4BR4A

Legionella pneumophila ntpdase1 crystal form i, open, apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
b'PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br4A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br4A02
2YHWA 4JN4A 4H5VA 3M3ZA 3CI5A 4XH1A 4K41A 1D4XA 1IJJA 4YDUA 4K25A 2P9UA 4FL9A 3HBTA 1QHAA 4IO8A 3WXJA 1NGGA 1QQMA 3M1FA 1G99A 3QB0A 5KPZA 2YCHA 2HOEA 4RCHA 1YUWA 4H03B 3LL3A 2A3ZA 2E2OA 3D2FB 4XH5A 1BDGA 1C0GA 4B1YB 2E2QA 2ZGYA 3FZKA 3GG4A 4GY2B 5AZJA 4FWLA 4JHDA 4BR7A 2CH6A 2QM1A 4XH4A 5LJWA 2GEMA 3VETA 3VF2A 3BP8A 3WEEA 5KPRA 2P9NA 2CGJA 4FOEA 2FF6A 5AFUA 1GLFO 3LDOA 3U4LA 3KZBA 4BR5A 4DQ8A 2D0PA 4BVPA 5LY3A 2Q0UA 4FWKA 3DXKB 1HUXA 4WQ4A 4JHDB 4BR4A 3VESA 1BO5O 2FXUA 1U6ZA 4BC2A 4EIAA 3QFPA 5AZIA 4HWIA 2QW9A 3H45C 4H0OA 1T44A 3QBWA 5FPEA 2P9NB 2P9SA 1NWKA 4MLHA 5AQQA 3VGMA 5JMVA 4NB4A 4O5FA 1NGIA 2HF4A 5AQHA 4BRQA 3JXUA 3GE1A 4YDUC 2NRHA 2YHXA 1NGAA 4WYBA 1NGEA 3IMXA 3QFUA 3DWLA 5AR0A 1T6CA 3VEWA 2FSJA 3TPQA 5JLHA 2A5XA 3FZHA 3WXIA 4H5RA 3CJ7A 2J4RA 5TKYA 3O1BA 5FPMA 4BRCA 1P8ZA 3O6WA 3FE1A 1KAZA 2YI1A 4CZHA 4IJNA 4BR9A 4AM6A 2P9SB 2E1ZA 1QZ5A 5F2RA 1QQNA 1TYQA 2QWMA 3ZX2A 4DB3A 3F9MA 4FO0A 2D0OA 3MDQA 3ZETA 4BRNA 3CJAA 3H3OB 1BOTO 1YXQA 3EN9A 4H0PA 4JAXA 1NLVA 5EOYA 3FZLA 4AM7A 5AQKA 1OKJA 5ELZA 5JICA 3J8AA 3A5NC 4PL8A 1JCEA 4BG8A 5BRFA 5AQPA 3W0LA 1WUAA 1QQOA 3UKUA 4ISEA 1RDWX 4L3QA 2PAVA 1NGCA 4H5WA 4BRPA 4CZLA 1DKGD 4EHUA 2HF3A 4Y0WA 5EVZA 3VEZA 2P9IA 4E1JA 1HJOA 4CBXA 5I9EB 4KBOA 4WQ4C 2P9LA 2FSKA 3W3DA 1GLEG 2QWOA 3WQUA 4H0YB 5F1XA 1TUYA 4LC9B 1TYQB 4FWSA 4GNIA 2YJEA 2AP1A 5AFUH 3TU5A 3I8BA 4FWMA 3ZETB 3SK3A 3ENHA 4PL7A 1X3MA 1HKBA 3KVGA 3HTVA 1QZ6A 4CZJA 1LCUA 3A5OC 3MMVA 3S41A 4CZKA 4RTFD 3G25A 5AQFA 2VCPA 4MLEA 1E4FT 2E8AA 3MN7A 2YJFA 3GL1A 3H46O 2P9IB 2ZF5O 2NLXA 1NBWA 5BRDA 1YVNA 2IIRA 5AQRA 3MN9A 3H1QA 4FWPA 1SAZA 2A42A 3LDQA 2GELA 3ATVA 5AQLA 4BVOA 3VGKA 4FSVA 1WOQA 2P9KA 1S22A 2P9UB 5BN8A 5F0XA 1BWFO 5EY4A 4K43A 5AQXA 1V4TA 1X3NA 2PBDA 3ZEUA 3WXLA 5BRHA 2ZWHA 4I6MA 3VF6A 4BC4A 5AQOA 3AARA 2NZTA 3QICA 4F9OA 4DHYA 3FGUA 3CHWA 1ATSA 1LOTB 2E2NA 4H5NA 5BREA 3P4IA 4WQ5C 3A5LC 5AZJB 4HTLA 3CJ1A 3CQYA 3HM8A 4BRKA 5KPTA 1J6ZA 2V51B 5FPNA 1ZXOA 2P9KB 4IXCA 3O80A 2D1KA 3H1VX 5AQWA 3D2EA 3WEEB 1GLJO 4BRDA 1Q18A 1SZ2A 3CJCA 3LDPA 3LDLA 3UB5A 3LM9A 4JNEA 4Z94A 3L6QA 3MN5A 2FF3B 2UYTA 3ZEUB 2IVOA 1ZBSA 4I6MB 3WXKA 1Y64A 4BREA 2HMPA 3CETA 3VF4A 3WT0A 3AAQA 3VEOA 2Q36A 2W41A 2E20A 2QWPA 3CERA 1HPMA 4CZFA 1NMDA 2EWSA 3H6EA 1T6DA 3U8XA 5AZIB 2QWRA 4ISFA 3BF1A 3R9PA 3D2EB 1NGDA 4BRIA 1MWMA 4M63C 4CZGA 5BN9A 1ESVA 3BEXA 4EAHD 4BRMA 3O08A 2Q31A 2I7NA 5FPDA 2CGKA 1DGKN 2H3GX 2YHYA 3LDNA 3U9ZA 1HKGA 4FWNA 3VEVA 4DCHA 4EFHA 4MO4A 2ASOA 3H3NO 2ASMA 3A0IX 4B1ZA 3FFKB 3VENA 3BF3A 1NGHA 1NGBA 4BR2A 2Q97A 3C7NA 2A41A 4WQ5A 2GWKA 3ID8A 4CZIA 3SMSA 1NM1A 3AAPA 2E88A 3DXMA 3ZX3A 1E4GT 1GLAG 1CZAN 1XUPO 4A62A 3ULEA 3C0BA 4FWRA 5JLFA 3GOIA 4BRHA 4CBWA 3DJCA 4BRGA 3IDHA 4B1XB 3VPZA 3FZFA 3M6GA 4H5TA 5AQUA 3SJHA 1EQYA 1MWKA 1U2VA 3VGLA 5EX5A 1RFQA 1KAXA 4B1WB 1H1VA 3L0QA 4CZEA 4BRFA 3MCPA 3C7NB 3UKUB 4EHTA 5BR9A 2FSNA 3VOVA 2A40A 3HZ6A 2QWNA 4FPBA 3DXMB 3O8MA 2VWBA 5AQVA 3EL2A 5LJVA 4FWOA 3RSEA 3MK6A 2GUPA 4O8KA 3R8EA 3QDKA 1BA0A 2QWQA 2P9LB 3ULEB 5AQTA 5AQGA 3CQXA 4BRLA 2D4WA 4BG9A 4BQLA 4J8FA 3O1WA 1XQSC 4BQZA 5AQZA 2OANA 2Q0RA 1U2VB 4B1VA 3EO3A 1JCFA 1GLDG 2BUPA 4CZMA 1HLUA 4PKHA 3FZMA 4RWTA 3ZX0A 4QS9A 4A61A 1GLLO 4H0VB 1HKCA 3DXKA 4BRAA 1MA9B 3UKRA 5E84A 1Z05A 3RSEB 3MN6A 4BGBA 2AA4A 1NGFA 2I7PA 4FWQA 3VERA 5BPLA 1Z6RA 1RGIA 3CJ9A 3QMLA 3EZWA 3QBXA 2FLOA 4H0TB 5KQ8A 4BC3A 4CI6A 2GTDA 4PKGA 4PKIA 1K8KA 1YAGA 3FLCO 3JS6A 4XEIA 1DEJA 2IVNA 3EKSA 4JD2A 5BPMA 5CE3A 4IJAA 3OHRA 2WUSA 1ZC6A 2Q2RA 4QS8A 3CJBA 2V7YA 4QS7A 4K42A 5BPNA 3GBTA 1BU6O 5B8HA 2KHOA 2F9WA 3WQTA 3FR0A 4M7YA 5ADXH 3UKRB 3O5BA 1R59O 4CD1A 3B8AX 4A2AA 1TUUA 5AQJA 3U9DA 1K8KB 1BG3A 3DAWA 2W40A 5E26A 4JD2B 1SQKA 2DPNA 3SLCA 2V52B 3EKUA 2P9PA 1BUPA 2CGLA 2A6AA 1GLCG 4A2BA 3O4WA 1C0FA 2GWJA 2V7ZA 2ASPA 1X9JA 3GDQA 3IUCA 1ATRA 3AY9A 3I33A 1ATNA 1GLBG 3D7EO 3L4IA 4BGAA 4FPAA 1HX1A 3KHYA 2ITMA 3ENOA 4BR0A 4C23A 4NO7A 4CJ7A 4IWVA 5AQMA 3IFRA 5AQSA 3R6MA 4ISGA 4BC5A 5AQYA 2E1YA 3SMPA 4FOIA 5AQNA 4IZ9A 3HSCA 2BTFA 5ADXA 3A5MC 4MO5A 2QWLA 2QXLA 2Q1NA 1XC3A 2IVPA 3VEXA 2F9TA 2CH5A 2P9PB 3BUZB 3ATUA 3A8YA 1NGJA 3LM2A 5EXWA 4B9QA 1S3XA 5KQDA 3CIPA 1V4SA 2VYPA 3VEYA 4M7XA 3HI0A 4CD3A 1KAYA 4BROA 1KXPA 1IG8A 3D2FA 1BA1A 4H0XB 5AQIA 4B1UB 3WUHA 3UE5A 1JCGA 1MDUB 4CBUA 2E2PA 2ZGZA
chains in the Genus database with same CATH superfamily
4JN4A 4Z4GA 1B9DA 4DQSA 3NE6A 5JS2A 1HMVA 4JKFA 2G8UA 3M3ZA 2FBYA 1D4XA 2ZQBA 1IJJA 2P9UA 4DTSA 4IO8A 1QQMA 3IG1A 3M1FA 1DT9A 4FK4A 1G99A 1YJNN 1YUWA 3THYA 4NLCA 3LL3A 4JKDA 2ZM6K 1BISA 4I2PA 1BDGA 1JXBA 1C0GA 4X66K 3FZKA 4GV6A 3GG4A 4GY2B 1JLCA 2D0AA 4JHDA 3ZSYA 4O44A 1YI2N 2WONA 5LJWA 2GEMA 4DTMA 1XC9A 4CEOA 1RBTA 3VETA 3BP8A 2NRZA 5KPRA 1D5AA 4CJSA 2CGJA 1WSFA 1HYVA 2NRTA 3AVJA 4B9MA 4KHPK 3OYFA 3KZBA 1TVRA 4FLTA 2VG7A 4GW6A 4A5AA 3QEVA 2GBZA 5K14A 4FWKA 4KHWA 3KJVA 4Q5VA 4BR4A 3VESA 1BO5O 3OYJA 3SQ4A 4CHOA 4BC2A 3RMAA 3O9UA 4Q0BA 5GIOA 4FJ9A 1A5WA 3H45C 1U4BA 1T44A 3AV9A 1VRTA 3QBWA 3MXJA 5AQQA 5JMVA 1LWCA 1RDBA 2HF4A 5AQHA 3K9JA 3MX2A 3OBWA 3NDKA 4DV5K 2NRHA 2YHXA 1NGAA 4CEDA 2FSJA 2HHUA 2QTDA 4X62K 3TPQA 4A59A 1NK6A 2YKNA 2A5XA 3WXIA 2E5LK 4O4GA 4M3ZA 3MECA 3I0RA 3O1BA 4BRCA 1IKVA 3O6WA 5HLFA 5CR4A 4ELTA 3FE1A 4LF9K 4FJIA 2YI1A 1VQMN 4AILC 1QSYA 2P9SB 1TYQA 1ZBUA 2QWMA 4N41A 3F9MA 2D0OA 3VMFB 4PQUA 1EWRA 3CJAA 2G8IA 4H0PA 1NLVA 3SBGA 3FZLA 3QNOA 1JKHA 1J9AA 1OKJA 5ELZA 3J8AA 3V4IA 3A5NC 3AO4A 1JCEA 1J54A 4PL8A 1BIUA 3AA3A 1QQOA 1RDWX 3AVAA 3THWA 1CXUA 2P51A 5HROA 3ZSVA 4BRPA 3TI0A 1DKGD 4E1JA 1HJOA 4YNQA 1JLQA 3K5LA 4KAZA 2FSKA 3WQUA 4H0YB 5F1XA 1IBMK 2I5JA 3AVHA 5AFUH 3SK3A 3ENHA 4DF4A 1X3MA 1HKBA 3C65A 1QZ6A 1IBKK 3OS1A 3S41A 4CJUA 4RTFD 2O8BB 2QA4N 3G25A 1NG9A 1E4FT 5FROA 3SV4A 2O8FB 5J2NA 3GL1A 3LANA 2ZF5O 1YVNA 5AQRA 1M90O 3J7ZO 1SAZA 2A42A 3LDQA 3SUOA 3VGKA 4FSVA 3L2VA 3LALA 1E3MA 3OYBA 2P9KA 4E7HA 1JLEA 5BN8A 1WNSA 5AQXA 2YV0X 5BRHA 2YNHA 4DHYA 3RMCA 2E2NA 1KVBA 3SQ2A 1GOAA 3U6FA 5AZJB 1NNEA 3CJ1A 5HP1A 4ELVA 1RT7A 5JVGL 3OYEA 3T3FA 1VQPN 1ZXOA 5AQWA 3D2EA 4JI8K 4BRDA 1Q18A 3LDPA 3CJCA 4KB0A 3CXCM 4BACA 3U3YA 2NRWA 3L6QA 3MN5A 1NJWA 4CJ3A 2UYTA 4DFJA 1VQLN 4CGDA 4F8RA 3CPEA 3WNHA 4CGIA 3HYFA 3CETA 3WT0A 4X65K 3L2QA 3VEOA 4HUGA 2E20A 4KHSA 3T1HK 1S1WA 1NMDA 1B9FA 4BY9C 1T6DA 5AZIB 2QWRA 3CC2N 3VQ8A 3AA4A 1MWMA 1VHXA 4FLXA 4CZGA 4DV7K 3BEXA 4B3OA 4EAHD 5FPDA 2CGKA 3LDNA 1X9MA 4MO4A 1A5VA 2OZMA 1Z25A 3VENA 2P1JA 5CZ2A 3CMAN 3C7NA 2A41A 3V1RA 4WQ5A 2GWKA 1SL1A 3OYCA 3AAPA 2E88A 1YTAA 3NBPA 1GLAG 1CZAN 3V9ZA 4E0DA 2KQ2A 4A62A 4N76A 3KK1A 2OPSA 3GOIA 4BDPA 4BRHA 3IDHA 3VPZA 2HHHK 1TKXA 3VQAA 1U04A 4AHCA 1HJRA 1U2VA 3AO3A 3VGLA 4FM1A 4HCCA 3PIPL 2XY5A 5SZTA 4CZEA 4BRFA 1D9DA 2ATQA 3VOVA 4FJXA 2A40A 3HZ6A 3O8MA 4EZ6A 4DFMA 2ETJA 4FWOA 3RSEA 2GUPA 1BA0A 3ULEB 1VSFA 2HNZA 1EP4A 1IKWA 4ILGB 4BWJA 3SNNA 4BQZA 4UQGA 4OX9K 2OANA 2OTJN 1EKEA 4B1VA 2VWJA 1GLDG 2BUPA 3VQ5A 4PKHA 3PUFA 1NJYA 3LZIA 2KFZA 4LFCK 1LAVA 4B9VA 2Q3SA 1TGOA 5E84A 2I7PA 4FWQA 4BE1A 3QBXA 4H0TB 4CI6A 4PKGA 1YAGA 4FJHA 3JS6A 3PO5A 4Y1DA 4JKHA 4IJAA 1RBVA 3T7ZA 3RTVA 1ZC6A 2Q2RA 4QS8A 2HMIA 3CJBA 3CFOA 4Z4HA 3O9SA 2F9WA 3FR0A 4M7YA 1VSJA 2HNYA 1R59O 3NF9A 2YKMA 1TUUA 2XO7A 2ZJQL 2HHTA 3U9DA 3SUNA 4IDHA 5MLCQ 3LP3A 5E26A 1RT5A 2P9PA 4FLYA 4CHPA 1GLCG 4GVMA 5LL6Z 3KLGA 3OTOK 4JK9A 2BGGA 1X9SA 1IO2A 1ATNA 4OPAA 1WSHA 4FPAA 4DU3A 4Z4EA 4KREA 1K8AO 4BR0A 4FOIA 5AQNA 1IG9A 5ADXA 2QWLA 3L3VA 1J5OA 4W5RA 2CH5A 1NK7A 3TR8A 4CGGA 1NGJA 3ZSXA 4CEEA 4HTUA 4LF6K 1X1PA 3PIOL 2WOMA 4QAGA 2IDOA 5KQDA 4CESA 2O8BA 3VEYA 2ZJPL 5C25A 3HI0A 3MEEA 1KXPA 1IG8A 1VQ7N 4L8RB 4JKGB 4IOCL 5IWAK 4CJVA 5AQIA 4B1UB 1WN7A 5KGXA 5JS1A 1NK5A 4LY7A 4OKEA 1JCGA 1MDUB 4OKKA 4AH9A 4OVLA 1T05A 1D9FA 1EX4A 2OTLN 2KFNA 3WXMB 1S1VA 3T69A 3J7AP 4AQYK 4K8XA 4CECA 4ILJA 5GINA 3AVKA 3HBTA 3T19A 3AA5X 2DTUA 2JWKA 4E1MA 1KVCA 4E7LA 5KPZA 2YCHA 3QLHA 4RCHA 4ID1A 3D2FB 4OPHA 4BE2A 4DTJA 4FJMA 2BE2A 2O8CB 1NKBA 2UUCK 2E2QA 2ZGYA 5AZJA 2WC9A 1LV5A 4BR7A 3RMBA 3VQEA 4XH4A 3QO9A 5HRPA 3HPOA 2ZJRL 1OVQA 5J2QA 2HNDA 3V6DA 5KGWA 2KW4A 3HPGA 4IG0A 3THVA 4MQ3A 2P9NA 4DR1K 4ZHRA 1VQ4N 4JV5K 1KQSM 3KIOA 5KRTA 4DF8A 3LDOA 2GV9A 3EYZA 3KD5E 4BR5A 4DQ8A 1IKXA 3L2WA 2FBVA 1D8YA 1L3VA 1K73O 5HRSA 3OYAA 1XHXA 1VQKN 3O3GA 2D5RA 1RDUA 4EIAA 2OPRA 5AZIA 4YOWA 3BZKA 1UOCA 4HWIA 4YFUA 1C1CA 4DS5A 4JKEA 4MLHA 3VGMA 1IKYA 4NB4A 4W5OA 2YNFA 4B08A 4BDYA 3RMDA 3JXUA 3GE1A 3QFUA 3VEWA 4YOYA 3DLRA 3P39A 3CMEN 1XMOK 3FZHA 4CW7B 3SUQA 4H5RA 3TAQA 1ZBFA 2J4RA 1HNVA 3ZLJA 5TKYA 5FPMA 4I7FA 5DM7L 2RE2A 5C0YA 4WE1A 3KK2A 4RW7A 4KHNA 1K6YA 1KAZA 4Z4IA 2DFHA 4KFBA 1TK0A 3EY1A 1FW6A 2UU9K 4LD0A 4AM6A 4R79A 3QERA 1QE1A 3ZX2A 1TK8A 1VQ5N 3EN9A 1RT3A 4BG8A 2O8DB 1SKSA 4FJ8A 2OCEA 5AQPA 3W0LA 3I8DA 1WUAA 1RBRA 4DS4A 4ISEA 4C8KA 4DR2K 3JYTA 5GADP 2HBLA 4CBXA 5I9EB 4KBOA 3W3DA 1GLEG 2QWOA 1TUYA 2NRXA 4JRPA 4FWSA 3C6HA 1EWQA 2AP1A 3ZETB 4FCYA 3I8BA 4JKBA 1WSEA 2O4GA 4PL7A 3S3MA 3VQBA 4CZJA 3L8BA 4CERA 1LCUA 3A5OC 4YOXA 3V81A 5AQFA 4B3RK 2VCPA 4MLEA 5J1EA 2O8EB 2DY4A 1YIJN 4KTQA 1NJIO 2P9IB 1NBWA 5BRDA 2IIRA 2NUBA 1HQEA 3MN9A 4DG1A 4FWPA 1RTDA 1VRUA 4O8UA 4Z4FA 5AQLA 3HOTA 1WOQA 4CEFA 5M1KA 3ITHA 5F0XA 3NGYA 5EY4A 2OPPA 1X3NA 3LPUA 4MDAA 1RILA 4FJGA 2ZWHA 3S9HA 4M45A 4U7BA 1SS6A 3FGUA 3IAYA 4F2RA 1ATSA 5BREA 1JL2A 3P4IA 4M41A 3RR7A 4CHQA 4E7JA 4HTLA 4LF5K 1FKOA 3CQYA 3CM5A 3CCJN 3TTCA 4N47A 1FJGK 1BL3A 1SKRA 1SZ2A 4LSNA 3HVRA 3LM9A 4JNEA 1YVUA 2FF3B 2X74A 1JLGA 3OS2A 3ZEUB 4I6MB 1W9HA 3WXKA 1Y64A 4BREA 1BI4B 3OYLA 2OZSA 1RTJA 4KI6A 3VQPA 4DQPA 1N34K 3TSUA 3OJSA 4F3OA 3SPZA 3VF4A 3CCLN 2HHSA 2Q36A 1NOZA 4ILHA 4Y1CA 4DFKA 2QWPA 3CERA 1KLNA 4JI7K 4KRFA 2VQFK 2EWSA 1Q9YA 4CFBA 4YORA 1QVGM 3L2UA 2QXFA 3HVTA 2PYLA 5BN9A 2QEXN 2KKZA 3KTQA 3ZT2A 3VQCA 1QVFM 1EXQA 5C10A 3O08A 2Q31A 4DSJA 3HRGA 3U9ZA 4ICLA 4FK2A 4IEIA 3CCRN 5HL7L 3H3NO 2ASMA 1L5UA 3A0IX 3BF3A 2R7YA 1NGHA 1NGBA 4CJLA 4CJTA 3SQ1A 4CF1A 3SUPA 3SMSA 1NM1A 2UUBK 1UA1A 5M1OA 2G8WA 4CVNE 1KSPA 3F9KA 3ZT4A 2ZD1A 3C0BA 5LMUK 3HT3A 3M8SA 3C95A 1NJXA 4RW9A 2F96A 1RT2A 3FZFA 3M6GA 1W2BM 5AQUA 3V9XA 3SJHA 3LAKA 1QQCA 1MWKA 3DLEA 2YNGA 4AF1A 1N5YA 1KAXA 1RT6A 2VGMA 5C2FA 2XY6A 2PY5A 1TKZA 3O3HA 1XHZA 1IBLK 4ZTFA 3RRGA 3DXMB 5AQVA 4B9LA 3PV8A 3MK6A 3DLBA 4KH4A 4O8KA 3R8EA 4OPJA 2QWQA 2P9LB 4CGHA 4WCEL 3SAGA 3O1WA 5AQZA 3EO3A 1Q81O 3ZSWA 1N32K 1HLUA 4QS9A 4H8KA 1F21A 1GLLO 3K5MA 3NVMA 1MU2A 2GUIA 4PHTX 3ZT1A 4BRAA 1S9EA 4NYNA 3DLKA 3SJJA 1RGIA 3TABA 3QMLA 4AHSA 3CCSN 1HPZA 4GKKK 4WFBL 2OPQA 4C1NI 1K8KA 4OLBA 1W0HA 3ZCMA 1DEJA 1YITN 5BPMA 2D0BA 5CE3A 4M3RA 5KI6A 3OHRA 1VQ9N 1L3SA 1Q86O 3B6OA 3TSQA 4F3TA 2Z1GA 1JJ2M 4K42A 5BPNA 4JRQA 5B8HA 2KHOA 1ZBHA 1OH7A 1BCOA 5ADXH 3UKRB 3O5BA 5BR8K 4LF4K 5AQJA 3CPWM 4E19A 3ZT3A 2XRIA 3CCEN 1ASWA 4ELUA 3LP2A 4JD2B 4DUYK 1SQKA 1KC8O 2DPNA 4IFEA 1BCMA 2WFBA 5GIPA 2CGLA 3BDPA 1TAUA 4QCLA 5M1PA 1N6QA 3O4WA 2V7ZA 1HNWK 2ASPA 1S1XA 1X9JA 3MWTA 3HSTB 3IUCA 3AY9A 4B8CA 3I33A 4GKJK 3D7EO 1HX1A 4DQIA 4C23A 3MEDA 2HHVA 4IWVA 2JGUA 2VWKA 4BC5A 5AQYA 3PY8A 4DUZK 3Q7CA 1UA0A 2E4LA 1YTUA 4HHTA 1KCFA 2F7TA 4C8LA 4DSIA 4MO5A 3TTDA 3VEXA 2Q1NA 5CHIA 2F9TA 3PO4A 3G6EN 2XY8A 3ATUA 3OBYA 3LM2A 5EXWA 1JXEA 1BGXT 3MAQA 4IO9L 1NJZA 3RVCA 1FXXA 3CIPA 3OYHA 3K9KA 3V9SA 2O4IA 3MX5A 4IEEA 3TSPA 1BA1A 5C12A 3TAPA 3DI6A 4KB1A 2VG5A 3MWPA 1YJ9N 5DK5A 4E3SA 4KPYA 3ZSQA 3OY9A 2E2PA 3BGRA 3CFRA 3PSIA 4H5VA 4DSFA 3MCAB 1N8RO 3I56N 4C8OA 2QK9A 3CI5A 4K41A 4BWMA 3ALYA 4K25A 3WXJA 4O55A 4KHUA 3KLHA 2D0CA 4DV6K 4DTPA 2E2OA 4O5BA 3AVBA 4B1YB 3THXB 3EE8A 5DM6L 2CH6A 3DOKA 3LAMA 1WSJA 2PFUA 1UAXA 3TWHA 3VF2A 3P1GA 3E66A 1Z26A 3NH1A 4CIFA 4WF9L 3V1QA 4JKCA 5AFUA 1L3TA 3THYB 1BI4A 1NKCA 5C42A 2DFFA 2D0PA 1HNZK 5LY3A 4MDBA 3TAGA 1HUXA 1C0MA 4WQ4A 1N36K 4JHDB 4CCHA 3G4SN 2FXUA 2XHBA 3D45A 4IKFA 1HQUA 3AVGA 3PX6A 1XMQK 2RPIA 3EZ5A 3OYDA 3RRHA 3ENBA 4CF2A 2WTUA 1Y97A 2P9SA 1NWKA 5E41A 4O5FA 4GV9A 3VQDA 1RTIA 4IFYA 5GAGP 4WYBA 3VQQA 1NK9A 4IOXA 3DWLA 5AR0A 1T6CA 1JL1A 1S72N 2A1RA 5JLHA 3K0SA 3EE9A 1S9GA 3CJ7A 3CYMA 1G15A 2HHXA 5CYQA 5HRNA 1NK8A 4KKOA 4CJKA 2RN2A 1QZ5A 4JS4A 1U45A 2IAJA 1QQNA 4M3WA 4FO0A 1WSIA 3MDQA 3HJFA 3I0SA 3H3OB 1BOTO 3SI6A 2HBKA 4FZYA 2YHBA 4NXMK 5JICA 3P83D 3KWIA 3DLHA 4L3QA 1NGCA 1WSGA 2O8FA 1VQ8N 4EHUA 1Q9XA 2HF3A 3OYKA 5EVZA 4JKAA 3VQ7A 5D3GA 4WQ4C 4M42A 2P9LA 3TANA 5GAHP 1RBSA 1QTMA 3DM2A 4LC9B 4IOAL 1TYQB 4GNIA 4DWIA 5DMRA 4ID5A 4FWMA 3TU5A 3NGIA 4DTXA 2OYQA 3A2FA 4E89A 2IGIA 2Y1JA 4JYAK 3KVGA 4FLUA 4ZTJA 3O3FA 4CF9A 2KZMA 3MMVA 2VGNA 1VK0A 3K58A 3THWB 3AVIA 4DTRA 1KVAA 1KLMA 4CEBA 3NFAA 4FVMA 2YJFA 4N5SA 3H46O 2EHGA 3OS0A 4JI1K 2NLXA 1VSDA 4CFCA 3CG7A 1TKDA 1SV5A 2Z1HA 3ATVA 2G8FA 3WNGA 2FBXA 4BVOA 3J80O 5I3UA 2G8KA 3Q7BA 3N4PA 1S22A 1BWFO 2HHWA 3ID6A 4CJ5A 1WAJA 4DV0K 2X6NA 1DTQA 3WXLA 3VF6A 3V1OA 3ZSOA 3KKSA 4BC4A 5AQOA 3AARA 2NZTA 3TAEA 3QICA 3NMUA 2NRRA 1LOTB 4H5NA 4J2DA 4CF0A 3VA0A 2P5OA 2HVHA 1SKWA 5A2QO 4BRKA 5KPTA 3SZ2A 4DSEA 4DV3K 4JLHA 1J6ZA 2V51B 1VSHA 2P9KB 4NXNK 3O80A 3H1VX 1TL1A 3P31A 1GLJO 3WEEB 1ZBIA 2HHQA 3QETA 3UB5A 3SAFA 4K8ZA 3VTHA 4DR3K 1WBBA 4PY5A 3DOLA 2IVOA 1ZBSA 3CCMN 1S6PA 4CEAA 5FDLA 2HMPA 3AO5A 2HSTA 3KK3A 4YHHK 4W5TA 5I42A 1HPMA 4JI0K 3U8XA 4CJRA 3R9PA 3HO1A 3D2EB 4FYDA 1NGDA 4BRIA 3RR8A 1O13A 3VN5A 1ESVA 4IFVA 4BRMA 1S5JA 4LF8K 4FW1A 2RF2A 3VEVA 4DCHA 3SQ0A 4EP4A 2F8TA 4H4OA 3FFKB 4I2QA 4BR2A 2A1SA 2Q97A 1UWBA 3OW2M 2PYJA 4OGCA 4JI2K 1NK4A 3ZX3A 1W97L 3KKRA 3K5OA 4IG3A 4NCBA 3OYMA 5TKWA 4KTZA 4B8AB 3LPTA 3ULEA 3WNFA 4FWRA 5JLFA 4E1NA 1OH5A 2DFEA 4BRGA 4H5TA 5C15A 3D6RA 3DLLL 4OGEA 3QEXA 1T7PA 1GOBA 1RFQA 4RW4A 4B1WB 1N33K 1H1VA 3EEQA 3L0QA 3UKUB 3C7NB 1I94K 1U48A 3HK2A 1IV0A 2FSNA 3NH0A 3SYZA 4FPBA 2VWBA 1SL0A 3EL2A 5LJVA 3N4QA 2GX9A 3QDKA 4U67L 1BQMA 3ZSRA 3L2RA 5AQTA 3M8QA 3CQXA 2D4WA 4DFPA 1BQNA 1GOCA 4CJ4A 3OA9A 2AJQA 3I55N 1XWLA 1ILYA 2Q0RA 5HRRA 1KTQA 1U2VB 4CJQA 3ZT0A 1U49A 1JCFA 4OKJA 4CZMA 1HR0K 2B5JA 3FZMA 4RWTA 1R0AA 4DR6K 2BH1A 1CZBA 4A61A 3O9RA 4H0VB 5M1NA 1QS4A 3V9UA 3RSEB 4BGBA 4AHUA 5BPLA 1Z6RA 3LWLA 3O4NA 4KO0A 5KQ8A 1RDDA 4BC3A 2YX6A 3FLCO 2RHKA 4XEIA 3LZJA 2QKKA 1S1UA 3CD6N 2B4JA 1RNHA 3E9OA 4CEZA 1O1WA 3NCIA 2WUSA 4FW2A 5EU7A 2YHAA 2UXDK 1S1TA 1EETA 3NF8A 4GMJB 1KFSA 2V7YA 4QS7A 1RT4A 2ZE2A 3HPHA 2UXBK 5HBMA 3GBTA 3MXIA 4EZ9A 4R5PA 5J2PA 1BU6O 1VQ6N 3L4QA 3WQTA 2Z1IA 4CK3A 4CD1A 3B8AX 4A2AA 4YOVA 3SAHA 3SPYA 3E1YA 4NYFA 4OO1J 3G71N 3DAWA 4CHZA 3G0ZA 4PWDA 3JSMA 3K2PA 1TL3A 1P90A 3SLCA 2V52B 2LSNA 1TAQA 2QI2A 1RCHA 4A2BA 3QEPA 3DMJA 1C0FA 2GWJA 3DRRA 3LP1A 4DV2K 1JLBA 3GDQA 3CCUN 1ATRA 4DSLA 4IDKA 3L4IA 4BGAA 4OLAA 1HRHA 2ITMA 3ENOA 4O0IA 5AQSA 3R6MA 1ASUA 3E01A 3SMPA 4JKGA 4DR5K 4W5NA 4F2SA 4CJWA 3A5MC 1WB9A 2XY7A 3LP0A 1XC3A 3BY5A 3CC7N 2P9PB 3BUZB 2UXCK 3A8YA 1HYZA 4FVUA 2IOCA 3CCVN 3BZCA 3SBTA 3OYNA 4CK1A 4RW6A 3O9TA 1REVA 1KAYA 3D2FA 3ZSZA 4AHRA 3O9QA 4TSXA 4H0XB 4DU4A 2UUAK 2O8CA 3M8RA 3UE5A 2G8VA 1CLQA 4CBUA 1HNXK 3K5NA 2ZGZA 4GV3A 2VG6A 2YHWA 3VA3A 4JI4K 4XH1A 1WLJA 4YDUA 4FL9A 1QHAA 1NGGA 2IC3A 3C94A 4DMNA 1CXQA 5FLXO 1ZBLA 1C1AA 1TV6A 3QB0A 4DTOA 2HOEA 3B6PA 4H03B 1KD1O 3ISNC 2A3ZA 3WNEA 4M3XA 3ULDA 3CCQN 4XH5A 5IT9O 3NF7A 1IH7A 1HYSA 3QEWA 3NH2A 4DKWA 5M1FA 4FWLA 1FKPA 2QM1A 4CE9A 1YHQN 1ASVA 4C1NK 1LWEA 1NU0A 4C8MA 3WEEA 1FK9A 2W42A 3E9PA 4M3TA 4FOEA 3OJUA 2FF6A 1NK0A 1SL2A 4DQQA 3OYIA 1GLFO 1RDCA 3U4LA 3NF6A 1SUQA 3NAEA 4PA1A 4E7KA 3QINA 4BVPA 3AVMA 4CFDA 4J2BA 4YOUA 3NGZA 3NHGA 2Q0UA 2OA8A 4HCBA 1VSLA 3DXKB 4KV8A 3CM6A 3O4QA 3TAFA 3PLAA 1U6ZA 1L3UA 3QFPA 2QW9A 4H0OA 3AGKA 5FPEA 4IBNA 2P9NB 2FC0A 2Z1JA 3CFPA 4DU1A 2B6AA 1NGIA 2F8SA 1HNIA 4KH5A 4BRQA 3TARA 4YDUC 2NRVA 1NGEA 3IMXA 4FM2A 1I39A 1ZYQA 4CF8A 3P38A 3VQ6A 2O8DA 4CGJA 4Z0UA 1P8ZA 2E6LA 4CZHA 4IJNA 4FK0A 4BR9A 2E1ZA 5F2RA 1S6QA 4DB3A 3FFIA 2KTQA 4JI5K 2E6MA 3ZETA 4BRNA 1YXQA 4XIUA 4JAXA 5EOYA 5SWMA 4AM7A 5AQKA 3ASMA 3AVNA 2Y1IA 4AHVA 5BRFA 4LF7K 3UKUA 4DSKA 4WFNL 2PAVA 1M1KO 2O8EA 3SCXA 4H5WA 3OVNA 5JVHL 4CZLA 4Y0WA 3VEZA 2P9IA 3AA2A 2NNWA 3KK7A 3TTFA 1RT1A 4CK2A 1NOYA 3SV3A 2X6SA 2YNIA 4A57A 2YJEA 4FM0A 1T3VA 4EP5A 1J5EK 3R3LA 1NKEA 3HTVA 4CZKA 1BHLA 1X9WA 1VAZA 3VTIA 4DR4K 2E8AA 3MN7A 2W6KA 1VSKA 2G8HA 4YOTA 3KLEA 1OH8A 3HM9A 3H1QA 4O0JA 4NLBA 2GELA 1WBDA 4HUFA 2QKBA 1J53A 3PX4A 2P9UB 3OYGA 4K43A 2KLAA 1V4TA 4FJLA 1TK5A 2JWLA 2PBDA 4DV1K 3ZEUA 2F4VK 4I6MA 3VQ9A 3HP6A 4DV4K 4F9OA 1Q7YO 3QIOA 3ZYYX 3CHWA 1ITGA 4LH5A 4AHTA 5GAEP 4CJEA 4RG8A 4WQ5C 1OVYA 3A5LC 3QESA 3HM8A 4B9NA 5LMNK 4CJPA 5KTQA 2EX3A 5FPNA 4IXCA 3K59A 5M1QA 2D1KA 3DRPA 1LW2A 3LDLA 4FZXC 1A5XA 4Z94A 4M3UA 3TAMA 3KLFA 4DTUA 4KI4A 3AO2A 3C6AA 1C1BA 3AAQA 4A5BA 3F73A 3VQ4A 4B9TA 2P5GA 3UIQA 4LFAK 2W41A 4CGFA 3AO1A 4JEPA 4CZFA 4CHYA 2BDPA 3H6EA 4ISFA 4DTNA 4FZZA 3BF1A 1K9MO 4JK7A 4OPKA 4M63C 1C0TA 1YJWN 5HOOA 1BIZA 2I7NA 2YHYA 1DGKN 2H3GX 1QSLA 1KFDA 3RWUA 1HKGA 4FWNA 3F2KA 4EFHA 1C6VA 2ASOA 5CY4A 4DLEA 1RDAA 3DRSA 3AVLA 4B1ZA 3KD1E 1DLOA 1XNRK 3ID8A 4CZIA 4DR7K 3DXMA 1E4GT 4B3TK 4CJFA 4CHNA 4BDZA 3KLIA 3V9WA 1XUPO 2PZSA 1JLFA 3MEGA 3T1AA 2W6LA 3P5JA 1LAWA 4J2EA 4CBWA 3IRXA 3DJCA 4B1XB 4BE0A 3KWGA 1Q82O 1EQYA 1YF5L 5EX5A 1XI1A 4KHQA 4UY8O 4PUOA 4WFAL 2BANA 2KZZA 3MCPA 3QIPA 4EHTA 2HBJA 5BR9A 2QWNA 4LSLA 1C0UA 3M8PA 4LH4A 5FRNA 3S3NA 3K57A 1LWFA 3QEIA 3H08A 3HOSA 4FXDA 3LWMA 4FJJA 1JLAA 5AQGA 4BRLA 3L3UA 4BG9A 3D0PA 2HBMA 4BQLA 3HXMA 4J8FA 4LFBK 1XQSC 1DTTA 4G9ZA 4FJNA 3CC4N 4CFAA 4F4KA 1B92A 4KH6A 2VQEK 4FJ5A 4DQRA 3ZX0A 3C6TA 3CQ8A 4B9UA 4RW8A 4X64K 2HW3A 3DLGA 1HKCA 5AJ3K 3DXKA 4FLWA 1MA9B 3UKRA 4CIEA 1Z05A 3MN6A 2WBNA 5CZ1A 2AA4A 1NGFA 3VERA 4HUEA 1YT3A 3CJ9A 4CIGA 3EZWA 5KRSA 2FLOA 4B9SA 2GTDA 4PKIA 1W7AA 3M5RA 1RBUA 4G1QA 2FBTA 2IVNA 3EKSA 4JD2A 3S3OA 3PSFA 3F5TA 1Q8IA 4FLVA 4GVEA 3HP9A 1KRPA 4KTWA 3G10A 4K0KK 3CF5L 1CZ9A 3AVCA 1VSMA 4FJ7A 4I9QA 1TKTA 4E7IA 1U47A 1QHTA 1RTHA 3PX0A 1XNQK 4N56A 4JS5A 1K8KB 1BG3A 2ITGA 2W40A 3C6UA 1OH6A 3EKUA 3J81O 5C24A 1I3AA 1BUPA 3AGRA 4KHYA 2A6AA 4NCAA 4M3YA 4NCGA 3R1XA 1LW0A 2X78A 4C8NA 3JAMO 1GLBG 4OJRA 4B3SK 5J2MA 3KHYA 3QNNA 1EO1A 4NO7A 4CJ7A 5AQMA 3IFRA 4ISGA 4FJKA 1T8EA 2E1YA 2HVIA 3HL8A 4JI3K 3U3GA 4IZ9A 3HSCA 3T1YK 5FRMA 2BTFA 1QSSA 3DYAA 1T03A 2QXLA 4I9LA 2IVPA 4JI6K 3LDSA 5H1SQ 1WAFA 4DLGA 2IS3A 1NMNA 1VQON 4MFBA 4J2AA 2HB5A 3AVFA 4V19S 4B9QA 4H4MA 3J7YP 1VQNN 3NVKA 1S3XA 4CEQA 4B3MK 3MXMA 1V4SA 2VYPA 2RKIA 4M7XA 3E9LA 4CD3A 3IKMA 1VSEA 4BROA 4JK8A 5C2DA 5T7BA 4Z4CA 3WUHA 4YY3K 3THXA 4FLZA 4W5QA 4HVJA 1VSIA 5CYMA 4QOZB 2JLEA 3IS9A
chains in the Genus database with same CATH topology
2YHWA 2OTLN 4JN4A 4H5VA 3WXMB 4JKFA 3MCAB 1N8RO 3T69A 3I56N 3M3ZA 3CI5A 4XH1A 4K41A 1D4XA 1IJJA 4YDUA 4ILJA 2P9UA 4FL9A 3HBTA 1QHAA 4IO8A 4K25A 1NGGA 1QQMA 3WXJA 5GINA 2JWKA 3M1FA 1DT9A 1G99A 3QB0A 5KPZA 2YCHA 1YJNN 2HOEA 4RCHA 1YUWA 4H03B 4NLCA 3LL3A 1KD1O 4JKDA 2A3ZA 2E2OA 3D2FB 4OPHA 3CCQN 4XH5A 1BDGA 1C0GA 4B1YB 2E2QA 2ZGYA 3FZKA 3GG4A 4GY2B 4DKWA 2WC9A 5AZJA 4FWLA 3EE8A 4JHDA 4BR7A 5DM6L 2CH6A 1YI2N 2QM1A 4XH4A 5LJWA 2GEMA 2ZJRL 2PFUA 1YHQN 4C1NK 3VETA 3VF2A 3BP8A 3E66A 3WEEA 2NRZA 3E9PA 5KPRA 2P9NA 2CGJA 4FOEA 2FF6A 1VQ4N 4WF9L 1KQSM 4JKCA 5AFUA 2NRTA 1GLFO 3LDOA 3U4LA 3KZBA 4BR5A 4DQ8A 2D0PA 4BVPA 4YOUA 4A5AA 5LY3A 2Q0UA 1K73O 4FWKA 4MDBA 3DXKB 1HUXA 1VQKN 4WQ4A 4JHDB 4BR4A 3VESA 3G4SN 1BO5O 2FXUA 3PLAA 1U6ZA 4BC2A 1RDUA 4EIAA 3O9UA 3QFPA 5GIOA 5AZIA 4YOWA 4HWIA 2QW9A 3H45C 4H0OA 1T44A 3ENBA 3QBWA 3AGKA 5FPEA 2P9NB 2P9SA 1NWKA 4JKEA 4MLHA 5AQQA 3VGMA 5JMVA 4NB4A 4O5FA 1NGIA 2HF4A 5AQHA 4GV9A 3K9JA 3MX2A 4KH5A 4BRQA 5GAGP 3OBWA 3JXUA 3GE1A 4YDUC 2NRHA 2YHXA 1NGAA 2NRVA 1NGEA 3IMXA 3QFUA 4IOXA 3DWLA 4WYBA 5AR0A 1T6CA 3VEWA 2FSJA 4YOYA 2QTDA 1S72N 3TPQA 4A59A 3P39A 5JLHA 3P38A 2A5XA 3EE9A 3CMEN 3FZHA 3WXIA 4H5RA 3CJ7A 2J4RA 5TKYA 3O1BA 5FPMA 4BRCA 5DM7L 1P8ZA 2RE2A 3O6WA 5C0YA 5CR4A 3FE1A 1KAZA 2YI1A 4CZHA 1VQMN 4IJNA 4BR9A 4AM6A 4R79A 2P9SB 2E1ZA 1QZ5A 5F2RA 1QQNA 1TYQA 2QWMA 3ZX2A 4DB3A 3F9MA 4FO0A 1VQ5N 2D0OA 3VMFB 3MDQA 3ZETA 4BRNA 3CJAA 3H3OB 1BOTO 1YXQA 3EN9A 2HBKA 4H0PA 4JAXA 1NLVA 5EOYA 3FZLA 3SBGA 4AM7A 5AQKA 1OKJA 5ELZA 5JICA 3J8AA 3A5NC 4PL8A 1JCEA 4BG8A 5BRFA 5AQPA 3W0LA 1WUAA 1QQOA 3UKUA 4ISEA 3KWIA 1RDWX 4L3QA 4WFNL 2PAVA 1NGCA 1M1KO 5GADP 4H5WA 4BRPA 5JVHL 1VQ8N 4CZLA 1DKGD 4EHUA 2HF3A 4Y0WA 2HBLA 5EVZA 3VEZA 2P9IA 4E1JA 1HJOA 2NNWA 3KK7A 4JKAA 3TTFA 4CBXA 5I9EB 4KBOA 4WQ4C 2P9LA 2FSKA 3W3DA 5GAHP 1GLEG 2QWOA 3WQUA 4H0YB 5F1XA 1TUYA 2NRXA 4LC9B 4IOAL 1TYQB 3C6HA 4FWSA 4GNIA 4A57A 2YJEA 2AP1A 5AFUH 3TU5A 3I8BA 4FWMA 3ZETB 3SK3A 4JKBA 1T3VA 3ENHA 4PL7A 1X3MA 1HKBA 3C65A 3R3LA 3KVGA 3HTVA 1QZ6A 4CZJA 1LCUA 3A5OC 2VGNA 3MMVA 3S41A 4RTFD 4CZKA 4YOXA 2QA4N 3G25A 5AQFA 1VAZA 2VCPA 4MLEA 3VTIA 1E4FT 2E8AA 3MN7A 1YIJN 2YJFA 3GL1A 3H46O 1NJIO 2P9IB 4YOTA 2ZF5O 2NLXA 1NBWA 5BRDA 1YVNA 2IIRA 5AQRA 1M90O 3MN9A 3J7ZO 3H1QA 4FWPA 1SAZA 2A42A 3LDQA 4O8UA 4NLBA 2GELA 3ATVA 5AQLA 4BVOA 3HOTA 3VGKA 4FSVA 1WOQA 2P9KA 5M1KA 3Q7BA 3N4PA 1S22A 2P9UB 5BN8A 5F0XA 1BWFO 5EY4A 4K43A 2KLAA 3ID6A 5AQXA 1V4TA 1X3NA 2JWLA 2PBDA 4MDAA 3ZEUA 3WXLA 5BRHA 2ZWHA 4I6MA 3VF6A 4BC4A 1SS6A 4U7BA 5AQOA 3AARA 2NZTA 3QICA 4F9OA 3NMUA 4DHYA 3FGUA 3ZYYX 1Q7YO 2NRRA 3CHWA 1ATSA 1LOTB 2E2NA 4H5NA 5GAEP 3P4IA 5BREA 4WQ5C 1OVYA 3A5LC 5AZJB 4HTLA 3CJ1A 3CQYA 3HM8A 4BRKA 5KPTA 3CCJN 5JVGL 1J6ZA 2V51B 3TTCA 5FPNA 1ZXOA 2P9KB 4IXCA 3O80A 1VQPN 5M1QA 2D1KA 3H1VX 5AQWA 3D2EA 3P31A 1GLJO 3WEEB 4BRDA 1Q18A 1SZ2A 3CJCA 3LDPA 3LDLA 3UB5A 3CXCM 3SAFA 3LM9A 4JNEA 4Z94A 2NRWA 3L6QA 3MN5A 3VTHA 2FF3B 2UYTA 3ZEUB 2IVOA 1ZBSA 4I6MB 3WXKA 1Y64A 4BREA 3CCMN 1VQLN 3CPEA 3TSUA 2HMPA 3C6AA 3CETA 3VF4A 3WT0A 3CCLN 2HSTA 3AAQA 4A5BA 3VEOA 2Q36A 4ILHA 2W41A 2E20A 2QWPA 3CERA 1HPMA 4JEPA 4CZFA 1NMDA 2EWSA 3H6EA 4BY9C 1T6DA 3U8XA 5AZIB 2QWRA 4ISFA 3CC2N 4YORA 3BF1A 1QVGM 3R9PA 1K9MO 4JK7A 3D2EB 1NGDA 4BRIA 1MWMA 1O13A 4M63C 4CZGA 5BN9A 1ESVA 2KKZA 2QEXN 1QVFM 3BEXA 1YJWN 4EAHD 4BRMA 3O08A 5C10A 5HOOA 2Q31A 2I7NA 5FPDA 2CGKA 1DGKN 2H3GX 2YHYA 3LDNA 3HRGA 1HKGA 4FWNA 3F2KA 3U9ZA 3VEVA 4MO4A 4DCHA 4EFHA 2ASOA 4IEIA 4GV6A 3CCRN 5HL7L 3H3NO 2ASMA 3A0IX 4B1ZA 3FFKB 3VENA 3BF3A 1NGHA 1NGBA 4BR2A 3CMAN 2Q97A 3C7NA 2A41A 3OW2M 4WQ5A 2GWKA 3ID8A 4CZIA 3SMSA 1NM1A 3AAPA 2E88A 3DXMA 3ZX3A 1E4GT 1W97L 5M1OA 1GLAG 1CZAN 1XUPO 5TKWA 4A62A 3ULEA 3C0BA 4FWRA 5JLFA 3GOIA 4BRHA 4CBWA 3DJCA 4BRGA 3IDHA 4B1XB 3VPZA 3FZFA 3M6GA 1W2BM 4H5TA 5AQUA 3KWGA 5C15A 1Q82O 3SJHA 3D6RA 1EQYA 3DLLL 1YF5L 1MWKA 1U2VA 3VGLA 5EX5A 4AF1A 1RFQA 1KAXA 4UY8O 4B1WB 2VGMA 1H1VA 3L0QA 5C2FA 4CZEA 4BRFA 4WFAL 3PIPL 3MCPA 3C7NB 3UKUB 4EHTA 2HBJA 5BR9A 2FSNA 3VOVA 2A40A 3HZ6A 2QWNA 4FPBA 3DXMB 3O8MA 2VWBA 5AQVA 3EL2A 5LJVA 3N4QA 4FWOA 2GX9A 3RSEA 3MK6A 2GUPA 4KH4A 4O8KA 3R8EA 3QDKA 1BA0A 3HOSA 4U67L 2QWQA 2P9LB 3ULEB 5AQTA 5AQGA 3CQXA 4BRLA 2D4WA 4WCEL 4BG9A 3SAGA 2HBMA 4BQLA 4J8FA 3O1WA 3OA9A 1XQSC 4ILGB 4BQZA 3I55N 4G9ZA 5AQZA 3CC4N 1ILYA 2OANA 2Q0RA 2OTJN 1U2VB 4B1VA 1JCFA 3EO3A 1GLDG 2BUPA 4CZMA 1Q81O 1HLUA 4PKHA 4KH6A 3FZMA 4RWTA 3ZX0A 2BH1A 4QS9A 4A61A 1GLLO 3O9RA 3NVMA 4H0VB 5M1NA 1HKCA 4PHTX 3DXKA 4BRAA 1MA9B 3UKRA 5E84A 1Z05A 3RSEB 3MN6A 2WBNA 4BGBA 2AA4A 1NGFA 2I7PA 4FWQA 3VERA 5BPLA 1Z6RA 1RGIA 3CJ9A 3QMLA 3CCSN 3EZWA 3QBXA 2FLOA 4H0TB 5KQ8A 4WFBL 4BC3A 4C1NI 4CI6A 2GTDA 4PKGA 4PKIA 2YX6A 1K8KA 1YAGA 3M5RA 3FLCO 2RHKA 3JS6A 4XEIA 1DEJA 2IVNA 3EKSA 4JD2A 1YITN 3CD6N 4JKHA 5BPMA 3E9OA 5CE3A 4IJAA 3T7ZA 3F5TA 3OHRA 2WUSA 1ZC6A 2Q2RA 1VQ9N 5M1FA 4GVEA 4QS8A 3CJBA 1Q86O 3TSQA 2V7YA 4QS7A 3CF5L 1JJ2M 4K42A 5BPNA 3GBTA 1VQ6N 1BU6O 3O9SA 2KHOA 2F9WA 3L4QA 3WQTA 5B8HA 3FR0A 4M7YA 5ADXH 3UKRB 3O5BA 1R59O 4CD1A 3B8AX 4A2AA 1TUUA 4YOVA 3SAHA 5AQJA 3CPWM 3E1YA 2ZJQL 4OO1J 3U9DA 3CCEN 3G71N 1K8KB 4IDHA 5MLCQ 1BG3A 3DAWA 2W40A 5E26A 4JD2B 1SQKA 1KC8O 2DPNA 4IFEA 2WFBA 5GIPA 1P90A 3SLCA 2V52B 3EKUA 2P9PA 1BUPA 2CGLA 3AGRA 2A6AA 2QI2A 1GLCG 5M1PA 4A2BA 3R1XA 3O4WA 1C0FA 2GWJA 2V7ZA 2ASPA 1X9JA 3MWTA 4JK9A 3GDQA 3CCUN 3IUCA 1ATRA 3AY9A 3I33A 1ATNA 1GLBG 3D7EO 3L4IA 4OPAA 4FPAA 1HX1A 4BGAA 3KHYA 1K8AO 2ITMA 1EO1A 3ENOA 4BR0A 4C23A 4NO7A 4CJ7A 4IWVA 5AQMA 3IFRA 5AQSA 3R6MA 4ISGA 4BC5A 5AQYA 2E1YA 3SMPA 4FOIA 3Q7CA 4JKGA 5AQNA 4IZ9A 3HSCA 2BTFA 2F7TA 3A5MC 5ADXA 4MO5A 2QWLA 2QXLA 3TTDA 2Q1NA 1XC3A 2IVPA 3VEXA 5CHIA 2F9TA 5H1SQ 2CH5A 3CC7N 1VQON 2P9PB 3BUZB 3G6EN 3ATUA 3A8YA 1NGJA 3OBYA 3LM2A 5EXWA 4B9QA 4IO9L 1VQNN 4FVUA 3NVKA 3RVCA 1S3XA 3PIOL 3CCVN 5KQDA 3CIPA 1V4SA 2VYPA 3K9KA 3SBTA 3VEYA 4M7XA 2ZJPL 3MX5A 3E9LA 3O9TA 3HI0A 4CD3A 3IKMA 1KAYA 4BROA 4IEEA 1KXPA 1IG8A 3D2FA 3TSPA 4JK8A 4JKGB 4IOCL 1VQ7N 3O9QA 1BA1A 4H0XB 5AQIA 4B1UB 5C12A 5C2DA 3WUHA 3UE5A 1JCGA 1MDUB 3MWPA 4CBUA 1YJ9N 2E2PA 2ZGZA 4GV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHW A;  4JN4 A;  4H5V A;  3M3Z A;  3CI5 A;  4XH1 A;  4K41 A;  1D4X A;  1IJJ A;  4YDU A;  4K25 A;  2P9U A;  4FL9 A;  3HBT A;  1QHA A;  4IO8 A;  3WXJ A;  1NGG A;  1QQM A;  3M1F A;  1G99 A;  3QB0 A;  5KPZ A;  2YCH A;  2HOE A;  4RCH A;  1YUW A;  4H03 B;  3LL3 A;  2A3Z A;  2E2O A;  3D2F B;  4XH5 A;  1BDG A;  1C0G A;  4B1Y B;  2E2Q A;  2ZGY A;  3FZK A;  3GG4 A;  4GY2 B;  5AZJ A;  4FWL A;  4JHD A;  4BR7 A;  2CH6 A;  2QM1 A;  4XH4 A;  5LJW A;  2GEM A;  3VET A;  3VF2 A;  3BP8 A;  3WEE A;  5KPR A;  2P9N A;  2CGJ A;  4FOE A;  2FF6 A;  5AFU A;  1GLF O;  3LDO A;  3U4L A;  3KZB A;  4BR5 A;  4DQ8 A;  2D0P A;  4BVP A;  5LY3 A;  2Q0U A;  4FWK A;  3DXK B;  1HUX A;  4WQ4 A;  4JHD B;  4BR4 A;  3VES A;  1BO5 O;  2FXU A;  1U6Z A;  4BC2 A;  4EIA A;  3QFP A;  5AZI A;  4HWI A;  2QW9 A;  3H45 C;  4H0O A;  1T44 A;  3QBW A;  5FPE A;  2P9N B;  2P9S A;  1NWK A;  4MLH A;  5AQQ A;  3VGM A;  5JMV A;  4NB4 A;  4O5F A;  1NGI A;  2HF4 A;  5AQH A;  4BRQ A;  3JXU A;  3GE1 A;  4YDU C;  2NRH A;  2YHX A;  1NGA A;  4WYB A;  1NGE A;  3IMX A;  3QFU A;  3DWL A;  5AR0 A;  1T6C A;  3VEW A;  2FSJ A;  3TPQ A;  5JLH A;  2A5X A;  3FZH A;  3WXI A;  4H5R A;  3CJ7 A;  2J4R A;  5TKY A;  3O1B A;  5FPM A;  4BRC A;  1P8Z A;  3O6W A;  3FE1 A;  1KAZ A;  2YI1 A;  4CZH A;  4IJN A;  4BR9 A;  4AM6 A;  2P9S B;  2E1Z A;  1QZ5 A;  5F2R A;  1QQN A;  1TYQ A;  2QWM A;  3ZX2 A;  4DB3 A;  3F9M A;  4FO0 A;  2D0O A;  3MDQ A;  3ZET A;  4BRN A;  3CJA A;  3H3O B;  1BOT O;  1YXQ A;  3EN9 A;  4H0P A;  4JAX A;  1NLV A;  5EOY A;  3FZL A;  4AM7 A;  5AQK A;  1OKJ A;  5ELZ A;  5JIC A;  3J8A A;  3A5N C;  4PL8 A;  1JCE A;  4BG8 A;  5BRF A;  5AQP A;  3W0L A;  1WUA A;  1QQO A;  3UKU A;  4ISE A;  1RDW X;  4L3Q A;  2PAV A;  1NGC A;  4H5W A;  4BRP A;  4CZL A;  1DKG D;  4EHU A;  2HF3 A;  4Y0W A;  5EVZ A;  3VEZ A;  2P9I A;  4E1J A;  1HJO A;  4CBX A;  5I9E B;  4KBO A;  4WQ4 C;  2P9L A;  2FSK A;  3W3D A;  1GLE G;  2QWO A;  3WQU A;  4H0Y B;  5F1X A;  1TUY A;  4LC9 B;  1TYQ B;  4FWS A;  4GNI A;  2YJE A;  2AP1 A;  5AFU H;  3TU5 A;  3I8B A;  4FWM A;  3ZET B;  3SK3 A;  3ENH A;  4PL7 A;  1X3M A;  1HKB A;  3KVG A;  3HTV A;  1QZ6 A;  4CZJ A;  1LCU A;  3A5O C;  3MMV A;  3S41 A;  4CZK A;  4RTF D;  3G25 A;  5AQF A;  2VCP A;  4MLE A;  1E4F T;  2E8A A;  3MN7 A;  2YJF A;  3GL1 A;  3H46 O;  2P9I B;  2ZF5 O;  2NLX A;  1NBW A;  5BRD A;  1YVN A;  2IIR A;  5AQR A;  3MN9 A;  3H1Q A;  4FWP A;  1SAZ A;  2A42 A;  3LDQ A;  2GEL A;  3ATV A;  5AQL A;  4BVO A;  3VGK A;  4FSV A;  1WOQ A;  2P9K A;  1S22 A;  2P9U B;  5BN8 A;  5F0X A;  1BWF O;  5EY4 A;  4K43 A;  5AQX A;  1V4T A;  1X3N A;  2PBD A;  3ZEU A;  3WXL A;  5BRH A;  2ZWH A;  4I6M A;  3VF6 A;  4BC4 A;  5AQO A;  3AAR A;  2NZT A;  3QIC A;  4F9O A;  4DHY A;  3FGU A;  3CHW A;  1ATS A;  1LOT B;  2E2N A;  4H5N A;  5BRE A;  3P4I A;  4WQ5 C;  3A5L C;  5AZJ B;  4HTL A;  3CJ1 A;  3CQY A;  3HM8 A;  4BRK A;  5KPT A;  1J6Z A;  2V51 B;  5FPN A;  1ZXO A;  2P9K B;  4IXC A;  3O80 A;  2D1K A;  3H1V X;  5AQW A;  3D2E A;  3WEE B;  1GLJ O;  4BRD A;  1Q18 A;  1SZ2 A;  3CJC A;  3LDP A;  3LDL A;  3UB5 A;  3LM9 A;  4JNE A;  4Z94 A;  3L6Q A;  3MN5 A;  2FF3 B;  2UYT A;  3ZEU B;  2IVO A;  1ZBS A;  4I6M B;  3WXK A;  1Y64 A;  4BRE A;  2HMP A;  3CET A;  3VF4 A;  3WT0 A;  3AAQ A;  3VEO A;  2Q36 A;  2W41 A;  2E20 A;  2QWP A;  3CER A;  1HPM A;  4CZF A;  1NMD A;  2EWS A;  3H6E A;  1T6D A;  3U8X A;  5AZI B;  2QWR A;  4ISF A;  3BF1 A;  3R9P A;  3D2E B;  1NGD A;  4BRI A;  1MWM A;  4M63 C;  4CZG A;  5BN9 A;  1ESV A;  3BEX A;  4EAH D;  4BRM A;  3O08 A;  2Q31 A;  2I7N A;  5FPD A;  2CGK A;  1DGK N;  2H3G X;  2YHY A;  3LDN A;  3U9Z A;  1HKG A;  4FWN A;  3VEV A;  4DCH A;  4EFH A;  4MO4 A;  2ASO A;  3H3N O;  2ASM A;  3A0I X;  4B1Z A;  3FFK B;  3VEN A;  3BF3 A;  1NGH A;  1NGB A;  4BR2 A;  2Q97 A;  3C7N A;  2A41 A;  4WQ5 A;  2GWK A;  3ID8 A;  4CZI A;  3SMS A;  1NM1 A;  3AAP A;  2E88 A;  3DXM A;  3ZX3 A;  1E4G T;  1GLA G;  1CZA N;  1XUP O;  4A62 A;  3ULE A;  3C0B A;  4FWR A;  5JLF A;  3GOI A;  4BRH A;  4CBW A;  3DJC A;  4BRG A;  3IDH A;  4B1X B;  3VPZ A;  3FZF A;  3M6G A;  4H5T A;  5AQU A;  3SJH A;  1EQY A;  1MWK A;  1U2V A;  3VGL A;  5EX5 A;  1RFQ A;  1KAX A;  4B1W B;  1H1V A;  3L0Q A;  4CZE A;  4BRF A;  3MCP A;  3C7N B;  3UKU B;  4EHT A;  5BR9 A;  2FSN A;  3VOV A;  2A40 A;  3HZ6 A;  2QWN A;  4FPB A;  3DXM B;  3O8M A;  2VWB A;  5AQV A;  3EL2 A;  5LJV A;  4FWO A;  3RSE A;  3MK6 A;  2GUP A;  4O8K A;  3R8E A;  3QDK A;  1BA0 A;  2QWQ A;  2P9L B;  3ULE B;  5AQT A;  5AQG A;  3CQX A;  4BRL A;  2D4W A;  4BG9 A;  4BQL A;  4J8F A;  3O1W A;  1XQS C;  4BQZ A;  5AQZ A;  2OAN A;  2Q0R A;  1U2V B;  4B1V A;  3EO3 A;  1JCF A;  1GLD G;  2BUP A;  4CZM A;  1HLU A;  4PKH A;  3FZM A;  4RWT A;  3ZX0 A;  4QS9 A;  4A61 A;  1GLL O;  4H0V B;  1HKC A;  3DXK A;  4BRA A;  1MA9 B;  3UKR A;  5E84 A;  1Z05 A;  3RSE B;  3MN6 A;  4BGB A;  2AA4 A;  1NGF A;  2I7P A;  4FWQ A;  3VER A;  5BPL A;  1Z6R A;  1RGI A;  3CJ9 A;  3QML A;  3EZW A;  3QBX A;  2FLO A;  4H0T B;  5KQ8 A;  4BC3 A;  4CI6 A;  2GTD A;  4PKG A;  4PKI A;  1K8K A;  1YAG A;  3FLC O;  3JS6 A;  4XEI A;  1DEJ A;  2IVN A;  3EKS A;  4JD2 A;  5BPM A;  5CE3 A;  4IJA A;  3OHR A;  2WUS A;  1ZC6 A;  2Q2R A;  4QS8 A;  3CJB A;  2V7Y A;  4QS7 A;  4K42 A;  5BPN A;  3GBT A;  1BU6 O;  5B8H A;  2KHO A;  2F9W A;  3WQT A;  3FR0 A;  4M7Y A;  5ADX H;  3UKR B;  3O5B A;  1R59 O;  4CD1 A;  3B8A X;  4A2A A;  1TUU A;  5AQJ A;  3U9D A;  1K8K B;  1BG3 A;  3DAW A;  2W40 A;  5E26 A;  4JD2 B;  1SQK A;  2DPN A;  3SLC A;  2V52 B;  3EKU A;  2P9P A;  1BUP A;  2CGL A;  2A6A A;  1GLC G;  4A2B A;  3O4W A;  1C0F A;  2GWJ A;  2V7Z A;  2ASP A;  1X9J A;  3GDQ A;  3IUC A;  1ATR A;  3AY9 A;  3I33 A;  1ATN A;  1GLB G;  3D7E O;  3L4I A;  4BGA A;  4FPA A;  1HX1 A;  3KHY A;  2ITM A;  3ENO A;  4BR0 A;  4C23 A;  4NO7 A;  4CJ7 A;  4IWV A;  5AQM A;  3IFR A;  5AQS A;  3R6M A;  4ISG A;  4BC5 A;  5AQY A;  2E1Y A;  3SMP A;  4FOI A;  5AQN A;  4IZ9 A;  3HSC A;  2BTF A;  5ADX A;  3A5M C;  4MO5 A;  2QWL A;  2QXL A;  2Q1N A;  1XC3 A;  2IVP A;  3VEX A;  2F9T A;  2CH5 A;  2P9P B;  3BUZ B;  3ATU A;  3A8Y A;  1NGJ A;  3LM2 A;  5EXW A;  4B9Q A;  1S3X A;  5KQD A;  3CIP A;  1V4S A;  2VYP A;  3VEY A;  4M7X A;  3HI0 A;  4CD3 A;  1KAY A;  4BRO A;  1KXP A;  1IG8 A;  3D2F A;  1BA1 A;  4H0X B;  5AQI A;  4B1U B;  3WUH A;  3UE5 A;  1JCG A;  1MDU B;  4CBU A;  2E2P A;  2ZGZ A; 
#chains in the Genus database with same CATH topology
 4JN4 A;  4Z4G A;  1B9D A;  4DQS A;  3NE6 A;  5JS2 A;  1HMV A;  4JKF A;  2G8U A;  3M3Z A;  2FBY A;  1D4X A;  2ZQB A;  1IJJ A;  2P9U A;  4DTS A;  4IO8 A;  1QQM A;  3IG1 A;  3M1F A;  1DT9 A;  4FK4 A;  1G99 A;  1YJN N;  1YUW A;  3THY A;  4NLC A;  3LL3 A;  4JKD A;  2ZM6 K;  1BIS A;  4I2P A;  1BDG A;  1JXB A;  1C0G A;  4X66 K;  3FZK A;  4GV6 A;  3GG4 A;  4GY2 B;  1JLC A;  2D0A A;  4JHD A;  3ZSY A;  4O44 A;  1YI2 N;  2WON A;  5LJW A;  2GEM A;  4DTM A;  1XC9 A;  4CEO A;  1RBT A;  3VET A;  3BP8 A;  2NRZ A;  5KPR A;  1D5A A;  4CJS A;  2CGJ A;  1WSF A;  1HYV A;  2NRT A;  3AVJ A;  4B9M A;  4KHP K;  3OYF A;  3KZB A;  1TVR A;  4FLT A;  2VG7 A;  4GW6 A;  4A5A A;  3QEV A;  2GBZ A;  5K14 A;  4FWK A;  4KHW A;  3KJV A;  4Q5V A;  4BR4 A;  3VES A;  1BO5 O;  3OYJ A;  3SQ4 A;  4CHO A;  4BC2 A;  3RMA A;  3O9U A;  4Q0B A;  5GIO A;  4FJ9 A;  1A5W A;  3H45 C;  1U4B A;  1T44 A;  3AV9 A;  1VRT A;  3QBW A;  3MXJ A;  5AQQ A;  5JMV A;  1LWC A;  1RDB A;  2HF4 A;  5AQH A;  3K9J A;  3MX2 A;  3OBW A;  3NDK A;  4DV5 K;  2NRH A;  2YHX A;  1NGA A;  4CED A;  2FSJ A;  2HHU A;  2QTD A;  4X62 K;  3TPQ A;  4A59 A;  1NK6 A;  2YKN A;  2A5X A;  3WXI A;  2E5L K;  4O4G A;  4M3Z A;  3MEC A;  3I0R A;  3O1B A;  4BRC A;  1IKV A;  3O6W A;  5HLF A;  5CR4 A;  4ELT A;  3FE1 A;  4LF9 K;  4FJI A;  2YI1 A;  1VQM N;  4AIL C;  1QSY A;  2P9S B;  1TYQ A;  1ZBU A;  2QWM A;  4N41 A;  3F9M A;  2D0O A;  3VMF B;  4PQU A;  1EWR A;  3CJA A;  2G8I A;  4H0P A;  1NLV A;  3SBG A;  3FZL A;  3QNO A;  1JKH A;  1J9A A;  1OKJ A;  5ELZ A;  3J8A A;  3V4I A;  3A5N C;  3AO4 A;  1JCE A;  1J54 A;  4PL8 A;  1BIU A;  3AA3 A;  1QQO A;  1RDW X;  3AVA A;  3THW A;  1CXU A;  2P51 A;  5HRO A;  3ZSV A;  4BRP A;  3TI0 A;  1DKG D;  4E1J A;  1HJO A;  4YNQ A;  1JLQ A;  3K5L A;  4KAZ A;  2FSK A;  3WQU A;  4H0Y B;  5F1X A;  1IBM K;  2I5J A;  3AVH A;  5AFU H;  3SK3 A;  3ENH A;  4DF4 A;  1X3M A;  1HKB A;  3C65 A;  1QZ6 A;  1IBK K;  3OS1 A;  3S41 A;  4CJU A;  4RTF D;  2O8B B;  2QA4 N;  3G25 A;  1NG9 A;  1E4F T;  5FRO A;  3SV4 A;  2O8F B;  5J2N A;  3GL1 A;  3LAN A;  2ZF5 O;  1YVN A;  5AQR A;  1M90 O;  3J7Z O;  1SAZ A;  2A42 A;  3LDQ A;  3SUO A;  3VGK A;  4FSV A;  3L2V A;  3LAL A;  1E3M A;  3OYB A;  2P9K A;  4E7H A;  1JLE A;  5BN8 A;  1WNS A;  5AQX A;  2YV0 X;  5BRH A;  2YNH A;  4DHY A;  3RMC A;  2E2N A;  1KVB A;  3SQ2 A;  1GOA A;  3U6F A;  5AZJ B;  1NNE A;  3CJ1 A;  5HP1 A;  4ELV A;  1RT7 A;  5JVG L;  3OYE A;  3T3F A;  1VQP N;  1ZXO A;  5AQW A;  3D2E A;  4JI8 K;  4BRD A;  1Q18 A;  3LDP A;  3CJC A;  4KB0 A;  3CXC M;  4BAC A;  3U3Y A;  2NRW A;  3L6Q A;  3MN5 A;  1NJW A;  4CJ3 A;  2UYT A;  4DFJ A;  1VQL N;  4CGD A;  4F8R A;  3CPE A;  3WNH A;  4CGI A;  3HYF A;  3CET A;  3WT0 A;  4X65 K;  3L2Q A;  3VEO A;  4HUG A;  2E20 A;  4KHS A;  3T1H K;  1S1W A;  1NMD A;  1B9F A;  4BY9 C;  1T6D A;  5AZI B;  2QWR A;  3CC2 N;  3VQ8 A;  3AA4 A;  1MWM A;  1VHX A;  4FLX A;  4CZG A;  4DV7 K;  3BEX A;  4B3O A;  4EAH D;  5FPD A;  2CGK A;  3LDN A;  1X9M A;  4MO4 A;  1A5V A;  2OZM A;  1Z25 A;  3VEN A;  2P1J A;  5CZ2 A;  3CMA N;  3C7N A;  2A41 A;  3V1R A;  4WQ5 A;  2GWK A;  1SL1 A;  3OYC A;  3AAP A;  2E88 A;  1YTA A;  3NBP A;  1GLA G;  1CZA N;  3V9Z A;  4E0D A;  2KQ2 A;  4A62 A;  4N76 A;  3KK1 A;  2OPS A;  3GOI A;  4BDP A;  4BRH A;  3IDH A;  3VPZ A;  2HHH K;  1TKX A;  3VQA A;  1U04 A;  4AHC A;  1HJR A;  1U2V A;  3AO3 A;  3VGL A;  4FM1 A;  4HCC A;  3PIP L;  2XY5 A;  5SZT A;  4CZE A;  4BRF A;  1D9D A;  2ATQ A;  3VOV A;  4FJX A;  2A40 A;  3HZ6 A;  3O8M A;  4EZ6 A;  4DFM A;  2ETJ A;  4FWO A;  3RSE A;  2GUP A;  1BA0 A;  3ULE B;  1VSF A;  2HNZ A;  1EP4 A;  1IKW A;  4ILG B;  4BWJ A;  3SNN A;  4BQZ A;  4UQG A;  4OX9 K;  2OAN A;  2OTJ N;  1EKE A;  4B1V A;  2VWJ A;  1GLD G;  2BUP A;  3VQ5 A;  4PKH A;  3PUF A;  1NJY A;  3LZI A;  2KFZ A;  4LFC K;  1LAV A;  4B9V A;  2Q3S A;  1TGO A;  5E84 A;  2I7P A;  4FWQ A;  4BE1 A;  3QBX A;  4H0T B;  4CI6 A;  4PKG A;  1YAG A;  4FJH A;  3JS6 A;  3PO5 A;  4Y1D A;  4JKH A;  4IJA A;  1RBV A;  3T7Z A;  3RTV A;  1ZC6 A;  2Q2R A;  4QS8 A;  2HMI A;  3CJB A;  3CFO A;  4Z4H A;  3O9S A;  2F9W A;  3FR0 A;  4M7Y A;  1VSJ A;  2HNY A;  1R59 O;  3NF9 A;  2YKM A;  1TUU A;  2XO7 A;  2ZJQ L;  2HHT A;  3U9D A;  3SUN A;  4IDH A;  5MLC Q;  3LP3 A;  5E26 A;  1RT5 A;  2P9P A;  4FLY A;  4CHP A;  1GLC G;  4GVM A;  5LL6 Z;  3KLG A;  3OTO K;  4JK9 A;  2BGG A;  1X9S A;  1IO2 A;  1ATN A;  4OPA A;  1WSH A;  4FPA A;  4DU3 A;  4Z4E A;  4KRE A;  1K8A O;  4BR0 A;  4FOI A;  5AQN A;  1IG9 A;  5ADX A;  2QWL A;  3L3V A;  1J5O A;  4W5R A;  2CH5 A;  1NK7 A;  3TR8 A;  4CGG A;  1NGJ A;  3ZSX A;  4CEE A;  4HTU A;  4LF6 K;  1X1P A;  3PIO L;  2WOM A;  4QAG A;  2IDO A;  5KQD A;  4CES A;  2O8B A;  3VEY A;  2ZJP L;  5C25 A;  3HI0 A;  3MEE A;  1KXP A;  1IG8 A;  1VQ7 N;  4L8R B;  4JKG B;  4IOC L;  5IWA K;  4CJV A;  5AQI A;  4B1U B;  1WN7 A;  5KGX A;  5JS1 A;  1NK5 A;  4LY7 A;  4OKE A;  1JCG A;  1MDU B;  4OKK A;  4AH9 A;  4OVL A;  1T05 A;  1D9F A;  1EX4 A;  2OTL N;  2KFN A;  3WXM B;  1S1V A;  3T69 A;  3J7A P;  4AQY K;  4K8X A;  4CEC A;  4ILJ A;  5GIN A;  3AVK A;  3HBT A;  3T19 A;  3AA5 X;  2DTU A;  2JWK A;  4E1M A;  1KVC A;  4E7L A;  5KPZ A;  2YCH A;  3QLH A;  4RCH A;  4ID1 A;  3D2F B;  4OPH A;  4BE2 A;  4DTJ A;  4FJM A;  2BE2 A;  2O8C B;  1NKB A;  2UUC K;  2E2Q A;  2ZGY A;  5AZJ A;  2WC9 A;  1LV5 A;  4BR7 A;  3RMB A;  3VQE A;  4XH4 A;  3QO9 A;  5HRP A;  3HPO A;  2ZJR L;  1OVQ A;  5J2Q A;  2HND A;  3V6D A;  5KGW A;  2KW4 A;  3HPG A;  4IG0 A;  3THV A;  4MQ3 A;  2P9N A;  4DR1 K;  4ZHR A;  1VQ4 N;  4JV5 K;  1KQS M;  3KIO A;  5KRT A;  4DF8 A;  3LDO A;  2GV9 A;  3EYZ A;  3KD5 E;  4BR5 A;  4DQ8 A;  1IKX A;  3L2W A;  2FBV A;  1D8Y A;  1L3V A;  1K73 O;  5HRS A;  3OYA A;  1XHX A;  1VQK N;  3O3G A;  2D5R A;  1RDU A;  4EIA A;  2OPR A;  5AZI A;  4YOW A;  3BZK A;  1UOC A;  4HWI A;  4YFU A;  1C1C A;  4DS5 A;  4JKE A;  4MLH A;  3VGM A;  1IKY A;  4NB4 A;  4W5O A;  2YNF A;  4B08 A;  4BDY A;  3RMD A;  3JXU A;  3GE1 A;  3QFU A;  3VEW A;  4YOY A;  3DLR A;  3P39 A;  3CME N;  1XMO K;  3FZH A;  4CW7 B;  3SUQ A;  4H5R A;  3TAQ A;  1ZBF A;  2J4R A;  1HNV A;  3ZLJ A;  5TKY A;  5FPM A;  4I7F A;  5DM7 L;  2RE2 A;  5C0Y A;  4WE1 A;  3KK2 A;  4RW7 A;  4KHN A;  1K6Y A;  1KAZ A;  4Z4I A;  2DFH A;  4KFB A;  1TK0 A;  3EY1 A;  1FW6 A;  2UU9 K;  4LD0 A;  4AM6 A;  4R79 A;  3QER A;  1QE1 A;  3ZX2 A;  1TK8 A;  1VQ5 N;  3EN9 A;  1RT3 A;  4BG8 A;  2O8D B;  1SKS A;  4FJ8 A;  2OCE A;  5AQP A;  3W0L A;  3I8D A;  1WUA A;  1RBR A;  4DS4 A;  4ISE A;  4C8K A;  4DR2 K;  3JYT A;  5GAD P;  2HBL A;  4CBX A;  5I9E B;  4KBO A;  3W3D A;  1GLE G;  2QWO A;  1TUY A;  2NRX A;  4JRP A;  4FWS A;  3C6H A;  1EWQ A;  2AP1 A;  3ZET B;  4FCY A;  3I8B A;  4JKB A;  1WSE A;  2O4G A;  4PL7 A;  3S3M A;  3VQB A;  4CZJ A;  3L8B A;  4CER A;  1LCU A;  3A5O C;  4YOX A;  3V81 A;  5AQF A;  4B3R K;  2VCP A;  4MLE A;  5J1E A;  2O8E B;  2DY4 A;  1YIJ N;  4KTQ A;  1NJI O;  2P9I B;  1NBW A;  5BRD A;  2IIR A;  2NUB A;  1HQE A;  3MN9 A;  4DG1 A;  4FWP A;  1RTD A;  1VRU A;  4O8U A;  4Z4F A;  5AQL A;  3HOT A;  1WOQ A;  4CEF A;  5M1K A;  3ITH A;  5F0X A;  3NGY A;  5EY4 A;  2OPP A;  1X3N A;  3LPU A;  4MDA A;  1RIL A;  4FJG A;  2ZWH A;  3S9H A;  4M45 A;  4U7B A;  1SS6 A;  3FGU A;  3IAY A;  4F2R A;  1ATS A;  5BRE A;  1JL2 A;  3P4I A;  4M41 A;  3RR7 A;  4CHQ A;  4E7J A;  4HTL A;  4LF5 K;  1FKO A;  3CQY A;  3CM5 A;  3CCJ N;  3TTC A;  4N47 A;  1FJG K;  1BL3 A;  1SKR A;  1SZ2 A;  4LSN A;  3HVR A;  3LM9 A;  4JNE A;  1YVU A;  2FF3 B;  2X74 A;  1JLG A;  3OS2 A;  3ZEU B;  4I6M B;  1W9H A;  3WXK A;  1Y64 A;  4BRE A;  1BI4 B;  3OYL A;  2OZS A;  1RTJ A;  4KI6 A;  3VQP A;  4DQP A;  1N34 K;  3TSU A;  3OJS A;  4F3O A;  3SPZ A;  3VF4 A;  3CCL N;  2HHS A;  2Q36 A;  1NOZ A;  4ILH A;  4Y1C A;  4DFK A;  2QWP A;  3CER A;  1KLN A;  4JI7 K;  4KRF A;  2VQF K;  2EWS A;  1Q9Y A;  4CFB A;  4YOR A;  1QVG M;  3L2U A;  2QXF A;  3HVT A;  2PYL A;  5BN9 A;  2QEX N;  2KKZ A;  3KTQ A;  3ZT2 A;  3VQC A;  1QVF M;  1EXQ A;  5C10 A;  3O08 A;  2Q31 A;  4DSJ A;  3HRG A;  3U9Z A;  4ICL A;  4FK2 A;  4IEI A;  3CCR N;  5HL7 L;  3H3N O;  2ASM A;  1L5U A;  3A0I X;  3BF3 A;  2R7Y A;  1NGH A;  1NGB A;  4CJL A;  4CJT A;  3SQ1 A;  4CF1 A;  3SUP A;  3SMS A;  1NM1 A;  2UUB K;  1UA1 A;  5M1O A;  2G8W A;  4CVN E;  1KSP A;  3F9K A;  3ZT4 A;  2ZD1 A;  3C0B A;  5LMU K;  3HT3 A;  3M8S A;  3C95 A;  1NJX A;  4RW9 A;  2F96 A;  1RT2 A;  3FZF A;  3M6G A;  1W2B M;  5AQU A;  3V9X A;  3SJH A;  3LAK A;  1QQC A;  1MWK A;  3DLE A;  2YNG A;  4AF1 A;  1N5Y A;  1KAX A;  1RT6 A;  2VGM A;  5C2F A;  2XY6 A;  2PY5 A;  1TKZ A;  3O3H A;  1XHZ A;  1IBL K;  4ZTF A;  3RRG A;  3DXM B;  5AQV A;  4B9L A;  3PV8 A;  3MK6 A;  3DLB A;  4KH4 A;  4O8K A;  3R8E A;  4OPJ A;  2QWQ A;  2P9L B;  4CGH A;  4WCE L;  3SAG A;  3O1W A;  5AQZ A;  3EO3 A;  1Q81 O;  3ZSW A;  1N32 K;  1HLU A;  4QS9 A;  4H8K A;  1F21 A;  1GLL O;  3K5M A;  3NVM A;  1MU2 A;  2GUI A;  4PHT X;  3ZT1 A;  4BRA A;  1S9E A;  4NYN A;  3DLK A;  3SJJ A;  1RGI A;  3TAB A;  3QML A;  4AHS A;  3CCS N;  1HPZ A;  4GKK K;  4WFB L;  2OPQ A;  4C1N I;  1K8K A;  4OLB A;  1W0H A;  3ZCM A;  1DEJ A;  1YIT N;  5BPM A;  2D0B A;  5CE3 A;  4M3R A;  5KI6 A;  3OHR A;  1VQ9 N;  1L3S A;  1Q86 O;  3B6O A;  3TSQ A;  4F3T A;  2Z1G A;  1JJ2 M;  4K42 A;  5BPN A;  4JRQ A;  5B8H A;  2KHO A;  1ZBH A;  1OH7 A;  1BCO A;  5ADX H;  3UKR B;  3O5B A;  5BR8 K;  4LF4 K;  5AQJ A;  3CPW M;  4E19 A;  3ZT3 A;  2XRI A;  3CCE N;  1ASW A;  4ELU A;  3LP2 A;  4JD2 B;  4DUY K;  1SQK A;  1KC8 O;  2DPN A;  4IFE A;  1BCM A;  2WFB A;  5GIP A;  2CGL A;  3BDP A;  1TAU A;  4QCL A;  5M1P A;  1N6Q A;  3O4W A;  2V7Z A;  1HNW K;  2ASP A;  1S1X A;  1X9J A;  3MWT A;  3HST B;  3IUC A;  3AY9 A;  4B8C A;  3I33 A;  4GKJ K;  3D7E O;  1HX1 A;  4DQI A;  4C23 A;  3MED A;  2HHV A;  4IWV A;  2JGU A;  2VWK A;  4BC5 A;  5AQY A;  3PY8 A;  4DUZ K;  3Q7C A;  1UA0 A;  2E4L A;  1YTU A;  4HHT A;  1KCF A;  2F7T A;  4C8L A;  4DSI A;  4MO5 A;  3TTD A;  3VEX A;  2Q1N A;  5CHI A;  2F9T A;  3PO4 A;  3G6E N;  2XY8 A;  3ATU A;  3OBY A;  3LM2 A;  5EXW A;  1JXE A;  1BGX T;  3MAQ A;  4IO9 L;  1NJZ A;  3RVC A;  1FXX A;  3CIP A;  3OYH A;  3K9K A;  3V9S A;  2O4I A;  3MX5 A;  4IEE A;  3TSP A;  1BA1 A;  5C12 A;  3TAP A;  3DI6 A;  4KB1 A;  2VG5 A;  3MWP A;  1YJ9 N;  5DK5 A;  4E3S A;  4KPY A;  3ZSQ A;  3OY9 A;  2E2P A;  3BGR A;  3CFR A;  3PSI A;  4H5V A;  4DSF A;  3MCA B;  1N8R O;  3I56 N;  4C8O A;  2QK9 A;  3CI5 A;  4K41 A;  4BWM A;  3ALY A;  4K25 A;  3WXJ A;  4O55 A;  4KHU A;  3KLH A;  2D0C A;  4DV6 K;  4DTP A;  2E2O A;  4O5B A;  3AVB A;  4B1Y B;  3THX B;  3EE8 A;  5DM6 L;  2CH6 A;  3DOK A;  3LAM A;  1WSJ A;  2PFU A;  1UAX A;  3TWH A;  3VF2 A;  3P1G A;  3E66 A;  1Z26 A;  3NH1 A;  4CIF A;  4WF9 L;  3V1Q A;  4JKC A;  5AFU A;  1L3T A;  3THY B;  1BI4 A;  1NKC A;  5C42 A;  2DFF A;  2D0P A;  1HNZ K;  5LY3 A;  4MDB A;  3TAG A;  1HUX A;  1C0M A;  4WQ4 A;  1N36 K;  4JHD B;  4CCH A;  3G4S N;  2FXU A;  2XHB A;  3D45 A;  4IKF A;  1HQU A;  3AVG A;  3PX6 A;  1XMQ K;  2RPI A;  3EZ5 A;  3OYD A;  3RRH A;  3ENB A;  4CF2 A;  2WTU A;  1Y97 A;  2P9S A;  1NWK A;  5E41 A;  4O5F A;  4GV9 A;  3VQD A;  1RTI A;  4IFY A;  5GAG P;  4WYB A;  3VQQ A;  1NK9 A;  4IOX A;  3DWL A;  5AR0 A;  1T6C A;  1JL1 A;  1S72 N;  2A1R A;  5JLH A;  3K0S A;  3EE9 A;  1S9G A;  3CJ7 A;  3CYM A;  1G15 A;  2HHX A;  5CYQ A;  5HRN A;  1NK8 A;  4KKO A;  4CJK A;  2RN2 A;  1QZ5 A;  4JS4 A;  1U45 A;  2IAJ A;  1QQN A;  4M3W A;  4FO0 A;  1WSI A;  3MDQ A;  3HJF A;  3I0S A;  3H3O B;  1BOT O;  3SI6 A;  2HBK A;  4FZY A;  2YHB A;  4NXM K;  5JIC A;  3P83 D;  3KWI A;  3DLH A;  4L3Q A;  1NGC A;  1WSG A;  2O8F A;  1VQ8 N;  4EHU A;  1Q9X A;  2HF3 A;  3OYK A;  5EVZ A;  4JKA A;  3VQ7 A;  5D3G A;  4WQ4 C;  4M42 A;  2P9L A;  3TAN A;  5GAH P;  1RBS A;  1QTM A;  3DM2 A;  4LC9 B;  4IOA L;  1TYQ B;  4GNI A;  4DWI A;  5DMR A;  4ID5 A;  4FWM A;  3TU5 A;  3NGI A;  4DTX A;  2OYQ A;  3A2F A;  4E89 A;  2IGI A;  2Y1J A;  4JYA K;  3KVG A;  4FLU A;  4ZTJ A;  3O3F A;  4CF9 A;  2KZM A;  3MMV A;  2VGN A;  1VK0 A;  3K58 A;  3THW B;  3AVI A;  4DTR A;  1KVA A;  1KLM A;  4CEB A;  3NFA A;  4FVM A;  2YJF A;  4N5S A;  3H46 O;  2EHG A;  3OS0 A;  4JI1 K;  2NLX A;  1VSD A;  4CFC A;  3CG7 A;  1TKD A;  1SV5 A;  2Z1H A;  3ATV A;  2G8F A;  3WNG A;  2FBX A;  4BVO A;  3J80 O;  5I3U A;  2G8K A;  3Q7B A;  3N4P A;  1S22 A;  1BWF O;  2HHW A;  3ID6 A;  4CJ5 A;  1WAJ A;  4DV0 K;  2X6N A;  1DTQ A;  3WXL A;  3VF6 A;  3V1O A;  3ZSO A;  3KKS A;  4BC4 A;  5AQO A;  3AAR A;  2NZT A;  3TAE A;  3QIC A;  3NMU A;  2NRR A;  1LOT B;  4H5N A;  4J2D A;  4CF0 A;  3VA0 A;  2P5O A;  2HVH A;  1SKW A;  5A2Q O;  4BRK A;  5KPT A;  3SZ2 A;  4DSE A;  4DV3 K;  4JLH A;  1J6Z A;  2V51 B;  1VSH A;  2P9K B;  4NXN K;  3O80 A;  3H1V X;  1TL1 A;  3P31 A;  1GLJ O;  3WEE B;  1ZBI A;  2HHQ A;  3QET A;  3UB5 A;  3SAF A;  4K8Z A;  3VTH A;  4DR3 K;  1WBB A;  4PY5 A;  3DOL A;  2IVO A;  1ZBS A;  3CCM N;  1S6P A;  4CEA A;  5FDL A;  2HMP A;  3AO5 A;  2HST A;  3KK3 A;  4YHH K;  4W5T A;  5I42 A;  1HPM A;  4JI0 K;  3U8X A;  4CJR A;  3R9P A;  3HO1 A;  3D2E B;  4FYD A;  1NGD A;  4BRI A;  3RR8 A;  1O13 A;  3VN5 A;  1ESV A;  4IFV A;  4BRM A;  1S5J A;  4LF8 K;  4FW1 A;  2RF2 A;  3VEV A;  4DCH A;  3SQ0 A;  4EP4 A;  2F8T A;  4H4O A;  3FFK B;  4I2Q A;  4BR2 A;  2A1S A;  2Q97 A;  1UWB A;  3OW2 M;  2PYJ A;  4OGC A;  4JI2 K;  1NK4 A;  3ZX3 A;  1W97 L;  3KKR A;  3K5O A;  4IG3 A;  4NCB A;  3OYM A;  5TKW A;  4KTZ A;  4B8A B;  3LPT A;  3ULE A;  3WNF A;  4FWR A;  5JLF A;  4E1N A;  1OH5 A;  2DFE A;  4BRG A;  4H5T A;  5C15 A;  3D6R A;  3DLL L;  4OGE A;  3QEX A;  1T7P A;  1GOB A;  1RFQ A;  4RW4 A;  4B1W B;  1N33 K;  1H1V A;  3EEQ A;  3L0Q A;  3UKU B;  3C7N B;  1I94 K;  1U48 A;  3HK2 A;  1IV0 A;  2FSN A;  3NH0 A;  3SYZ A;  4FPB A;  2VWB A;  1SL0 A;  3EL2 A;  5LJV A;  3N4Q A;  2GX9 A;  3QDK A;  4U67 L;  1BQM A;  3ZSR A;  3L2R A;  5AQT A;  3M8Q A;  3CQX A;  2D4W A;  4DFP A;  1BQN A;  1GOC A;  4CJ4 A;  3OA9 A;  2AJQ A;  3I55 N;  1XWL A;  1ILY A;  2Q0R A;  5HRR A;  1KTQ A;  1U2V B;  4CJQ A;  3ZT0 A;  1U49 A;  1JCF A;  4OKJ A;  4CZM A;  1HR0 K;  2B5J A;  3FZM A;  4RWT A;  1R0A A;  4DR6 K;  2BH1 A;  1CZB A;  4A61 A;  3O9R A;  4H0V B;  5M1N A;  1QS4 A;  3V9U A;  3RSE B;  4BGB A;  4AHU A;  5BPL A;  1Z6R A;  3LWL A;  3O4N A;  4KO0 A;  5KQ8 A;  1RDD A;  4BC3 A;  2YX6 A;  3FLC O;  2RHK A;  4XEI A;  3LZJ A;  2QKK A;  1S1U A;  3CD6 N;  2B4J A;  1RNH A;  3E9O A;  4CEZ A;  1O1W A;  3NCI A;  2WUS A;  4FW2 A;  5EU7 A;  2YHA A;  2UXD K;  1S1T A;  1EET A;  3NF8 A;  4GMJ B;  1KFS A;  2V7Y A;  4QS7 A;  1RT4 A;  2ZE2 A;  3HPH A;  2UXB K;  5HBM A;  3GBT A;  3MXI A;  4EZ9 A;  4R5P A;  5J2P A;  1BU6 O;  1VQ6 N;  3L4Q A;  3WQT A;  2Z1I A;  4CK3 A;  4CD1 A;  3B8A X;  4A2A A;  4YOV A;  3SAH A;  3SPY A;  3E1Y A;  4NYF A;  4OO1 J;  3G71 N;  3DAW A;  4CHZ A;  3G0Z A;  4PWD A;  3JSM A;  3K2P A;  1TL3 A;  1P90 A;  3SLC A;  2V52 B;  2LSN A;  1TAQ A;  2QI2 A;  1RCH A;  4A2B A;  3QEP A;  3DMJ A;  1C0F A;  2GWJ A;  3DRR A;  3LP1 A;  4DV2 K;  1JLB A;  3GDQ A;  3CCU N;  1ATR A;  4DSL A;  4IDK A;  3L4I A;  4BGA A;  4OLA A;  1HRH A;  2ITM A;  3ENO A;  4O0I A;  5AQS A;  3R6M A;  1ASU A;  3E01 A;  3SMP A;  4JKG A;  4DR5 K;  4W5N A;  4F2S A;  4CJW A;  3A5M C;  1WB9 A;  2XY7 A;  3LP0 A;  1XC3 A;  3BY5 A;  3CC7 N;  2P9P B;  3BUZ B;  2UXC K;  3A8Y A;  1HYZ A;  4FVU A;  2IOC A;  3CCV N;  3BZC A;  3SBT A;  3OYN A;  4CK1 A;  4RW6 A;  3O9T A;  1REV A;  1KAY A;  3D2F A;  3ZSZ A;  4AHR A;  3O9Q A;  4TSX A;  4H0X B;  4DU4 A;  2UUA K;  2O8C A;  3M8R A;  3UE5 A;  2G8V A;  1CLQ A;  4CBU A;  1HNX K;  3K5N A;  2ZGZ A;  4GV3 A;  2VG6 A;  2YHW A;  3VA3 A;  4JI4 K;  4XH1 A;  1WLJ A;  4YDU A;  4FL9 A;  1QHA A;  1NGG A;  2IC3 A;  3C94 A;  4DMN A;  1CXQ A;  5FLX O;  1ZBL A;  1C1A A;  1TV6 A;  3QB0 A;  4DTO A;  2HOE A;  3B6P A;  4H03 B;  1KD1 O;  3ISN C;  2A3Z A;  3WNE A;  4M3X A;  3ULD A;  3CCQ N;  4XH5 A;  5IT9 O;  3NF7 A;  1IH7 A;  1HYS A;  3QEW A;  3NH2 A;  4DKW A;  5M1F A;  4FWL A;  1FKP A;  2QM1 A;  4CE9 A;  1YHQ N;  1ASV A;  4C1N K;  1LWE A;  1NU0 A;  4C8M A;  3WEE A;  1FK9 A;  2W42 A;  3E9P A;  4M3T A;  4FOE A;  3OJU A;  2FF6 A;  1NK0 A;  1SL2 A;  4DQQ A;  3OYI A;  1GLF O;  1RDC A;  3U4L A;  3NF6 A;  1SUQ A;  3NAE A;  4PA1 A;  4E7K A;  3QIN A;  4BVP A;  3AVM A;  4CFD A;  4J2B A;  4YOU A;  3NGZ A;  3NHG A;  2Q0U A;  2OA8 A;  4HCB A;  1VSL A;  3DXK B;  4KV8 A;  3CM6 A;  3O4Q A;  3TAF A;  3PLA A;  1U6Z A;  1L3U A;  3QFP A;  2QW9 A;  4H0O A;  3AGK A;  5FPE A;  4IBN A;  2P9N B;  2FC0 A;  2Z1J A;  3CFP A;  4DU1 A;  2B6A A;  1NGI A;  2F8S A;  1HNI A;  4KH5 A;  4BRQ A;  3TAR A;  4YDU C;  2NRV A;  1NGE A;  3IMX A;  4FM2 A;  1I39 A;  1ZYQ A;  4CF8 A;  3P38 A;  3VQ6 A;  2O8D A;  4CGJ A;  4Z0U A;  1P8Z A;  2E6L A;  4CZH A;  4IJN A;  4FK0 A;  4BR9 A;  2E1Z A;  5F2R A;  1S6Q A;  4DB3 A;  3FFI A;  2KTQ A;  4JI5 K;  2E6M A;  3ZET A;  4BRN A;  1YXQ A;  4XIU A;  4JAX A;  5EOY A;  5SWM A;  4AM7 A;  5AQK A;  3ASM A;  3AVN A;  2Y1I A;  4AHV A;  5BRF A;  4LF7 K;  3UKU A;  4DSK A;  4WFN L;  2PAV A;  1M1K O;  2O8E A;  3SCX A;  4H5W A;  3OVN A;  5JVH L;  4CZL A;  4Y0W A;  3VEZ A;  2P9I A;  3AA2 A;  2NNW A;  3KK7 A;  3TTF A;  1RT1 A;  4CK2 A;  1NOY A;  3SV3 A;  2X6S A;  2YNI A;  4A57 A;  2YJE A;  4FM0 A;  1T3V A;  4EP5 A;  1J5E K;  3R3L A;  1NKE A;  3HTV A;  4CZK A;  1BHL A;  1X9W A;  1VAZ A;  3VTI A;  4DR4 K;  2E8A A;  3MN7 A;  2W6K A;  1VSK A;  2G8H A;  4YOT A;  3KLE A;  1OH8 A;  3HM9 A;  3H1Q A;  4O0J A;  4NLB A;  2GEL A;  1WBD A;  4HUF A;  2QKB A;  1J53 A;  3PX4 A;  2P9U B;  3OYG A;  4K43 A;  2KLA A;  1V4T A;  4FJL A;  1TK5 A;  2JWL A;  2PBD A;  4DV1 K;  3ZEU A;  2F4V K;  4I6M A;  3VQ9 A;  3HP6 A;  4DV4 K;  4F9O A;  1Q7Y O;  3QIO A;  3ZYY X;  3CHW A;  1ITG A;  4LH5 A;  4AHT A;  5GAE P;  4CJE A;  4RG8 A;  4WQ5 C;  1OVY A;  3A5L C;  3QES A;  3HM8 A;  4B9N A;  5LMN K;  4CJP A;  5KTQ A;  2EX3 A;  5FPN A;  4IXC A;  3K59 A;  5M1Q A;  2D1K A;  3DRP A;  1LW2 A;  3LDL A;  4FZX C;  1A5X A;  4Z94 A;  4M3U A;  3TAM A;  3KLF A;  4DTU A;  4KI4 A;  3AO2 A;  3C6A A;  1C1B A;  3AAQ A;  4A5B A;  3F73 A;  3VQ4 A;  4B9T A;  2P5G A;  3UIQ A;  4LFA K;  2W41 A;  4CGF A;  3AO1 A;  4JEP A;  4CZF A;  4CHY A;  2BDP A;  3H6E A;  4ISF A;  4DTN A;  4FZZ A;  3BF1 A;  1K9M O;  4JK7 A;  4OPK A;  4M63 C;  1C0T A;  1YJW N;  5HOO A;  1BIZ A;  2I7N A;  2YHY A;  1DGK N;  2H3G X;  1QSL A;  1KFD A;  3RWU A;  1HKG A;  4FWN A;  3F2K A;  4EFH A;  1C6V A;  2ASO A;  5CY4 A;  4DLE A;  1RDA A;  3DRS A;  3AVL A;  4B1Z A;  3KD1 E;  1DLO A;  1XNR K;  3ID8 A;  4CZI A;  4DR7 K;  3DXM A;  1E4G T;  4B3T K;  4CJF A;  4CHN A;  4BDZ A;  3KLI A;  3V9W A;  1XUP O;  2PZS A;  1JLF A;  3MEG A;  3T1A A;  2W6L A;  3P5J A;  1LAW A;  4J2E A;  4CBW A;  3IRX A;  3DJC A;  4B1X B;  4BE0 A;  3KWG A;  1Q82 O;  1EQY A;  1YF5 L;  5EX5 A;  1XI1 A;  4KHQ A;  4UY8 O;  4PUO A;  4WFA L;  2BAN A;  2KZZ A;  3MCP A;  3QIP A;  4EHT A;  2HBJ A;  5BR9 A;  2QWN A;  4LSL A;  1C0U A;  3M8P A;  4LH4 A;  5FRN A;  3S3N A;  3K57 A;  1LWF A;  3QEI A;  3H08 A;  3HOS A;  4FXD A;  3LWM A;  4FJJ A;  1JLA A;  5AQG A;  4BRL A;  3L3U A;  4BG9 A;  3D0P A;  2HBM A;  4BQL A;  3HXM A;  4J8F A;  4LFB K;  1XQS C;  1DTT A;  4G9Z A;  4FJN A;  3CC4 N;  4CFA A;  4F4K A;  1B92 A;  4KH6 A;  2VQE K;  4FJ5 A;  4DQR A;  3ZX0 A;  3C6T A;  3CQ8 A;  4B9U A;  4RW8 A;  4X64 K;  2HW3 A;  3DLG A;  1HKC A;  5AJ3 K;  3DXK A;  4FLW A;  1MA9 B;  3UKR A;  4CIE A;  1Z05 A;  3MN6 A;  2WBN A;  5CZ1 A;  2AA4 A;  1NGF A;  3VER A;  4HUE A;  1YT3 A;  3CJ9 A;  4CIG A;  3EZW A;  5KRS A;  2FLO A;  4B9S A;  2GTD A;  4PKI A;  1W7A A;  3M5R A;  1RBU A;  4G1Q A;  2FBT A;  2IVN A;  3EKS A;  4JD2 A;  3S3O A;  3PSF A;  3F5T A;  1Q8I A;  4FLV A;  4GVE A;  3HP9 A;  1KRP A;  4KTW A;  3G10 A;  4K0K K;  3CF5 L;  1CZ9 A;  3AVC A;  1VSM A;  4FJ7 A;  4I9Q A;  1TKT A;  4E7I A;  1U47 A;  1QHT A;  1RTH A;  3PX0 A;  1XNQ K;  4N56 A;  4JS5 A;  1K8K B;  1BG3 A;  2ITG A;  2W40 A;  3C6U A;  1OH6 A;  3EKU A;  3J81 O;  5C24 A;  1I3A A;  1BUP A;  3AGR A;  4KHY A;  2A6A A;  4NCA A;  4M3Y A;  4NCG A;  3R1X A;  1LW0 A;  2X78 A;  4C8N A;  3JAM O;  1GLB G;  4OJR A;  4B3S K;  5J2M A;  3KHY A;  3QNN A;  1EO1 A;  4NO7 A;  4CJ7 A;  5AQM A;  3IFR A;  4ISG A;  4FJK A;  1T8E A;  2E1Y A;  2HVI A;  3HL8 A;  4JI3 K;  3U3G A;  4IZ9 A;  3HSC A;  3T1Y K;  5FRM A;  2BTF A;  1QSS A;  3DYA A;  1T03 A;  2QXL A;  4I9L A;  2IVP A;  4JI6 K;  3LDS A;  5H1S Q;  1WAF A;  4DLG A;  2IS3 A;  1NMN A;  1VQO N;  4MFB A;  4J2A A;  2HB5 A;  3AVF A;  4V19 S;  4B9Q A;  4H4M A;  3J7Y P;  1VQN N;  3NVK A;  1S3X A;  4CEQ A;  4B3M K;  3MXM A;  1V4S A;  2VYP A;  2RKI A;  4M7X A;  3E9L A;  4CD3 A;  3IKM A;  1VSE A;  4BRO A;  4JK8 A;  5C2D A;  5T7B A;  4Z4C A;  3WUH A;  4YY3 K;  3THX A;  4FLZ A;  4W5Q A;  4HVJ A;  1VSI A;  5CYM A;  4QOZ B;  2JLE A;  3IS9 A; 
#chains in the Genus database with same CATH homology
 2YHW A;  2OTL N;  4JN4 A;  4H5V A;  3WXM B;  4JKF A;  3MCA B;  1N8R O;  3T69 A;  3I56 N;  3M3Z A;  3CI5 A;  4XH1 A;  4K41 A;  1D4X A;  1IJJ A;  4YDU A;  4ILJ A;  2P9U A;  4FL9 A;  3HBT A;  1QHA A;  4IO8 A;  4K25 A;  1NGG A;  1QQM A;  3WXJ A;  5GIN A;  2JWK A;  3M1F A;  1DT9 A;  1G99 A;  3QB0 A;  5KPZ A;  2YCH A;  1YJN N;  2HOE A;  4RCH A;  1YUW A;  4H03 B;  4NLC A;  3LL3 A;  1KD1 O;  4JKD A;  2A3Z A;  2E2O A;  3D2F B;  4OPH A;  3CCQ N;  4XH5 A;  1BDG A;  1C0G A;  4B1Y B;  2E2Q A;  2ZGY A;  3FZK A;  3GG4 A;  4GY2 B;  4DKW A;  2WC9 A;  5AZJ A;  4FWL A;  3EE8 A;  4JHD A;  4BR7 A;  5DM6 L;  2CH6 A;  1YI2 N;  2QM1 A;  4XH4 A;  5LJW A;  2GEM A;  2ZJR L;  2PFU A;  1YHQ N;  4C1N K;  3VET A;  3VF2 A;  3BP8 A;  3E66 A;  3WEE A;  2NRZ A;  3E9P A;  5KPR A;  2P9N A;  2CGJ A;  4FOE A;  2FF6 A;  1VQ4 N;  4WF9 L;  1KQS M;  4JKC A;  5AFU A;  2NRT A;  1GLF O;  3LDO A;  3U4L A;  3KZB A;  4BR5 A;  4DQ8 A;  2D0P A;  4BVP A;  4YOU A;  4A5A A;  5LY3 A;  2Q0U A;  1K73 O;  4FWK A;  4MDB A;  3DXK B;  1HUX A;  1VQK N;  4WQ4 A;  4JHD B;  4BR4 A;  3VES A;  3G4S N;  1BO5 O;  2FXU A;  3PLA A;  1U6Z A;  4BC2 A;  1RDU A;  4EIA A;  3O9U A;  3QFP A;  5GIO A;  5AZI A;  4YOW A;  4HWI A;  2QW9 A;  3H45 C;  4H0O A;  1T44 A;  3ENB A;  3QBW A;  3AGK A;  5FPE A;  2P9N B;  2P9S A;  1NWK A;  4JKE A;  4MLH A;  5AQQ A;  3VGM A;  5JMV A;  4NB4 A;  4O5F A;  1NGI A;  2HF4 A;  5AQH A;  4GV9 A;  3K9J A;  3MX2 A;  4KH5 A;  4BRQ A;  5GAG P;  3OBW A;  3JXU A;  3GE1 A;  4YDU C;  2NRH A;  2YHX A;  1NGA A;  2NRV A;  1NGE A;  3IMX A;  3QFU A;  4IOX A;  3DWL A;  4WYB A;  5AR0 A;  1T6C A;  3VEW A;  2FSJ A;  4YOY A;  2QTD A;  1S72 N;  3TPQ A;  4A59 A;  3P39 A;  5JLH A;  3P38 A;  2A5X A;  3EE9 A;  3CME N;  3FZH A;  3WXI A;  4H5R A;  3CJ7 A;  2J4R A;  5TKY A;  3O1B A;  5FPM A;  4BRC A;  5DM7 L;  1P8Z A;  2RE2 A;  3O6W A;  5C0Y A;  5CR4 A;  3FE1 A;  1KAZ A;  2YI1 A;  4CZH A;  1VQM N;  4IJN A;  4BR9 A;  4AM6 A;  4R79 A;  2P9S B;  2E1Z A;  1QZ5 A;  5F2R A;  1QQN A;  1TYQ A;  2QWM A;  3ZX2 A;  4DB3 A;  3F9M A;  4FO0 A;  1VQ5 N;  2D0O A;  3VMF B;  3MDQ A;  3ZET A;  4BRN A;  3CJA A;  3H3O B;  1BOT O;  1YXQ A;  3EN9 A;  2HBK A;  4H0P A;  4JAX A;  1NLV A;  5EOY A;  3FZL A;  3SBG A;  4AM7 A;  5AQK A;  1OKJ A;  5ELZ A;  5JIC A;  3J8A A;  3A5N C;  4PL8 A;  1JCE A;  4BG8 A;  5BRF A;  5AQP A;  3W0L A;  1WUA A;  1QQO A;  3UKU A;  4ISE A;  3KWI A;  1RDW X;  4L3Q A;  4WFN L;  2PAV A;  1NGC A;  1M1K O;  5GAD P;  4H5W A;  4BRP A;  5JVH L;  1VQ8 N;  4CZL A;  1DKG D;  4EHU A;  2HF3 A;  4Y0W A;  2HBL A;  5EVZ A;  3VEZ A;  2P9I A;  4E1J A;  1HJO A;  2NNW A;  3KK7 A;  4JKA A;  3TTF A;  4CBX A;  5I9E B;  4KBO A;  4WQ4 C;  2P9L A;  2FSK A;  3W3D A;  5GAH P;  1GLE G;  2QWO A;  3WQU A;  4H0Y B;  5F1X A;  1TUY A;  2NRX A;  4LC9 B;  4IOA L;  1TYQ B;  3C6H A;  4FWS A;  4GNI A;  4A57 A;  2YJE A;  2AP1 A;  5AFU H;  3TU5 A;  3I8B A;  4FWM A;  3ZET B;  3SK3 A;  4JKB A;  1T3V A;  3ENH A;  4PL7 A;  1X3M A;  1HKB A;  3C65 A;  3R3L A;  3KVG A;  3HTV A;  1QZ6 A;  4CZJ A;  1LCU A;  3A5O C;  2VGN A;  3MMV A;  3S41 A;  4RTF D;  4CZK A;  4YOX A;  2QA4 N;  3G25 A;  5AQF A;  1VAZ A;  2VCP A;  4MLE A;  3VTI A;  1E4F T;  2E8A A;  3MN7 A;  1YIJ N;  2YJF A;  3GL1 A;  3H46 O;  1NJI O;  2P9I B;  4YOT A;  2ZF5 O;  2NLX A;  1NBW A;  5BRD A;  1YVN A;  2IIR A;  5AQR A;  1M90 O;  3MN9 A;  3J7Z O;  3H1Q A;  4FWP A;  1SAZ A;  2A42 A;  3LDQ A;  4O8U A;  4NLB A;  2GEL A;  3ATV A;  5AQL A;  4BVO A;  3HOT A;  3VGK A;  4FSV A;  1WOQ A;  2P9K A;  5M1K A;  3Q7B A;  3N4P A;  1S22 A;  2P9U B;  5BN8 A;  5F0X A;  1BWF O;  5EY4 A;  4K43 A;  2KLA A;  3ID6 A;  5AQX A;  1V4T A;  1X3N A;  2JWL A;  2PBD A;  4MDA A;  3ZEU A;  3WXL A;  5BRH A;  2ZWH A;  4I6M A;  3VF6 A;  4BC4 A;  1SS6 A;  4U7B A;  5AQO A;  3AAR A;  2NZT A;  3QIC A;  4F9O A;  3NMU A;  4DHY A;  3FGU A;  3ZYY X;  1Q7Y O;  2NRR A;  3CHW A;  1ATS A;  1LOT B;  2E2N A;  4H5N A;  5GAE P;  3P4I A;  5BRE A;  4WQ5 C;  1OVY A;  3A5L C;  5AZJ B;  4HTL A;  3CJ1 A;  3CQY A;  3HM8 A;  4BRK A;  5KPT A;  3CCJ N;  5JVG L;  1J6Z A;  2V51 B;  3TTC A;  5FPN A;  1ZXO A;  2P9K B;  4IXC A;  3O80 A;  1VQP N;  5M1Q A;  2D1K A;  3H1V X;  5AQW A;  3D2E A;  3P31 A;  1GLJ O;  3WEE B;  4BRD A;  1Q18 A;  1SZ2 A;  3CJC A;  3LDP A;  3LDL A;  3UB5 A;  3CXC M;  3SAF A;  3LM9 A;  4JNE A;  4Z94 A;  2NRW A;  3L6Q A;  3MN5 A;  3VTH A;  2FF3 B;  2UYT A;  3ZEU B;  2IVO A;  1ZBS A;  4I6M B;  3WXK A;  1Y64 A;  4BRE A;  3CCM N;  1VQL N;  3CPE A;  3TSU A;  2HMP A;  3C6A A;  3CET A;  3VF4 A;  3WT0 A;  3CCL N;  2HST A;  3AAQ A;  4A5B A;  3VEO A;  2Q36 A;  4ILH A;  2W41 A;  2E20 A;  2QWP A;  3CER A;  1HPM A;  4JEP A;  4CZF A;  1NMD A;  2EWS A;  3H6E A;  4BY9 C;  1T6D A;  3U8X A;  5AZI B;  2QWR A;  4ISF A;  3CC2 N;  4YOR A;  3BF1 A;  1QVG M;  3R9P A;  1K9M O;  4JK7 A;  3D2E B;  1NGD A;  4BRI A;  1MWM A;  1O13 A;  4M63 C;  4CZG A;  5BN9 A;  1ESV A;  2KKZ A;  2QEX N;  1QVF M;  3BEX A;  1YJW N;  4EAH D;  4BRM A;  3O08 A;  5C10 A;  5HOO A;  2Q31 A;  2I7N A;  5FPD A;  2CGK A;  1DGK N;  2H3G X;  2YHY A;  3LDN A;  3HRG A;  1HKG A;  4FWN A;  3F2K A;  3U9Z A;  3VEV A;  4MO4 A;  4DCH A;  4EFH A;  2ASO A;  4IEI A;  4GV6 A;  3CCR N;  5HL7 L;  3H3N O;  2ASM A;  3A0I X;  4B1Z A;  3FFK B;  3VEN A;  3BF3 A;  1NGH A;  1NGB A;  4BR2 A;  3CMA N;  2Q97 A;  3C7N A;  2A41 A;  3OW2 M;  4WQ5 A;  2GWK A;  3ID8 A;  4CZI A;  3SMS A;  1NM1 A;  3AAP A;  2E88 A;  3DXM A;  3ZX3 A;  1E4G T;  1W97 L;  5M1O A;  1GLA G;  1CZA N;  1XUP O;  5TKW A;  4A62 A;  3ULE A;  3C0B A;  4FWR A;  5JLF A;  3GOI A;  4BRH A;  4CBW A;  3DJC A;  4BRG A;  3IDH A;  4B1X B;  3VPZ A;  3FZF A;  3M6G A;  1W2B M;  4H5T A;  5AQU A;  3KWG A;  5C15 A;  1Q82 O;  3SJH A;  3D6R A;  1EQY A;  3DLL L;  1YF5 L;  1MWK A;  1U2V A;  3VGL A;  5EX5 A;  4AF1 A;  1RFQ A;  1KAX A;  4UY8 O;  4B1W B;  2VGM A;  1H1V A;  3L0Q A;  5C2F A;  4CZE A;  4BRF A;  4WFA L;  3PIP L;  3MCP A;  3C7N B;  3UKU B;  4EHT A;  2HBJ A;  5BR9 A;  2FSN A;  3VOV A;  2A40 A;  3HZ6 A;  2QWN A;  4FPB A;  3DXM B;  3O8M A;  2VWB A;  5AQV A;  3EL2 A;  5LJV A;  3N4Q A;  4FWO A;  2GX9 A;  3RSE A;  3MK6 A;  2GUP A;  4KH4 A;  4O8K A;  3R8E A;  3QDK A;  1BA0 A;  3HOS A;  4U67 L;  2QWQ A;  2P9L B;  3ULE B;  5AQT A;  5AQG A;  3CQX A;  4BRL A;  2D4W A;  4WCE L;  4BG9 A;  3SAG A;  2HBM A;  4BQL A;  4J8F A;  3O1W A;  3OA9 A;  1XQS C;  4ILG B;  4BQZ A;  3I55 N;  4G9Z A;  5AQZ A;  3CC4 N;  1ILY A;  2OAN A;  2Q0R A;  2OTJ N;  1U2V B;  4B1V A;  1JCF A;  3EO3 A;  1GLD G;  2BUP A;  4CZM A;  1Q81 O;  1HLU A;  4PKH A;  4KH6 A;  3FZM A;  4RWT A;  3ZX0 A;  2BH1 A;  4QS9 A;  4A61 A;  1GLL O;  3O9R A;  3NVM A;  4H0V B;  5M1N A;  1HKC A;  4PHT X;  3DXK A;  4BRA A;  1MA9 B;  3UKR A;  5E84 A;  1Z05 A;  3RSE B;  3MN6 A;  2WBN A;  4BGB A;  2AA4 A;  1NGF A;  2I7P A;  4FWQ A;  3VER A;  5BPL A;  1Z6R A;  1RGI A;  3CJ9 A;  3QML A;  3CCS N;  3EZW A;  3QBX A;  2FLO A;  4H0T B;  5KQ8 A;  4WFB L;  4BC3 A;  4C1N I;  4CI6 A;  2GTD A;  4PKG A;  4PKI A;  2YX6 A;  1K8K A;  1YAG A;  3M5R A;  3FLC O;  2RHK A;  3JS6 A;  4XEI A;  1DEJ A;  2IVN A;  3EKS A;  4JD2 A;  1YIT N;  3CD6 N;  4JKH A;  5BPM A;  3E9O A;  5CE3 A;  4IJA A;  3T7Z A;  3F5T A;  3OHR A;  2WUS A;  1ZC6 A;  2Q2R A;  1VQ9 N;  5M1F A;  4GVE A;  4QS8 A;  3CJB A;  1Q86 O;  3TSQ A;  2V7Y A;  4QS7 A;  3CF5 L;  1JJ2 M;  4K42 A;  5BPN A;  3GBT A;  1VQ6 N;  1BU6 O;  3O9S A;  2KHO A;  2F9W A;  3L4Q A;  3WQT A;  5B8H A;  3FR0 A;  4M7Y A;  5ADX H;  3UKR B;  3O5B A;  1R59 O;  4CD1 A;  3B8A X;  4A2A A;  1TUU A;  4YOV A;  3SAH A;  5AQJ A;  3CPW M;  3E1Y A;  2ZJQ L;  4OO1 J;  3U9D A;  3CCE N;  3G71 N;  1K8K B;  4IDH A;  5MLC Q;  1BG3 A;  3DAW A;  2W40 A;  5E26 A;  4JD2 B;  1SQK A;  1KC8 O;  2DPN A;  4IFE A;  2WFB A;  5GIP A;  1P90 A;  3SLC A;  2V52 B;  3EKU A;  2P9P A;  1BUP A;  2CGL A;  3AGR A;  2A6A A;  2QI2 A;  1GLC G;  5M1P A;  4A2B A;  3R1X A;  3O4W A;  1C0F A;  2GWJ A;  2V7Z A;  2ASP A;  1X9J A;  3MWT A;  4JK9 A;  3GDQ A;  3CCU N;  3IUC A;  1ATR A;  3AY9 A;  3I33 A;  1ATN A;  1GLB G;  3D7E O;  3L4I A;  4OPA A;  4FPA A;  1HX1 A;  4BGA A;  3KHY A;  1K8A O;  2ITM A;  1EO1 A;  3ENO A;  4BR0 A;  4C23 A;  4NO7 A;  4CJ7 A;  4IWV A;  5AQM A;  3IFR A;  5AQS A;  3R6M A;  4ISG A;  4BC5 A;  5AQY A;  2E1Y A;  3SMP A;  4FOI A;  3Q7C A;  4JKG A;  5AQN A;  4IZ9 A;  3HSC A;  2BTF A;  2F7T A;  3A5M C;  5ADX A;  4MO5 A;  2QWL A;  2QXL A;  3TTD A;  2Q1N A;  1XC3 A;  2IVP A;  3VEX A;  5CHI A;  2F9T A;  5H1S Q;  2CH5 A;  3CC7 N;  1VQO N;  2P9P B;  3BUZ B;  3G6E N;  3ATU A;  3A8Y A;  1NGJ A;  3OBY A;  3LM2 A;  5EXW A;  4B9Q A;  4IO9 L;  1VQN N;  4FVU A;  3NVK A;  3RVC A;  1S3X A;  3PIO L;  3CCV N;  5KQD A;  3CIP A;  1V4S A;  2VYP A;  3K9K A;  3SBT A;  3VEY A;  4M7X A;  2ZJP L;  3MX5 A;  3E9L A;  3O9T A;  3HI0 A;  4CD3 A;  3IKM A;  1KAY A;  4BRO A;  4IEE A;  1KXP A;  1IG8 A;  3D2F A;  3TSP A;  4JK8 A;  4JKG B;  4IOC L;  1VQ7 N;  3O9Q A;  1BA1 A;  4H0X B;  5AQI A;  4B1U B;  5C12 A;  5C2D A;  3WUH A;  3UE5 A;  1JCG A;  1MDU B;  3MWP A;  4CBU A;  1YJ9 N;  2E2P A;  2ZGZ A;  4GV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...