4BR4A

Legionella pneumophila ntpdase1 crystal form i, open, apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br4A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br4A02
1K8KA 1QQOA 3QFUA 4XH1A 1XC3A 3H3OB 2AA4A 5E26A 3O1WA 2A5XA 3MDQA 3O4WA 3FZKA 3VGMA 4FO0A 1HLUA 1ZC6A 3CIPA 1NGBA 2QWQA 3ZX2A 4CBXA 4K41A 3LDNA 2NZTA 4K25A 1U2VA 3VGKA 4PL8A 1X9JA 3L0QA 2E1YA 4M7YA 1BWFO 1NLVA 1D4XA 2ZGYA 3H1QA 3MN6A 4IJAA 4BGAA 3W3DA 4BRCA 4WQ5C 3BP8A 5EOYA 3QICA 4BG9A 3B8AX 3DXMB 1WOQA 1QZ6A 3VETA 1NGJA 4O5FA 5AQTA 4B1UB 4GY2B 4F9OA 5KPTA 2FLOA 3JS6A 2GUPA 4H5VA 2QWNA 3A5LC 3CJ7A 2QW9A 4JNEA 4JN4A 3H46O 1V4TA 1HJOA 2A41A 1E4FT 1YUWA 4CZHA 4CBUA 1HKCA 3W0LA 4PKGA 5AR0A 4BRGA 5AQYA 3LM9A 5AQNA 4PL7A 5FPNA 2EWSA 4CZJA 3DXKA 2V51B 2CH6A 2E2OA 1TUUA 3LM2A 1GLLO 4YDUC 5AQUA 4ISFA 5AZIA 5AQLA 3D2EB 3GG4A 3TPQA 2I7PA 4JD2B 4MLEA 3A5NC 3CQYA 5TKYA 1MWMA 4BC3A 4IWVA 4CJ7A 5BPMA 1NMDA 3C0BA 3H45C 1NM1A 2E8AA 1QHAA 1XQSC 2Q97A 5KPRA 3D2FA 3U9ZA 4FWMA 1KAXA 5FPEA 1QQMA 3ZX0A 3CJAA 3MN9A 2FSKA 4A62A 1WUAA 4CD3A 1JCEA 2A3ZA 3QB0A 4DQ8A 1QZ5A 2J4RA 4FL9A 3SLCA 2VYPA 3LL3A 3L4IA 2D1KA 2YHYA 2GWKA 3ZX3A 2ASPA 4FPAA 1BDGA 4XH4A 1U2VB 5LY3A 2P9LB 4J8FA 4BRQA 5AQMA 3IDHA 2E2QA 4BRAA 3C7NA 2P9UB 1SQKA 1NGEA 4KBOA 2FSJA 1NGAA 2A40A 2AP1A 2QXLA 3H1VX 3ID8A 3EL2A 4JHDA 2CH5A 2FF6A 1BG3A 3ATUA 1Z6RA 3WQTA 4RCHA 4BRFA 3FZLA 5AZJA 1NBWA 4AM7A 1H1VA 2GELA 3G25A 5BN8A 4JHDB 3CJ1A 3FE1A 4BQZA 4B1ZA 3SMSA 4BQLA 1JCGA 3WXJA 3EKSA 3ENOA 3FFKB 2IVNA 3HSCA 1IG8A 4H5NA 2P9SB 3RSEA 2D0PA 4BVOA 4FOIA 1HX1A 3J8AA 3WXLA 1Q18A 3UKUB 3AAPA 4BR7A 3UKRB 2F9WA 4FWNA 4QS8A 5BRFA 3HBTA 5JICA 1X3NA 2P9KA 3A5OC 4HWIA 3S41A 5BPNA 3HTVA 4WQ5A 4BG8A 2V7YA 4RTFD 5ADXA 2FF3B 1RGIA 3ZETA 3CJ9A 3WT0A 4K42A 5BR9A 2CGJA 3IUCA 1NGGA 3EO3A 4MO4A 1BOTO 3WXIA 4CZFA 3HI0A 1RFQA 1S22A 3CJCA 4FWLA 3EN9A 3VEVA 3ZEUA 3QFPA 3IFRA 3DWLA 1GLJO 2P9NA 1BUPA 2FXUA 5AZIB 2Q1NA 3LDPA 2E1ZA 2UYTA 2VCPA 2ZGZA 2ASOA 3MK6A 5F0XA 3FGUA 1S3XA 2ZF5O 4I6MA 2E2NA 3ZETB 2VWBA 5LJWA 5AQWA 3L6QA 2P9NB 4PKHA 5AQIA 4CZEA 3CHWA 5AQPA 4WQ4C 5AFUH 2BUPA 4IZ9A 1ATNA 3P4IA 3QBWA 3QBXA 4MLHA 3UKUA 4BRLA 2Q0RA 4QS7A 4QS9A 4BRHA 3O08A 4FWOA 1GLFO 2ZWHA 3AARA 2HF4A 2Q31A 1LCUA 3FZMA 3QMLA 4IXCA 3VERA 3MN7A 5JLHA 4H5TA 4FWPA 5AFUA 2YJFA 3VEZA 1V4SA 1RDWX 2V7ZA 4K43A 4WYBA 3VF6A 4CD1A 3ENHA 3LDOA 5EVZA 1YVNA 2QWOA 2P9SA 3BF1A 3H6EA 3H3NO 3KHYA 5AQJA 3LDLA 1ATSA 1X3MA 2W40A 4PKIA 3HM8A 1MWKA 2ASMA 3C7NB 3WUHA 2IIRA 1C0GA 4M63C 2P9LA 4A2BA 1BO5O 4HTLA 4BC2A 2P9IB 2P9IA 4BC5A 2D0OA 3R8EA 3EZWA 5EXWA 5F1XA 1G99A 3VEYA 3O80A 2E88A 2D4WA 3UE5A 5AQRA 4EHUA 1GLAG 1NWKA 1Z05A 2OANA 3A0IX 3M1FA 4BGBA 3A8YA 4CI6A 1DGKN 4H0XB 4YDUA 3D2FB 3UB5A 5BPLA 3I8BA 4DHYA 3MN5A 2P9PA 4C23A 4H0PA 4O8KA 4BR0A 1E4GT 2I7NA 2A6AA 4DB3A 3FZHA 4H0VB 3WXKA 4FOEA 4FPBA 2CGLA 4FSVA 1NGCA 5BN9A 3ULEB 4BR5A 1YAGA 4B1WB 3DXKB 3U9DA 1EQYA 4H5WA 2A42A 3VF4A 5CE3A 5EY4A 4E1JA 1GLEG 1ZXOA 1NGHA 2HF3A 3ATVA 3ZEUB 1P8ZA 1DEJA 4H0YB 3U8XA 4JD2A 3MCPA 2QWLA 4BC4A 4EAHD 4ISEA 5FPDA 1MDUB 3GOIA 2YJEA 3OHRA 5AQXA 3VGLA 3O6WA 1XUPO 5AQQA 1TYQB 3SMPA 1ESVA 4ISGA 3MMVA 5BRHA 5AQKA 5FPMA 3BUZB 4BRPA 3ULEA 2ITMA 4H5RA 3M6GA 5B8HA 4BRIA 3D7EO 2YI1A 2KHOA 3DJCA 3DAWA 4FWKA 2NLXA 3CJBA 2QWPA 4GNIA 1SZ2A 4JAXA 3WEEB 1KAYA 4B1VA 5JLFA 5AQSA 4BRDA 3F9MA 4B1XB 3VPZA 4BREA 3AY9A 3JXUA 3A5MC 3O5BA 2NRHA 5AQVA 3RSEB 2PAVA 5AQGA 2W41A 4IJNA 4CZIA 3VEWA 4CZKA 2Q36A 1U6ZA 4BRKA 3CETA 2F9TA 3GBTA 4CZMA 4BROA 4H0OA 4FWSA 4EHTA 2WUSA 5AQZA 1BU6O 5LJVA 4EFHA 2E2PA 4FWRA 1GLDG 5KQ8A 3KZBA 1JCFA 1QQNA 4CBWA 4AM6A 3U4LA 4CZGA 1NGDA 3VOVA 1R59O 1T44A 4XEIA 2P9UA 5EX5A 1K8KB 1ATRA 2H3GX 1HPMA 2HMPA 1GLBG 3I33A 4WQ4A 2IVOA 2QM1A 5AQHA 5AZJB 3SK3A 4H03B 2YHWA 3WEEA 1MA9B 1ZBSA 3VESA 1T6CA 4DCHA 5BRDA 4IO8A 4A2AA 3HZ6A 5ADXH 3CQXA 4Y0WA 4EIAA 2DPNA 4Z94A 3VENA 1BA0A 4I6MB 4XH5A 3GE1A 3VEOA 1J6ZA 1NGFA 3QDKA 1GLCG 5F2RA 2V52B 2PBDA 5BREA 2CGKA 3BF3A 5E84A 4BR9A 1KXPA 5ELZA 2GEMA 2GWJA 2YHXA 3FZFA 3VF2A 3WQUA 5JMVA 2FSNA 2GTDA 5AQOA 3D2EA 2Q0UA 3SJHA 1CZAN 1LOTB 3O8MA 5AQFA 4FWQA 3CERA 4NB4A 1TYQA 3O1BA 1IJJA 4B9QA 4RWTA 2E20A 4H0TB 2QWRA 3VEXA 2BTFA 1YXQA 5KQDA 1NGIA 3R9PA 3LDQA 5KPZA 1HKBA 2HOEA 3CI5A 3GL1A 2IVPA 3GDQA 4BR2A 3KVGA 2Q2RA 4NO7A 2P9PB 1Y64A 1BA1A 3FR0A 1C0FA 4BVPA 1OKJA 3TU5A 5I9EB 1T6DA 2YCHA 3EKUA 4L3QA 4MO5A 3R6MA 1DKGD 3DXMA 2P9KB 1KAZA 1HKGA 1SAZA 1HUXA 3M3ZA 4LC9B 3BEXA 2QWMA 3AAQA 3IMXA 3UKRA 3FLCO 4A61A 4B1YB 4BR4A 4BRMA 4BRNA 4M7XA 1TUYA 4CZLA
chains in the Genus database with same CATH superfamily
3THYA 4M3UA 4XH1A 1XC3A 5GAHP 2BH1A 3TWHA 5E26A 3AA2A 2A5XA 3VGMA 1ZC6A 4CGGA 1C6VA 2OPQA 3LDNA 3VQBA 4FJ7A 1UOCA 3L0QA 4CHOA 3SUOA 1BWFO 1NLVA 4BGAA 3KKRA 4DU3A 1YJNN 2GV9A 3DXMB 1QZ6A 1N6QA 2R7YA 4JK7A 4O5FA 5AQTA 4B1UB 5DK5A 4DR5K 4OLAA 3L3UA 1TK0A 3O9UA 2QWNA 4HCCA 1FK9A 2QW9A 4JNEA 3H46O 1LWEA 2XO7A 4KH6A 4GW6A 4PKGA 5AR0A 4CJSA 1VRUA 5HRPA 1HYSA 3T19A 4NCBA 5AQNA 1NK6A 2BE2A 5HLFA 3DXKA 1ZBHA 4PWDA 1U45A 2V51B 2E2OA 3ISNC 1TUUA 3LM2A 1GLLO 2LSNA 1RDAA 3U3GA 1M90O 1WSGA 4FLTA 3CCEN 3HJFA 1XNRK 1ZBFA 3OYAA 5HRRA 3C0BA 3AGKA 2D5RA 5CZ2A 4DF8A 1KAXA 2HBKA 3I0RA 4CJFA 3L4QA 3K9KA 4JRPA 1S1XA 3L3VA 3QB0A 2ETJA 1HNVA 4O55A 1VK0A 2YHYA 2ASPA 3N4PA 4F4KA 4J8FA 2G8HA 1YF5L 1YHQN 1Y97A 5GIOA 4DLGA 3VTIA 4IDHA 1VSFA 3EL2A 2CH5A 4Z4HA 1NK5A 3ZSQA 4BRFA 3FZLA 4IFYA 3ZLJA 4M3YA 1IV0A 4JKGA 1OH5A 1H1VA 2GELA 3G25A 5BN8A 1LW0A 5KTQA 4JHDB 3CMAN 3IRXA 4BQZA 4B1ZA 4DQIA 4CJKA 4BQLA 1JCGA 5DM6L 1C1CA 3HSCA 1VQPN 4G9ZA 4NCGA 4BVOA 4PA1A 1HX1A 1OH7A 1JKHA 2VWJA 2IC3A 1Z25A 3WXLA 3OYLA 4IOXA 3VMFB 3RMCA 3AVIA 3AO3A 1RDUA 4DFMA 4CJRA 2F9WA 2NNWA 5BRFA 5C2DA 3F73A 4E19A 2W6LA 3QIOA 3ZETA 3HOSA 3P38A 4JS4A 3PY8A 3IUCA 3HOTA 4DR4K 3V9SA 1NGGA 1SL0A 3NDKA 4JI7K 2HHSA 3MWPA 3HI0A 4JI6K 4KV8A 1K6YA 4GVEA 1RTHA 3EN9A 3VEVA 3N4QA 1FW6A 3AVMA 2Q1NA 3LDPA 1OVQA 3QERA 2ASOA 3FGUA 4E7KA 2ZM6K 3QEXA 5AQWA 3L6QA 3QEIA 1VSIA 4Q5VA 1FXXA 5AQIA 4CZEA 1ZYQA 2JWLA 5CZ1A 1ATNA 3QBXA 2YNGA 3M8PA 4BRLA 1U47A 4QS9A 3AO2A 4BRHA 3HVTA 4FWOA 4B9MA 4JI0K 3VQDA 3VERA 4FLUA 4DF4A 3EYZA 1VSHA 5AFUA 4HCBA 1TKZA 4FM0A 1U49A 4LFCK 4OO1J 1V4SA 1ZBIA 2NRVA 3LDOA 4TSXA 1I3AA 2P9SA 2DTUA 4FJ8A 4KH5A 3RTVA 4KO0A 2ASMA 3HT3A 3MECA 4A2BA 4DV3K 4X64K 4BC2A 3OBWA 1GOBA 4ILHA 4KB1A 4B9NA 3OYFA 1VSKA 1OH6A 5C24A 5I42A 1P90A 4O8UA 2D4WA 4Z4CA 3UE5A 3TAFA 1Z05A 2X6SA 3M1FA 1NK7A 5M1QA 3LP2A 1DGKN 2HSTA 3KD1E 3D2FB 5J1EA 3UB5A 2G8VA 3C6HA 1RDBA 3MN5A 4B9SA 4C23A 4H0PA 3CM6A 3DRPA 2DY4A 4O8KA 4JLHA 1LWFA 4H0VB 3WXKA 4B3TK 4DSEA 4FSVA 3LPTA 4DG1A 5E41A 1HQUA 4CIEA 2RN2A 3C6UA 3DXKB 1RBUA 1EQYA 3TR8A 4B9VA 3G71N 4FLZA 4FLVA 1S6QA 3VF4A 4DTPA 3NF6A 1Q9XA 1JXEA 3T1AA 2Q3SA 3HPOA 4FLXA 1P8ZA 4H0YB 3L2QA 4JD2A 4CEBA 4OKKA 4GKJK 1MDUB 4DV2K 4KPYA 3OHRA 5AQQA 3KTQA 5FPMA 4CJEA 1A5VA 3BGRA 2ITMA 4AHTA 3M6GA 4JI4K 3AVNA 3D7EO 4BACA 3V9XA 3DOLA 4FWKA 4DFPA 3CJBA 4GNIA 2XY8A 1SZ2A 4JAXA 3OJUA 4B1VA 3LZJA 1J9AA 3VPZA 2QEXN 4CJ5A 3JXUA 3MEGA 3RSEB 4RW4A 2PAVA 5AQGA 2W41A 1RT4A 3NF7A 1HYVA 4E1NA 1YTUA 2P51A 3TAEA 3C95A 2F9TA 4LF9K 1NK9A 3DI6A 5JS2A 2WUSA 4EHTA 1EETA 3SAGA 1BGXT 3ULDA 1NJYA 4IBNA 4HHTA 3U4LA 1RBSA 4CZGA 1R59O 4CF0A 2IAJA 4CK1A 2HBMA 5GIPA 1Q81O 4I9LA 3PSIA 3VQ5A 3I33A 1K8KB 3WNHA 1JXBA 1HPMA 5AQHA 4H03B 2HW3A 4QAGA 4EZ6A 4JK9A 4NXMK 1MA9B 3VESA 4IG3A 5T7BA 4O0JA 4FVUA 1KVAA 2KZMA 2F7TA 5JVHL 1BA0A 4I6MB 4LY7A 4OGEA 2VGMA 1GLCG 5F2RA 3ZCMA 2PBDA 4DU1A 2GUIA 2YHXA 4J2EA 3CC2N 4A5BA 2FSNA 4LSNA 3NGIA 1SKRA 1SS6A 3OYHA 2IGIA 3AA3A 3IKMA 3KLFA 1CZBA 1TYQA 3O1BA 1IJJA 1IKVA 4LH5A 4DFJA 5M1FA 2E4LA 4E7LA 3AVAA 1C0UA 2QKKA 1YXQA 5KQDA 1N32K 2IVPA 4NLCA 4FZXC 4EP5A 4LF5K 4AHSA 3AO5A 2ATQA 1C0FA 4BVPA 3S3MA 4UQGA 1OKJA 3EKUA 4DV5K 4L3QA 4CGFA 3DXMA 1KAZA 3U3YA 3S9HA 3QLHA 2ZD1A 2NRZA 4BR4A 3K5MA 4BRNA 3HXMA 3OBYA 2ZE2A 4CZLA 4DUZK 4JKCA 3JAMO 2XY6A 1IG9A 3O3HA 3MXJA 1O13A 3CIPA 1NGBA 2QWQA 4CBXA 4HVJA 1NJZA 3ZSVA 2YNFA 2G8IA 1U2VA 3PLAA 1K9MO 3VGKA 5M1NA 4DWIA 4PL8A 1X9JA 4LD0A 2E1YA 2YKMA 2ZGYA 3MN6A 3H1QA 3VQ8A 3W3DA 4BRCA 4DR3K 3KK2A 3QICA 4BG9A 1QSSA 1TVRA 3B8AX 2UXBK 1WOQA 3VETA 3T1HK 1NGJA 1RILA 3Q7BA 4B08A 2UU9K 3P31A 4N5SA 4CFAA 4F9OA 5KPTA 3L2UA 4HUGA 3O9RA 1RTDA 2FLOA 4JI5K 2GUPA 4H5VA 4JN4A 1S9EA 4CJWA 4KHSA 1V4TA 2VGNA 3PO4A 2A41A 1RCHA 4JKBA 5K14A 3WNGA 1HKCA 4L8RB 4BRGA 3LM9A 2HHUA 1BCMA 4ZTFA 3TTDA 5FPNA 2EWSA 4CZJA 1CXQA 2PY5A 1SKSA 2VG6A 5AQUA 5AZIA 1NK8A 4JD2B 1KSPA 3A5NC 4CGDA 3DLHA 3CQYA 1MWMA 2P1JA 3NFAA 1ZBLA 1NMDA 3L2RA 3H45C 1NM1A 2QA4N 2E8AA 1XQSC 2Q97A 5KPRA 3U9ZA 4IDKA 4AHUA 5FPEA 5MLCQ 3K59A 1EXQA 3MN9A 3LZIA 2A3ZA 3CCSN 2VG5A 2GX9A 4QOZB 2J4RA 2X78A 3M8SA 1JL1A 4E7JA 1Q82O 3SLCA 2VYPA 1JLCA 3K5NA 3L4IA 2D1KA 3ZX3A 1SUQA 4KREA 4W5OA 2O8FA 1NMNA 2DFEA 2HHQA 2P9LB 4B3SK 5AQMA 3P1GA 3VQQA 4KBOA 3HPGA 2BANA 2A40A 4DR2K 1VSJA 3OS1A 3H1VX 3ID8A 2RE2A 1TL3A 2HHWA 2O8DA 1BG3A 4GV6A 4M3XA 5AZJA 4C8NA 4E3SA 1S6PA 4H4OA 1T03A 1UA0A 3MWTA 3PX4A 3CCQN 3G0ZA 4YHHK 4DQPA 3BZCA 3FFKB 2P9SB 4WFAL 4FOIA 3CFPA 1L3TA 1Q18A 2G8KA 4DTOA 4BR7A 4CJUA 3E9LA 1X3NA 4HWIA 3A5OC 5BPNA 5C15A 2OCEA 3HTVA 4FYDA 4RTFD 4E89A 1LV5A 4KI4A 3WT0A 3DM2A 3KK1A 4HUEA 3AV9A 3CPWM 5KGXA 5IT9O 3EO3A 4MO4A 3ZYYX 3SUQA 4AH9A 4CZFA 5FRNA 3VQ6A 2D0CA 1RFQA 3DYAA 3QFPA 4FJLA 3IFRA 2P9NA 3DLGA 4Q0BA 3CFOA 4YOYA 2YHAA 4CF8A 2ZGZA 4NYNA 3O4NA 1WBBA 1S9GA 4CF2A 5F0XA 2ZF5O 5CR4A 4PQUA 3NVKA 4MFBA 1T05A 3MCAB 1C0TA 4CF9A 4DTRA 2BUPA 4IZ9A 4DMNA 3QEVA 3QBWA 4DTNA 3ITHA 3DOKA 4AF1A 1Q8IA 3PX6A 2UUBK 3LAMA 3EY1A 4DFKA 1F21A 2OPRA 4DTUA 3SBGA 3MAQA 3OYGA 4ELVA 3MN7A 1TK5A 4LF8K 1RTIA 4FWPA 4KTZA 3VQ9A 2YJFA 4AQYK 1D9FA 2O8BA 1WSIA 2YNIA 2V7ZA 3VF6A 4BY9C 4WYBA 1BISA 4B9LA 3SNNA 4CD1A 3T69A 2G8FA 3ZSYA 4UY8O 1YVNA 3LDSA 4O0IA 3BDPA 3KHYA 3H3NO 1GOCA 3F2KA 3LDLA 1ATSA 1EP4A 3OYNA 3HM8A 2UUAK 1C0GA 3CCLN 3THVA 1BQMA 1BO5O 2P9IB 2P9IA 1RT1A 3K0SA 3KK7A 3MEDA 4A5AA 1EKEA 3EZWA 4OPAA 1D9DA 3AVFA 5F1XA 3A2FA 4LF7K 3VEYA 2E88A 1X9SA 4N56A 4EHUA 4JS5A 1NWKA 2OANA 4BGBA 4FJXA 2BGGA 4H0XB 2JGUA 4YDUA 3J7YP 3PIPL 2QXFA 2P9PA 3VQAA 1RT3A 3L2WA 4RW8A 4FW1A 1ASVA 2I7NA 4DV1K 2A6AA 4DB3A 1A5WA 4C8OA 3FZHA 1QE1A 1KC8O 4CGIA 1NGCA 5BN9A 3I8DA 4FJIA 4KHQA 2OTLN 4B1WB 2UXCK 3HM9A 4N76A 5CE3A 1S72N 1GLEG 4CK2A 2OA8A 3ATVA 4FCYA 1KTQA 3ZEUB 3D45A 3ALYA 3U8XA 3VQPA 4B8CA 3THWB 4KRFA 2RKIA 3GOIA 4BDPA 4MDAA 1IO2A 1VQLN 5AQXA 3O6WA 1XUPO 1TYQB 3SMPA 3OA9A 3K2PA 5BRHA 3O3GA 4H5RA 4W5NA 4K8ZA 4LF4K 2WFBA 4JKEA 3DJCA 4FJJA 2NLXA 2OPPA 2VQFK 4H8KA 2ZJPL 4GMJB 1XMQK 4NCAA 1CLQA 3RWUA 3C94A 4DR7K 4LF6K 4BRDA 2HHTA 4CW7B 4BREA 3O5BA 2NRHA 4BWJA 3JSMA 1B92A 5JVGL 3ID6A 4DSIA 4CZIA 3TARA 1IBMK 1WSJA 3CETA 1XC9A 4K8XA 4R5PA 4H0OA 3KLEA 4ILJA 4OJRA 5LJVA 1BIZA 4EFHA 4N41A 2HHXA 1WN7A 1S1WA 4CBWA 2O8EA 1NGDA 3V1RA 1T44A 4XEIA 1JLBA 2P9UA 4CIGA 4DKWA 3QNNA 2QKBA 1W7AA 1NOYA 3DLRA 2H3GX 2HMPA 1GLBG 2O8FB 5FDLA 5AZJB 3SK3A 5A2QO 3WEEA 3G4SN 1VQ7N 1NNEA 4CJQA 3K58A 3QIPA 5HL7L 5BRDA 1SL2A 5C10A 3OYMA 4Z94A 5HROA 4IOAL 5TKWA 3LP1A 4CESA 4DV4K 2UXDK 4CK3A 5E84A 4EP4A 3QNOA 1KXPA 2GWJA 3VF2A 4CERA 2A1RA 5AQOA 1NU0A 4FJ5A 2Q0UA 3E9PA 1CZAN 4EZ9A 3O8MA 1N33K 1RT7A 1TL1A 2VG7A 1YI2N 1XHZA 4CHPA 1NJIO 4RWTA 4CEQA 2E20A 5HBMA 1Q9YA 5KGWA 1HNWK 3KLGA 2XRIA 2BTFA 1HJRA 1WNSA 1NGIA 1VAZA 4YY3K 2IOCA 3LDQA 3J7AP 3PX0A 5KPZA 2HOEA 3GL1A 1U4BA 3GDQA 1SL1A 2Q2RA 4IFEA 1VQ6N 2E6MA 3HL8A 3HP6A 4NO7A 1Y64A 3VQ7A 3JYTA 3S3NA 3CF5L 3NGYA 4JYAK 1I39A 3VQ4A 2YCHA 4O44A 4GV3A 4MO5A 2NUBA 3R6MA 2P9KB 4B3MK 3CCRN 1SAZA 2OZSA 3AO4A 2KTQA 3BEXA 5C42A 4ID5A 4A57A 3KD5E 1KVBA 4CEFA 4DQQA 4B1YB 4DS4A 5HOOA 4C1NI 4BRMA 1Q86O 2EHGA 4FK4A 2HVHA 4WF9L 1QQOA 2PZSA 4NLBA 1DTTA 4CJVA 4JKFA 5J2QA 3MDQA 3RVCA 3FZKA 4OPKA 1KFSA 4FO0A 4CJ4A 3O9SA 4M3RA 3ZX2A 1L3VA 4K0KK 3SBTA 2NZTA 4K25A 4FXDA 2X74A 1RNHA 1QHTA 4M7YA 5GAEP 5M1KA 1D4XA 1FJGK 3SQ1A 4WQ5C 3O4QA 3BP8A 5EOYA 4DTMA 1M1KO 3CCVN 1N8RO 1W0HA 5DMRA 3HYFA 4GY2B 4CEDA 3J81O 3EZ5A 1XMOK 3THXB 4O4GA 3A5LC 3CJ7A 5CHIA 1NKCA 1YIJN 1HJOA 2RPIA 1E4FT 1YUWA 4CZHA 4CBUA 3ZT4A 3OS0A 5AQYA 1EX4A 4PL7A 1FKPA 4CVNE 2CH6A 1JL2A 1CZ9A 3D2EB 3GG4A 3V9WA 4AILC 4YFUA 4FLWA 2HBJA 4IWVA 5BPMA 5JS1A 1Q7YO 3D2FA 2OTJN 1RBVA 3TSUA 3OYEA 1QQMA 2FSKA 5M1OA 1WUAA 4CD3A 4IG0A 4FL9A 4DV7K 3LL3A 3DRSA 5CY4A 2YHBA 4FPAA 4DV6K 3HK2A 4FVMA 4PY5A 1BDGA 4XH4A 5FLXO 2X6NA 1TAUA 4KH4A 3DRRA 3IDHA 2E2QA 4FW2A 4WE1A 1SQKA 1XHXA 1NK4A 4DR1K 1NGAA 1VHXA 2QXLA 3B6PA 1VQKN 3K9JA 1EWQA 3MX2A 2FF6A 3DLBA 1J5EK 1Z6RA 3WQTA 4RCHA 1NBWA 4AM7A 1RTJA 4RW9A 3FE1A 3SMSA 3EKSA 4H5NA 4KKOA 3RSEA 2D0PA 3LWMA 4JKGB 3J8AA 1C1BA 2KLAA 1KQSM 3IG1A 4JKAA 5HRNA 1KRPA 3UKUB 3AGRA 3CFRA 1W9HA 3UKRB 2Z1HA 3T1YK 4QS8A 4R79A 1BL3A 5JICA 3HBTA 2P9KA 3S41A 4BG8A 5ADXA 2FF3B 3LP0A 4E1MA 3CJ9A 1N36K 4F8RA 3RRGA 2CGJA 4FZZA 4CE9A 1DLOA 1X1PA 4ILGB 3CC4N 1S22A 4FWLA 1VQMN 1GLJO 1BUPA 2FXUA 5AZIB 5LMUK 2E1ZA 1HYZA 1E3MA 3OYKA 1ASUA 5GADP 2KW4A 4Z4GA 1VSLA 3V81A 1RDDA 1S3XA 3ZETB 3P83D 2VWBA 2P9NB 1XNQK 4PKHA 2VQEK 4BE1A 3CHWA 5AFUH 4WQ4C 1XWLA 2XY7A 3RMAA 4I9QA 3UKUA 4Z0UA 2Q0RA 1QQCA 4QCLA 2UUCK 1VQNN 1K8AO 2HHHK 3VA0A 4WCEL 1GLFO 1T8EA 1JLEA 2ZWHA 3AARA 4DTXA 3CCJN 2HF4A 1LCUA 3AA5X 4HTUA 5C0YA 4H5TA 4CEAA 1EWRA 1VSMA 3LWLA 3KWGA 4YORA 1RDWX 2OPSA 3NF9A 3ENHA 2KZZA 3SQ0A 4BWMA 3R1XA 4FZYA 4CGJA 4DR6K 2QWOA 4JEPA 5DM7L 2FC0A 5AQJA 3M5RA 3MXIA 2W40A 4PKIA 3KLHA 1MWKA 3J80O 3WUHA 2FBXA 1J54A 3TAGA 4G1QA 5HP1A 3CMEN 4YOTA 3ASMA 1C0MA 1QVFM 4NYFA 4J2AA 4DTSA 1S5JA 1TV6A 4KFBA 1T7PA 5AQRA 1BQNA 1GLAG 3LALA 2RF2A 3A0IX 3SYZA 1HNZK 1IKYA 3A8YA 4B3OA 4CI6A 4H4MA 3O9TA 2KFZA 5BPLA 1C1AA 4OKJA 4DHYA 1HPZA 2F4VK 3G10A 1S1UA 4CHNA 4U67L 2FBTA 4CHZA 1JJ2M 3Q7CA 3S3OA 4HUFA 4CEZA 3THWA 3D6RA 3V1QA 2ITGA 2WC9A 5FRMA 1VQON 5IWAK 3ULEB 2KKZA 2ZJRL 1GOAA 4JK8A 1X9MA 4BE2A 1YAGA 3U9DA 4H5WA 1NJXA 2A42A 3M8QA 3BY5A 5HRSA 2WONA 3QO9A 3IS9A 4E1JA 1NGHA 2HF3A 4M41A 3ZT1A 4EAHD 4BC4A 3MCPA 4YOWA 3V9UA 4ISEA 2W42A 1J53A 3ZSWA 4LFAK 3SQ4A 2VWKA 3NGZA 3VGLA 3NCIA 4ISGA 5AQKA 3BUZB 1SV5A 4Z4IA 5B8HA 2HB5A 1W2BM 2QI2A 4M3TA 4X66K 1TKDA 3CM5A 1TKTA 4NXNK 3OYIA 1NK0A 3F9KA 1KLMA 3F9MA 4B1XB 4F3OA 3AY9A 3A5MC 4OGCA 3TAPA 3NVMA 3SV3A 4IJNA 3RMDA 1QSYA 3CD6N 1YTAA 4W5QA 2Q36A 1U6ZA 5LL6Z 3GBTA 4CZMA 3THYB 1NJWA 4BROA 2FBYA 2HNZA 4FWSA 1T3VA 1LAWA 1BU6O 2E2PA 1GLDG 3VQEA 5KQ8A 1JCFA 1QQNA 4DS5A 2PFUA 1RT2A 3OYJA 2G8WA 2Z1IA 4YOVA 1KFDA 3VOVA 4FM1A 5D3GA 3ZT2A 2Z1JA 3ZT3A 4IFVA 2W6KA 1WAFA 3BZKA 1IH7A 4WQ4A 2IVOA 2QM1A 2YHWA 2PYJA 1ASWA 4W5RA 1ZBSA 4O5BA 1T6CA 1DTQA 1WLJA 4A2AA 3CQXA 3WNFA 4Y0WA 3NH0A 4EIAA 2DPNA 3VENA 3QETA 3AVLA 3SAFA 2Y1JA 3GE1A 3VEOA 1X9WA 1J6ZA 4RG8A 1NGFA 5FROA 3QDKA 2V52B 3AVHA 5BREA 3BF3A 4BR9A 3AVCA 3VTHA 5ELZA 4LFBK 2GTDA 4F2SA 1Z26A 3D2EA 3SJHA 1QS4A 1NOZA 4U7BA 4FWQA 3SI6A 4KI6A 4NB4A 4B9QA 4H0TB 4DTJA 2QWRA 2NRTA 3AVJA 3VEXA 5LMNK 2RHKA 3AVGA 3HPHA 3K5OA 1HKBA 4E0DA 3C6TA 3KVGA 4J2BA 4JV5K 3TI0A 1B9FA 3FR0A 1WSEA 4RW7A 4BDYA 3TANA 5I9EB 1J5OA 2YX6A 1HUXA 4LC9B 3TTCA 2QWMA 3NHGA 1LWCA 2WBNA 3KLIA 1N34K 1BI4B 3PIOL 4E7HA 4CEEA 1OVYA 4DV0K 3THXA 4M7XA 1TUYA 4KB0A 3E66A 4BDZA 3KIOA 1K8KA 1G15A 1WAJA 3QFUA 3H3OB 2AA4A 5SWMA 2IS3A 3O1WA 3NBPA 3O4WA 4X65K 2XY5A 1HLUA 3NH1A 3ZT0A 4CJ3A 4K41A 3G6EN 1U04A 5SZTA 4JKHA 4IJAA 4I2QA 4CF1A 2D0BA 3KK3A 2ZQBA 5J2PA 1BCOA 3V4IA 2F8SA 4CJTA 1VSDA 3NAEA 4CCHA 4OPJA 3NH2A 3JS6A 3SPZA 3AVKA 4B8AB 4OKEA 3CYMA 2OZMA 4RW6A 3W0LA 3WNEA 5KI6A 3VN5A 3PUFA 4F2RA 3TAMA 2O4GA 4WFNL 4YDUC 3EEQA 2JLEA 4CHQA 4ISFA 2IDOA 3SPYA 5AQLA 3TPQA 2I7PA 4MLEA 4CFCA 4FK2A 3OS2A 3RRHA 5C12A 1MU2A 5TKYA 4WFBL 2KQ2A 4BC3A 1U48A 4JKDA 3LANA 4CJ7A 3TSQA 4DQSA 1QHAA 4F3TA 3VA3A 4FWMA 1HNXK 1VQ8N 4DSFA 3HRGA 3ZX0A 3CJAA 3DLLL 4A62A 1CXUA 3E1YA 3U6FA 1JCEA 4MDBA 3OYCA 4DQ8A 5J2MA 1QZ5A 3K5LA 3I0SA 2GWKA 1BHLA 4CGHA 2F8TA 1U2VB 5LY3A 4BRQA 4DLEA 4M3WA 3SCXA 4MQ3A 4BRAA 3C7NA 2P9UB 3CC7N 1NGEA 3AO1A 3TTFA 2FSJA 2AP1A 1YJWN 1ILYA 1IKXA 4JHDA 2NRXA 3J7ZO 3MEEA 3ATUA 3E9OA 3DLEA 3SAHA 2AJQA 2O8BB 4CJPA 1BI4A 4AHVA 3CJ1A 3OJSA 1KCFA 1RT5A 3V9ZA 5GAGP 1KD1O 4IKFA 4KHYA 4JI2K 3WXJA 3ENOA 2IVNA 1IG8A 4KHWA 1FKOA 3SUPA 2FBVA 3CXCM 4DUYK 3OW2M 3AAPA 4FWNA 2QTDA 4X62K 4XIUA 4IOCL 3NE6A 4PHTX 2QK9A 2KFNA 2JWKA 4WQ5A 1RDCA 2V7YA 1YT3A 1RGIA 4KHNA 4KHUA 1KVCA 4CHYA 2HHVA 2B5JA 4K42A 2O8CB 1LW2A 5BR9A 3L2VA 3TAQA 1RBRA 4DSKA 1JLFA 1BOTO 3WXIA 4JI8K 2Z1GA 3CJCA 1QSLA 1YVUA 3ZEUA 2WTUA 3DWLA 1LAVA 5H1SQ 4KAZA 2HNYA 3CCMN 1K73O 2UYTA 2VCPA 3QINA 4ICLA 4AHRA 1B9DA 1S1VA 3MK6A 2GBZA 4FLYA 4I6MA 2Y1IA 2E2NA 4CFDA 5LJWA 3E01A 1EO1A 1VQ4N 5AQPA 3MXMA 4E7IA 1DT9A 4IEEA 1JLQA 5EU7A 4GKKK 3P4IA 4MLHA 4DSLA 4QS7A 2WOMA 3OY9A 4KTWA 3O08A 1HMVA 2Q31A 2E5LK 4GVMA 3FZMA 3QMLA 4IXCA 5GINA 4JI3K 3T7ZA 5JLHA 4V19S 4OLBA 4ID1A 4M3ZA 1XI1A 5M1PA 3VEZA 4K43A 5AJ3K 1W97L 5EVZA 4ZTJA 3RR8A 2BDPA 4FK0A 3O9QA 3BF1A 3H6EA 3OTOK 2YV0X 3HVRA 1HRHA 1X3MA 4IEIA 2NRWA 1VRTA 3C7NB 2NRRA 3M8RA 1QVGM 3VQCA 2IIRA 4M63C 2P9LA 3V6DA 4OVLA 4HTLA 1YJ9N 4DSJA 4DU4A 4CEOA 3OYBA 2EX3A 3DMJA 4C8MA 4LH4A 4BC5A 4M42A 2D0OA 3IAYA 3R8EA 3ZSZA 3EE8A 5EXWA 1NKBA 1A5XA 1G99A 3ENBA 4I2PA 3O80A 4KTQA 3QEPA 4CFBA 4YNQA 3I8BA 3OYDA 3I55N 2YNHA 5CYQA 1RT6A 4AHCA 3PSFA 4BR0A 1HR0K 4Y1DA 1E4GT 3TSPA 5I3UA 3C65A 4FJKA 4FOEA 1ITGA 4FPBA 2ZJQL 3QESA 2CGLA 4CIFA 4FJGA 2E6LA 5CYMA 4N47A 4BR5A 1S1TA 1D8YA 3LAKA 2F96A 1N5YA 5BR8K 4JRQA 4GV9A 2P5OA 1IBLK 5EY4A 4ZHRA 1ZXOA 4A59A 3NMUA 1DEJA 1TAQA 5C25A 1HNIA 2QWLA 5J2NA 1KLNA 4I7FA 4PUOA 3AA4A 4B9UA 5FPDA 3LPUA 2YJEA 1ESVA 4FJMA 4JI1K 3MMVA 5KRTA 4OPHA 4DQRA 1ZBUA 3ZSXA 4YOXA 4BRPA 3ULEA 2YKNA 3T3FA 3OVNA 1D5AA 1HQEA 4BRIA 2YI1A 2KHOA 3PV8A 3DAWA 2QWPA 1REVA 2B6AA 3P5JA 3CQ8A 3WEEB 1L3SA 4LSLA 1KAYA 2P5GA 5JLFA 5AQSA 3KWIA 2O8CA 1UWBA 3FFIA 5AQVA 4FJHA 3VEWA 4CZKA 1RBTA 4BRKA 3SV4A 3HSTB 2O8EB 1O1WA 1JLAA 4J2DA 1R0AA 3H08A 5AQZA 3ZSOA 3D0PA 4FWRA 3R3LA 2XHBA 3KZBA 4FM2A 2DFHA 3LP3A 4AM6A 3B6OA 4FJNA 3O3FA 3I56N 3SUNA 2A1SA 3HP9A 3KJVA 1IKWA 4Z4FA 4C1NK 1TGOA 5EX5A 3DLKA 1UAXA 1ATRA 4YOUA 3MX5A 5C2FA 1VQ9N 1UA1A 4M45A 3K57A 3F5TA 1L5UA 2O8DB 1SKWA 1OH8A 1BIUA 4B9TA 3RMBA 4ELTA 4Y1CA 4DCHA 2HMIA 1QTMA 4ELUA 4IO8A 5ADXH 3HZ6A 4FJ9A 3RR7A 3SZ2A 3UIQA 1NG9A 2DFFA 4XH5A 2PYLA 4CECA 1I94K 4W5TA 3SQ2A 2CGKA 1NKEA 3PO5A 2GEMA 3C6AA 3FZFA 3CCUN 4C8KA 3WQUA 5JMVA 1LOTB 5AQFA 4BE0A 3P39A 1WSFA 3NF8A 3CERA 3TABA 3CPEA 1YITN 3WXMB 2I5JA 2O4IA 2B4JA 2HNDA 2HVIA 3R9PA 3KKSA 1WB9A 1VQ5N 3CI5A 1VSEA 1IBKK 4BR2A 4Z4EA 4IO9L 2P9PB 1BA1A 4B3RK 3AVBA 3CG7A 1TK8A 2G8UA 3TU5A 5KRSA 3L8BA 3HO1A 1T6DA 4KHPK 1DKGD 3QEWA 3SJJA 2HBLA 2OYQA 1HKGA 1WSHA 3M3ZA 3ZSRA 3AAQA 2D0AA 3IMXA 3UKRA 3FLCO 1TKXA 4A61A 1WBDA 1L3UA 1JLGA 4C8LA 3V1OA 4OX9K 4CJLA 3EE9A
chains in the Genus database with same CATH topology
1K8KA 1QQOA 4JKCA 3QFUA 4XH1A 1XC3A 3H3OB 5GAHP 2BH1A 2AA4A 5E26A 3O1WA 4NLBA 4JKFA 2A5XA 3MDQA 3O4WA 3FZKA 3RVCA 3VGMA 4FO0A 1HLUA 1O13A 1ZC6A 3CIPA 1NGBA 2QWQA 3O9SA 3ZX2A 4CBXA 4K41A 3SBTA 3LDNA 2NZTA 4K25A 3G6EN 1U2VA 3PLAA 1K9MO 3VGKA 5M1NA 4PL8A 1X9JA 3L0QA 2E1YA 4JKHA 5M1KA 4M7YA 1BWFO 1NLVA 1D4XA 2ZGYA 3H1QA 3MN6A 4IJAA 4BGAA 3W3DA 4BRCA 4WQ5C 3BP8A 5GAEP 5EOYA 1YJNN 3QICA 4BG9A 1M1KO 3B8AX 3CCVN 3DXMB 1N8RO 1WOQA 1QZ6A 3VETA 1NGJA 3Q7BA 4JK7A 4O5FA 5AQTA 4B1UB 3P31A 4GY2B 4F9OA 5KPTA 3O9RA 2FLOA 3JS6A 2GUPA 3O9UA 4H5VA 2QWNA 3A5LC 3CJ7A 5CHIA 2QW9A 4JNEA 4JN4A 1YIJN 3H46O 1V4TA 1HJOA 2VGNA 2A41A 1E4FT 1YUWA 4JKBA 4CZHA 4CBUA 1HKCA 4KH6A 3W0LA 4PKGA 5AR0A 4BRGA 5AQYA 3LM9A 5AQNA 3TTDA 4PL7A 5FPNA 2EWSA 4CZJA 3DXKA 2V51B 4WFNL 2CH6A 2E2OA 1TUUA 3LM2A 1GLLO 4YDUC 5AQUA 4ISFA 5AZIA 5AQLA 3D2EB 3GG4A 3TPQA 2I7PA 4JD2B 4MLEA 1M90O 3A5NC 5C12A 3CQYA 5TKYA 3CCEN 4WFBL 2HBJA 1MWMA 4BC3A 4IWVA 4JKDA 4CJ7A 5BPMA 3TSQA 1NMDA 3C0BA 3AGKA 3H45C 1NM1A 2QA4N 2E8AA 1Q7YO 1QHAA 1XQSC 2Q97A 5KPRA 3D2FA 2OTJN 3TSUA 4FWMA 3U9ZA 1KAXA 2HBKA 5FPEA 1VQ8N 1QQMA 3HRGA 3ZX0A 3L4QA 5MLCQ 3CJAA 3K9KA 3MN9A 2FSKA 4A62A 3DLLL 3E1YA 5M1OA 1WUAA 4CD3A 1JCEA 4MDBA 2A3ZA 3CCSN 3QB0A 4DQ8A 1QZ5A 2GX9A 2J4RA 4FL9A 1Q82O 3SLCA 2VYPA 3LL3A 3L4IA 2D1KA 2YHYA 2GWKA 3ZX3A 2ASPA 4FPAA 3N4PA 1BDGA 4XH4A 1U2VB 5LY3A 2P9LB 4J8FA 4BRQA 5AQMA 1YF5L 3IDHA 4KH4A 2E2QA 1YHQN 4BRAA 3C7NA 2P9UB 3CC7N 1SQKA 1NGEA 4KBOA 5GIOA 3TTFA 3VTIA 2FSJA 1NGAA 2A40A 2AP1A 2QXLA 4IDHA 3H1VX 1YJWN 3ID8A 2RE2A 3EL2A 3K9JA 1VQKN 1ILYA 4JHDA 2NRXA 3MX2A 3J7ZO 2CH5A 2FF6A 1BG3A 3ATUA 4GV6A 1Z6RA 3WQTA 3E9OA 4RCHA 4BRFA 3SAHA 3FZLA 5AZJA 1NBWA 4AM7A 4JKGA 1H1VA 2GELA 3G25A 5BN8A 3MWTA 4JHDB 3CJ1A 3CMAN 3FE1A 4BQZA 4B1ZA 5GAGP 3CCQN 1KD1O 3SMSA 4BQLA 1JCGA 3WXJA 3EKSA 3ENOA 5DM6L 3FFKB 2IVNA 3HSCA 1IG8A 1VQPN 4H5NA 2P9SB 3RSEA 2D0PA 4G9ZA 4WFAL 4BVOA 4JKGB 3CXCM 4FOIA 1HX1A 3J8AA 2KLAA 1KQSM 4JKAA 3WXLA 1Q18A 3UKUB 4IOXA 3OW2M 3AGRA 3VMFB 1RDUA 3AAPA 4BR7A 3UKRB 2F9WA 4FWNA 2QTDA 3E9LA 4QS8A 4R79A 4IOCL 2NNWA 5BRFA 3HBTA 4PHTX 1X3NA 5JICA 2JWKA 2P9KA 3A5OC 4HWIA 3S41A 5BPNA 5C2DA 5C15A 3HTVA 4WQ5A 4BG8A 2V7YA 4RTFD 5ADXA 2FF3B 1RGIA 3ZETA 3CJ9A 3WT0A 3HOSA 4K42A 3P38A 5BR9A 3CPWM 2CGJA 3IUCA 3HOTA 1NGGA 3EO3A 4MO4A 3ZYYX 1BOTO 3WXIA 4CZFA 3MWPA 3HI0A 4ILGB 1RFQA 4GVEA 1S22A 3CJCA 3CC4N 4FWLA 3EN9A 3VEVA 3ZEUA 3QFPA 3N4QA 3IFRA 3DWLA 1VQMN 5H1SQ 1GLJO 2P9NA 1BUPA 2FXUA 5AZIB 2Q1NA 4YOYA 3LDPA 2E1ZA 3CCMN 1K73O 2UYTA 2VCPA 2ZGZA 5GADP 2ASOA 3MK6A 5F0XA 3FGUA 1S3XA 2ZF5O 4I6MA 2E2NA 3ZETB 5CR4A 2VWBA 5LJWA 5AQWA 3L6QA 3NVKA 1EO1A 2P9NB 1VQ4N 4PKHA 5AQIA 3MCAB 4CZEA 3CHWA 5AQPA 4WQ4C 5AFUH 2BUPA 1DT9A 4IEEA 4IZ9A 2JWLA 1ATNA 3P4IA 3QBWA 3QBXA 4MLHA 3UKUA 4BRLA 2Q0RA 4QS7A 4QS9A 1K8AO 1VQNN 4AF1A 4BRHA 4WCEL 3O08A 4FWOA 1GLFO 2ZWHA 3AARA 3CCJN 3SBGA 2HF4A 2Q31A 1LCUA 3FZMA 3QMLA 4IXCA 3VERA 3MN7A 3T7ZA 5JLHA 5GINA 5C0YA 4H5TA 4FWPA 5AFUA 2YJFA 3KWGA 5M1PA 3VEZA 4YORA 1V4SA 1RDWX 2V7ZA 4K43A 4WYBA 3VF6A 4BY9C 4OO1J 2NRVA 1W97L 3ENHA 3LDOA 5EVZA 3T69A 4CD1A 3R1XA 4UY8O 1YVNA 2QWOA 4JEPA 3O9QA 2P9SA 3BF1A 3H6EA 3H3NO 3KHYA 3F2KA 5DM7L 3M5RA 5AQJA 3LDLA 1ATSA 1X3MA 2W40A 4PKIA 4IEIA 3HM8A 2NRWA 1MWKA 4KH5A 2ASMA 3C7NB 2NRRA 3WUHA 1QVGM 2IIRA 1C0GA 4M63C 3CCLN 2P9LA 4A2BA 1BO5O 4HTLA 4BC2A 1YJ9N 2P9IB 3OBWA 4ILHA 2P9IA 3KK7A 3CMEN 4YOTA 4A5AA 4BC5A 2D0OA 1QVFM 3R8EA 3EZWA 3EE8A 4OPAA 5EXWA 1G99A 1P90A 3ENBA 5F1XA 3VEYA 4O8UA 3O80A 2E88A 2D4WA 3UE5A 5AQRA 4EHUA 1GLAG 1NWKA 1Z05A 2OANA 3A0IX 3M1FA 4BGBA 3A8YA 5M1QA 4CI6A 1DGKN 2HSTA 4H0XB 3O9TA 4YDUA 3D2FB 3UB5A 5BPLA 3I8BA 4DHYA 3C6HA 3I55N 3MN5A 3PIPL 4U67L 1JJ2M 2P9PA 4C23A 4H0PA 3Q7CA 4O8KA 4BR0A 1E4GT 3TSPA 2I7NA 2A6AA 4DB3A 3D6RA 3FZHA 4H0VB 2WC9A 3C65A 3WXKA 1KC8O 4FOEA 4FPBA 2ZJQL 2CGLA 4FSVA 1NGCA 5BN9A 1VQON 3ULEB 2KKZA 2ZJRL 4BR5A 4JK8A 2OTLN 1YAGA 4B1WB 3DXKB 3U9DA 1EQYA 4H5WA 2A42A 3G71N 4GV9A 3VF4A 5CE3A 5EY4A 1S72N 4E1JA 1GLEG 1ZXOA 4A59A 1NGHA 2HF3A 3ATVA 3NMUA 3ZEUB 1P8ZA 1DEJA 4H0YB 3U8XA 4JD2A 3MCPA 2QWLA 4BC4A 4EAHD 4YOWA 4ISEA 5FPDA 1MDUB 3GOIA 4MDAA 1VQLN 2YJEA 3OHRA 5AQXA 3VGLA 3O6WA 1XUPO 5AQQA 1TYQB 3SMPA 1ESVA 3OA9A 4ISGA 3MMVA 4OPHA 5BRHA 5AQKA 5FPMA 3BUZB 4YOXA 4BRPA 3ULEA 2ITMA 4H5RA 3M6GA 5B8HA 1W2BM 4BRIA 2WFBA 3D7EO 4JKEA 2QI2A 2KHOA 2YI1A 3DJCA 3DAWA 4FWKA 2NLXA 3CJBA 2QWPA 4GNIA 1SZ2A 4JAXA 2ZJPL 3WEEB 1KAYA 4B1VA 5JLFA 5AQSA 3KWIA 3F9MA 4BRDA 4B1XB 3VPZA 2QEXN 4BREA 3AY9A 3JXUA 3A5MC 3O5BA 2NRHA 5AQVA 3RSEB 2PAVA 3NVMA 3ID6A 5AQGA 5JVGL 2W41A 4IJNA 4CZIA 3VEWA 4CZKA 3CD6N 2Q36A 1U6ZA 4BRKA 3CETA 2F9TA 3GBTA 4CZMA 4BROA 4H0OA 4FWSA 4ILJA 1T3VA 4EHTA 2WUSA 5AQZA 1BU6O 5LJVA 4EFHA 2E2PA 4FWRA 1GLDG 3R3LA 3SAGA 5KQ8A 3KZBA 1JCFA 1QQNA 4CBWA 4AM6A 2PFUA 3I56N 3U4LA 4CZGA 1NGDA 3VOVA 4YOVA 1R59O 1T44A 4XEIA 2P9UA 4DKWA 4C1NK 5EX5A 2HBMA 5GIPA 1Q81O 1K8KB 1ATRA 2H3GX 1HPMA 2HMPA 1GLBG 3I33A 4WQ4A 4YOUA 2IVOA 2QM1A 5AQHA 5AZJB 3SK3A 3MX5A 5C2FA 1VQ9N 4H03B 2YHWA 3WEEA 3G4SN 4JK9A 3F5TA 1MA9B 1VQ7N 1ZBSA 3VESA 1T6CA 4DCHA 5HL7L 5BRDA 4IO8A 4A2AA 3HZ6A 5ADXH 3CQXA 4FVUA 4Y0WA 4EIAA 5C10A 2DPNA 4Z94A 2F7TA 3VENA 5JVHL 4IOAL 5TKWA 1BA0A 4I6MB 3SAFA 4XH5A 3GE1A 2VGMA 3VEOA 1J6ZA 1NGFA 3QDKA 1GLCG 5F2RA 2V52B 2PBDA 5BREA 2CGKA 3BF3A 5E84A 4BR9A 1KXPA 3VTHA 5ELZA 2GEMA 2GWJA 2YHXA 3C6AA 3FZFA 3VF2A 3CCUN 3WQUA 3CC2N 5JMVA 4A5BA 2FSNA 2GTDA 5AQOA 3D2EA 1SS6A 2Q0UA 1CZAN 3E9PA 1LOTB 3O8MA 5AQFA 3SJHA 4U7BA 4FWQA 3P39A 3IKMA 1YI2N 3CERA 4NB4A 1NJIO 1TYQA 3CPEA 3O1BA 1IJJA 4B9QA 4RWTA 1YITN 2E20A 3WXMB 5M1FA 4H0TB 2QWRA 2NRTA 3VEXA 2BTFA 1YXQA 5KQDA 1NGIA 1VAZA 3R9PA 2RHKA 3LDQA 5KPZA 1VQ5N 3CI5A 1HKBA 2HOEA 3GL1A 2IVPA 4NLCA 3GDQA 4BR2A 3KVGA 2Q2RA 4IFEA 1VQ6N 4IO9L 4NO7A 2P9PB 1Y64A 1BA1A 3FR0A 1C0FA 4BVPA 3CF5L 1OKJA 3TU5A 5I9EB 1T6DA 2YCHA 3EKUA 4L3QA 4GV3A 4MO5A 3R6MA 1DKGD 2YX6A 3DXMA 2HBLA 2P9KB 1KAZA 1HKGA 1SAZA 1HUXA 3M3ZA 4LC9B 3TTCA 3CCRN 3BEXA 2QWMA 3AAQA 2WBNA 3IMXA 2NRZA 3UKRA 4A57A 3FLCO 3PIOL 4A61A 4B1YB 1OVYA 4BR4A 5HOOA 4C1NI 4BRMA 4BRNA 1Q86O 4M7XA 1TUYA 3OBYA 3E66A 4CZLA 4WF9L 3EE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8K A;  1QQO A;  3QFU A;  4XH1 A;  1XC3 A;  3H3O B;  2AA4 A;  5E26 A;  3O1W A;  2A5X A;  3MDQ A;  3O4W A;  3FZK A;  3VGM A;  4FO0 A;  1HLU A;  1ZC6 A;  3CIP A;  1NGB A;  2QWQ A;  3ZX2 A;  4CBX A;  4K41 A;  3LDN A;  2NZT A;  4K25 A;  1U2V A;  3VGK A;  4PL8 A;  1X9J A;  3L0Q A;  2E1Y A;  4M7Y A;  1BWF O;  1NLV A;  1D4X A;  2ZGY A;  3H1Q A;  3MN6 A;  4IJA A;  4BGA A;  3W3D A;  4BRC A;  4WQ5 C;  3BP8 A;  5EOY A;  3QIC A;  4BG9 A;  3B8A X;  3DXM B;  1WOQ A;  1QZ6 A;  3VET A;  1NGJ A;  4O5F A;  5AQT A;  4B1U B;  4GY2 B;  4F9O A;  5KPT A;  2FLO A;  3JS6 A;  2GUP A;  4H5V A;  2QWN A;  3A5L C;  3CJ7 A;  2QW9 A;  4JNE A;  4JN4 A;  3H46 O;  1V4T A;  1HJO A;  2A41 A;  1E4F T;  1YUW A;  4CZH A;  4CBU A;  1HKC A;  3W0L A;  4PKG A;  5AR0 A;  4BRG A;  5AQY A;  3LM9 A;  5AQN A;  4PL7 A;  5FPN A;  2EWS A;  4CZJ A;  3DXK A;  2V51 B;  2CH6 A;  2E2O A;  1TUU A;  3LM2 A;  1GLL O;  4YDU C;  5AQU A;  4ISF A;  5AZI A;  5AQL A;  3D2E B;  3GG4 A;  3TPQ A;  2I7P A;  4JD2 B;  4MLE A;  3A5N C;  3CQY A;  5TKY A;  1MWM A;  4BC3 A;  4IWV A;  4CJ7 A;  5BPM A;  1NMD A;  3C0B A;  3H45 C;  1NM1 A;  2E8A A;  1QHA A;  1XQS C;  2Q97 A;  5KPR A;  3D2F A;  3U9Z A;  4FWM A;  1KAX A;  5FPE A;  1QQM A;  3ZX0 A;  3CJA A;  3MN9 A;  2FSK A;  4A62 A;  1WUA A;  4CD3 A;  1JCE A;  2A3Z A;  3QB0 A;  4DQ8 A;  1QZ5 A;  2J4R A;  4FL9 A;  3SLC A;  2VYP A;  3LL3 A;  3L4I A;  2D1K A;  2YHY A;  2GWK A;  3ZX3 A;  2ASP A;  4FPA A;  1BDG A;  4XH4 A;  1U2V B;  5LY3 A;  2P9L B;  4J8F A;  4BRQ A;  5AQM A;  3IDH A;  2E2Q A;  4BRA A;  3C7N A;  2P9U B;  1SQK A;  1NGE A;  4KBO A;  2FSJ A;  1NGA A;  2A40 A;  2AP1 A;  2QXL A;  3H1V X;  3ID8 A;  3EL2 A;  4JHD A;  2CH5 A;  2FF6 A;  1BG3 A;  3ATU A;  1Z6R A;  3WQT A;  4RCH A;  4BRF A;  3FZL A;  5AZJ A;  1NBW A;  4AM7 A;  1H1V A;  2GEL A;  3G25 A;  5BN8 A;  4JHD B;  3CJ1 A;  3FE1 A;  4BQZ A;  4B1Z A;  3SMS A;  4BQL A;  1JCG A;  3WXJ A;  3EKS A;  3ENO A;  3FFK B;  2IVN A;  3HSC A;  1IG8 A;  4H5N A;  2P9S B;  3RSE A;  2D0P A;  4BVO A;  4FOI A;  1HX1 A;  3J8A A;  3WXL A;  1Q18 A;  3UKU B;  3AAP A;  4BR7 A;  3UKR B;  2F9W A;  4FWN A;  4QS8 A;  5BRF A;  3HBT A;  5JIC A;  1X3N A;  2P9K A;  3A5O C;  4HWI A;  3S41 A;  5BPN A;  3HTV A;  4WQ5 A;  4BG8 A;  2V7Y A;  4RTF D;  5ADX A;  2FF3 B;  1RGI A;  3ZET A;  3CJ9 A;  3WT0 A;  4K42 A;  5BR9 A;  2CGJ A;  3IUC A;  1NGG A;  3EO3 A;  4MO4 A;  1BOT O;  3WXI A;  4CZF A;  3HI0 A;  1RFQ A;  1S22 A;  3CJC A;  4FWL A;  3EN9 A;  3VEV A;  3ZEU A;  3QFP A;  3IFR A;  3DWL A;  1GLJ O;  2P9N A;  1BUP A;  2FXU A;  5AZI B;  2Q1N A;  3LDP A;  2E1Z A;  2UYT A;  2VCP A;  2ZGZ A;  2ASO A;  3MK6 A;  5F0X A;  3FGU A;  1S3X A;  2ZF5 O;  4I6M A;  2E2N A;  3ZET B;  2VWB A;  5LJW A;  5AQW A;  3L6Q A;  2P9N B;  4PKH A;  5AQI A;  4CZE A;  3CHW A;  5AQP A;  4WQ4 C;  5AFU H;  2BUP A;  4IZ9 A;  1ATN A;  3P4I A;  3QBW A;  3QBX A;  4MLH A;  3UKU A;  4BRL A;  2Q0R A;  4QS7 A;  4QS9 A;  4BRH A;  3O08 A;  4FWO A;  1GLF O;  2ZWH A;  3AAR A;  2HF4 A;  2Q31 A;  1LCU A;  3FZM A;  3QML A;  4IXC A;  3VER A;  3MN7 A;  5JLH A;  4H5T A;  4FWP A;  5AFU A;  2YJF A;  3VEZ A;  1V4S A;  1RDW X;  2V7Z A;  4K43 A;  4WYB A;  3VF6 A;  4CD1 A;  3ENH A;  3LDO A;  5EVZ A;  1YVN A;  2QWO A;  2P9S A;  3BF1 A;  3H6E A;  3H3N O;  3KHY A;  5AQJ A;  3LDL A;  1ATS A;  1X3M A;  2W40 A;  4PKI A;  3HM8 A;  1MWK A;  2ASM A;  3C7N B;  3WUH A;  2IIR A;  1C0G A;  4M63 C;  2P9L A;  4A2B A;  1BO5 O;  4HTL A;  4BC2 A;  2P9I B;  2P9I A;  4BC5 A;  2D0O A;  3R8E A;  3EZW A;  5EXW A;  5F1X A;  1G99 A;  3VEY A;  3O80 A;  2E88 A;  2D4W A;  3UE5 A;  5AQR A;  4EHU A;  1GLA G;  1NWK A;  1Z05 A;  2OAN A;  3A0I X;  3M1F A;  4BGB A;  3A8Y A;  4CI6 A;  1DGK N;  4H0X B;  4YDU A;  3D2F B;  3UB5 A;  5BPL A;  3I8B A;  4DHY A;  3MN5 A;  2P9P A;  4C23 A;  4H0P A;  4O8K A;  4BR0 A;  1E4G T;  2I7N A;  2A6A A;  4DB3 A;  3FZH A;  4H0V B;  3WXK A;  4FOE A;  4FPB A;  2CGL A;  4FSV A;  1NGC A;  5BN9 A;  3ULE B;  4BR5 A;  1YAG A;  4B1W B;  3DXK B;  3U9D A;  1EQY A;  4H5W A;  2A42 A;  3VF4 A;  5CE3 A;  5EY4 A;  4E1J A;  1GLE G;  1ZXO A;  1NGH A;  2HF3 A;  3ATV A;  3ZEU B;  1P8Z A;  1DEJ A;  4H0Y B;  3U8X A;  4JD2 A;  3MCP A;  2QWL A;  4BC4 A;  4EAH D;  4ISE A;  5FPD A;  1MDU B;  3GOI A;  2YJE A;  3OHR A;  5AQX A;  3VGL A;  3O6W A;  1XUP O;  5AQQ A;  1TYQ B;  3SMP A;  1ESV A;  4ISG A;  3MMV A;  5BRH A;  5AQK A;  5FPM A;  3BUZ B;  4BRP A;  3ULE A;  2ITM A;  4H5R A;  3M6G A;  5B8H A;  4BRI A;  3D7E O;  2YI1 A;  2KHO A;  3DJC A;  3DAW A;  4FWK A;  2NLX A;  3CJB A;  2QWP A;  4GNI A;  1SZ2 A;  4JAX A;  3WEE B;  1KAY A;  4B1V A;  5JLF A;  5AQS A;  4BRD A;  3F9M A;  4B1X B;  3VPZ A;  4BRE A;  3AY9 A;  3JXU A;  3A5M C;  3O5B A;  2NRH A;  5AQV A;  3RSE B;  2PAV A;  5AQG A;  2W41 A;  4IJN A;  4CZI A;  3VEW A;  4CZK A;  2Q36 A;  1U6Z A;  4BRK A;  3CET A;  2F9T A;  3GBT A;  4CZM A;  4BRO A;  4H0O A;  4FWS A;  4EHT A;  2WUS A;  5AQZ A;  1BU6 O;  5LJV A;  4EFH A;  2E2P A;  4FWR A;  1GLD G;  5KQ8 A;  3KZB A;  1JCF A;  1QQN A;  4CBW A;  4AM6 A;  3U4L A;  4CZG A;  1NGD A;  3VOV A;  1R59 O;  1T44 A;  4XEI A;  2P9U A;  5EX5 A;  1K8K B;  1ATR A;  2H3G X;  1HPM A;  2HMP A;  1GLB G;  3I33 A;  4WQ4 A;  2IVO A;  2QM1 A;  5AQH A;  5AZJ B;  3SK3 A;  4H03 B;  2YHW A;  3WEE A;  1MA9 B;  1ZBS A;  3VES A;  1T6C A;  4DCH A;  5BRD A;  4IO8 A;  4A2A A;  3HZ6 A;  5ADX H;  3CQX A;  4Y0W A;  4EIA A;  2DPN A;  4Z94 A;  3VEN A;  1BA0 A;  4I6M B;  4XH5 A;  3GE1 A;  3VEO A;  1J6Z A;  1NGF A;  3QDK A;  1GLC G;  5F2R A;  2V52 B;  2PBD A;  5BRE A;  2CGK A;  3BF3 A;  5E84 A;  4BR9 A;  1KXP A;  5ELZ A;  2GEM A;  2GWJ A;  2YHX A;  3FZF A;  3VF2 A;  3WQU A;  5JMV A;  2FSN A;  2GTD A;  5AQO A;  3D2E A;  2Q0U A;  3SJH A;  1CZA N;  1LOT B;  3O8M A;  5AQF A;  4FWQ A;  3CER A;  4NB4 A;  1TYQ A;  3O1B A;  1IJJ A;  4B9Q A;  4RWT A;  2E20 A;  4H0T B;  2QWR A;  3VEX A;  2BTF A;  1YXQ A;  5KQD A;  1NGI A;  3R9P A;  3LDQ A;  5KPZ A;  1HKB A;  2HOE A;  3CI5 A;  3GL1 A;  2IVP A;  3GDQ A;  4BR2 A;  3KVG A;  2Q2R A;  4NO7 A;  2P9P B;  1Y64 A;  1BA1 A;  3FR0 A;  1C0F A;  4BVP A;  1OKJ A;  3TU5 A;  5I9E B;  1T6D A;  2YCH A;  3EKU A;  4L3Q A;  4MO5 A;  3R6M A;  1DKG D;  3DXM A;  2P9K B;  1KAZ A;  1HKG A;  1SAZ A;  1HUX A;  3M3Z A;  4LC9 B;  3BEX A;  2QWM A;  3AAQ A;  3IMX A;  3UKR A;  3FLC O;  4A61 A;  4B1Y B;  4BR4 A;  4BRM A;  4BRN A;  4M7X A;  1TUY A;  4CZL A; 
#chains in the Genus database with same CATH topology
 3THY A;  4M3U A;  4XH1 A;  1XC3 A;  5GAH P;  2BH1 A;  3TWH A;  5E26 A;  3AA2 A;  2A5X A;  3VGM A;  1ZC6 A;  4CGG A;  1C6V A;  2OPQ A;  3LDN A;  3VQB A;  4FJ7 A;  1UOC A;  3L0Q A;  4CHO A;  3SUO A;  1BWF O;  1NLV A;  4BGA A;  3KKR A;  4DU3 A;  1YJN N;  2GV9 A;  3DXM B;  1QZ6 A;  1N6Q A;  2R7Y A;  4JK7 A;  4O5F A;  5AQT A;  4B1U B;  5DK5 A;  4DR5 K;  4OLA A;  3L3U A;  1TK0 A;  3O9U A;  2QWN A;  4HCC A;  1FK9 A;  2QW9 A;  4JNE A;  3H46 O;  1LWE A;  2XO7 A;  4KH6 A;  4GW6 A;  4PKG A;  5AR0 A;  4CJS A;  1VRU A;  5HRP A;  1HYS A;  3T19 A;  4NCB A;  5AQN A;  1NK6 A;  2BE2 A;  5HLF A;  3DXK A;  1ZBH A;  4PWD A;  1U45 A;  2V51 B;  2E2O A;  3ISN C;  1TUU A;  3LM2 A;  1GLL O;  2LSN A;  1RDA A;  3U3G A;  1M90 O;  1WSG A;  4FLT A;  3CCE N;  3HJF A;  1XNR K;  1ZBF A;  3OYA A;  5HRR A;  3C0B A;  3AGK A;  2D5R A;  5CZ2 A;  4DF8 A;  1KAX A;  2HBK A;  3I0R A;  4CJF A;  3L4Q A;  3K9K A;  4JRP A;  1S1X A;  3L3V A;  3QB0 A;  2ETJ A;  1HNV A;  4O55 A;  1VK0 A;  2YHY A;  2ASP A;  3N4P A;  4F4K A;  4J8F A;  2G8H A;  1YF5 L;  1YHQ N;  1Y97 A;  5GIO A;  4DLG A;  3VTI A;  4IDH A;  1VSF A;  3EL2 A;  2CH5 A;  4Z4H A;  1NK5 A;  3ZSQ A;  4BRF A;  3FZL A;  4IFY A;  3ZLJ A;  4M3Y A;  1IV0 A;  4JKG A;  1OH5 A;  1H1V A;  2GEL A;  3G25 A;  5BN8 A;  1LW0 A;  5KTQ A;  4JHD B;  3CMA N;  3IRX A;  4BQZ A;  4B1Z A;  4DQI A;  4CJK A;  4BQL A;  1JCG A;  5DM6 L;  1C1C A;  3HSC A;  1VQP N;  4G9Z A;  4NCG A;  4BVO A;  4PA1 A;  1HX1 A;  1OH7 A;  1JKH A;  2VWJ A;  2IC3 A;  1Z25 A;  3WXL A;  3OYL A;  4IOX A;  3VMF B;  3RMC A;  3AVI A;  3AO3 A;  1RDU A;  4DFM A;  4CJR A;  2F9W A;  2NNW A;  5BRF A;  5C2D A;  3F73 A;  4E19 A;  2W6L A;  3QIO A;  3ZET A;  3HOS A;  3P38 A;  4JS4 A;  3PY8 A;  3IUC A;  3HOT A;  4DR4 K;  3V9S A;  1NGG A;  1SL0 A;  3NDK A;  4JI7 K;  2HHS A;  3MWP A;  3HI0 A;  4JI6 K;  4KV8 A;  1K6Y A;  4GVE A;  1RTH A;  3EN9 A;  3VEV A;  3N4Q A;  1FW6 A;  3AVM A;  2Q1N A;  3LDP A;  1OVQ A;  3QER A;  2ASO A;  3FGU A;  4E7K A;  2ZM6 K;  3QEX A;  5AQW A;  3L6Q A;  3QEI A;  1VSI A;  4Q5V A;  1FXX A;  5AQI A;  4CZE A;  1ZYQ A;  2JWL A;  5CZ1 A;  1ATN A;  3QBX A;  2YNG A;  3M8P A;  4BRL A;  1U47 A;  4QS9 A;  3AO2 A;  4BRH A;  3HVT A;  4FWO A;  4B9M A;  4JI0 K;  3VQD A;  3VER A;  4FLU A;  4DF4 A;  3EYZ A;  1VSH A;  5AFU A;  4HCB A;  1TKZ A;  4FM0 A;  1U49 A;  4LFC K;  4OO1 J;  1V4S A;  1ZBI A;  2NRV A;  3LDO A;  4TSX A;  1I3A A;  2P9S A;  2DTU A;  4FJ8 A;  4KH5 A;  3RTV A;  4KO0 A;  2ASM A;  3HT3 A;  3MEC A;  4A2B A;  4DV3 K;  4X64 K;  4BC2 A;  3OBW A;  1GOB A;  4ILH A;  4KB1 A;  4B9N A;  3OYF A;  1VSK A;  1OH6 A;  5C24 A;  5I42 A;  1P90 A;  4O8U A;  2D4W A;  4Z4C A;  3UE5 A;  3TAF A;  1Z05 A;  2X6S A;  3M1F A;  1NK7 A;  5M1Q A;  3LP2 A;  1DGK N;  2HST A;  3KD1 E;  3D2F B;  5J1E A;  3UB5 A;  2G8V A;  3C6H A;  1RDB A;  3MN5 A;  4B9S A;  4C23 A;  4H0P A;  3CM6 A;  3DRP A;  2DY4 A;  4O8K A;  4JLH A;  1LWF A;  4H0V B;  3WXK A;  4B3T K;  4DSE A;  4FSV A;  3LPT A;  4DG1 A;  5E41 A;  1HQU A;  4CIE A;  2RN2 A;  3C6U A;  3DXK B;  1RBU A;  1EQY A;  3TR8 A;  4B9V A;  3G71 N;  4FLZ A;  4FLV A;  1S6Q A;  3VF4 A;  4DTP A;  3NF6 A;  1Q9X A;  1JXE A;  3T1A A;  2Q3S A;  3HPO A;  4FLX A;  1P8Z A;  4H0Y B;  3L2Q A;  4JD2 A;  4CEB A;  4OKK A;  4GKJ K;  1MDU B;  4DV2 K;  4KPY A;  3OHR A;  5AQQ A;  3KTQ A;  5FPM A;  4CJE A;  1A5V A;  3BGR A;  2ITM A;  4AHT A;  3M6G A;  4JI4 K;  3AVN A;  3D7E O;  4BAC A;  3V9X A;  3DOL A;  4FWK A;  4DFP A;  3CJB A;  4GNI A;  2XY8 A;  1SZ2 A;  4JAX A;  3OJU A;  4B1V A;  3LZJ A;  1J9A A;  3VPZ A;  2QEX N;  4CJ5 A;  3JXU A;  3MEG A;  3RSE B;  4RW4 A;  2PAV A;  5AQG A;  2W41 A;  1RT4 A;  3NF7 A;  1HYV A;  4E1N A;  1YTU A;  2P51 A;  3TAE A;  3C95 A;  2F9T A;  4LF9 K;  1NK9 A;  3DI6 A;  5JS2 A;  2WUS A;  4EHT A;  1EET A;  3SAG A;  1BGX T;  3ULD A;  1NJY A;  4IBN A;  4HHT A;  3U4L A;  1RBS A;  4CZG A;  1R59 O;  4CF0 A;  2IAJ A;  4CK1 A;  2HBM A;  5GIP A;  1Q81 O;  4I9L A;  3PSI A;  3VQ5 A;  3I33 A;  1K8K B;  3WNH A;  1JXB A;  1HPM A;  5AQH A;  4H03 B;  2HW3 A;  4QAG A;  4EZ6 A;  4JK9 A;  4NXM K;  1MA9 B;  3VES A;  4IG3 A;  5T7B A;  4O0J A;  4FVU A;  1KVA A;  2KZM A;  2F7T A;  5JVH L;  1BA0 A;  4I6M B;  4LY7 A;  4OGE A;  2VGM A;  1GLC G;  5F2R A;  3ZCM A;  2PBD A;  4DU1 A;  2GUI A;  2YHX A;  4J2E A;  3CC2 N;  4A5B A;  2FSN A;  4LSN A;  3NGI A;  1SKR A;  1SS6 A;  3OYH A;  2IGI A;  3AA3 A;  3IKM A;  3KLF A;  1CZB A;  1TYQ A;  3O1B A;  1IJJ A;  1IKV A;  4LH5 A;  4DFJ A;  5M1F A;  2E4L A;  4E7L A;  3AVA A;  1C0U A;  2QKK A;  1YXQ A;  5KQD A;  1N32 K;  2IVP A;  4NLC A;  4FZX C;  4EP5 A;  4LF5 K;  4AHS A;  3AO5 A;  2ATQ A;  1C0F A;  4BVP A;  3S3M A;  4UQG A;  1OKJ A;  3EKU A;  4DV5 K;  4L3Q A;  4CGF A;  3DXM A;  1KAZ A;  3U3Y A;  3S9H A;  3QLH A;  2ZD1 A;  2NRZ A;  4BR4 A;  3K5M A;  4BRN A;  3HXM A;  3OBY A;  2ZE2 A;  4CZL A;  4DUZ K;  4JKC A;  3JAM O;  2XY6 A;  1IG9 A;  3O3H A;  3MXJ A;  1O13 A;  3CIP A;  1NGB A;  2QWQ A;  4CBX A;  4HVJ A;  1NJZ A;  3ZSV A;  2YNF A;  2G8I A;  1U2V A;  3PLA A;  1K9M O;  3VGK A;  5M1N A;  4DWI A;  4PL8 A;  1X9J A;  4LD0 A;  2E1Y A;  2YKM A;  2ZGY A;  3MN6 A;  3H1Q A;  3VQ8 A;  3W3D A;  4BRC A;  4DR3 K;  3KK2 A;  3QIC A;  4BG9 A;  1QSS A;  1TVR A;  3B8A X;  2UXB K;  1WOQ A;  3VET A;  3T1H K;  1NGJ A;  1RIL A;  3Q7B A;  4B08 A;  2UU9 K;  3P31 A;  4N5S A;  4CFA A;  4F9O A;  5KPT A;  3L2U A;  4HUG A;  3O9R A;  1RTD A;  2FLO A;  4JI5 K;  2GUP A;  4H5V A;  4JN4 A;  1S9E A;  4CJW A;  4KHS A;  1V4T A;  2VGN A;  3PO4 A;  2A41 A;  1RCH A;  4JKB A;  5K14 A;  3WNG A;  1HKC A;  4L8R B;  4BRG A;  3LM9 A;  2HHU A;  1BCM A;  4ZTF A;  3TTD A;  5FPN A;  2EWS A;  4CZJ A;  1CXQ A;  2PY5 A;  1SKS A;  2VG6 A;  5AQU A;  5AZI A;  1NK8 A;  4JD2 B;  1KSP A;  3A5N C;  4CGD A;  3DLH A;  3CQY A;  1MWM A;  2P1J A;  3NFA A;  1ZBL A;  1NMD A;  3L2R A;  3H45 C;  1NM1 A;  2QA4 N;  2E8A A;  1XQS C;  2Q97 A;  5KPR A;  3U9Z A;  4IDK A;  4AHU A;  5FPE A;  5MLC Q;  3K59 A;  1EXQ A;  3MN9 A;  3LZI A;  2A3Z A;  3CCS N;  2VG5 A;  2GX9 A;  4QOZ B;  2J4R A;  2X78 A;  3M8S A;  1JL1 A;  4E7J A;  1Q82 O;  3SLC A;  2VYP A;  1JLC A;  3K5N A;  3L4I A;  2D1K A;  3ZX3 A;  1SUQ A;  4KRE A;  4W5O A;  2O8F A;  1NMN A;  2DFE A;  2HHQ A;  2P9L B;  4B3S K;  5AQM A;  3P1G A;  3VQQ A;  4KBO A;  3HPG A;  2BAN A;  2A40 A;  4DR2 K;  1VSJ A;  3OS1 A;  3H1V X;  3ID8 A;  2RE2 A;  1TL3 A;  2HHW A;  2O8D A;  1BG3 A;  4GV6 A;  4M3X A;  5AZJ A;  4C8N A;  4E3S A;  1S6P A;  4H4O A;  1T03 A;  1UA0 A;  3MWT A;  3PX4 A;  3CCQ N;  3G0Z A;  4YHH K;  4DQP A;  3BZC A;  3FFK B;  2P9S B;  4WFA L;  4FOI A;  3CFP A;  1L3T A;  1Q18 A;  2G8K A;  4DTO A;  4BR7 A;  4CJU A;  3E9L A;  1X3N A;  4HWI A;  3A5O C;  5BPN A;  5C15 A;  2OCE A;  3HTV A;  4FYD A;  4RTF D;  4E89 A;  1LV5 A;  4KI4 A;  3WT0 A;  3DM2 A;  3KK1 A;  4HUE A;  3AV9 A;  3CPW M;  5KGX A;  5IT9 O;  3EO3 A;  4MO4 A;  3ZYY X;  3SUQ A;  4AH9 A;  4CZF A;  5FRN A;  3VQ6 A;  2D0C A;  1RFQ A;  3DYA A;  3QFP A;  4FJL A;  3IFR A;  2P9N A;  3DLG A;  4Q0B A;  3CFO A;  4YOY A;  2YHA A;  4CF8 A;  2ZGZ A;  4NYN A;  3O4N A;  1WBB A;  1S9G A;  4CF2 A;  5F0X A;  2ZF5 O;  5CR4 A;  4PQU A;  3NVK A;  4MFB A;  1T05 A;  3MCA B;  1C0T A;  4CF9 A;  4DTR A;  2BUP A;  4IZ9 A;  4DMN A;  3QEV A;  3QBW A;  4DTN A;  3ITH A;  3DOK A;  4AF1 A;  1Q8I A;  3PX6 A;  2UUB K;  3LAM A;  3EY1 A;  4DFK A;  1F21 A;  2OPR A;  4DTU A;  3SBG A;  3MAQ A;  3OYG A;  4ELV A;  3MN7 A;  1TK5 A;  4LF8 K;  1RTI A;  4FWP A;  4KTZ A;  3VQ9 A;  2YJF A;  4AQY K;  1D9F A;  2O8B A;  1WSI A;  2YNI A;  2V7Z A;  3VF6 A;  4BY9 C;  4WYB A;  1BIS A;  4B9L A;  3SNN A;  4CD1 A;  3T69 A;  2G8F A;  3ZSY A;  4UY8 O;  1YVN A;  3LDS A;  4O0I A;  3BDP A;  3KHY A;  3H3N O;  1GOC A;  3F2K A;  3LDL A;  1ATS A;  1EP4 A;  3OYN A;  3HM8 A;  2UUA K;  1C0G A;  3CCL N;  3THV A;  1BQM A;  1BO5 O;  2P9I B;  2P9I A;  1RT1 A;  3K0S A;  3KK7 A;  3MED A;  4A5A A;  1EKE A;  3EZW A;  4OPA A;  1D9D A;  3AVF A;  5F1X A;  3A2F A;  4LF7 K;  3VEY A;  2E88 A;  1X9S A;  4N56 A;  4EHU A;  4JS5 A;  1NWK A;  2OAN A;  4BGB A;  4FJX A;  2BGG A;  4H0X B;  2JGU A;  4YDU A;  3J7Y P;  3PIP L;  2QXF A;  2P9P A;  3VQA A;  1RT3 A;  3L2W A;  4RW8 A;  4FW1 A;  1ASV A;  2I7N A;  4DV1 K;  2A6A A;  4DB3 A;  1A5W A;  4C8O A;  3FZH A;  1QE1 A;  1KC8 O;  4CGI A;  1NGC A;  5BN9 A;  3I8D A;  4FJI A;  4KHQ A;  2OTL N;  4B1W B;  2UXC K;  3HM9 A;  4N76 A;  5CE3 A;  1S72 N;  1GLE G;  4CK2 A;  2OA8 A;  3ATV A;  4FCY A;  1KTQ A;  3ZEU B;  3D45 A;  3ALY A;  3U8X A;  3VQP A;  4B8C A;  3THW B;  4KRF A;  2RKI A;  3GOI A;  4BDP A;  4MDA A;  1IO2 A;  1VQL N;  5AQX A;  3O6W A;  1XUP O;  1TYQ B;  3SMP A;  3OA9 A;  3K2P A;  5BRH A;  3O3G A;  4H5R A;  4W5N A;  4K8Z A;  4LF4 K;  2WFB A;  4JKE A;  3DJC A;  4FJJ A;  2NLX A;  2OPP A;  2VQF K;  4H8K A;  2ZJP L;  4GMJ B;  1XMQ K;  4NCA A;  1CLQ A;  3RWU A;  3C94 A;  4DR7 K;  4LF6 K;  4BRD A;  2HHT A;  4CW7 B;  4BRE A;  3O5B A;  2NRH A;  4BWJ A;  3JSM A;  1B92 A;  5JVG L;  3ID6 A;  4DSI A;  4CZI A;  3TAR A;  1IBM K;  1WSJ A;  3CET A;  1XC9 A;  4K8X A;  4R5P A;  4H0O A;  3KLE A;  4ILJ A;  4OJR A;  5LJV A;  1BIZ A;  4EFH A;  4N41 A;  2HHX A;  1WN7 A;  1S1W A;  4CBW A;  2O8E A;  1NGD A;  3V1R A;  1T44 A;  4XEI A;  1JLB A;  2P9U A;  4CIG A;  4DKW A;  3QNN A;  2QKB A;  1W7A A;  1NOY A;  3DLR A;  2H3G X;  2HMP A;  1GLB G;  2O8F B;  5FDL A;  5AZJ B;  3SK3 A;  5A2Q O;  3WEE A;  3G4S N;  1VQ7 N;  1NNE A;  4CJQ A;  3K58 A;  3QIP A;  5HL7 L;  5BRD A;  1SL2 A;  5C10 A;  3OYM A;  4Z94 A;  5HRO A;  4IOA L;  5TKW A;  3LP1 A;  4CES A;  4DV4 K;  2UXD K;  4CK3 A;  5E84 A;  4EP4 A;  3QNO A;  1KXP A;  2GWJ A;  3VF2 A;  4CER A;  2A1R A;  5AQO A;  1NU0 A;  4FJ5 A;  2Q0U A;  3E9P A;  1CZA N;  4EZ9 A;  3O8M A;  1N33 K;  1RT7 A;  1TL1 A;  2VG7 A;  1YI2 N;  1XHZ A;  4CHP A;  1NJI O;  4RWT A;  4CEQ A;  2E20 A;  5HBM A;  1Q9Y A;  5KGW A;  1HNW K;  3KLG A;  2XRI A;  2BTF A;  1HJR A;  1WNS A;  1NGI A;  1VAZ A;  4YY3 K;  2IOC A;  3LDQ A;  3J7A P;  3PX0 A;  5KPZ A;  2HOE A;  3GL1 A;  1U4B A;  3GDQ A;  1SL1 A;  2Q2R A;  4IFE A;  1VQ6 N;  2E6M A;  3HL8 A;  3HP6 A;  4NO7 A;  1Y64 A;  3VQ7 A;  3JYT A;  3S3N A;  3CF5 L;  3NGY A;  4JYA K;  1I39 A;  3VQ4 A;  2YCH A;  4O44 A;  4GV3 A;  4MO5 A;  2NUB A;  3R6M A;  2P9K B;  4B3M K;  3CCR N;  1SAZ A;  2OZS A;  3AO4 A;  2KTQ A;  3BEX A;  5C42 A;  4ID5 A;  4A57 A;  3KD5 E;  1KVB A;  4CEF A;  4DQQ A;  4B1Y B;  4DS4 A;  5HOO A;  4C1N I;  4BRM A;  1Q86 O;  2EHG A;  4FK4 A;  2HVH A;  4WF9 L;  1QQO A;  2PZS A;  4NLB A;  1DTT A;  4CJV A;  4JKF A;  5J2Q A;  3MDQ A;  3RVC A;  3FZK A;  4OPK A;  1KFS A;  4FO0 A;  4CJ4 A;  3O9S A;  4M3R A;  3ZX2 A;  1L3V A;  4K0K K;  3SBT A;  2NZT A;  4K25 A;  4FXD A;  2X74 A;  1RNH A;  1QHT A;  4M7Y A;  5GAE P;  5M1K A;  1D4X A;  1FJG K;  3SQ1 A;  4WQ5 C;  3O4Q A;  3BP8 A;  5EOY A;  4DTM A;  1M1K O;  3CCV N;  1N8R O;  1W0H A;  5DMR A;  3HYF A;  4GY2 B;  4CED A;  3J81 O;  3EZ5 A;  1XMO K;  3THX B;  4O4G A;  3A5L C;  3CJ7 A;  5CHI A;  1NKC A;  1YIJ N;  1HJO A;  2RPI A;  1E4F T;  1YUW A;  4CZH A;  4CBU A;  3ZT4 A;  3OS0 A;  5AQY A;  1EX4 A;  4PL7 A;  1FKP A;  4CVN E;  2CH6 A;  1JL2 A;  1CZ9 A;  3D2E B;  3GG4 A;  3V9W A;  4AIL C;  4YFU A;  4FLW A;  2HBJ A;  4IWV A;  5BPM A;  5JS1 A;  1Q7Y O;  3D2F A;  2OTJ N;  1RBV A;  3TSU A;  3OYE A;  1QQM A;  2FSK A;  5M1O A;  1WUA A;  4CD3 A;  4IG0 A;  4FL9 A;  4DV7 K;  3LL3 A;  3DRS A;  5CY4 A;  2YHB A;  4FPA A;  4DV6 K;  3HK2 A;  4FVM A;  4PY5 A;  1BDG A;  4XH4 A;  5FLX O;  2X6N A;  1TAU A;  4KH4 A;  3DRR A;  3IDH A;  2E2Q A;  4FW2 A;  4WE1 A;  1SQK A;  1XHX A;  1NK4 A;  4DR1 K;  1NGA A;  1VHX A;  2QXL A;  3B6P A;  1VQK N;  3K9J A;  1EWQ A;  3MX2 A;  2FF6 A;  3DLB A;  1J5E K;  1Z6R A;  3WQT A;  4RCH A;  1NBW A;  4AM7 A;  1RTJ A;  4RW9 A;  3FE1 A;  3SMS A;  3EKS A;  4H5N A;  4KKO A;  3RSE A;  2D0P A;  3LWM A;  4JKG B;  3J8A A;  1C1B A;  2KLA A;  1KQS M;  3IG1 A;  4JKA A;  5HRN A;  1KRP A;  3UKU B;  3AGR A;  3CFR A;  1W9H A;  3UKR B;  2Z1H A;  3T1Y K;  4QS8 A;  4R79 A;  1BL3 A;  5JIC A;  3HBT A;  2P9K A;  3S41 A;  4BG8 A;  5ADX A;  2FF3 B;  3LP0 A;  4E1M A;  3CJ9 A;  1N36 K;  4F8R A;  3RRG A;  2CGJ A;  4FZZ A;  4CE9 A;  1DLO A;  1X1P A;  4ILG B;  3CC4 N;  1S22 A;  4FWL A;  1VQM N;  1GLJ O;  1BUP A;  2FXU A;  5AZI B;  5LMU K;  2E1Z A;  1HYZ A;  1E3M A;  3OYK A;  1ASU A;  5GAD P;  2KW4 A;  4Z4G A;  1VSL A;  3V81 A;  1RDD A;  1S3X A;  3ZET B;  3P83 D;  2VWB A;  2P9N B;  1XNQ K;  4PKH A;  2VQE K;  4BE1 A;  3CHW A;  5AFU H;  4WQ4 C;  1XWL A;  2XY7 A;  3RMA A;  4I9Q A;  3UKU A;  4Z0U A;  2Q0R A;  1QQC A;  4QCL A;  2UUC K;  1VQN N;  1K8A O;  2HHH K;  3VA0 A;  4WCE L;  1GLF O;  1T8E A;  1JLE A;  2ZWH A;  3AAR A;  4DTX A;  3CCJ N;  2HF4 A;  1LCU A;  3AA5 X;  4HTU A;  5C0Y A;  4H5T A;  4CEA A;  1EWR A;  1VSM A;  3LWL A;  3KWG A;  4YOR A;  1RDW X;  2OPS A;  3NF9 A;  3ENH A;  2KZZ A;  3SQ0 A;  4BWM A;  3R1X A;  4FZY A;  4CGJ A;  4DR6 K;  2QWO A;  4JEP A;  5DM7 L;  2FC0 A;  5AQJ A;  3M5R A;  3MXI A;  2W40 A;  4PKI A;  3KLH A;  1MWK A;  3J80 O;  3WUH A;  2FBX A;  1J54 A;  3TAG A;  4G1Q A;  5HP1 A;  3CME N;  4YOT A;  3ASM A;  1C0M A;  1QVF M;  4NYF A;  4J2A A;  4DTS A;  1S5J A;  1TV6 A;  4KFB A;  1T7P A;  5AQR A;  1BQN A;  1GLA G;  3LAL A;  2RF2 A;  3A0I X;  3SYZ A;  1HNZ K;  1IKY A;  3A8Y A;  4B3O A;  4CI6 A;  4H4M A;  3O9T A;  2KFZ A;  5BPL A;  1C1A A;  4OKJ A;  4DHY A;  1HPZ A;  2F4V K;  3G10 A;  1S1U A;  4CHN A;  4U67 L;  2FBT A;  4CHZ A;  1JJ2 M;  3Q7C A;  3S3O A;  4HUF A;  4CEZ A;  3THW A;  3D6R A;  3V1Q A;  2ITG A;  2WC9 A;  5FRM A;  1VQO N;  5IWA K;  3ULE B;  2KKZ A;  2ZJR L;  1GOA A;  4JK8 A;  1X9M A;  4BE2 A;  1YAG A;  3U9D A;  4H5W A;  1NJX A;  2A42 A;  3M8Q A;  3BY5 A;  5HRS A;  2WON A;  3QO9 A;  3IS9 A;  4E1J A;  1NGH A;  2HF3 A;  4M41 A;  3ZT1 A;  4EAH D;  4BC4 A;  3MCP A;  4YOW A;  3V9U A;  4ISE A;  2W42 A;  1J53 A;  3ZSW A;  4LFA K;  3SQ4 A;  2VWK A;  3NGZ A;  3VGL A;  3NCI A;  4ISG A;  5AQK A;  3BUZ B;  1SV5 A;  4Z4I A;  5B8H A;  2HB5 A;  1W2B M;  2QI2 A;  4M3T A;  4X66 K;  1TKD A;  3CM5 A;  1TKT A;  4NXN K;  3OYI A;  1NK0 A;  3F9K A;  1KLM A;  3F9M A;  4B1X B;  4F3O A;  3AY9 A;  3A5M C;  4OGC A;  3TAP A;  3NVM A;  3SV3 A;  4IJN A;  3RMD A;  1QSY A;  3CD6 N;  1YTA A;  4W5Q A;  2Q36 A;  1U6Z A;  5LL6 Z;  3GBT A;  4CZM A;  3THY B;  1NJW A;  4BRO A;  2FBY A;  2HNZ A;  4FWS A;  1T3V A;  1LAW A;  1BU6 O;  2E2P A;  1GLD G;  3VQE A;  5KQ8 A;  1JCF A;  1QQN A;  4DS5 A;  2PFU A;  1RT2 A;  3OYJ A;  2G8W A;  2Z1I A;  4YOV A;  1KFD A;  3VOV A;  4FM1 A;  5D3G A;  3ZT2 A;  2Z1J A;  3ZT3 A;  4IFV A;  2W6K A;  1WAF A;  3BZK A;  1IH7 A;  4WQ4 A;  2IVO A;  2QM1 A;  2YHW A;  2PYJ A;  1ASW A;  4W5R A;  1ZBS A;  4O5B A;  1T6C A;  1DTQ A;  1WLJ A;  4A2A A;  3CQX A;  3WNF A;  4Y0W A;  3NH0 A;  4EIA A;  2DPN A;  3VEN A;  3QET A;  3AVL A;  3SAF A;  2Y1J A;  3GE1 A;  3VEO A;  1X9W A;  1J6Z A;  4RG8 A;  1NGF A;  5FRO A;  3QDK A;  2V52 B;  3AVH A;  5BRE A;  3BF3 A;  4BR9 A;  3AVC A;  3VTH A;  5ELZ A;  4LFB K;  2GTD A;  4F2S A;  1Z26 A;  3D2E A;  3SJH A;  1QS4 A;  1NOZ A;  4U7B A;  4FWQ A;  3SI6 A;  4KI6 A;  4NB4 A;  4B9Q A;  4H0T B;  4DTJ A;  2QWR A;  2NRT A;  3AVJ A;  3VEX A;  5LMN K;  2RHK A;  3AVG A;  3HPH A;  3K5O A;  1HKB A;  4E0D A;  3C6T A;  3KVG A;  4J2B A;  4JV5 K;  3TI0 A;  1B9F A;  3FR0 A;  1WSE A;  4RW7 A;  4BDY A;  3TAN A;  5I9E B;  1J5O A;  2YX6 A;  1HUX A;  4LC9 B;  3TTC A;  2QWM A;  3NHG A;  1LWC A;  2WBN A;  3KLI A;  1N34 K;  1BI4 B;  3PIO L;  4E7H A;  4CEE A;  1OVY A;  4DV0 K;  3THX A;  4M7X A;  1TUY A;  4KB0 A;  3E66 A;  4BDZ A;  3KIO A;  1K8K A;  1G15 A;  1WAJ A;  3QFU A;  3H3O B;  2AA4 A;  5SWM A;  2IS3 A;  3O1W A;  3NBP A;  3O4W A;  4X65 K;  2XY5 A;  1HLU A;  3NH1 A;  3ZT0 A;  4CJ3 A;  4K41 A;  3G6E N;  1U04 A;  5SZT A;  4JKH A;  4IJA A;  4I2Q A;  4CF1 A;  2D0B A;  3KK3 A;  2ZQB A;  5J2P A;  1BCO A;  3V4I A;  2F8S A;  4CJT A;  1VSD A;  3NAE A;  4CCH A;  4OPJ A;  3NH2 A;  3JS6 A;  3SPZ A;  3AVK A;  4B8A B;  4OKE A;  3CYM A;  2OZM A;  4RW6 A;  3W0L A;  3WNE A;  5KI6 A;  3VN5 A;  3PUF A;  4F2R A;  3TAM A;  2O4G A;  4WFN L;  4YDU C;  3EEQ A;  2JLE A;  4CHQ A;  4ISF A;  2IDO A;  3SPY A;  5AQL A;  3TPQ A;  2I7P A;  4MLE A;  4CFC A;  4FK2 A;  3OS2 A;  3RRH A;  5C12 A;  1MU2 A;  5TKY A;  4WFB L;  2KQ2 A;  4BC3 A;  1U48 A;  4JKD A;  3LAN A;  4CJ7 A;  3TSQ A;  4DQS A;  1QHA A;  4F3T A;  3VA3 A;  4FWM A;  1HNX K;  1VQ8 N;  4DSF A;  3HRG A;  3ZX0 A;  3CJA A;  3DLL L;  4A62 A;  1CXU A;  3E1Y A;  3U6F A;  1JCE A;  4MDB A;  3OYC A;  4DQ8 A;  5J2M A;  1QZ5 A;  3K5L A;  3I0S A;  2GWK A;  1BHL A;  4CGH A;  2F8T A;  1U2V B;  5LY3 A;  4BRQ A;  4DLE A;  4M3W A;  3SCX A;  4MQ3 A;  4BRA A;  3C7N A;  2P9U B;  3CC7 N;  1NGE A;  3AO1 A;  3TTF A;  2FSJ A;  2AP1 A;  1YJW N;  1ILY A;  1IKX A;  4JHD A;  2NRX A;  3J7Z O;  3MEE A;  3ATU A;  3E9O A;  3DLE A;  3SAH A;  2AJQ A;  2O8B B;  4CJP A;  1BI4 A;  4AHV A;  3CJ1 A;  3OJS A;  1KCF A;  1RT5 A;  3V9Z A;  5GAG P;  1KD1 O;  4IKF A;  4KHY A;  4JI2 K;  3WXJ A;  3ENO A;  2IVN A;  1IG8 A;  4KHW A;  1FKO A;  3SUP A;  2FBV A;  3CXC M;  4DUY K;  3OW2 M;  3AAP A;  4FWN A;  2QTD A;  4X62 K;  4XIU A;  4IOC L;  3NE6 A;  4PHT X;  2QK9 A;  2KFN A;  2JWK A;  4WQ5 A;  1RDC A;  2V7Y A;  1YT3 A;  1RGI A;  4KHN A;  4KHU A;  1KVC A;  4CHY A;  2HHV A;  2B5J A;  4K42 A;  2O8C B;  1LW2 A;  5BR9 A;  3L2V A;  3TAQ A;  1RBR A;  4DSK A;  1JLF A;  1BOT O;  3WXI A;  4JI8 K;  2Z1G A;  3CJC A;  1QSL A;  1YVU A;  3ZEU A;  2WTU A;  3DWL A;  1LAV A;  5H1S Q;  4KAZ A;  2HNY A;  3CCM N;  1K73 O;  2UYT A;  2VCP A;  3QIN A;  4ICL A;  4AHR A;  1B9D A;  1S1V A;  3MK6 A;  2GBZ A;  4FLY A;  4I6M A;  2Y1I A;  2E2N A;  4CFD A;  5LJW A;  3E01 A;  1EO1 A;  1VQ4 N;  5AQP A;  3MXM A;  4E7I A;  1DT9 A;  4IEE A;  1JLQ A;  5EU7 A;  4GKK K;  3P4I A;  4MLH A;  4DSL A;  4QS7 A;  2WOM A;  3OY9 A;  4KTW A;  3O08 A;  1HMV A;  2Q31 A;  2E5L K;  4GVM A;  3FZM A;  3QML A;  4IXC A;  5GIN A;  4JI3 K;  3T7Z A;  5JLH A;  4V19 S;  4OLB A;  4ID1 A;  4M3Z A;  1XI1 A;  5M1P A;  3VEZ A;  4K43 A;  5AJ3 K;  1W97 L;  5EVZ A;  4ZTJ A;  3RR8 A;  2BDP A;  4FK0 A;  3O9Q A;  3BF1 A;  3H6E A;  3OTO K;  2YV0 X;  3HVR A;  1HRH A;  1X3M A;  4IEI A;  2NRW A;  1VRT A;  3C7N B;  2NRR A;  3M8R A;  1QVG M;  3VQC A;  2IIR A;  4M63 C;  2P9L A;  3V6D A;  4OVL A;  4HTL A;  1YJ9 N;  4DSJ A;  4DU4 A;  4CEO A;  3OYB A;  2EX3 A;  3DMJ A;  4C8M A;  4LH4 A;  4BC5 A;  4M42 A;  2D0O A;  3IAY A;  3R8E A;  3ZSZ A;  3EE8 A;  5EXW A;  1NKB A;  1A5X A;  1G99 A;  3ENB A;  4I2P A;  3O80 A;  4KTQ A;  3QEP A;  4CFB A;  4YNQ A;  3I8B A;  3OYD A;  3I55 N;  2YNH A;  5CYQ A;  1RT6 A;  4AHC A;  3PSF A;  4BR0 A;  1HR0 K;  4Y1D A;  1E4G T;  3TSP A;  5I3U A;  3C65 A;  4FJK A;  4FOE A;  1ITG A;  4FPB A;  2ZJQ L;  3QES A;  2CGL A;  4CIF A;  4FJG A;  2E6L A;  5CYM A;  4N47 A;  4BR5 A;  1S1T A;  1D8Y A;  3LAK A;  2F96 A;  1N5Y A;  5BR8 K;  4JRQ A;  4GV9 A;  2P5O A;  1IBL K;  5EY4 A;  4ZHR A;  1ZXO A;  4A59 A;  3NMU A;  1DEJ A;  1TAQ A;  5C25 A;  1HNI A;  2QWL A;  5J2N A;  1KLN A;  4I7F A;  4PUO A;  3AA4 A;  4B9U A;  5FPD A;  3LPU A;  2YJE A;  1ESV A;  4FJM A;  4JI1 K;  3MMV A;  5KRT A;  4OPH A;  4DQR A;  1ZBU A;  3ZSX A;  4YOX A;  4BRP A;  3ULE A;  2YKN A;  3T3F A;  3OVN A;  1D5A A;  1HQE A;  4BRI A;  2YI1 A;  2KHO A;  3PV8 A;  3DAW A;  2QWP A;  1REV A;  2B6A A;  3P5J A;  3CQ8 A;  3WEE B;  1L3S A;  4LSL A;  1KAY A;  2P5G A;  5JLF A;  5AQS A;  3KWI A;  2O8C A;  1UWB A;  3FFI A;  5AQV A;  4FJH A;  3VEW A;  4CZK A;  1RBT A;  4BRK A;  3SV4 A;  3HST B;  2O8E B;  1O1W A;  1JLA A;  4J2D A;  1R0A A;  3H08 A;  5AQZ A;  3ZSO A;  3D0P A;  4FWR A;  3R3L A;  2XHB A;  3KZB A;  4FM2 A;  2DFH A;  3LP3 A;  4AM6 A;  3B6O A;  4FJN A;  3O3F A;  3I56 N;  3SUN A;  2A1S A;  3HP9 A;  3KJV A;  1IKW A;  4Z4F A;  4C1N K;  1TGO A;  5EX5 A;  3DLK A;  1UAX A;  1ATR A;  4YOU A;  3MX5 A;  5C2F A;  1VQ9 N;  1UA1 A;  4M45 A;  3K57 A;  3F5T A;  1L5U A;  2O8D B;  1SKW A;  1OH8 A;  1BIU A;  4B9T A;  3RMB A;  4ELT A;  4Y1C A;  4DCH A;  2HMI A;  1QTM A;  4ELU A;  4IO8 A;  5ADX H;  3HZ6 A;  4FJ9 A;  3RR7 A;  3SZ2 A;  3UIQ A;  1NG9 A;  2DFF A;  4XH5 A;  2PYL A;  4CEC A;  1I94 K;  4W5T A;  3SQ2 A;  2CGK A;  1NKE A;  3PO5 A;  2GEM A;  3C6A A;  3FZF A;  3CCU N;  4C8K A;  3WQU A;  5JMV A;  1LOT B;  5AQF A;  4BE0 A;  3P39 A;  1WSF A;  3NF8 A;  3CER A;  3TAB A;  3CPE A;  1YIT N;  3WXM B;  2I5J A;  2O4I A;  2B4J A;  2HND A;  2HVI A;  3R9P A;  3KKS A;  1WB9 A;  1VQ5 N;  3CI5 A;  1VSE A;  1IBK K;  4BR2 A;  4Z4E A;  4IO9 L;  2P9P B;  1BA1 A;  4B3R K;  3AVB A;  3CG7 A;  1TK8 A;  2G8U A;  3TU5 A;  5KRS A;  3L8B A;  3HO1 A;  1T6D A;  4KHP K;  1DKG D;  3QEW A;  3SJJ A;  2HBL A;  2OYQ A;  1HKG A;  1WSH A;  3M3Z A;  3ZSR A;  3AAQ A;  2D0A A;  3IMX A;  3UKR A;  3FLC O;  1TKX A;  4A61 A;  1WBD A;  1L3U A;  1JLG A;  4C8L A;  3V1O A;  4OX9 K;  4CJL A;  3EE9 A; 
#chains in the Genus database with same CATH homology
 1K8K A;  1QQO A;  4JKC A;  3QFU A;  4XH1 A;  1XC3 A;  3H3O B;  5GAH P;  2BH1 A;  2AA4 A;  5E26 A;  3O1W A;  4NLB A;  4JKF A;  2A5X A;  3MDQ A;  3O4W A;  3FZK A;  3RVC A;  3VGM A;  4FO0 A;  1HLU A;  1O13 A;  1ZC6 A;  3CIP A;  1NGB A;  2QWQ A;  3O9S A;  3ZX2 A;  4CBX A;  4K41 A;  3SBT A;  3LDN A;  2NZT A;  4K25 A;  3G6E N;  1U2V A;  3PLA A;  1K9M O;  3VGK A;  5M1N A;  4PL8 A;  1X9J A;  3L0Q A;  2E1Y A;  4JKH A;  5M1K A;  4M7Y A;  1BWF O;  1NLV A;  1D4X A;  2ZGY A;  3H1Q A;  3MN6 A;  4IJA A;  4BGA A;  3W3D A;  4BRC A;  4WQ5 C;  3BP8 A;  5GAE P;  5EOY A;  1YJN N;  3QIC A;  4BG9 A;  1M1K O;  3B8A X;  3CCV N;  3DXM B;  1N8R O;  1WOQ A;  1QZ6 A;  3VET A;  1NGJ A;  3Q7B A;  4JK7 A;  4O5F A;  5AQT A;  4B1U B;  3P31 A;  4GY2 B;  4F9O A;  5KPT A;  3O9R A;  2FLO A;  3JS6 A;  2GUP A;  3O9U A;  4H5V A;  2QWN A;  3A5L C;  3CJ7 A;  5CHI A;  2QW9 A;  4JNE A;  4JN4 A;  1YIJ N;  3H46 O;  1V4T A;  1HJO A;  2VGN A;  2A41 A;  1E4F T;  1YUW A;  4JKB A;  4CZH A;  4CBU A;  1HKC A;  4KH6 A;  3W0L A;  4PKG A;  5AR0 A;  4BRG A;  5AQY A;  3LM9 A;  5AQN A;  3TTD A;  4PL7 A;  5FPN A;  2EWS A;  4CZJ A;  3DXK A;  2V51 B;  4WFN L;  2CH6 A;  2E2O A;  1TUU A;  3LM2 A;  1GLL O;  4YDU C;  5AQU A;  4ISF A;  5AZI A;  5AQL A;  3D2E B;  3GG4 A;  3TPQ A;  2I7P A;  4JD2 B;  4MLE A;  1M90 O;  3A5N C;  5C12 A;  3CQY A;  5TKY A;  3CCE N;  4WFB L;  2HBJ A;  1MWM A;  4BC3 A;  4IWV A;  4JKD A;  4CJ7 A;  5BPM A;  3TSQ A;  1NMD A;  3C0B A;  3AGK A;  3H45 C;  1NM1 A;  2QA4 N;  2E8A A;  1Q7Y O;  1QHA A;  1XQS C;  2Q97 A;  5KPR A;  3D2F A;  2OTJ N;  3TSU A;  4FWM A;  3U9Z A;  1KAX A;  2HBK A;  5FPE A;  1VQ8 N;  1QQM A;  3HRG A;  3ZX0 A;  3L4Q A;  5MLC Q;  3CJA A;  3K9K A;  3MN9 A;  2FSK A;  4A62 A;  3DLL L;  3E1Y A;  5M1O A;  1WUA A;  4CD3 A;  1JCE A;  4MDB A;  2A3Z A;  3CCS N;  3QB0 A;  4DQ8 A;  1QZ5 A;  2GX9 A;  2J4R A;  4FL9 A;  1Q82 O;  3SLC A;  2VYP A;  3LL3 A;  3L4I A;  2D1K A;  2YHY A;  2GWK A;  3ZX3 A;  2ASP A;  4FPA A;  3N4P A;  1BDG A;  4XH4 A;  1U2V B;  5LY3 A;  2P9L B;  4J8F A;  4BRQ A;  5AQM A;  1YF5 L;  3IDH A;  4KH4 A;  2E2Q A;  1YHQ N;  4BRA A;  3C7N A;  2P9U B;  3CC7 N;  1SQK A;  1NGE A;  4KBO A;  5GIO A;  3TTF A;  3VTI A;  2FSJ A;  1NGA A;  2A40 A;  2AP1 A;  2QXL A;  4IDH A;  3H1V X;  1YJW N;  3ID8 A;  2RE2 A;  3EL2 A;  3K9J A;  1VQK N;  1ILY A;  4JHD A;  2NRX A;  3MX2 A;  3J7Z O;  2CH5 A;  2FF6 A;  1BG3 A;  3ATU A;  4GV6 A;  1Z6R A;  3WQT A;  3E9O A;  4RCH A;  4BRF A;  3SAH A;  3FZL A;  5AZJ A;  1NBW A;  4AM7 A;  4JKG A;  1H1V A;  2GEL A;  3G25 A;  5BN8 A;  3MWT A;  4JHD B;  3CJ1 A;  3CMA N;  3FE1 A;  4BQZ A;  4B1Z A;  5GAG P;  3CCQ N;  1KD1 O;  3SMS A;  4BQL A;  1JCG A;  3WXJ A;  3EKS A;  3ENO A;  5DM6 L;  3FFK B;  2IVN A;  3HSC A;  1IG8 A;  1VQP N;  4H5N A;  2P9S B;  3RSE A;  2D0P A;  4G9Z A;  4WFA L;  4BVO A;  4JKG B;  3CXC M;  4FOI A;  1HX1 A;  3J8A A;  2KLA A;  1KQS M;  4JKA A;  3WXL A;  1Q18 A;  3UKU B;  4IOX A;  3OW2 M;  3AGR A;  3VMF B;  1RDU A;  3AAP A;  4BR7 A;  3UKR B;  2F9W A;  4FWN A;  2QTD A;  3E9L A;  4QS8 A;  4R79 A;  4IOC L;  2NNW A;  5BRF A;  3HBT A;  4PHT X;  1X3N A;  5JIC A;  2JWK A;  2P9K A;  3A5O C;  4HWI A;  3S41 A;  5BPN A;  5C2D A;  5C15 A;  3HTV A;  4WQ5 A;  4BG8 A;  2V7Y A;  4RTF D;  5ADX A;  2FF3 B;  1RGI A;  3ZET A;  3CJ9 A;  3WT0 A;  3HOS A;  4K42 A;  3P38 A;  5BR9 A;  3CPW M;  2CGJ A;  3IUC A;  3HOT A;  1NGG A;  3EO3 A;  4MO4 A;  3ZYY X;  1BOT O;  3WXI A;  4CZF A;  3MWP A;  3HI0 A;  4ILG B;  1RFQ A;  4GVE A;  1S22 A;  3CJC A;  3CC4 N;  4FWL A;  3EN9 A;  3VEV A;  3ZEU A;  3QFP A;  3N4Q A;  3IFR A;  3DWL A;  1VQM N;  5H1S Q;  1GLJ O;  2P9N A;  1BUP A;  2FXU A;  5AZI B;  2Q1N A;  4YOY A;  3LDP A;  2E1Z A;  3CCM N;  1K73 O;  2UYT A;  2VCP A;  2ZGZ A;  5GAD P;  2ASO A;  3MK6 A;  5F0X A;  3FGU A;  1S3X A;  2ZF5 O;  4I6M A;  2E2N A;  3ZET B;  5CR4 A;  2VWB A;  5LJW A;  5AQW A;  3L6Q A;  3NVK A;  1EO1 A;  2P9N B;  1VQ4 N;  4PKH A;  5AQI A;  3MCA B;  4CZE A;  3CHW A;  5AQP A;  4WQ4 C;  5AFU H;  2BUP A;  1DT9 A;  4IEE A;  4IZ9 A;  2JWL A;  1ATN A;  3P4I A;  3QBW A;  3QBX A;  4MLH A;  3UKU A;  4BRL A;  2Q0R A;  4QS7 A;  4QS9 A;  1K8A O;  1VQN N;  4AF1 A;  4BRH A;  4WCE L;  3O08 A;  4FWO A;  1GLF O;  2ZWH A;  3AAR A;  3CCJ N;  3SBG A;  2HF4 A;  2Q31 A;  1LCU A;  3FZM A;  3QML A;  4IXC A;  3VER A;  3MN7 A;  3T7Z A;  5JLH A;  5GIN A;  5C0Y A;  4H5T A;  4FWP A;  5AFU A;  2YJF A;  3KWG A;  5M1P A;  3VEZ A;  4YOR A;  1V4S A;  1RDW X;  2V7Z A;  4K43 A;  4WYB A;  3VF6 A;  4BY9 C;  4OO1 J;  2NRV A;  1W97 L;  3ENH A;  3LDO A;  5EVZ A;  3T69 A;  4CD1 A;  3R1X A;  4UY8 O;  1YVN A;  2QWO A;  4JEP A;  3O9Q A;  2P9S A;  3BF1 A;  3H6E A;  3H3N O;  3KHY A;  3F2K A;  5DM7 L;  3M5R A;  5AQJ A;  3LDL A;  1ATS A;  1X3M A;  2W40 A;  4PKI A;  4IEI A;  3HM8 A;  2NRW A;  1MWK A;  4KH5 A;  2ASM A;  3C7N B;  2NRR A;  3WUH A;  1QVG M;  2IIR A;  1C0G A;  4M63 C;  3CCL N;  2P9L A;  4A2B A;  1BO5 O;  4HTL A;  4BC2 A;  1YJ9 N;  2P9I B;  3OBW A;  4ILH A;  2P9I A;  3KK7 A;  3CME N;  4YOT A;  4A5A A;  4BC5 A;  2D0O A;  1QVF M;  3R8E A;  3EZW A;  3EE8 A;  4OPA A;  5EXW A;  1G99 A;  1P90 A;  3ENB A;  5F1X A;  3VEY A;  4O8U A;  3O80 A;  2E88 A;  2D4W A;  3UE5 A;  5AQR A;  4EHU A;  1GLA G;  1NWK A;  1Z05 A;  2OAN A;  3A0I X;  3M1F A;  4BGB A;  3A8Y A;  5M1Q A;  4CI6 A;  1DGK N;  2HST A;  4H0X B;  3O9T A;  4YDU A;  3D2F B;  3UB5 A;  5BPL A;  3I8B A;  4DHY A;  3C6H A;  3I55 N;  3MN5 A;  3PIP L;  4U67 L;  1JJ2 M;  2P9P A;  4C23 A;  4H0P A;  3Q7C A;  4O8K A;  4BR0 A;  1E4G T;  3TSP A;  2I7N A;  2A6A A;  4DB3 A;  3D6R A;  3FZH A;  4H0V B;  2WC9 A;  3C65 A;  3WXK A;  1KC8 O;  4FOE A;  4FPB A;  2ZJQ L;  2CGL A;  4FSV A;  1NGC A;  5BN9 A;  1VQO N;  3ULE B;  2KKZ A;  2ZJR L;  4BR5 A;  4JK8 A;  2OTL N;  1YAG A;  4B1W B;  3DXK B;  3U9D A;  1EQY A;  4H5W A;  2A42 A;  3G71 N;  4GV9 A;  3VF4 A;  5CE3 A;  5EY4 A;  1S72 N;  4E1J A;  1GLE G;  1ZXO A;  4A59 A;  1NGH A;  2HF3 A;  3ATV A;  3NMU A;  3ZEU B;  1P8Z A;  1DEJ A;  4H0Y B;  3U8X A;  4JD2 A;  3MCP A;  2QWL A;  4BC4 A;  4EAH D;  4YOW A;  4ISE A;  5FPD A;  1MDU B;  3GOI A;  4MDA A;  1VQL N;  2YJE A;  3OHR A;  5AQX A;  3VGL A;  3O6W A;  1XUP O;  5AQQ A;  1TYQ B;  3SMP A;  1ESV A;  3OA9 A;  4ISG A;  3MMV A;  4OPH A;  5BRH A;  5AQK A;  5FPM A;  3BUZ B;  4YOX A;  4BRP A;  3ULE A;  2ITM A;  4H5R A;  3M6G A;  5B8H A;  1W2B M;  4BRI A;  2WFB A;  3D7E O;  4JKE A;  2QI2 A;  2KHO A;  2YI1 A;  3DJC A;  3DAW A;  4FWK A;  2NLX A;  3CJB A;  2QWP A;  4GNI A;  1SZ2 A;  4JAX A;  2ZJP L;  3WEE B;  1KAY A;  4B1V A;  5JLF A;  5AQS A;  3KWI A;  3F9M A;  4BRD A;  4B1X B;  3VPZ A;  2QEX N;  4BRE A;  3AY9 A;  3JXU A;  3A5M C;  3O5B A;  2NRH A;  5AQV A;  3RSE B;  2PAV A;  3NVM A;  3ID6 A;  5AQG A;  5JVG L;  2W41 A;  4IJN A;  4CZI A;  3VEW A;  4CZK A;  3CD6 N;  2Q36 A;  1U6Z A;  4BRK A;  3CET A;  2F9T A;  3GBT A;  4CZM A;  4BRO A;  4H0O A;  4FWS A;  4ILJ A;  1T3V A;  4EHT A;  2WUS A;  5AQZ A;  1BU6 O;  5LJV A;  4EFH A;  2E2P A;  4FWR A;  1GLD G;  3R3L A;  3SAG A;  5KQ8 A;  3KZB A;  1JCF A;  1QQN A;  4CBW A;  4AM6 A;  2PFU A;  3I56 N;  3U4L A;  4CZG A;  1NGD A;  3VOV A;  4YOV A;  1R59 O;  1T44 A;  4XEI A;  2P9U A;  4DKW A;  4C1N K;  5EX5 A;  2HBM A;  5GIP A;  1Q81 O;  1K8K B;  1ATR A;  2H3G X;  1HPM A;  2HMP A;  1GLB G;  3I33 A;  4WQ4 A;  4YOU A;  2IVO A;  2QM1 A;  5AQH A;  5AZJ B;  3SK3 A;  3MX5 A;  5C2F A;  1VQ9 N;  4H03 B;  2YHW A;  3WEE A;  3G4S N;  4JK9 A;  3F5T A;  1MA9 B;  1VQ7 N;  1ZBS A;  3VES A;  1T6C A;  4DCH A;  5HL7 L;  5BRD A;  4IO8 A;  4A2A A;  3HZ6 A;  5ADX H;  3CQX A;  4FVU A;  4Y0W A;  4EIA A;  5C10 A;  2DPN A;  4Z94 A;  2F7T A;  3VEN A;  5JVH L;  4IOA L;  5TKW A;  1BA0 A;  4I6M B;  3SAF A;  4XH5 A;  3GE1 A;  2VGM A;  3VEO A;  1J6Z A;  1NGF A;  3QDK A;  1GLC G;  5F2R A;  2V52 B;  2PBD A;  5BRE A;  2CGK A;  3BF3 A;  5E84 A;  4BR9 A;  1KXP A;  3VTH A;  5ELZ A;  2GEM A;  2GWJ A;  2YHX A;  3C6A A;  3FZF A;  3VF2 A;  3CCU N;  3WQU A;  3CC2 N;  5JMV A;  4A5B A;  2FSN A;  2GTD A;  5AQO A;  3D2E A;  1SS6 A;  2Q0U A;  1CZA N;  3E9P A;  1LOT B;  3O8M A;  5AQF A;  3SJH A;  4U7B A;  4FWQ A;  3P39 A;  3IKM A;  1YI2 N;  3CER A;  4NB4 A;  1NJI O;  1TYQ A;  3CPE A;  3O1B A;  1IJJ A;  4B9Q A;  4RWT A;  1YIT N;  2E20 A;  3WXM B;  5M1F A;  4H0T B;  2QWR A;  2NRT A;  3VEX A;  2BTF A;  1YXQ A;  5KQD A;  1NGI A;  1VAZ A;  3R9P A;  2RHK A;  3LDQ A;  5KPZ A;  1VQ5 N;  3CI5 A;  1HKB A;  2HOE A;  3GL1 A;  2IVP A;  4NLC A;  3GDQ A;  4BR2 A;  3KVG A;  2Q2R A;  4IFE A;  1VQ6 N;  4IO9 L;  4NO7 A;  2P9P B;  1Y64 A;  1BA1 A;  3FR0 A;  1C0F A;  4BVP A;  3CF5 L;  1OKJ A;  3TU5 A;  5I9E B;  1T6D A;  2YCH A;  3EKU A;  4L3Q A;  4GV3 A;  4MO5 A;  3R6M A;  1DKG D;  2YX6 A;  3DXM A;  2HBL A;  2P9K B;  1KAZ A;  1HKG A;  1SAZ A;  1HUX A;  3M3Z A;  4LC9 B;  3TTC A;  3CCR N;  3BEX A;  2QWM A;  3AAQ A;  2WBN A;  3IMX A;  2NRZ A;  3UKR A;  4A57 A;  3FLC O;  3PIO L;  4A61 A;  4B1Y B;  1OVY A;  4BR4 A;  5HOO A;  4C1N I;  4BRM A;  4BRN A;  1Q86 O;  4M7X A;  1TUY A;  3OBY A;  3E66 A;  4CZL A;  4WF9 L;  3EE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...