A;  1LDO A;  1NBX A;  1SY0 A;  3NAD A;  3VE2 A;  2OFB A;  5IRA A;  5AJC A;  1OBP A;  2RTC B;  3EC5 A;  3EW1 A;  5AJB A;  2E4J A;  4YMY A;  1VWK B;  4IMN A;  1DZJ A;  1SWR A;  3BU1 A;  4IRW A;  2W2F A;  3P6E A;  4YGH A;  4IB9 A;  1EPB A;  3Q6L A;  3VG5 A;  5LKE A;  1L6M A;  2JU7 A;  4YGZ A;  4GH7 A;  3WOV A;  4YBP A;  1EII A;  2X46 A;  3L4R A;  2OY1 O;  5LJE A;  1SY3 A;  1X8Q A;  4K19 A;  5B10 O;  1VYF A;  1KT7 A;  3RY1 A;  4NNT A;  1RSU B;  2RTG B;  4O3Z A;  4GK9 A;  1HQP A;  5B27 A;  4CPH B;  2ALL X;  3T1D A;  1HY2 A;  1OSP O;  4ALB A;  5LJH A;  1YWC A;  2MM3 A;  2QO4 A;  2ZAG A;  1SY2 A;  4ORS A;  4QAE A;  4TJZ A;  1LDQ A;  5F58 A;  2R73 A;  4JNJ A;  3ZW0 B;  1B4M A;  3APX A;  4WFV A;  2R56 A;  4YFR A;  3FA6 A;  1ALB A;  4YVB A;  4A8Z A;  1GXA A;  4I9R A;  3SOT A;  4TQ2 A;  1U18 A;  1SLE B;  3KVN A;  4GET A;  1YWD A;  4GZV A;  4GDA A;  5IO7 A;  1ERB A;  4Z2P A;  4YKM A;  1VWL B;  2WSJ A;  2FKG A;  3S26 A;  1E2T A;  1EI5 A;  2X8F A;  3HPE A;  4MVI A;  4AZP A;  1LIB A;  4Z6J A;  4ZFX A;  1X8U A;  1IIU A;  2OY5 O;  2FHL A;  4I60 A;  3PH5 A;  1NC9 A;  3STK A;  4INN A;  4AZQ A;  3MBT A;  4ZCB A;  4COT A;  3Q34 A;  4XMD A;  4XMF A;  4AZO A;  3I17 A;  3T2X A;  3MVF A;  1FEN A;  3FYF A;  5C0N A;  1JZU A;  1STR B;  2RTD B;  2Q4N A;  4ODD A;  4TNN A;  1I06 A;  3SAO A;  1ADL A;  2FS7 A;  1FE3 A;  1SWK A;  1PEE A;  3VG2 A;  1SWD A;  3VU1 A;  2JGS A;  3WXQ A;  1SWJ A;  1TOU A;  2FHN X;  2GH7 A;  4QZU A;  1SRH A;  1X8P A;  2MO5 A;  3BLG A;  3P02 A;  2OVE A;  5B3M O;  4QYP A;  5LJC A;  1CBR A;  3P6C A;  1HBP A;  3B2K A;  5H9A A;  2NNQ A;  3KQ0 A;  4NV8 A;  3P6F A;  2CM4 A;  1KQX A;  3UAQ A;  3FEN A;  3PQS A;  1VWM B;  2OL7 A;  1JMZ A;  2QMI A;  5H9K A;  2L9C A;  1JJU A;  3STN A;  3RE5 A;  2C4I A;  2QOM A;  4WFU A;  4YKO A;  1OBQ A;  4BX6 B;  1X8O A;  1GKA B;  1EQD A;  2BC3 A;  1IFB A;  2QOS C;  4GKC A;  5FQ7 E;  3DSZ A;  2IZG B;  4GGR A;  3RKG A;  3D95 A;  3B2J A;  4CDD A;  1VWH B;  1OBU A;  1MDC A;  1FEL A;  2KD2 A;  2RTE B;  2JU8 A;  3QKG A;  2G78 A;  2Z4H A;  3HWE A;  4M6S A;  3B2H A;  5D45 A;  5D47 A;  3BS2 A;  5B2A O;  3U9P C;  5CE4 A;  1JYJ A;  4O4S A;  3WJF A;  2RQ0 A;  1QY1 A;  3N91 A;  1SWF A;  3D96 A;  1U17 A;  3STM X;  2CZT A;  1VWB B;  1TW4 A;  2Q39 A;  3OE3 A;  4KH8 A;  2IZK A;  2WPU A;  5K06 A;  3WJG A;  1S2P A;  4AZM A;  4FBO A;  5L3Y A;  1W6F A;  4I3D A;  4O4O A;  4BX5 A;  1TOW A;  1O8V A;  3WZQ A;  3RBY A;  4OEM A;  3BX7 A;  1FJ1 E;  1GX8 A;  5DPQ A;  1SXX A;  5HZQ A;  4A1H A;  5BVQ A;  2IZD B;  4IB7 A;  1KXO A;  3WYQ A;  2Y3F A;  3PEC A;  4ALO A;  1SY1 A;  1TXL A;  4U8U O;  1DFV A;  2QO6 A;  3VG6 A;  5HBS A;  2IZE B;  3BDR A;  4KII A;  1ML7 A;  2AH7 X;  3ZZV A;  1SMP I;  1SWN A;  1N9Y A;  1VWR B;  1GT1 A;  1O1U A;  2A0A A;  2Q2M A;  4HPD A;  4NV7 A;  4QNI A;  1SWB A;  1SWG A;  4U8U M;  1BJ7 A;  1DZK A;  2K62 A;  3EW2 A;  4OS8 A;  3V8U A;  4QGX A;  5EZ2 A;  3B2I A;  3HTY A;  4O3W A;  1EUO A;  1PBY A;  1QWD A;  1RBP A;  2CAM A;  2Y3E A;  5HAE A;  4MIR A;  4Z2O A;  3C76 X;  2I5V O;  5CSE A;  3BRN A;  4LQZ A;  4MVE A;  1FEM A;  1G5W A;  2GC9 A;  1VWJ B;  1Y9T A;  3FR4 A;  1P6P A;  3PP6 A;  4NNS A;  4FBV A;  3HWD A;  1RLB E;  3K3L A;  4PJ2 A;  3TF6 A;  5L8O A;  4BX7 A;  2X55 A;  2FGS A;  3C77 X;  3FA7 A;  4Y0P A;  2RCQ A;  1UZ2 X;  4QQ1 A;  1SRG A;  3WYP A;  3ZWE A;  1LPJ A;  3H3I A;  5B11 O;  2L67 A;  1VWF B;  3CKF A;  4FGI B;  3UEV A;  1U0X A;  3RE6 A;  3ELZ A;  2R74 A;  4GNY A;  1IW2 A;  4YH0 A;  1OPA A;  2AT5 X;  2MWH A;  2N93 A;  2A2G A;  1VWC B;  2IZB A;  3EMM A;  5F2B A;  3S60 A;  1LIF A;  1G74 A;  1MVG A;  2C1Q A;  1BEB A;  2BHV A;  2FLJ A;  1JJX A;  5D48 A;  1MEP A;  1KZX A;  2FR3 A;  1KL5 A;  1KOI A;  1LFO A;  4ORX A;  2BT9 A;  5FQ6 E;  3S5X A;  3OD9 A;  5H9N A;  4ES7 A;  1K24 A;  1HBQ A;  1BSQ A;  3HWF A;  4IB8 A;  4WBK A;  2HKD A;  5DG4 A;  4BVM A;  2AMM X;  1QAB E;  1KL3 A;  4U46 A;  1YP7 A;  1H91 A;  1LKE A;  4GE1 A;  1YWA A;  1MM9 A;  1NQM A;  3PK2 A;  4EFG A;  1BSO A;  1SWH A;  1UYO X;  3FMZ A;  4OS0 A;  1ZNH A;  3CBC A;  1ICM A;  4YBU A;  5HCD C;  5IXG A;  3F6Z B;  3SZI A;  2C1S A;  2LA7 A;  4GGT A;  4TKJ A;  1VWN B;  1VWE B;  4L3R A;  2FT9 A;  5K67 A;  1SWP A;  2A5C A;  2KTD A;  4OKA A;  1G85 A;  1LUQ A;  4UU3 A;  2Y32 A;  1X8N A;  4AZN A;  1LIC A;  4ORW A;  2DJF A;  1DF8 A;  2G79 A;  2JMB A;  2KT4 B;  4QRL A;  2X4M A;  2X8T A;  2GTF X;  3FR2 A;  2A2U A;  5HZ9 A;  3OBL A;  2WEX A;  3NX2 A;  2JW1 A;  3AKM A;  3FID A;  4N7C A;  2OFR X;  3NPO A;  2G7B A;  3QQ2 A;  3CKG A;  2A8G A;  2Z4I A;  5EDB A;  1OEE A;  2WQ9 A;  4Z2V A;  4Y5D A;  5FAZ A;  2Q9S A;  4OEL A;  3VHH A;  1A57 A;  4EQA C;  3GAQ A;  2ACO A;  3BU9 A;  5H8T A;  2IZH B;  3EM0 A;  2LB6 A;  2OYB O;  2A5B A;  2FS6 A;  5IRW A;  1UYN X;  1BWY A;  2QO5 A;  3AKN A;  4I9S A;  4IAW A;  1VYG A;  3F8A A;  4QYN A;  3WJB A;  1AVD A;  1KQW A;  1T0V A;  3CMP A;  3FEK A;  2OL8 O;  2LBA A;  4O3X B;  4CPI A;  1HMS A;  4TKH A;  2L5P A;  4I6S A;  3RZY A;  2LBV A;  5BVS A;  5HTD A;  4IAB A;  1VWG B;  1VWI B;  4BX6 A;  4M7M A;  1B0O A;  5KID A;  2KTS A;  1I78 A;  1VPR A;  1JJJ A;  1SXW A;  2NNE A;  3AUM O;  2YMS A;  3WZO A;  1AVG I;  1LNM A;  3TGB A;  1BM5 A;  4WHI A;  1JYD A;  3D9W A;  5IO6 A;  3NP1 A;  1JBH A;  4ORU A;  1GT5 A;  2RTK A;  3LTW A;  4ZJ0 A;  3VG3 A;  2FWV A;  2CBR A;  2HMB A;  3ZUI A;  1XKI A;  5LKF A;  4I95 A;  4LKP A;  1AB0 A;  1NP4 A;  5D8J A;  4Z27 A;  1Y9L A;  4TLJ A;  3WVM A;  3IFB A;  4CDE A;  4ZHD A;  4U8U N;  3CBS A;  4B55 A;  3KFG A;  2HZQ A;  2RTA A;  5B5F A;  5H9L A;  4YCE A;  4HWM A;  4YGG A;  1KT4 A;  3VG7 A;  4A60 A;  1HMR A;  1GM6 A;  2CM9 A;  3SLJ A;  3APV A;  5HA0 A;  2IZL B;  2RTM A;  1BLR A;  1QQS A;  1DC9 A;  1QG5 A;  1YWB A;  3C78 X;  3FW4 A;  1KFF A;  3JQO A;  2W2B A;  4QGV A;  4TKB A;  1VWO B;  3U03 A;  4IMO A;  4IB6 A;  4HPB A;  5HZ5 A;  1SWA A;  4XME A;  5EPQ A;  5LJD A;  5F1E A;  1FDQ A;  4ZHH A;  4ZGF A;  3WJD A;  1A2D A;  1W5R A;  2AKQ A;  2CZU A;  1VYO A;  3KFF A;  4CDF A;  1KT3 A;  2ZAI A;  1E06 A;  1SWU A;  1PBO A;  3ZW1 B;  2DM5 A;  1SWO A;  1EAL A;  2GTL M;  2IZI A;  1OPB A;  2FRS A;  1ZNE A;  5IO5 A;  3MX7 A;  4IAX A;  4CDC A;  5KHP A;  1O1V A;  4ORY A;  2RD7 C;  3APW A;  5D4A A;  2RCT A;  4AZR A;  3O22 A;  4ZHC A;  1N43 A;  1CRB A;  3LV4 A;  2RTR B;  1KT6 A;  1ZNL A;  1AEL A;  1LCV A;  3DTQ A;  4BX5 B;  2YG2 A;  4ZR2 A;  1ZRY A;  2XKL A;  1B8E A;  3PPT A;  3PQU A;  2JN3 A;  1X89 A;  1SWT A;  4NW4 A;  3VHI A;  2CBS A;  1KT5 A;  1MOY A;  2X8S A;  2VFB A;  1SWL A;  5AEO A;  4GRJ A;  4BQU A;  1GGL A;  2M4L A;  3FLL A;  4RUU A;  1X71 A;  2Q2P A;  1GX9 A;  4YDB A;  3T2W A;  1WBI A;  4BGF A;  4Y0S A;  5HZ8 A;  3ZUO A;  2GJ5 A;  2RTQ B;  1B56 A;  1BRQ A;  1DZP A;  4YFQ A;  1ACD A;  1SLG B;  2AT0 X;  2UZ2 A;  2WR6 A;  1HQQ A;  4GDZ A;  4GU8 A;  3NR3 A;  3WBG A;  4GGZ A;  3WZP A;  1JIW I;  2RTH B;  4HPC A;  4XMH A;  3TGC A;  4PSQ A;  3D97 A;  1SA8 A;  4Y0R A;  1NDJ A;  2NP1 A;  1SRI A;  2QM9 A;  3P6D A;  2OL6 O;  4NP1 A;  4EEJ A;  2ACP X;  3UEX A;  3TZS A;  4O4X A;  1SWS A;  4R0B A;  4DQ4 A;  1A18 A;  1OEJ A;  2ANS A;  3X00 A;  1Y53 X;  2WQA E;  1VWP B;  1I05 A;  3CR6 A;  3HOL A;  4QGW A;  5CYB A;  4CPH A;  1DV9 A;  3SLT A;  2DJG A;  3D4R A;  2IZJ A;  5LJK A;  4I3C A;  2IZA A;  1VWQ B;  3F9D A;  4BX7 B;  1EPA A;  1E02 A;  2RTP B;  3ZW0 A;  1KGL A;  1LIE A;  4Y59 A;  3WJE A;  1NP1 A;  3VPJ E;  1DF3 A;  3RSW A;  2W2A A;  3O2Y A;  2EU7 X;  4IBA A;  1KZW A;  1A3Y A;  3B2L A;  1Y52 X;  3FEP A;  2A13 A;  2FR2 A;  2QCB A;  3WZN A;  2BSZ A;  1GT4 A;  2FTB A;  3NX1 A;  2BS5 A;  2MHD A;  3O19 A;  4JHQ A;  4FQB B;  3RDX A;  2PI3 O;  1EIO A;  1YIV A;  1HMT A;  1RXK A;  2AT8 X;  2L68 A;  3VHM A;  1E00 A;  1QFV A;  5HCE C;  3T6F A;  3FW5 A;  1Y0G A;  2F09 A;  2OVA A;  3VE1 A;  2POA A;  4AYH A;  1S44 A;  2IZC B;  3BX8 A;  3P6G A;  1CJ5 A;  3ELX A;  2OVD A;  3KZA A;  1VWA B;  2MF6 A;  1RXJ A;  3RY2 A;  3APU A;  2BLG A;  2KW1 A;  1ICN A;  1MK5 A;  4U3Q A;  3G7X A;  3NQ9 A;  3UEU A;  3AEH A;  4BBO A;  2RTI B;  2RTO B;  3EYC A;  2RTJ A;  2F73 A;  3FDC A;  2RTN B;  3HWG A;  4GUZ A;  4OMW A;  3SZH A;  1QFT A;  3LHN A;  5JD2 A;  2UYW A;  3RDO A;  1WUB A;  1ERX A;  5HCC C;  4LZV A;  2HLV A;  1RST B;  1MX7 A;  2OY8 A;  5F6B A;  5FFH A;  3CWK A;  4U9C A;  4GJV A;  1KL4 A;  4ML7 B;  2G8C O;  3FIQ A;  2P8G A;  2OY7 A;  3NQ3 A;  2G5L A;  5F6Z A;  2OFM X;  4EKV A;  3FEL A;  1MX8 A;  1LCZ A;  5HWZ A;  4KT5 A;  4ON1 A;  3P6H A;  4CPF A;  1JMX A;  2RTL A;  2HNX A;  1GT3 A;  3P24 A;  1N4J A;  1URE A;  4CPE A;  4MIS A;  1GKA A;  3NQK A;  3CQN A;  4O9S A;  2RTF B;  2HYS A;  2FKJ A;  2AL0 X;  3HK1 A;  1SWE A;  2OVS A;  3RDQ A;  1PMP A;  4ZH9 A;  4ZHF A;  2F01 A;  1FTP A;  1RXH A;  3E3C A;  4LZU A;  1K3B A;  5IRU A;  3VGW A;  1SRE A;  4N7D A;  5KIC A;  1HXL A;  1LEL A;  1SLD B;  4DCB A;  1TVQ A;  3RWX A;  5CHK A;  4D6A A;  5BVT A;  5JR8 A;  1Y55 X;  1G7N A;  2X45 A;  1JV4 A;  1Z24 A;  3JS1 A;  1JQP A;  1STP A;  4O4U A;  5FQ8 E;  3EBK A;  5LJB A;  1BRP A;  3JSQ A;  1IJ8 A;  1PM1 X;  4OMX A;  3MM0 A;  2HZR A;  4GD9 A;  5EDC A; 
#chains in the Genus database with same CATH homology
 2MJI A;  1SXU A;  3BY0 A;  5L8I A;  1IKJ A;  2K23 A;  4DQ3 A;  5L8N A;  2GTL N;  2WWP A;  1DZM A;  3FR5 A;  3PED A;  1CBI A;  3EBW A;  3WJC A;  2PY1 A;  4NYR A;  1D3S A;  5AQ6 A;  1YP6 A;  2NND A;  1YUP A;  4CK4 A;  2A3F X;  1HN2 A;  2ASN X;  3KFI A;  1QY2 A;  3FA8 A;  1ZND A;  2O62 A;  4HPA A;  1S7D A;  1E5P A;  5LJG A;  4EXZ A;  3HOE A;  4EDE A;  2GTL O;  4YFP A;  4O3Y A;  1T8V A;  3ZW1 A;  3NBX X;  1IKE A;  2IFB A;  2RN4 A;  3KFH A;  4QZT A;  4XMG A;  4Y0Q A;  4O49 A;  3ZI8 A;  4NLJ A;  3BSZ E;  1BSY A;  1LF7 A;  3ZQ3 A;  3CQR A;  1T68 X;  4UU2 A;  4A1Y A;  1R0U A;  4ID2 A;  4ORR A;  1AQB A;  1QY0 A;  4RUN A;  3U0D A;  3OJY C;  1NGL A;  1EXS A;  3IA8 A;  5B29 A;  3UEW A;  4OS3 A;  1CBS A;  1ZNG A;  3FA9 A;  3S5V A;  3TGA A;  2WEW A;  1D2U A;  2JOZ A;  3GE2 A;  2XST A;  4FBR A;  1SXY A;  4NLI A;  4AW8 A;  5HA1 A;  5BYP A;  4YCH A;  4GNW A;  3PH6 A;  1IFC A;  1XCA A;  2AT6 X;  4HFO A;  5EEE A;  4ZH6 A;  1N0S A;  5HTE A;  4KC7 A;  5F7G A;  1I04 A;  4KCA A;  4BOE A;  1CBQ A;  4KC8 A;  5FEN A;  4L1N A;  5HZ6 A;  3VG4 A;  1LID A;  4YDA A;  2LFO A;  4MVK A;  4I3B A;  3I0A A;  1ZNK A;  1OEK A;  4NYQ A;  2LKK A;  4ZHG A;  2AT3 X;  1EW3 A;  4MVL A;  3ZW2 A;  4D6B A;  4ARH A;  4ZGU A;  1I4U A;  4JGL A;  5EED A;  2WUT A;  1MUP A;  1BBP A;  2RA6 A;  4CSB A;  2OZQ A;  2BS6 A;  4LKT A;  4XMC A;  4CV7 A;  2JU3 A;  3NAD A;  1SY0 A;  3VE2 A;  5AJC A;  1OBP A;  5AJB A;  4YMY A;  2E4J A;  4IMN A;  1DZJ A;  3BU1 A;  4YGH A;  2W2F A;  3P6E A;  4IB9 A;  1EPB A;  3Q6L A;  3VG5 A;  5LKE A;  1L6M A;  2JU7 A;  4YGZ A;  4GH7 A;  3WOV A;  4YBP A;  1EII A;  2X46 A;  3L4R A;  5LJE A;  1SY3 A;  1X8Q A;  4K19 A;  1VYF A;  1KT7 A;  4NNT A;  4O3Z A;  4GK9 A;  1HQP A;  5B27 A;  2ALL X;  3T1D A;  4ALB A;  5LJH A;  1YWC A;  2MM3 A;  2QO4 A;  2ZAG A;  1SY2 A;  4ORS A;  4QAE A;  4TJZ A;  5F58 A;  1B4M A;  2R73 A;  3ZW0 B;  3APX A;  4WFV A;  2R56 A;  4YFR A;  3FA6 A;  1ALB A;  4A8Z A;  1GXA A;  4I9R A;  3SOT A;  4TQ2 A;  1U18 A;  4GET A;  4GZV A;  1YWD A;  5IO7 A;  1ERB A;  4YKM A;  2WSJ A;  3S26 A;  1EI5 A;  2X8F A;  4MVI A;  4AZP A;  1LIB A;  4ZFX A;  1X8U A;  1IIU A;  4AZQ A;  3STK A;  3PH5 A;  4INN A;  3MBT A;  4ZCB A;  4COT A;  4XMD A;  4XMF A;  4AZO A;  3I17 A;  3MVF A;  1FEN A;  3FYF A;  5C0N A;  1JZU A;  4ODD A;  2Q4N A;  4TNN A;  1I06 A;  3SAO A;  1ADL A;  2FS7 A;  1FE3 A;  1PEE A;  3VG2 A;  3VU1 A;  3WXQ A;  1TOU A;  4QZU A;  2MO5 A;  1X8P A;  3BLG A;  3P02 A;  2OVE A;  4QYP A;  5LJC A;  1CBR A;  3P6C A;  1HBP A;  3B2K A;  5H9A A;  2NNQ A;  3KQ0 A;  3P6F A;  2CM4 A;  1KQX A;  3UAQ A;  3FEN A;  3PQS A;  5H9K A;  2QMI A;  2L9C A;  3STN A;  4WFU A;  4YKO A;  1OBQ A;  1X8O A;  1GKA B;  1EQD A;  5FQ7 E;  1IFB A;  2QOS C;  4GKC A;  3RKG A;  3DSZ A;  5HCC C;  3D95 A;  3B2J A;  1OBU A;  1MDC A;  1FEL A;  2KD2 A;  2JU8 A;  3QKG A;  2G78 A;  2Z4H A;  3HWE A;  4M6S A;  3B2H A;  5D45 A;  5D47 A;  3BS2 A;  3U9P C;  5CE4 A;  1JYJ A;  4O4S A;  3WJF A;  2RQ0 A;  1QY1 A;  3N91 A;  3D96 A;  3STM X;  1U17 A;  2CZT A;  1TW4 A;  2Q39 A;  3OE3 A;  4KH8 A;  5K06 A;  3WJG A;  1S2P A;  4AZM A;  4FBO A;  4I3D A;  4O4O A;  1TOW A;  1O8V A;  3RBY A;  3BX7 A;  1GX8 A;  5DPQ A;  1SXX A;  5HZQ A;  4A1H A;  5BVQ A;  4IB7 A;  1KXO A;  3PEC A;  4ALO A;  1SY1 A;  1TXL A;  4U8U O;  1DFV A;  2QO6 A;  3VG6 A;  5HBS A;  3BDR A;  4KII A;  1ML7 A;  2AH7 X;  3ZZV A;  1SMP I;  2Q2M A;  1GT1 A;  1O1U A;  2A0A A;  4HPD A;  4QNI A;  4U8U M;  1BJ7 A;  1DZK A;  2K62 A;  4OS8 A;  3V8U A;  4QGX A;  5EZ2 A;  3B2I A;  3HTY A;  4O3W A;  1EUO A;  1QWD A;  1RBP A;  5HAE A;  4MIR A;  3C76 X;  1G5W A;  3BRN A;  4LQZ A;  4MVE A;  1FEM A;  2GC9 A;  1Y9T A;  3FR4 A;  1P6P A;  3PP6 A;  4NNS A;  4FBV A;  3HWD A;  1RLB E;  3K3L A;  4PJ2 A;  3TF6 A;  5L8O A;  3C77 X;  3FA7 A;  4Y0P A;  2RCQ A;  1UZ2 X;  4QQ1 A;  3ZWE A;  1LPJ A;  3H3I A;  2L67 A;  4FGI B;  3UEV A;  1U0X A;  3ELZ A;  2R74 A;  4GNY A;  1IW2 A;  4YH0 A;  1OPA A;  2AT5 X;  2MWH A;  2N93 A;  2A2G A;  3EMM A;  3S60 A;  1LIF A;  1G74 A;  1MVG A;  1BEB A;  2BHV A;  2FLJ A;  1JJX A;  5D48 A;  1KZX A;  2FR3 A;  1KOI A;  1LFO A;  4ORX A;  2BT9 A;  5FQ6 E;  3S5X A;  3OD9 A;  5H9N A;  4ES7 A;  4WBK A;  1HBQ A;  1BSQ A;  3HWF A;  4IB8 A;  5DG4 A;  4BVM A;  2AMM X;  1QAB E;  1YP7 A;  1H91 A;  1LKE A;  4GE1 A;  1YWA A;  4EFG A;  1BSO A;  3FMZ A;  4OS0 A;  4YBU A;  5HCD C;  1ZNH A;  3CBC A;  1ICM A;  3F6Z B;  2LA7 A;  4TKJ A;  4L3R A;  2FT9 A;  4UU3 A;  2KTD A;  1G85 A;  1X8N A;  4AZN A;  1LIC A;  4ORW A;  2G79 A;  2KT4 B;  2JMB A;  4QRL A;  2X8T A;  2GTF X;  3FR2 A;  2A2U A;  5HZ9 A;  3OBL A;  2WEX A;  3NX2 A;  2JW1 A;  3AKM A;  4N7C A;  2OFR X;  3NPO A;  2G7B A;  2Z4I A;  5EDB A;  1OEE A;  2WQ9 A;  5FAZ A;  2Q9S A;  1A57 A;  4EQA C;  3GAQ A;  2ACO A;  3BU9 A;  5H8T A;  3EM0 A;  2LB6 A;  2FS6 A;  1BWY A;  2QO5 A;  3AKN A;  4I9S A;  4IAW A;  1VYG A;  3F8A A;  4QYN A;  3WJB A;  1KQW A;  3FEK A;  1T0V A;  3CMP A;  4O3X B;  2LBA A;  1HMS A;  4TKH A;  2L5P A;  4I6S A;  3RZY A;  2LBV A;  5BVS A;  5HTD A;  4IAB A;  4M7M A;  1B0O A;  5KID A;  2KTS A;  1VPR A;  1JJJ A;  1SXW A;  2NNE A;  3TGB A;  2YMS A;  1AVG I;  1LNM A;  1BM5 A;  4WHI A;  1JYD A;  5IO6 A;  1JBH A;  3NP1 A;  4ORU A;  1GT5 A;  4ZJ0 A;  3VG3 A;  2FWV A;  2CBR A;  2HMB A;  3ZUI A;  1XKI A;  5LKF A;  4I95 A;  4LKP A;  1AB0 A;  1NP4 A;  5D8J A;  1Y9L A;  4TLJ A;  3WVM A;  3IFB A;  4ZHD A;  4U8U N;  3CBS A;  3KFG A;  2HZQ A;  5H9L A;  4YCE A;  4HWM A;  4YGG A;  1KT4 A;  3VG7 A;  4A60 A;  1HMR A;  1GM6 A;  2CM9 A;  3APV A;  5HA0 A;  1BLR A;  1QQS A;  1DC9 A;  1QG5 A;  1YWB A;  3C78 X;  3FW4 A;  3JQO A;  2W2B A;  4QGV A;  4TKB A;  3U03 A;  4IMO A;  4IB6 A;  4HPB A;  5HZ5 A;  4XME A;  5EPQ A;  5LJD A;  5F1E A;  1FDQ A;  4ZHH A;  4ZGF A;  3WJD A;  1A2D A;  2AKQ A;  2CZU A;  3KFF A;  1KT3 A;  2ZAI A;  1E06 A;  1PBO A;  3ZW1 B;  2DM5 A;  1EAL A;  2GTL M;  5IO5 A;  1OPB A;  2FRS A;  1ZNE A;  5KHP A;  3MX7 A;  4IAX A;  5LJK A;  1O1V A;  4ORY A;  2RD7 C;  3APW A;  5D4A A;  2RCT A;  4AZR A;  3O22 A;  4ZHC A;  1CRB A;  3LV4 A;  1KT6 A;  1ZNL A;  1AEL A;  3DTQ A;  2YG2 A;  4ZR2 A;  1ZRY A;  2XKL A;  1B8E A;  3PPT A;  3PQU A;  2JN3 A;  1X89 A;  4NW4 A;  2CBS A;  1KT5 A;  2X8S A;  5AEO A;  4GRJ A;  4BQU A;  1GGL A;  2M4L A;  3FLL A;  4RUU A;  1X71 A;  2Q2P A;  1GX9 A;  4YDB A;  4Y0S A;  5HZ8 A;  3ZUO A;  2GJ5 A;  1B56 A;  1BRQ A;  1DZP A;  4YFQ A;  1ACD A;  2WR6 A;  2AT0 X;  4GDZ A;  3WBG A;  4GU8 A;  3NR3 A;  1JIW I;  4HPC A;  4XMH A;  3TGC A;  4PSQ A;  3D97 A;  1SA8 A;  4Y0R A;  3P6D A;  2NP1 A;  2QM9 A;  4EEJ A;  4NP1 A;  3TZS A;  2ACP X;  3UEX A;  4O4X A;  4R0B A;  4DQ4 A;  1A18 A;  1OEJ A;  2ANS A;  2WQA E;  1I05 A;  3CR6 A;  3HOL A;  4QGW A;  5CYB A;  1DV9 A;  3D4R A;  4I3C A;  3F9D A;  1EPA A;  1E02 A;  3ZW0 A;  1KGL A;  1LIE A;  3WJE A;  1DF3 A;  1NP1 A;  3VPJ E;  3RSW A;  2W2A A;  3O2Y A;  2EU7 X;  4IBA A;  1KZW A;  1A3Y A;  3B2L A;  3FEP A;  2A13 A;  2FR2 A;  1GT4 A;  2FTB A;  3NX1 A;  2BS5 A;  2MHD A;  3O19 A;  4FQB B;  1EIO A;  1YIV A;  1HMT A;  2L68 A;  2AT8 X;  1E00 A;  1QFV A;  5HCE C;  3FW5 A;  2F09 A;  2OVA A;  3VE1 A;  4AYH A;  2POA A;  1S44 A;  3BX8 A;  3P6G A;  1CJ5 A;  3ELX A;  2OVD A;  3KZA A;  3APU A;  2BLG A;  2KW1 A;  1ICN A;  4U3Q A;  3G7X A;  3NQ9 A;  3UEU A;  3EYC A;  2F73 A;  3HWG A;  4OMW A;  1QFT A;  3LHN A;  1ERX A;  4LZV A;  2HLV A;  5FFH A;  1MX7 A;  5F6B A;  3CWK A;  4U9C A;  4ML7 B;  3FIQ A;  2P8G A;  3NQ3 A;  5F6Z A;  2OFM X;  3FEL A;  1MX8 A;  5HWZ A;  4KT5 A;  4ON1 A;  3P6H A;  2HNX A;  1GT3 A;  3P24 A;  1URE A;  4MIS A;  1GKA A;  3NQK A;  3CQN A;  4O9S A;  2HYS A;  2AL0 X;  3HK1 A;  2OVS A;  1PMP A;  4ZH9 A;  4ZHF A;  1FTP A;  3E3C A;  4LZU A;  4N7D A;  5KIC A;  1TVQ A;  3RWX A;  4D6A A;  5BVT A;  5JR8 A;  1G7N A;  2X45 A;  1JV4 A;  1Z24 A;  3JS1 A;  4O4U A;  5FQ8 E;  3EBK A;  5LJB A;  1BRP A;  3JSQ A;  4OMX A;  1PM1 X;  2HZR A;  5EDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...