4BR4A

Legionella pneumophila ntpdase1 crystal form i, open, apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br4A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br4A02
3EKSA 2HF3A 5AQLA 4H5WA 2E20A 1GLCG 3ENHA 1KAZA 1EQYA 3CJAA 3FLCO 3WT0A 2HF4A 3L6QA 3WXLA 2F9TA 1CZAN 2YHYA 1T6CA 2YJEA 3O5BA 1GLEG 3VEXA 1MDUB 5FPDA 3LM2A 2QW9A 3A5MC 2NRHA 2Q0UA 3CJ7A 4BRHA 3EO3A 2Q1NA 1BOTO 5AQNA 3ENOA 4QS7A 1XQSC 3ID8A 4WQ4A 4PL7A 4BRNA 4XH4A 2A6AA 2WUSA 2QWPA 1YVNA 4CBUA 3GBTA 3JS6A 4CZGA 3I8BA 5KQ8A 4XH1A 4B9QA 2ITMA 5B8HA 3QICA 1TYQB 2Q97A 2A40A 2V7YA 3HBTA 3VF6A 5LY3A 4KBOA 4BG9A 3D2EB 1V4SA 1NGDA 3W3DA 1HUXA 2P9KA 3DXMA 4BRKA 5BN9A 1HLUA 2IVNA 2P9UB 4B1YB 2FSNA 3A5LC 1NBWA 1P8ZA 4JHDB 4FL9A 1QHAA 4B1ZA 3O1WA 1U2VA 2CGJA 4A2BA 3FGUA 1DEJA 3FZHA 1NGHA 3L0QA 5BPNA 5AFUH 1NM1A 4PKIA 5AQRA 2Q36A 3MN7A 1NWKA 3VETA 2GTDA 3MCPA 1JCGA 5CE3A 4ISFA 1BUPA 2FF3B 1NGFA 4K25A 4WQ4C 2IVOA 3A0IX 4BC4A 5AQJA 3VEZA 1XUPO 4EFHA 1DKGD 1E4FT 2QWMA 3CQXA 3MN5A 4BR2A 4MO4A 3GDQA 4M63C 3VF4A 4CD3A 2I7PA 3CJBA 2P9IB 1NGGA 4H0TB 2BUPA 4H5TA 1XC3A 4BRFA 4H03B 3WEEB 4BGAA 4IXCA 4ISGA 4BQZA 3CIPA 1LOTB 3SMPA 2D0OA 5BPLA 4A61A 3GL1A 4BRAA 4QS9A 2P9SB 3G25A 4H0OA 1KAYA 2CGKA 5BR9A 4H0YB 3BEXA 2NLXA 5AQWA 4FPBA 2ZWHA 4RWTA 4FWQA 3H3NO 5F2RA 3MN9A 2A5XA 4H0VB 1NMDA 2PAVA 3VEYA 1YAGA 5EXWA 4FOEA 1YUWA 1ZC6A 3ZEUA 4FO0A 3FZKA 2H3GX 5AQTA 3VGMA 4J8FA 2QXLA 3VGKA 1QZ6A 3BF1A 3CETA 2P9IA 1J6ZA 3EL2A 4CD1A 3ATUA 2OANA 4BREA 1K8KB 4BRDA 4MLHA 3HM8A 4CZMA 4RTFD 2QWQA 3LDQA 1S22A 2P9UA 2P9SA 1HKGA 1S3XA 5AQXA 2UYTA 2V51B 1RDWX 3QFUA 5KPTA 3GE1A 5AZIA 1K8KA 4L3QA 2CH6A 3O4WA 3CQYA 3C7NB 4FWLA 4BRLA 3QB0A 2ZGYA 3DXKA 2D4WA 3UB5A 1NGAA 4JD2B 1JCEA 2YHWA 1U6ZA 3O80A 4FWSA 1Z05A 4EIAA 4GNIA 4B1UB 4BC2A 2YHXA 2QM1A 2GWJA 2D0PA 3QDKA 4JHDA 2E1YA 3UKUB 2FXUA 3LDLA 3DWLA 3H46O 2E2QA 4JD2A 4DHYA 4WYBA 4B1VA 2P9NA 1ATSA 1HKCA 3A5NC 5KPZA 1T44A 3UKUA 2Q31A 4M7YA 3QFPA 3AARA 3IDHA 1NLVA 4K42A 3VEVA 2I7NA 5ADXH 3FZFA 2HOEA 5BRDA 4BR7A 3VGLA 3J8AA 3H3OB 2AA4A 1MWMA 4BRGA 3AAPA 3R6MA 1TYQA 3DXKB 5AZJB 2FF6A 1WOQA 4H5VA 1U2VB 3MN6A 1BWFO 4NB4A 4BVPA 5ELZA 1KAXA 1QQMA 4IZ9A 3ZX3A 1G99A 2A3ZA 4O8KA 3LL3A 3VESA 2P9NB 3EN9A 2VWBA 2F9WA 3SMSA 5JLHA 1HKBA 2AP1A 4YDUC 3O8MA 4GY2B 5FPEA 4M7XA 3UKRB 1MA9B 3D2FA 4FOIA 2HMPA 3WEEA 2KHOA 2ZGZA 3CJCA 1QZ5A 2V52B 4CZKA 5AQSA 5EY4A 2YI1A 5LJWA 4CJ7A 4BQLA 3D2FB 5AQZA 3FZMA 3RSEA 3M6GA 2BTFA 3VF2A 1SAZA 1BDGA 2PBDA 3BUZB 4K41A 4BG8A 5FPNA 5AZJA 1SQKA 3U9DA 1ZXOA 3HI0A 4EAHD 5BN8A 4H5RA 3HTVA 1GLJO 2ZF5O 4CBWA 5BRFA 1BA1A 4B1WB 4XEIA 4C23A 3IUCA 1C0GA 1ATRA 1ZBSA 5AQPA 5AQGA 1GLFO 3CI5A 1HJOA 3LDOA 3TPQA 4PKGA 4BRCA 4EHTA 4B1XB 3A8YA 3WUHA 1NGBA 4I6MB 4FWRA 3O08A 4FWKA 4WQ5A 4A62A 4F9OA 3IFRA 3QBXA 5F1XA 5BRHA 5E26A 4HTLA 4FWNA 1YXQA 3JXUA 3D2EA 1V4TA 3FZLA 1Z6RA 1GLBG 3VERA 3VENA 3MK6A 4CZFA 1KXPA 4DB3A 5AQQA 4BR9A 3ZX2A 1C0FA 1BU6O 4MLEA 4BR5A 2J4RA 2IVPA 1ATNA 2QWNA 5AQFA 5AQIA 1BG3A 2P9LB 5E84A 5AZIB 4BROA 4E1JA 3LDPA 1D4XA 4BRIA 3BP8A 4MO5A 3VEWA 3ULEA 1R59O 3C7NA 2VCPA 3UKRA 4JNEA 4WQ5C 4AM7A 3MDQA 4JAXA 2E2PA 1ESVA 2YJFA 3O1BA 4IJNA 4CZIA 4Z94A 3F9MA 5AQMA 1NGJA 3LM9A 5KQDA 4CBXA 1IG8A 3KVGA 3GG4A 5EX5A 4DCHA 3M1FA 4A2AA 1H1VA 5EVZA 2DPNA 3SLCA 3ATVA 2IIRA 1GLLO 2Q0RA 2Q2RA 1TUYA 4BR0A 5F0XA 1X3NA 4NO7A 4BRPA 2E8AA 3I33A 3H45C 2GELA 3CHWA 4BGBA 4Y0WA 2GUPA 3KZBA 2A42A 4ISEA 4BR4A 4EHUA 5ADXA 1QQOA 3WXJA 4BRMA 5JICA 5JMVA 3H6EA 1HPMA 1IJJA 1BA0A 1DGKN 2E88A 3H1VX 5I9EB 2NZTA 2E1ZA 3B8AX 1X9JA 2GEMA 2W40A 4XH5A 3BF3A 4O5FA 3GOIA 3U8XA 2CGLA 4H5NA 1LCUA 5JLFA 4FPAA 2E2NA 3ZEUB 4CZEA 1WUAA 4CZJA 3FR0A 3A5OC 3CJ1A 4FSVA 4PKHA 3R9PA 4K43A 1E4GT 2CH5A 3EKUA 3WXKA 5AQUA 3R8EA 3VOVA 4CZLA 3ZX0A 2W41A 4QS8A 3ZETB 5AR0A 3FE1A 1TUUA 4BC3A 2V7ZA 1QQNA 2ASPA 2E2OA 1NGEA 1NGCA 3QMLA 3D7EO 2ASMA 4I6MA 1Y64A 1RGIA 3MMVA 3DJCA 3FFKB 5AQKA 2QWRA 3IMXA 2D1KA 3EZWA 3C0BA 4LC9B 5EOYA 4JN4A 3LDNA 5FPMA 4DQ8A 1MWKA 5AFUA 3HSCA 3OHRA 5LJVA 3AAQA 5AQOA 4CI6A 1X3MA 3CJ9A 1OKJA 5BREA 3DAWA 4IWVA 4CZHA 1BO5O 5TKYA 1NGIA 2P9PB 4PL8A 3WQTA 3W0LA 2FSJA 1RFQA 3L4IA 3QBWA 4FWMA 3U9ZA 3ZETA 2FSKA 2VYPA 2FLOA 3S41A 3DXMB 3UE5A 3TU5A 3ULEB 3CERA 1JCFA 4FWOA 5BPMA 5AQHA 4BRQA 3RSEB 5AQYA 3U4LA 2A41A 4H0XB 2GWKA 3KHYA 4H0PA 1GLDG 1GLAG 2EWSA 3SJHA 2P9KB 2QWLA 4RCHA 3H1QA 3WQUA 3AY9A 4YDUA 3O6WA 1Q18A 1SZ2A 4IO8A 3SK3A 2P9LA 2QWOA 4BC5A 2YCHA 1HX1A 4AM6A 5KPRA 3VPZA 3HZ6A 2ASOA 4HWIA 4IJAA 3VEOA 1T6DA 5AQVA 4BVOA 4FWPA 3M3ZA 3WXIA 2P9PA 3P4IA
chains in the Genus database with same CATH superfamily
3PIPL 3AVBA 1S1TA 3OVNA 3V9WA 2HBJA 4H5WA 2E20A 2Y1JA 3QNNA 2HF4A 3NE6A 4AILC 5GINA 2F9TA 1CZAN 2YHYA 3CCJN 4O0JA 3O5BA 4ID5A 1GLEG 3VEXA 2XO7A 2OCEA 2O8BA 4C1NK 1QSYA 4BRHA 2Q1NA 2G8UA 4JK7A 3ENOA 4QS7A 4KPYA 5KRSA 3QEVA 4PL7A 2NNWA 1QTMA 3ZSWA 3D6RA 2A6AA 1NK5A 3GBTA 3MEDA 4XH1A 4JKGA 3OYEA 2Q97A 2V7YA 3QERA 4WF9L 3SUNA 3HO1A 4IO9L 3DLGA 1EWQA 1QHTA 1C1AA 4FW2A 2P9KA 3O3FA 4X65K 1VRUA 4KH5A 3AO1A 2WFBA 4JKEA 4B1YB 2EHGA 1TKZA 2FSNA 2ZQBA 4E3SA 1P8ZA 5D3GA 1QHAA 3SCXA 4B1ZA 4DTUA 1CZ9A 3FGUA 3FZHA 1EX4A 1JL2A 3L0QA 5DM7L 3SQ2A 4B9TA 5AFUH 3QINA 4OPHA 1YT3A 3THYA 1TK0A 2X74A 1NWKA 2GTDA 3DLLL 5CE3A 3RRGA 4ISFA 3K5NA 1IH7A 3TTFA 4WQ4C 5GAHP 4YOUA 2O8DB 2QWMA 3EZ5A 4XIUA 3HSTB 4DQRA 4Q5VA 3CMEN 4GW6A 4ZTFA 2P9IB 3NFAA 3HXMA 1XC3A 3OYJA 2O8FA 4ISGA 4OJRA 3CIPA 1IBLK 1LOTB 1RTIA 4KAZA 4A61A 4DV1K 1GOAA 4ID1A 2UXCK 4H0OA 1KAYA 2CGKA 3C95A 5AJ3K 2VQEK 1XNQK 4FPBA 4C8NA 3CD6N 4K8XA 5FRMA 3F2KA 3ZSXA 3ZLJA 3AV9A 4DQSA 3H3NO 5F2RA 5TKWA 3K5LA 1XHZA 3THVA 4GVEA 4CW7B 1YAGA 4FOEA 2XY5A 4FO0A 3V9UA 3N4PA 2H3GX 3KKSA 5KI6A 3VGMA 4CF2A 2QXLA 1UWBA 2VG7A 3ASMA 3EL2A 3C65A 1JKHA 4Z4EA 4C8MA 3L2QA 2OANA 5M1QA 4AQYK 4LF6K 1D5AA 1EKEA 1U45A 3NF8A 1Q9XA 3CCRN 2P9UA 1IKVA 3PSFA 2P9SA 4K0KK 1S3XA 4ILJA 3O3HA 2YNHA 4RW8A 3K5MA 4IFVA 2CH6A 1SL0A 3O4WA 2IAJA 1TK5A 1FJGK 4FLVA 3ZSOA 4CEFA 2ZGYA 3C6AA 3JSMA 4RW9A 4JI7K 2GWJA 5C15A 2KZMA 4N56A 4CHQA 2OPQA 3DWLA 3H46O 1XC9A 1ITGA 4B1VA 1ATSA 4KI6A 2B6AA 3J81O 3A5NC 5KPZA 3K0SA 3RWUA 3QFPA 3IDHA 4K42A 3VEVA 4KTWA 2P1JA 1U4BA 1BGXT 4JKDA 2UUBK 1QS4A 1WSFA 3H3OB 4PQUA 4R79A 1MWMA 4BRGA 2EX3A 4CF8A 3AAPA 3AVFA 3R6MA 3MWTA 1WSEA 2GBZA 1WOQA 3VQPA 1YJNN 4CJQA 3MN6A 4NB4A 1VRTA 1J53A 2G8HA 3ZX3A 3SI6A 3KD1E 1ZBLA 1TKDA 1IBKK 3V81A 2UUAK 3OJUA 3VQ6A 4DF8A 2NUBA 4DR5K 3O8MA 1C0UA 4M7XA 1MA9B 3D2FA 2HMPA 4HHTA 4KHPK 2ZGZA 4CEBA 1J5EK 3TAPA 2V52B 5AQSA 3PSIA 5LJWA 4CJ7A 4BY9C 1W7AA 3D2FB 3NMUA 4KV8A 1UA1A 4F2SA 4B08A 3J7YP 4B3SK 1ASWA 4H5RA 3HTVA 3KK3A 4FK2A 4LFBK 5BRFA 1VQON 1S6PA 3IUCA 1ZBSA 1ATRA 5AQPA 1S72N 1FXXA 4B3RK 4LFAK 1OH6A 4PKGA 5A2QO 4BRCA 4QAGA 4M45A 3C6UA 1VSJA 3O08A 4ILGB 1HPZA 2BGGA 4I2PA 2RF2A 4CGFA 1RBSA 5BRHA 2IOCA 4HTLA 1W2BM 1KFSA 1Z6RA 4DFMA 3CXCM 4BWMA 4I7FA 1KXPA 2KKZA 4B3MK 4DTXA 3AVHA 3DRPA 2QWNA 5AQFA 3P5JA 1VQNN 4BROA 4E1JA 4YOYA 4DS4A 4KHUA 3LDPA 2VWJA 1NK9A 3N4QA 4MO5A 3VEWA 2HSTA 3M8PA 3SAGA 4BE1A 4WQ5C 4PHTX 3OS0A 3KK7A 2HVHA 4FCYA 3DOKA 4CZIA 3F9MA 5AQMA 5KQDA 2HMIA 1IG8A 3KVGA 4DCHA 4KRFA 1QE1A 5EVZA 3SLCA 2D0AA 1LWEA 5CZ1A 2OPRA 1TUYA 3S9HA 3MX5A 1XWLA 3MEEA 1SKRA 4BRPA 4CIGA 4CJUA 1RT2A 3O4QA 3CCEN 3H45C 3O4NA 3QEXA 3CHWA 4BE0A 4JI0K 3U6FA 1HYZA 1SV5A 2O4IA 3KZBA 1VSDA 4EHUA 1QQOA 3WXJA 4BRMA 3PV8A 4CGGA 2HHXA 1DGKN 3O9SA 3H1VX 4OVLA 1KD1O 2NZTA 3TTCA 3KTQA 1I39A 1HJRA 4O5FA 4BDZA 3U8XA 3UIQA 3NGZA 4FM1A 1NMNA 3G71N 4DTNA 4CZJA 3FR0A 3A5OC 3AGRA 5LMNK 2VG5A 2O4GA 3EKUA 5AQUA 4CZLA 3ZX0A 3K58A 4QS8A 3DLHA 3NH2A 3SV3A 2V7ZA 4N76A 4RW6A 4FZZA 5C0YA 3TANA 2HBLA 4M41A 1Y64A 3G4SN 1HNZK 2D5RA 1RDBA 3MMVA 3DJCA 2QWRA 3IMXA 3O9UA 4CFDA 3LZJA 3C0BA 4JN4A 4DR2K 4X64K 3HSCA 2YNIA 4FJGA 2UXDK 4CI6A 5FDLA 3NF9A 5BREA 1P90A 4NYFA 1JXBA 2QXFA 4FJ9A 2P9PB 3OA9A 4I2QA 3W0LA 4A5BA 4Z4IA 1IV0A 4HCCA 3QBWA 3EEQA 1WSJA 4FWMA 2VG6A 3U9ZA 3ZETA 1HNWK 2FLOA 4DLGA 4RW7A 4DFJA 4L8RB 2OZSA 5BPMA 3RSEB 1VK0A 3TAGA 4JKGB 3KHYA 3LWLA 4O44A 4CJTA 1HQEA 4DLEA 5CYQA 2EWSA 3IS9A 4E1MA 2P9KB 4F3TA 3WQUA 3AY9A 4FLXA 1D8YA 2P9LA 5KPRA 4AM6A 3HZ6A 2ASOA 4HVJA 3KLIA 4BVOA 4KHQA 3F73A 2W6LA 3KIOA 4CJKA 2I5JA 1T05A 3J7AP 2P51A 1NJWA 3ENHA 1WB9A 4DR7K 2E4LA 3E9LA 4JKFA 4Z4CA 4B3OA 1RTDA 5FRNA 4JI4K 3TARA 4OLAA 2Q0UA 1KVCA 5HLFA 1BOTO 1VQLN 1WLJA 3G10A 1YI2N 4FXDA 3ID8A 3R3LA 1IG9A 3EE8A 4WQ4A 2OYQA 2WUSA 2O8CA 1VQ4N 1YVNA 5KQ8A 3DMJA 1HNXK 4B9QA 2ITMA 5B8HA 3DLKA 4CF1A 2A40A 3HBTA 4KBOA 4BG9A 4DKWA 1NKCA 1V4SA 4JI2K 1NGDA 3QIPA 1HUXA 4DSFA 3DRSA 4BRKA 1RT6A 5BN9A 3P39A 1WN7A 3SNNA 4CVNE 1HLUA 2IVNA 2P9UB 4FK0A 2XY6A 1RTJA 1X1PA 2ZD1A 4AHUA 3IRXA 3O1WA 3LWMA 4FLYA 1NOZA 1LAVA 3HPHA 4R5PA 5AQRA 4N5SA 4G9ZA 3MN7A 5J2MA 1JCGA 1KVAA 3WNEA 4K25A 3VQ8A 3A0IX 3VEZA 1XUPO 4EFHA 3OYBA 1DKGD 3CQXA 3NGIA 3MN5A 1HNIA 4BR2A 4E7KA 3EE9A 1VQ5N 2F96A 2PYLA 2I7PA 3CJBA 1N34K 4M3XA 4A59A 2BUPA 3OBWA 4X62K 3ZSZA 1CLQA 4H5TA 4H03B 4BGAA 3M8QA 1XI1A 5JS1A 4CJWA 5CR4A 1JXEA 4HTUA 3SMPA 3PIOL 2P5GA 3AVNA 4QS9A 3SJJA 2P9SB 4OGCA 2LSNA 2ZWHA 4RWTA 1QVFM 1TV6A 4J2BA 3CF5L 4NCAA 4FWQA 4EZ9A 5DM6L 1YVUA 2Q3SA 1NMDA 3VEYA 3B6OA 4KHWA 4ELVA 2QI2A 1ZC6A 2NRWA 3IG1A 4JLHA 4DTOA 1A5XA 2RE2A 5AQTA 3OS1A 2QK9A 1QZ6A 4YNQA 1XMQK 1KRPA 1ZYQA 4BREA 3OYDA 4DV2K 4CZMA 4RTFD 4ELUA 1S22A 2HBMA 2A1SA 3F5TA 3QFUA 4FYDA 3BDPA 5AZIA 1K8KA 3L3UA 2JLEA 3E9PA 3TWHA 3RMAA 2P5OA 3CQYA 3MXIA 4FWLA 1RTHA 4CGIA 3NGYA 3KLHA 1KSPA 3DXKA 3AVMA 1L3SA 2YHWA 3L2WA 4EIAA 4GNIA 2FBVA 3AA2A 1NK4A 5J1EA 4Z4GA 3PX4A 2E1YA 3UKUB 2E6LA 4JD2A 3SBGA 4G1QA 4WYBA 3WNFA 2P9NA 1VQKN 3IAYA 2G8VA 4H4OA 3ZT0A 3THYB 3AARA 4MQ3A 2I7NA 5ADXH 2W6KA 3LAMA 5C12A 4M3TA 5BRDA 5C2DA 3J8AA 1LAWA 1NKEA 3MWPA 3HVRA 1HRHA 4E7JA 4JI8K 1TYQA 5J2NA 4W5NA 5AZJB 2FF6A 4C1NI 4H5VA 1BWFO 4CCHA 1ASVA 1KAXA 1YITN 1QQMA 3K9KA 3R1XA 1G99A 1X9WA 5FLXO 2DFEA 2P9NB 2HNZA 2F9WA 4YDUC 3ZT2A 4M3YA 1VSLA 3UKRB 4FOIA 4YORA 2KHOA 1QZ5A 4BQLA 2HNYA 2DY4A 5AQZA 2Z1IA 3WXMB 3K2PA 4I9QA 3RSEA 3M6GA 3CC2N 1N36K 4CE9A 1SAZA 4O8UA 1KTQA 5FPNA 4DFKA 5AZJA 1SQKA 4DFPA 3THXA 5BN8A 3LPTA 4OPKA 1GLJO 2WBNA 4CJLA 4XEIA 3G0ZA 2BANA 4DU4A 2QKKA 1BL3A 5AQGA 1GLFO 1VSFA 2YKNA 3CI5A 4CJVA 3TPQA 1KLMA 3O9QA 2XY8A 2BH1A 2Y1IA 4OKEA 3L2UA 2XY7A 5DK5A 3P1GA 4B1XB 3Q7BA 3WUHA 1NGBA 4I6MB 4FWRA 4DUZK 1DTQA 1YIJN 4WQ5A 3CCUN 4A62A 3L3VA 5E26A 5GAEP 3JXUA 1VSIA 3VERA 3LP1A 2AJQA 3MK6A 3NAEA 1VQ8N 1N33K 5GIPA 1Z26A 4KKOA 4CZFA 4H8KA 4BR9A 3RRHA 1C0FA 1VQMN 4KHYA 2ITGA 3DI6A 4AHSA 2JWKA 2Z1JA 4IFYA 3CFPA 2J4RA 5C2FA 2IVPA 1BCOA 1GOBA 3NH1A 3V1RA 4IG3A 3L2VA 2IC3A 3QEIA 5AZIB 3MXJA 2G8IA 2IS3A 4O0IA 5CHIA 4BRIA 1QSSA 3BY5A 3BP8A 1BHLA 2ATQA 3THWA 2YKMA 4IG0A 1R59O 4KI4A 3K57A 4CECA 4JNEA 1IKYA 1NJYA 3SQ1A 1B9DA 1VSHA 5CY4A 4FJXA 1REVA 4B9NA 1ESVA 3O1BA 4IJNA 3OYMA 1TVRA 3AO5A 3GG4A 4DR1K 4JI6K 3QO9A 1HYVA 2X6SA 1F21A 4OLBA 2DPNA 3ATVA 2IIRA 4DV6K 2Q2RA 3E01A 1J5OA 1X3NA 1M90O 3LP0A 2W42A 1BIZA 1RT3A 3I33A 2GELA 4Y0WA 2GUPA 2G8KA 1BISA 1YF5L 4ISEA 1RBRA 1N32K 3DLBA 4BR4A 5JICA 1U49A 5M1PA 1OH7A 2HW3A 2E88A 4U67L 3DLRA 3B8AX 4B9MA 4BACA 3TI0A 3AO4A 2CGLA 1LCUA 2E2NA 4CZEA 3TABA 1W9HA 1WUAA 2HHTA 3DYAA 5HRRA 1TGOA 1M1KO 4F2RA 1Q8IA 4BC3A 4OO1J 3QESA 3B6PA 1L3UA 2OZMA 2ASPA 1NGEA 1NGCA 3LP3A 2ASMA 1BQMA 3FFKB 3ENBA 2BE2A 2D1KA 2PFUA 5M1OA 5EOYA 3A2FA 4FM2A 5AFUA 4Y1DA 2RHKA 4U7BA 5LJVA 4M3ZA 2NRZA 4WFNL 3DOLA 3OYGA 2X78A 1BO5O 5GAGP 5TKYA 4K8ZA 2VGNA 1NGIA 3HVTA 2VGMA 4PL8A 3VQ7A 3T3FA 1TL3A 3P38A 1D9FA 5DMRA 2VYPA 3JAMO 3UE5A 1JCFA 4FWOA 1J54A 4BRQA 3OYLA 5AQYA 3MEGA 5HRPA 2A41A 4H0XB 4CJPA 2KTQA 4W5RA 2HHVA 4H0PA 1GLAG 3SJHA 3AVLA 1KC8O 1NK7A 1LWFA 4O4GA 1NNEA 3CCQN 1SZ2A 4W5QA 1LW2A 4HWIA 3VEOA 1FW6A 2FBTA 1NU0A 1VSKA 1CZBA 4B8AB 3TAQA 2YHBA 3WXIA 3P4IA 1C0TA 1GLCG 4DSJA 2HNDA 3CJAA 3FLCO 3P31A 4CJSA 3U3YA 3L6QA 3WXLA 4Z4HA 4E0DA 1T6CA 3LP2A 4DQIA 5HOOA 3NBPA 4CEEA 3ZSQA 4IKFA 5FPDA 5C24A 4CF9A 4JV5K 2QW9A 3A5MC 2NRHA 2B4JA 3CJ7A 3V1OA 3EO3A 4CK2A 4CEOA 5AQNA 4XH4A 2KQ2A 2QWPA 3KKRA 4J2AA 3CYMA 3I8BA 4CZGA 4FVMA 1Y97A 3S3OA 4IEEA 3MECA 1Z25A 3QICA 5KTQA 5LY3A 1JLAA 3W3DA 1VQ9N 4GKJK 3S3MA 1OH5A 2FBYA 3DXMA 2HVIA 4MDAA 4FJ5A 1XNRK 4IOXA 2HHWA 4Z0UA 3SAHA 3A5LC 2HB5A 1A5WA 1UA0A 2A1RA 3HK2A 3VQCA 1U2VA 1VSEA 4OGEA 1NM1A 4PKIA 4C8KA 4EP4A 2Q36A 1RDDA 3VETA 3HM9A 3MCPA 4PA1A 1EXQA 4WCEL 1K73O 4ILHA 1NGFA 5AQJA 3VTHA 3D0PA 3NCIA 1LW0A 3AVAA 3TAMA 1U47A 3MXMA 5SWMA 3GDQA 4BWJA 4M63C 4CGJA 3VF4A 2UXBK 1DTTA 3T19A 1NG9A 2KFNA 2QEXN 1NGGA 4H0TB 3L4QA 1GOCA 3CPEA 2PY5A 1Q82O 4IXCA 1FKPA 2D0OA 3BZKA 3GL1A 4BRAA 1NJIO 3T1HK 3G25A 5BR9A 4CJEA 4H0YB 4YOWA 4JYAK 3ZCMA 4GV3A 3PUFA 1ZBUA 4FZXC 2QTDA 3U3GA 2QA4N 4LF7K 1D9DA 1BQNA 2Z1HA 3I0RA 1I94K 2PAVA 1FKOA 1YUWA 3ZEUA 1HQUA 1WSGA 3CETA 2P9IA 1J6ZA 3HYFA 3VQQA 1ASUA 1DLOA 4CD1A 3ATUA 4KTZA 1X9MA 2XHBA 3CPWM 1C0MA 4LD0A 4GV9A 3LDQA 3HPGA 4W5OA 1ILYA 2UYTA 2ZJPL 1RDWX 3HL8A 4FJKA 1ZBHA 2Z1GA 1C1CA 5HROA 3TR8A 3HP6A 2F8TA 3AVKA 3VA3A 3THXB 1WSIA 4LSLA 1N8RO 4YOTA 3C7NB 4BRLA 3QB0A 1S5JA 3PO5A 3T1AA 2D4WA 4JD2B 1TAQA 4HUFA 1U6ZA 1K9MO 3O80A 4FWSA 1Z05A 4B1UB 1RT5A 2YHXA 2QM1A 4OPJA 3VQEA 4H4MA 3QDKA 2WOMA 1XHXA 2FXUA 3V6DA 3NVKA 2E2QA 1YJWN 4AF1A 2KW4A 4CHPA 1EO1A 1HKCA 1T44A 3UKUA 2Q31A 4A57A 1JLQA 1NLVA 1OVQA 3FZFA 5MLCQ 3ZT1A 2HOEA 3VN5A 4BR7A 2ZJRL 3OTOK 4FLWA 3CCMN 3NH0A 3HOTA 2AA4A 3ISNC 3AVJA 4DG1A 1TL1A 4NXNK 1UAXA 4FJMA 3C94A 5ELZA 3MCAB 4KB0A 4IZ9A 2A3ZA 4O8KA 4CJ4A 3EN9A 2VWBA 3DM2A 3J80O 3OYNA 3V9SA 5JLHA 4B9SA 1HKBA 2AP1A 4GY2B 4CFAA 5FPEA 3KWIA 4DSLA 4Z4FA 1JJ2M 4CFCA 1HNVA 3IKMA 3ZT3A 1KLNA 3CJCA 3TSQA 2FBXA 2YI1A 1KFDA 3KLFA 4A5AA 3FZMA 1R0AA 4FLZA 3T69A 1BDGA 4TSXA 1SS6A 3OW2M 3U9DA 1ZXOA 4DTPA 3HI0A 1RCHA 3OYHA 4JS4A 4GV6A 4OX9K 2ZF5O 3LZIA 3NVMA 4Q0BA 4C23A 4FK4A 4FZYA 4KH6A 4MDBA 4RW4A 4DSKA 2RPIA 1IKWA 3LALA 1UOCA 2XRIA 4EHTA 3KK2A 1QQCA 3KK1A 4WE1A 1S6QA 4GMJB 3QEPA 3OJSA 3VQDA 1JLBA 3AO2A 4F9OA 5LL6Z 2RKIA 5F1XA 3OYFA 3M8SA 1WAJA 1SKSA 1O1WA 4FWNA 1YXQA 2YV0X 3D2EA 1V4TA 3FZLA 4DV5K 1GLBG 5HRNA 2ZE2A 3SPYA 5E41A 2O8EB 2WTUA 1NJXA 4KFBA 3HJFA 3VTIA 4DB3A 3OYIA 1LV5A 3E66A 1BU6O 4LFCK 3THWB 1U48A 4BR5A 3ZSYA 2DFFA 1ATNA 4PUOA 1BG3A 2P9LB 4B3TK 1Q86O 1RDUA 3AVGA 2O8DA 4DSEA 4BDYA 3HT3A 5HP1A 3ULEA 3C7NA 1ZBIA 2O8BB 3M5RA 4NCBA 2VCPA 4GKKK 4FJNA 5CYMA 1S9EA 3OYAA 4AM7A 3AO3A 3T1YK 3RR7A 2G8FA 3MDQA 4JAXA 4QCLA 4WFAL 3KJVA 1NGJA 3S3NA 3CMAN 4C8OA 4AHTA 2B5JA 4DMNA 2O8CB 3M1FA 4A2AA 2Q0RA 4X66K 4BDPA 4BR0A 5F0XA 3CM5A 3L8BA 2WONA 2E8AA 1S1VA 2YHAA 3CM6A 3WNGA 2JGUA 4NXMK 3ZSRA 5JMVA 2YX6A 1HPMA 1IJJA 1BA0A 5IWAK 1RT1A 1Q81O 1NK0A 3VQAA 1T8EA 1X9JA 2GEMA 1JLEA 2W40A 4XH5A 3VMFB 4B8CA 5M1KA 3EYZA 3BF3A 4CGHA 1S9GA 4H5NA 4JI1K 4IDHA 5JLFA 2O8EA 3CJ1A 4FSVA 4PKHA 3R9PA 4K43A 1E4GT 2R7YA 4JRQA 3ZETB 5AR0A 3FE1A 1TUUA 3O3GA 2PZSA 4FW1A 4CJ3A 1T03A 2KZZA 3PX6A 4ICLA 1ZBFA 1FK9A 1MU2A 4ZTJA 4FJ7A 4F4KA 3QMLA 3D7EO 4JKCA 5BR8K 4DF4A 4YFUA 1RGIA 5AQKA 4UY8O 1YTAA 5GADP 3EZWA 4O5BA 2UUCK 5KGXA 4KHNA 1RNHA 1TKTA 5FPMA 4JRPA 2E5LK 4DQ8A 2X6NA 2JWLA 3AAQA 5AQOA 1TKXA 1JLFA 3ZYYX 2KFZA 3SYZA 1RBUA 1G15A 3WQTA 5C25A 2VQFK 2FSJA 4KO0A 1L3TA 4DQPA 5JVHL 1Q7YO 3S41A 3DXMB 4CIFA 3TU5A 3ITHA 3ULEB 4NLBA 4ZHRA 1RBTA 2QKBA 5J2PA 1EETA 5AQHA 3SQ4A 1OH8A 3HOSA 4CJRA 1B92A 3RTVA 1YJ9N 3QEWA 4FJ8A 2ZM6K 1GLDG 2VWKA 4DU1A 2GX9A 2QWLA 3SBTA 4RCHA 3E1YA 3H1QA 4CHYA 3TSUA 2ZJQL 4Y1CA 3OY9A 4JKBA 2QWOA 4BC5A 4DTSA 2YCHA 1HX1A 4FVUA 1JL1A 3VPZA 1T6DA 4CK1A 5AQVA 3TTDA 5J2QA 2IGIA 4JKHA 3LM9A 2P9PA 3ALYA 1U04A 3EKSA 2HF3A 5AQLA 5I42A 3OYKA 1IBMK 4DTMA 1KAZA 1EQYA 3WT0A 2WC9A 2YJEA 1LWCA 4IDKA 4JKAA 1MDUB 3ID6A 3LM2A 4FLUA 3RVCA 3MX2A 1RDCA 2OA8A 2HBKA 3PLAA 4CJ5A 4E1NA 2D0BA 3TAEA 4ELTA 1XQSC 4BRNA 4CEZA 4CBUA 1S1XA 3JS6A 1L3VA 2NRXA 4W5TA 1X9SA 3LANA 4EZ6A 1TYQB 1NOYA 1NJZA 3VF6A 5CZ2A 3D2EB 3WNHA 3C6TA 4MFBA 3SUPA 2BDPA 1NBWA 3AA4A 4JHDB 4FL9A 3VA0A 3DLEA 4DU3A 1WBBA 2CGJA 4A2BA 3M8RA 1DEJA 1NGHA 5BPNA 4AHCA 3NHGA 1O13A 3SV4A 1HYSA 2YNGA 4JS5A 3H08A 4KB1A 1BUPA 2FF3B 2IVOA 4BC4A 5HRSA 4FM0A 3D45A 3PO4A 1E4FT 4DS5A 3ZSVA 4MO4A 4FLTA 4OPAA 4DV0K 1W97L 5M1FA 4JI5K 4CD3A 3CQ8A 4O55A 1CXUA 5H1SQ 4LSNA 3VQ5A 4BRFA 3WEEB 4BQZA 3QIOA 3I8DA 2DTUA 1SL2A 5BPLA 4IBNA 3V4IA 1BI4B 1WSHA 4QOZB 4AHVA 3BEXA 2NLXA 3NF7A 5EU7A 1N6QA 5AQWA 2HHUA 1NK8A 3P83D 2YNFA 3MN9A 1S1UA 2A5XA 4H0VB 4JI3K 5EXWA 4DR3K 5HL7L 3AVIA 3ULDA 1KVBA 3FZKA 4J8FA 1EP4A 1WBDA 3VGKA 4AH9A 4E7IA 1L5UA 1VQ6N 3BF1A 2HHHK 4YOVA 1JLCA 4YHHK 4CHNA 1K8KB 2NRVA 4BRDA 4MLHA 3HM8A 3O9RA 2QWQA 2DFHA 4GVMA 4M3RA 5I3UA 3KWGA 1HKGA 1DT9A 5AQXA 3RMBA 2V51B 4CEDA 3GE1A 5KPTA 3CC4N 4NCGA 4L3QA 5GIOA 4AHRA 4LF9K 1NKBA 4LH5A 4E89A 1YHQN 4CJFA 3UB5A 1NGAA 1JCEA 4LF8K 4PY5A 2NRTA 4BC2A 2F4VK 3CCSN 2D0PA 4JHDA 3RMCA 3LDLA 4DHYA 3PX0A 3HPOA 4YOXA 3LDSA 4EP5A 2KLAA 4KHSA 4M7YA 4HUGA 1CXQA 4IOCL 1RT7A 4FJLA 1VHXA 1K8AO 4LY7A 3O9TA 3LAKA 3VGLA 3TAFA 2G8WA 3KLGA 3CC7N 4FJJA 3SQ0A 3K59A 1E3MA 3DXKB 4F8RA 3AVCA 2HHQA 3PY8A 1U2VB 1B9FA 4CEAA 4BVPA 2FC0A 4LF4K 3QLHA 1TAUA 4HCBA 3TSPA 1WAFA 4M3UA 3LL3A 3VESA 4M3WA 3CFOA 3SMSA 3NF6A 1KCFA 4CHZA 4DTRA 3WEEA 2NRRA 4IFEA 2F7TA 1I3AA 4CZKA 5EY4A 4DSIA 5M1NA 2ETJA 2BTFA 4CESA 3VF2A 2O8FB 3BGRA 1VQPN 2PBDA 3BUZB 4K41A 4M42A 4BG8A 1OVYA 3MAQA 3HRGA 4JEPA 4F3OA 4EAHD 2D0CA 1IO2A 4CBWA 1BA1A 3BZCA 4B1WB 4DUYK 2UU9K 1C0GA 3Q7CA 3QETA 1HJOA 3LDOA 3NDKA 4LF5K 3AGKA 1RBVA 3A8YA 4LH4A 4BE2A 1HMVA 4FWKA 5C10A 4IEIA 3IFRA 3QBXA 4DV7K 4NLCA 1JLGA 1VAZA 3VENA 5AQQA 3ZX2A 1BI4A 4MLEA 1S1WA 3E9OA 1QSLA 1EWRA 3KD5E 3VQ4A 5AQIA 5T7BA 1TK8A 3SAFA 5E84A 3KLEA 4N41A 3V9XA 1C6VA 4CGDA 1D4XA 4FJHA 5C42A 4DR6K 3EY1A 2PYJA 4J2EA 4CHOA 4N47A 3AA5X 4YY3K 1A5VA 3UKRA 3F9KA 4JK9A 3V9ZA 1VQ7N 5KRTA 4B9LA 3SUOA 4FJIA 4B9UA 2E2PA 2YJFA 4Z94A 4V19S 1C1BA 4DTJA 3L2RA 4CBXA 4RG8A 3SUQA 1QVGM 5EX5A 3OS2A 3G6EN 4NYNA 4PWDA 4DQQA 2OPSA 3SPZA 1H1VA 4KREA 3ZT4A 1GLLO 1RT4A 4WFBL 3I56N 4NO7A 4OKKA 3JYTA 5K14A 4BGBA 1SKWA 4OKJA 2A42A 3LPUA 4KTQA 4C8LA 2OPPA 5ADXA 3VQBA 3H6EA 3VQ9A 5I9EB 3DRRA 1IKXA 4DV3K 2E1ZA 2RN2A 3OBYA 5LMUK 1N5YA 5IT9O 3OYCA 4E7HA 1W0HA 3GOIA 4IOAL 2OTJN 4CFBA 2HHSA 4FPAA 5JS2A 3QNOA 4CK3A 3V1QA 2IDOA 3FFIA 3ZEUB 4CEQA 2E6MA 1NK6A 2CH5A 3WXKA 1SL1A 3R8EA 3VOVA 2W41A 3CCLN 3C6HA 4E19A 1QQNA 2E2OA 3I55N 1HR0K 4J2DA 3HP9A 4UQGA 4I6MA 5SZTA 3J7ZO 4HUEA 4JK8A 1KQSM 4B9VA 1BCMA 4LC9B 1K6YA 3LDNA 1MWKA 3OHRA 4CIEA 4DV4K 1X3MA 3CJ9A 3CG7A 1OKJA 5KGWA 3DAWA 4IWVA 1T3VA 4CZHA 1WNSA 4E7LA 1J9AA 4DWIA 1RFQA 1T7PA 3L4IA 1YTUA 2FSKA 4CF0A 3RR8A 3CERA 4CERA 2GV9A 5HBMA 2F8SA 1RILA 1SUQA 2GUIA 3U4LA 5JVGL 1XMOK 2GWKA 3AA3A 2OTLN 1Q9YA 3CCVN 3SZ2A 3I0SA 3K9JA 4YDUA 3O6WA 1Q18A 4IO8A 3T7ZA 3SK3A 3CFRA 3RMDA 5FROA 4IJAA 1RDAA 3K5OA 4I9LA 4FWPA 1BIUA 4KH4A 3M3ZA 1VSMA 4DR4K
chains in the Genus database with same CATH topology
3PIPL 3EKSA 2HF3A 5AQLA 2HBJA 4H5WA 2E20A 1GLCG 3ENHA 1KAZA 1EQYA 3CJAA 3FLCO 3P31A 3WT0A 2HF4A 2WC9A 3L6QA 5GINA 3WXLA 2F9TA 1CZAN 2YHYA 1T6CA 3CCJN 2YJEA 5HOOA 3O5BA 3E9LA 4JKFA 1GLEG 4JKAA 3VEXA 1MDUB 5FPDA 3ID6A 2QW9A 3A5MC 3LM2A 4C1NK 2NRHA 3RVCA 2Q0UA 3MX2A 3CJ7A 4BRHA 2HBKA 3EO3A 2Q1NA 3PLAA 1BOTO 4JK7A 1VQLN 5AQNA 3ENOA 4QS7A 1YI2N 1XQSC 3ID8A 3R3LA 3EE8A 4WQ4A 2NNWA 4BRNA 4PL7A 4XH4A 3D6RA 2A6AA 2WUSA 2QWPA 1VQ4N 1YVNA 4CBUA 3GBTA 3JS6A 4CZGA 2NRXA 3I8BA 5KQ8A 4XH1A 4B9QA 2ITMA 4JKGA 5B8HA 4IEEA 3QICA 1TYQB 2Q97A 2A40A 2V7YA 3HBTA 4WF9L 3VF6A 5LY3A 4IO9L 4KBOA 4BG9A 4DKWA 3D2EB 1V4SA 1NGDA 3W3DA 1HUXA 1VQ9N 2P9KA 3DXMA 4BRKA 5BN9A 3P39A 4KH5A 4MDAA 2WFBA 4JKEA 1HLUA 2IVNA 2P9UB 4IOXA 4B1YB 3SAHA 2FSNA 3A5LC 1NBWA 1P8ZA 4JHDB 4FL9A 1QHAA 4B1ZA 3O1WA 1U2VA 2CGJA 4A2BA 3FGUA 1DEJA 3FZHA 1NGHA 3L0QA 5BPNA 5DM7L 5AFUH 1NM1A 1O13A 4OPHA 4PKIA 5AQRA 2Q36A 4G9ZA 3MN7A 1NWKA 3VETA 2GTDA 3MCPA 1JCGA 5CE3A 3DLLL 4ISFA 4WCEL 1BUPA 1K73O 2FF3B 1NGFA 4ILHA 4K25A 4WQ4C 3TTFA 2IVOA 3A0IX 4BC4A 5AQJA 3VEZA 3VTHA 1XUPO 5GAHP 4EFHA 4YOUA 1DKGD 1E4FT 2QWMA 3CQXA 3MN5A 4BR2A 4MO4A 3GDQA 4OPAA 4M63C 3EE9A 3VF4A 1W97L 1VQ5N 5M1FA 4CD3A 2QEXN 2I7PA 3CMEN 3CJBA 2P9IB 1NGGA 4H0TB 4A59A 2BUPA 3L4QA 3OBWA 5H1SQ 3CPEA 1XC3A 4H5TA 4BRFA 4H03B 3WEEB 4BGAA 4IXCA 1Q82O 4ISGA 4BQZA 3CIPA 5CR4A 1LOTB 3SMPA 2D0OA 3PIOL 5BPLA 4A61A 3GL1A 4BRAA 1NJIO 4QS9A 2P9SB 3G25A 4H0OA 1KAYA 2CGKA 5BR9A 4H0YB 4YOWA 3BEXA 2NLXA 4GV3A 5AQWA 4FPBA 3CD6N 2ZWHA 4RWTA 1QVFM 2QTDA 3F2KA 3CF5L 2QA4N 4FWQA 3H3NO 5F2RA 5TKWA 3MN9A 5DM6L 2A5XA 4H0VB 1NMDA 4GVEA 2PAVA 3VEYA 1YAGA 5EXWA 5HL7L 4FOEA 1YUWA 2QI2A 1ZC6A 2NRWA 4FO0A 3ZEUA 3N4PA 2RE2A 2H3GX 3FZKA 5AQTA 4J8FA 3VGMA 2QXLA 3VGKA 1QZ6A 1VQ6N 3BF1A 3CETA 2P9IA 4YOVA 1J6ZA 3C65A 3EL2A 4CD1A 3ATUA 2OANA 5M1QA 4BREA 1K8KB 2NRVA 4BRDA 4MLHA 3CPWM 3HM8A 4CZMA 4RTFD 3O9RA 4GV9A 2QWQA 3LDQA 1S22A 2P9UA 3CCRN 2HBMA 2P9SA 3KWGA 1HKGA 1DT9A 1S3XA 1ILYA 5AQXA 2UYTA 2V51B 1RDWX 4ILJA 3F5TA 2ZJPL 3QFUA 5KPTA 3GE1A 5AZIA 3CC4N 1K8KA 4L3QA 5GIOA 2CH6A 3E9PA 3O4WA 1N8RO 4YOTA 3CQYA 1YHQN 3C7NB 4FWLA 4BRLA 3QB0A 2ZGYA 3DXKA 2D4WA 3UB5A 1NGAA 4JD2B 3C6AA 1JCEA 2YHWA 1U6ZA 1K9MO 3O80A 4FWSA 1Z05A 2NRTA 4GNIA 4B1UB 4BC2A 4EIAA 2YHXA 2QM1A 3CCSN 2GWJA 5C15A 2D0PA 3QDKA 4JHDA 2E1YA 3UKUB 2FXUA 3LDLA 3DWLA 3H46O 3NVKA 2E2QA 4JD2A 3SBGA 1YJWN 4DHYA 4WYBA 4B1VA 2P9NA 1ATSA 4AF1A 1EO1A 1HKCA 3A5NC 5KPZA 4YOXA 1VQKN 1T44A 2KLAA 3UKUA 2Q31A 4M7YA 4A57A 3QFPA 3AARA 3IDHA 1NLVA 4K42A 4IOCL 3VEVA 2I7NA 5ADXH 3FZFA 5MLCQ 5C12A 2HOEA 5BRDA 1K8AO 4BR7A 2ZJRL 4JKDA 5C2DA 3O9TA 3CCMN 3VGLA 3J8AA 3H3OB 3HOTA 2AA4A 4R79A 3CC7N 1MWMA 3MWPA 4BRGA 3AAPA 3R6MA 1TYQA 3MWTA 3DXKB 5AZJB 2FF6A 1WOQA 1YJNN 4C1NI 4H5VA 1U2VB 3MN6A 1BWFO 4NB4A 4BVPA 5ELZA 1KAXA 3MCAB 1YITN 1QQMA 4IZ9A 3K9KA 3ZX3A 3R1XA 3TSPA 1G99A 2A3ZA 4O8KA 3LL3A 3VESA 2P9NB 3EN9A 2VWBA 2F9WA 3SMSA 5JLHA 1HKBA 2AP1A 4YDUC 3O8MA 4GY2B 5FPEA 3KWIA 4M7XA 3UKRB 1MA9B 3D2FA 4FOIA 2HMPA 3WEEA 4YORA 2KHOA 2NRRA 1JJ2M 2ZGZA 3IKMA 4IFEA 3CJCA 1QZ5A 2F7TA 2V52B 3TSQA 4CZKA 5AQSA 5EY4A 2YI1A 5LJWA 4CJ7A 4BQLA 5M1NA 4BY9C 3D2FB 3NMUA 5AQZA 4A5AA 3WXMB 3FZMA 3RSEA 3M6GA 3CC2N 2BTFA 3VF2A 3T69A 1SAZA 4O8UA 1BDGA 2PBDA 1VQPN 3BUZB 4K41A 4BG8A 5FPNA 1SS6A 3OW2M 5AZJA 1SQKA 1OVYA 3U9DA 1ZXOA 3HRGA 3HI0A 4JEPA 4EAHD 5BN8A 4H5RA 3HTVA 4GV6A 1GLJO 2ZF5O 4CBWA 5BRFA 1VQON 3NVMA 1BA1A 2WBNA 4B1WB 4XEIA 4C23A 3IUCA 1C0GA 1ATRA 1ZBSA 4KH6A 5AQPA 5AQGA 1S72N 3Q7CA 1GLFO 4MDBA 3CI5A 1HJOA 3LDOA 3TPQA 3O9QA 4PKGA 2BH1A 3AGKA 4BRCA 4EHTA 4B1XB 3A8YA 3Q7BA 3WUHA 1NGBA 4I6MB 4FWRA 3O08A 4ILGB 1YIJN 4FWKA 4WQ5A 5C10A 3CCUN 4A62A 4IEIA 4F9OA 3IFRA 3QBXA 5F1XA 5BRHA 5E26A 4HTLA 4FWNA 5GAEP 1YXQA 3JXUA 1W2BM 3D2EA 4NLCA 1V4TA 3FZLA 1Z6RA 1VAZA 1GLBG 3VERA 3VENA 3MK6A 1VQ8N 3CXCM 5GIPA 3VTIA 4CZFA 1KXPA 4DB3A 5AQQA 4BR9A 3E66A 1C0FA 3ZX2A 1VQMN 2KKZA 1BU6O 4MLEA 2JWKA 3E9OA 4BR5A 2J4RA 5C2FA 2IVPA 1ATNA 2QWNA 5AQFA 5AQIA 1BG3A 2P9LB 3SAFA 5E84A 1VQNN 5AZIB 1Q86O 4BROA 1RDUA 4E1JA 4YOYA 5CHIA 3LDPA 1D4XA 4BRIA 3N4QA 3BP8A 4MO5A 3VEWA 3ULEA 1R59O 3C7NA 2HSTA 2ZJQL 3M5RA 2VCPA 3UKRA 4JK9A 3SAGA 4JNEA 1VQ7N 4WQ5C 4PHTX 4AM7A 3MDQA 3KK7A 4JAXA 2E2PA 1ESVA 2YJFA 3O1BA 4IJNA 4CZIA 4Z94A 3F9MA 5AQMA 1NGJA 4WFAL 3CMAN 3LM9A 5KQDA 4CBXA 1QVGM 1IG8A 3KVGA 3GG4A 5EX5A 4DCHA 3G6EN 3M1FA 4A2AA 1H1VA 5EVZA 2DPNA 3SLCA 3ATVA 2IIRA 1GLLO 2Q0RA 2Q2RA 1TUYA 4BR0A 5F0XA 4WFBL 1X3NA 1M90O 3MX5A 3I56N 4NO7A 4BRPA 2E8AA 3CCEN 3I33A 3H45C 2GELA 3CHWA 4BGBA 4Y0WA 2GUPA 3KZBA 2A42A 1YF5L 4ISEA 4BR4A 4EHUA 5ADXA 1QQOA 2YX6A 3WXJA 4BRMA 5JICA 5M1PA 3H6EA 5JMVA 1HPMA 1IJJA 1BA0A 1DGKN 2E88A 3O9SA 3H1VX 5I9EB 4U67L 1Q81O 1KD1O 2NZTA 3TTCA 2E1ZA 3B8AX 3OBYA 1X9JA 2GEMA 5M1KA 2W40A 4XH5A 3VMFB 3BF3A 4O5FA 3GOIA 3U8XA 2CGLA 4IOAL 2OTJN 4H5NA 1LCUA 4IDHA 4FPAA 5JLFA 2E2NA 3ZEUB 4CZEA 3G71N 1WUAA 4CZJA 3FR0A 3A5OC 3CJ1A 4FSVA 4PKHA 3AGRA 3R9PA 4K43A 1E4GT 2CH5A 3EKUA 3WXKA 5AQUA 3R8EA 3VOVA 4CZLA 3ZX0A 2W41A 1M1KO 3CCLN 4QS8A 3ZETB 5AR0A 3FE1A 1TUUA 4BC3A 4OO1J 3C6HA 2V7ZA 1QQNA 2ASPA 2E2OA 3I55N 1NGEA 1NGCA 5C0YA 2HBLA 3QMLA 3D7EO 2ASMA 4I6MA 1Y64A 4JKCA 3G4SN 3J7ZO 1RGIA 3MMVA 3DJCA 3FFKB 4JK8A 5AQKA 1KQSM 4UY8O 2QWRA 3ENBA 3IMXA 2D1KA 3O9UA 5GADP 3EZWA 3C0BA 2PFUA 4LC9B 5M1OA 5EOYA 4JN4A 3LDNA 5FPMA 4DQ8A 1MWKA 5AFUA 3HSCA 2RHKA 4U7BA 3OHRA 5LJVA 2JWLA 3AAQA 2NRZA 5AQOA 4CI6A 1X3MA 3CJ9A 4WFNL 1OKJA 3ZYYX 5BREA 1P90A 3DAWA 4IWVA 1T3VA 4CZHA 1BO5O 5GAGP 5TKYA 2VGNA 1NGIA 2P9PB 2VGMA 4PL8A 3WQTA 3OA9A 3W0LA 4A5BA 2FSJA 1RFQA 3P38A 3L4IA 3QBWA 4FWMA 5JVHL 3U9ZA 3ZETA 2FSKA 2VYPA 1Q7YO 2FLOA 3S41A 3DXMB 3UE5A 3TU5A 3ULEB 3CERA 4NLBA 1JCFA 4FWOA 5BPMA 5AQHA 4BRQA 3RSEB 5AQYA 3HOSA 3U4LA 5JVGL 1YJ9N 2A41A 4H0XB 4JKGB 2GWKA 3KHYA 4H0PA 2OTLN 1GLDG 1GLAG 2EWSA 3SJHA 2GX9A 3CCVN 1KC8O 2P9KB 2QWLA 3SBTA 4RCHA 3E1YA 3H1QA 3K9JA 3TSUA 3WQUA 3AY9A 4YDUA 3O6WA 1Q18A 1SZ2A 4IO8A 3SK3A 4JKBA 3T7ZA 3CCQN 2P9LA 2QWOA 4BC5A 2YCHA 1HX1A 4AM6A 5KPRA 3VPZA 3HZ6A 2ASOA 4HWIA 4IJAA 3VEOA 4FVUA 1T6DA 5AQVA 3TTDA 4BVOA 4FWPA 4JKHA 4KH4A 3M3ZA 3WXIA 2P9PA 3P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKS A;  2HF3 A;  5AQL A;  4H5W A;  2E20 A;  1GLC G;  3ENH A;  1KAZ A;  1EQY A;  3CJA A;  3FLC O;  3WT0 A;  2HF4 A;  3L6Q A;  3WXL A;  2F9T A;  1CZA N;  2YHY A;  1T6C A;  2YJE A;  3O5B A;  1GLE G;  3VEX A;  1MDU B;  5FPD A;  3LM2 A;  2QW9 A;  3A5M C;  2NRH A;  2Q0U A;  3CJ7 A;  4BRH A;  3EO3 A;  2Q1N A;  1BOT O;  5AQN A;  3ENO A;  4QS7 A;  1XQS C;  3ID8 A;  4WQ4 A;  4PL7 A;  4BRN A;  4XH4 A;  2A6A A;  2WUS A;  2QWP A;  1YVN A;  4CBU A;  3GBT A;  3JS6 A;  4CZG A;  3I8B A;  5KQ8 A;  4XH1 A;  4B9Q A;  2ITM A;  5B8H A;  3QIC A;  1TYQ B;  2Q97 A;  2A40 A;  2V7Y A;  3HBT A;  3VF6 A;  5LY3 A;  4KBO A;  4BG9 A;  3D2E B;  1V4S A;  1NGD A;  3W3D A;  1HUX A;  2P9K A;  3DXM A;  4BRK A;  5BN9 A;  1HLU A;  2IVN A;  2P9U B;  4B1Y B;  2FSN A;  3A5L C;  1NBW A;  1P8Z A;  4JHD B;  4FL9 A;  1QHA A;  4B1Z A;  3O1W A;  1U2V A;  2CGJ A;  4A2B A;  3FGU A;  1DEJ A;  3FZH A;  1NGH A;  3L0Q A;  5BPN A;  5AFU H;  1NM1 A;  4PKI A;  5AQR A;  2Q36 A;  3MN7 A;  1NWK A;  3VET A;  2GTD A;  3MCP A;  1JCG A;  5CE3 A;  4ISF A;  1BUP A;  2FF3 B;  1NGF A;  4K25 A;  4WQ4 C;  2IVO A;  3A0I X;  4BC4 A;  5AQJ A;  3VEZ A;  1XUP O;  4EFH A;  1DKG D;  1E4F T;  2QWM A;  3CQX A;  3MN5 A;  4BR2 A;  4MO4 A;  3GDQ A;  4M63 C;  3VF4 A;  4CD3 A;  2I7P A;  3CJB A;  2P9I B;  1NGG A;  4H0T B;  2BUP A;  4H5T A;  1XC3 A;  4BRF A;  4H03 B;  3WEE B;  4BGA A;  4IXC A;  4ISG A;  4BQZ A;  3CIP A;  1LOT B;  3SMP A;  2D0O A;  5BPL A;  4A61 A;  3GL1 A;  4BRA A;  4QS9 A;  2P9S B;  3G25 A;  4H0O A;  1KAY A;  2CGK A;  5BR9 A;  4H0Y B;  3BEX A;  2NLX A;  5AQW A;  4FPB A;  2ZWH A;  4RWT A;  4FWQ A;  3H3N O;  5F2R A;  3MN9 A;  2A5X A;  4H0V B;  1NMD A;  2PAV A;  3VEY A;  1YAG A;  5EXW A;  4FOE A;  1YUW A;  1ZC6 A;  3ZEU A;  4FO0 A;  3FZK A;  2H3G X;  5AQT A;  3VGM A;  4J8F A;  2QXL A;  3VGK A;  1QZ6 A;  3BF1 A;  3CET A;  2P9I A;  1J6Z A;  3EL2 A;  4CD1 A;  3ATU A;  2OAN A;  4BRE A;  1K8K B;  4BRD A;  4MLH A;  3HM8 A;  4CZM A;  4RTF D;  2QWQ A;  3LDQ A;  1S22 A;  2P9U A;  2P9S A;  1HKG A;  1S3X A;  5AQX A;  2UYT A;  2V51 B;  1RDW X;  3QFU A;  5KPT A;  3GE1 A;  5AZI A;  1K8K A;  4L3Q A;  2CH6 A;  3O4W A;  3CQY A;  3C7N B;  4FWL A;  4BRL A;  3QB0 A;  2ZGY A;  3DXK A;  2D4W A;  3UB5 A;  1NGA A;  4JD2 B;  1JCE A;  2YHW A;  1U6Z A;  3O80 A;  4FWS A;  1Z05 A;  4EIA A;  4GNI A;  4B1U B;  4BC2 A;  2YHX A;  2QM1 A;  2GWJ A;  2D0P A;  3QDK A;  4JHD A;  2E1Y A;  3UKU B;  2FXU A;  3LDL A;  3DWL A;  3H46 O;  2E2Q A;  4JD2 A;  4DHY A;  4WYB A;  4B1V A;  2P9N A;  1ATS A;  1HKC A;  3A5N C;  5KPZ A;  1T44 A;  3UKU A;  2Q31 A;  4M7Y A;  3QFP A;  3AAR A;  3IDH A;  1NLV A;  4K42 A;  3VEV A;  2I7N A;  5ADX H;  3FZF A;  2HOE A;  5BRD A;  4BR7 A;  3VGL A;  3J8A A;  3H3O B;  2AA4 A;  1MWM A;  4BRG A;  3AAP A;  3R6M A;  1TYQ A;  3DXK B;  5AZJ B;  2FF6 A;  1WOQ A;  4H5V A;  1U2V B;  3MN6 A;  1BWF O;  4NB4 A;  4BVP A;  5ELZ A;  1KAX A;  1QQM A;  4IZ9 A;  3ZX3 A;  1G99 A;  2A3Z A;  4O8K A;  3LL3 A;  3VES A;  2P9N B;  3EN9 A;  2VWB A;  2F9W A;  3SMS A;  5JLH A;  1HKB A;  2AP1 A;  4YDU C;  3O8M A;  4GY2 B;  5FPE A;  4M7X A;  3UKR B;  1MA9 B;  3D2F A;  4FOI A;  2HMP A;  3WEE A;  2KHO A;  2ZGZ A;  3CJC A;  1QZ5 A;  2V52 B;  4CZK A;  5AQS A;  5EY4 A;  2YI1 A;  5LJW A;  4CJ7 A;  4BQL A;  3D2F B;  5AQZ A;  3FZM A;  3RSE A;  3M6G A;  2BTF A;  3VF2 A;  1SAZ A;  1BDG A;  2PBD A;  3BUZ B;  4K41 A;  4BG8 A;  5FPN A;  5AZJ A;  1SQK A;  3U9D A;  1ZXO A;  3HI0 A;  4EAH D;  5BN8 A;  4H5R A;  3HTV A;  1GLJ O;  2ZF5 O;  4CBW A;  5BRF A;  1BA1 A;  4B1W B;  4XEI A;  4C23 A;  3IUC A;  1C0G A;  1ATR A;  1ZBS A;  5AQP A;  5AQG A;  1GLF O;  3CI5 A;  1HJO A;  3LDO A;  3TPQ A;  4PKG A;  4BRC A;  4EHT A;  4B1X B;  3A8Y A;  3WUH A;  1NGB A;  4I6M B;  4FWR A;  3O08 A;  4FWK A;  4WQ5 A;  4A62 A;  4F9O A;  3IFR A;  3QBX A;  5F1X A;  5BRH A;  5E26 A;  4HTL A;  4FWN A;  1YXQ A;  3JXU A;  3D2E A;  1V4T A;  3FZL A;  1Z6R A;  1GLB G;  3VER A;  3VEN A;  3MK6 A;  4CZF A;  1KXP A;  4DB3 A;  5AQQ A;  4BR9 A;  3ZX2 A;  1C0F A;  1BU6 O;  4MLE A;  4BR5 A;  2J4R A;  2IVP A;  1ATN A;  2QWN A;  5AQF A;  5AQI A;  1BG3 A;  2P9L B;  5E84 A;  5AZI B;  4BRO A;  4E1J A;  3LDP A;  1D4X A;  4BRI A;  3BP8 A;  4MO5 A;  3VEW A;  3ULE A;  1R59 O;  3C7N A;  2VCP A;  3UKR A;  4JNE A;  4WQ5 C;  4AM7 A;  3MDQ A;  4JAX A;  2E2P A;  1ESV A;  2YJF A;  3O1B A;  4IJN A;  4CZI A;  4Z94 A;  3F9M A;  5AQM A;  1NGJ A;  3LM9 A;  5KQD A;  4CBX A;  1IG8 A;  3KVG A;  3GG4 A;  5EX5 A;  4DCH A;  3M1F A;  4A2A A;  1H1V A;  5EVZ A;  2DPN A;  3SLC A;  3ATV A;  2IIR A;  1GLL O;  2Q0R A;  2Q2R A;  1TUY A;  4BR0 A;  5F0X A;  1X3N A;  4NO7 A;  4BRP A;  2E8A A;  3I33 A;  3H45 C;  2GEL A;  3CHW A;  4BGB A;  4Y0W A;  2GUP A;  3KZB A;  2A42 A;  4ISE A;  4BR4 A;  4EHU A;  5ADX A;  1QQO A;  3WXJ A;  4BRM A;  5JIC A;  5JMV A;  3H6E A;  1HPM A;  1IJJ A;  1BA0 A;  1DGK N;  2E88 A;  3H1V X;  5I9E B;  2NZT A;  2E1Z A;  3B8A X;  1X9J A;  2GEM A;  2W40 A;  4XH5 A;  3BF3 A;  4O5F A;  3GOI A;  3U8X A;  2CGL A;  4H5N A;  1LCU A;  5JLF A;  4FPA A;  2E2N A;  3ZEU B;  4CZE A;  1WUA A;  4CZJ A;  3FR0 A;  3A5O C;  3CJ1 A;  4FSV A;  4PKH A;  3R9P A;  4K43 A;  1E4G T;  2CH5 A;  3EKU A;  3WXK A;  5AQU A;  3R8E A;  3VOV A;  4CZL A;  3ZX0 A;  2W41 A;  4QS8 A;  3ZET B;  5AR0 A;  3FE1 A;  1TUU A;  4BC3 A;  2V7Z A;  1QQN A;  2ASP A;  2E2O A;  1NGE A;  1NGC A;  3QML A;  3D7E O;  2ASM A;  4I6M A;  1Y64 A;  1RGI A;  3MMV A;  3DJC A;  3FFK B;  5AQK A;  2QWR A;  3IMX A;  2D1K A;  3EZW A;  3C0B A;  4LC9 B;  5EOY A;  4JN4 A;  3LDN A;  5FPM A;  4DQ8 A;  1MWK A;  5AFU A;  3HSC A;  3OHR A;  5LJV A;  3AAQ A;  5AQO A;  4CI6 A;  1X3M A;  3CJ9 A;  1OKJ A;  5BRE A;  3DAW A;  4IWV A;  4CZH A;  1BO5 O;  5TKY A;  1NGI A;  2P9P B;  4PL8 A;  3WQT A;  3W0L A;  2FSJ A;  1RFQ A;  3L4I A;  3QBW A;  4FWM A;  3U9Z A;  3ZET A;  2FSK A;  2VYP A;  2FLO A;  3S41 A;  3DXM B;  3UE5 A;  3TU5 A;  3ULE B;  3CER A;  1JCF A;  4FWO A;  5BPM A;  5AQH A;  4BRQ A;  3RSE B;  5AQY A;  3U4L A;  2A41 A;  4H0X B;  2GWK A;  3KHY A;  4H0P A;  1GLD G;  1GLA G;  2EWS A;  3SJH A;  2P9K B;  2QWL A;  4RCH A;  3H1Q A;  3WQU A;  3AY9 A;  4YDU A;  3O6W A;  1Q18 A;  1SZ2 A;  4IO8 A;  3SK3 A;  2P9L A;  2QWO A;  4BC5 A;  2YCH A;  1HX1 A;  4AM6 A;  5KPR A;  3VPZ A;  3HZ6 A;  2ASO A;  4HWI A;  4IJA A;  3VEO A;  1T6D A;  5AQV A;  4BVO A;  4FWP A;  3M3Z A;  3WXI A;  2P9P A;  3P4I A; 
#chains in the Genus database with same CATH topology
 3PIP L;  3AVB A;  1S1T A;  3OVN A;  3V9W A;  2HBJ A;  4H5W A;  2E20 A;  2Y1J A;  3QNN A;  2HF4 A;  3NE6 A;  4AIL C;  5GIN A;  2F9T A;  1CZA N;  2YHY A;  3CCJ N;  4O0J A;  3O5B A;  4ID5 A;  1GLE G;  3VEX A;  2XO7 A;  2OCE A;  2O8B A;  4C1N K;  1QSY A;  4BRH A;  2Q1N A;  2G8U A;  4JK7 A;  3ENO A;  4QS7 A;  4KPY A;  5KRS A;  3QEV A;  4PL7 A;  2NNW A;  1QTM A;  3ZSW A;  3D6R A;  2A6A A;  1NK5 A;  3GBT A;  3MED A;  4XH1 A;  4JKG A;  3OYE A;  2Q97 A;  2V7Y A;  3QER A;  4WF9 L;  3SUN A;  3HO1 A;  4IO9 L;  3DLG A;  1EWQ A;  1QHT A;  1C1A A;  4FW2 A;  2P9K A;  3O3F A;  4X65 K;  1VRU A;  4KH5 A;  3AO1 A;  2WFB A;  4JKE A;  4B1Y B;  2EHG A;  1TKZ A;  2FSN A;  2ZQB A;  4E3S A;  1P8Z A;  5D3G A;  1QHA A;  3SCX A;  4B1Z A;  4DTU A;  1CZ9 A;  3FGU A;  3FZH A;  1EX4 A;  1JL2 A;  3L0Q A;  5DM7 L;  3SQ2 A;  4B9T A;  5AFU H;  3QIN A;  4OPH A;  1YT3 A;  3THY A;  1TK0 A;  2X74 A;  1NWK A;  2GTD A;  3DLL L;  5CE3 A;  3RRG A;  4ISF A;  3K5N A;  1IH7 A;  3TTF A;  4WQ4 C;  5GAH P;  4YOU A;  2O8D B;  2QWM A;  3EZ5 A;  4XIU A;  3HST B;  4DQR A;  4Q5V A;  3CME N;  4GW6 A;  4ZTF A;  2P9I B;  3NFA A;  3HXM A;  1XC3 A;  3OYJ A;  2O8F A;  4ISG A;  4OJR A;  3CIP A;  1IBL K;  1LOT B;  1RTI A;  4KAZ A;  4A61 A;  4DV1 K;  1GOA A;  4ID1 A;  2UXC K;  4H0O A;  1KAY A;  2CGK A;  3C95 A;  5AJ3 K;  2VQE K;  1XNQ K;  4FPB A;  4C8N A;  3CD6 N;  4K8X A;  5FRM A;  3F2K A;  3ZSX A;  3ZLJ A;  3AV9 A;  4DQS A;  3H3N O;  5F2R A;  5TKW A;  3K5L A;  1XHZ A;  3THV A;  4GVE A;  4CW7 B;  1YAG A;  4FOE A;  2XY5 A;  4FO0 A;  3V9U A;  3N4P A;  2H3G X;  3KKS A;  5KI6 A;  3VGM A;  4CF2 A;  2QXL A;  1UWB A;  2VG7 A;  3ASM A;  3EL2 A;  3C65 A;  1JKH A;  4Z4E A;  4C8M A;  3L2Q A;  2OAN A;  5M1Q A;  4AQY K;  4LF6 K;  1D5A A;  1EKE A;  1U45 A;  3NF8 A;  1Q9X A;  3CCR N;  2P9U A;  1IKV A;  3PSF A;  2P9S A;  4K0K K;  1S3X A;  4ILJ A;  3O3H A;  2YNH A;  4RW8 A;  3K5M A;  4IFV A;  2CH6 A;  1SL0 A;  3O4W A;  2IAJ A;  1TK5 A;  1FJG K;  4FLV A;  3ZSO A;  4CEF A;  2ZGY A;  3C6A A;  3JSM A;  4RW9 A;  4JI7 K;  2GWJ A;  5C15 A;  2KZM A;  4N56 A;  4CHQ A;  2OPQ A;  3DWL A;  3H46 O;  1XC9 A;  1ITG A;  4B1V A;  1ATS A;  4KI6 A;  2B6A A;  3J81 O;  3A5N C;  5KPZ A;  3K0S A;  3RWU A;  3QFP A;  3IDH A;  4K42 A;  3VEV A;  4KTW A;  2P1J A;  1U4B A;  1BGX T;  4JKD A;  2UUB K;  1QS4 A;  1WSF A;  3H3O B;  4PQU A;  4R79 A;  1MWM A;  4BRG A;  2EX3 A;  4CF8 A;  3AAP A;  3AVF A;  3R6M A;  3MWT A;  1WSE A;  2GBZ A;  1WOQ A;  3VQP A;  1YJN N;  4CJQ A;  3MN6 A;  4NB4 A;  1VRT A;  1J53 A;  2G8H A;  3ZX3 A;  3SI6 A;  3KD1 E;  1ZBL A;  1TKD A;  1IBK K;  3V81 A;  2UUA K;  3OJU A;  3VQ6 A;  4DF8 A;  2NUB A;  4DR5 K;  3O8M A;  1C0U A;  4M7X A;  1MA9 B;  3D2F A;  2HMP A;  4HHT A;  4KHP K;  2ZGZ A;  4CEB A;  1J5E K;  3TAP A;  2V52 B;  5AQS A;  3PSI A;  5LJW A;  4CJ7 A;  4BY9 C;  1W7A A;  3D2F B;  3NMU A;  4KV8 A;  1UA1 A;  4F2S A;  4B08 A;  3J7Y P;  4B3S K;  1ASW A;  4H5R A;  3HTV A;  3KK3 A;  4FK2 A;  4LFB K;  5BRF A;  1VQO N;  1S6P A;  3IUC A;  1ZBS A;  1ATR A;  5AQP A;  1S72 N;  1FXX A;  4B3R K;  4LFA K;  1OH6 A;  4PKG A;  5A2Q O;  4BRC A;  4QAG A;  4M45 A;  3C6U A;  1VSJ A;  3O08 A;  4ILG B;  1HPZ A;  2BGG A;  4I2P A;  2RF2 A;  4CGF A;  1RBS A;  5BRH A;  2IOC A;  4HTL A;  1W2B M;  1KFS A;  1Z6R A;  4DFM A;  3CXC M;  4BWM A;  4I7F A;  1KXP A;  2KKZ A;  4B3M K;  4DTX A;  3AVH A;  3DRP A;  2QWN A;  5AQF A;  3P5J A;  1VQN N;  4BRO A;  4E1J A;  4YOY A;  4DS4 A;  4KHU A;  3LDP A;  2VWJ A;  1NK9 A;  3N4Q A;  4MO5 A;  3VEW A;  2HST A;  3M8P A;  3SAG A;  4BE1 A;  4WQ5 C;  4PHT X;  3OS0 A;  3KK7 A;  2HVH A;  4FCY A;  3DOK A;  4CZI A;  3F9M A;  5AQM A;  5KQD A;  2HMI A;  1IG8 A;  3KVG A;  4DCH A;  4KRF A;  1QE1 A;  5EVZ A;  3SLC A;  2D0A A;  1LWE A;  5CZ1 A;  2OPR A;  1TUY A;  3S9H A;  3MX5 A;  1XWL A;  3MEE A;  1SKR A;  4BRP A;  4CIG A;  4CJU A;  1RT2 A;  3O4Q A;  3CCE N;  3H45 C;  3O4N A;  3QEX A;  3CHW A;  4BE0 A;  4JI0 K;  3U6F A;  1HYZ A;  1SV5 A;  2O4I A;  3KZB A;  1VSD A;  4EHU A;  1QQO A;  3WXJ A;  4BRM A;  3PV8 A;  4CGG A;  2HHX A;  1DGK N;  3O9S A;  3H1V X;  4OVL A;  1KD1 O;  2NZT A;  3TTC A;  3KTQ A;  1I39 A;  1HJR A;  4O5F A;  4BDZ A;  3U8X A;  3UIQ A;  3NGZ A;  4FM1 A;  1NMN A;  3G71 N;  4DTN A;  4CZJ A;  3FR0 A;  3A5O C;  3AGR A;  5LMN K;  2VG5 A;  2O4G A;  3EKU A;  5AQU A;  4CZL A;  3ZX0 A;  3K58 A;  4QS8 A;  3DLH A;  3NH2 A;  3SV3 A;  2V7Z A;  4N76 A;  4RW6 A;  4FZZ A;  5C0Y A;  3TAN A;  2HBL A;  4M41 A;  1Y64 A;  3G4S N;  1HNZ K;  2D5R A;  1RDB A;  3MMV A;  3DJC A;  2QWR A;  3IMX A;  3O9U A;  4CFD A;  3LZJ A;  3C0B A;  4JN4 A;  4DR2 K;  4X64 K;  3HSC A;  2YNI A;  4FJG A;  2UXD K;  4CI6 A;  5FDL A;  3NF9 A;  5BRE A;  1P90 A;  4NYF A;  1JXB A;  2QXF A;  4FJ9 A;  2P9P B;  3OA9 A;  4I2Q A;  3W0L A;  4A5B A;  4Z4I A;  1IV0 A;  4HCC A;  3QBW A;  3EEQ A;  1WSJ A;  4FWM A;  2VG6 A;  3U9Z A;  3ZET A;  1HNW K;  2FLO A;  4DLG A;  4RW7 A;  4DFJ A;  4L8R B;  2OZS A;  5BPM A;  3RSE B;  1VK0 A;  3TAG A;  4JKG B;  3KHY A;  3LWL A;  4O44 A;  4CJT A;  1HQE A;  4DLE A;  5CYQ A;  2EWS A;  3IS9 A;  4E1M A;  2P9K B;  4F3T A;  3WQU A;  3AY9 A;  4FLX A;  1D8Y A;  2P9L A;  5KPR A;  4AM6 A;  3HZ6 A;  2ASO A;  4HVJ A;  3KLI A;  4BVO A;  4KHQ A;  3F73 A;  2W6L A;  3KIO A;  4CJK A;  2I5J A;  1T05 A;  3J7A P;  2P51 A;  1NJW A;  3ENH A;  1WB9 A;  4DR7 K;  2E4L A;  3E9L A;  4JKF A;  4Z4C A;  4B3O A;  1RTD A;  5FRN A;  4JI4 K;  3TAR A;  4OLA A;  2Q0U A;  1KVC A;  5HLF A;  1BOT O;  1VQL N;  1WLJ A;  3G10 A;  1YI2 N;  4FXD A;  3ID8 A;  3R3L A;  1IG9 A;  3EE8 A;  4WQ4 A;  2OYQ A;  2WUS A;  2O8C A;  1VQ4 N;  1YVN A;  5KQ8 A;  3DMJ A;  1HNX K;  4B9Q A;  2ITM A;  5B8H A;  3DLK A;  4CF1 A;  2A40 A;  3HBT A;  4KBO A;  4BG9 A;  4DKW A;  1NKC A;  1V4S A;  4JI2 K;  1NGD A;  3QIP A;  1HUX A;  4DSF A;  3DRS A;  4BRK A;  1RT6 A;  5BN9 A;  3P39 A;  1WN7 A;  3SNN A;  4CVN E;  1HLU A;  2IVN A;  2P9U B;  4FK0 A;  2XY6 A;  1RTJ A;  1X1P A;  2ZD1 A;  4AHU A;  3IRX A;  3O1W A;  3LWM A;  4FLY A;  1NOZ A;  1LAV A;  3HPH A;  4R5P A;  5AQR A;  4N5S A;  4G9Z A;  3MN7 A;  5J2M A;  1JCG A;  1KVA A;  3WNE A;  4K25 A;  3VQ8 A;  3A0I X;  3VEZ A;  1XUP O;  4EFH A;  3OYB A;  1DKG D;  3CQX A;  3NGI A;  3MN5 A;  1HNI A;  4BR2 A;  4E7K A;  3EE9 A;  1VQ5 N;  2F96 A;  2PYL A;  2I7P A;  3CJB A;  1N34 K;  4M3X A;  4A59 A;  2BUP A;  3OBW A;  4X62 K;  3ZSZ A;  1CLQ A;  4H5T A;  4H03 B;  4BGA A;  3M8Q A;  1XI1 A;  5JS1 A;  4CJW A;  5CR4 A;  1JXE A;  4HTU A;  3SMP A;  3PIO L;  2P5G A;  3AVN A;  4QS9 A;  3SJJ A;  2P9S B;  4OGC A;  2LSN A;  2ZWH A;  4RWT A;  1QVF M;  1TV6 A;  4J2B A;  3CF5 L;  4NCA A;  4FWQ A;  4EZ9 A;  5DM6 L;  1YVU A;  2Q3S A;  1NMD A;  3VEY A;  3B6O A;  4KHW A;  4ELV A;  2QI2 A;  1ZC6 A;  2NRW A;  3IG1 A;  4JLH A;  4DTO A;  1A5X A;  2RE2 A;  5AQT A;  3OS1 A;  2QK9 A;  1QZ6 A;  4YNQ A;  1XMQ K;  1KRP A;  1ZYQ A;  4BRE A;  3OYD A;  4DV2 K;  4CZM A;  4RTF D;  4ELU A;  1S22 A;  2HBM A;  2A1S A;  3F5T A;  3QFU A;  4FYD A;  3BDP A;  5AZI A;  1K8K A;  3L3U A;  2JLE A;  3E9P A;  3TWH A;  3RMA A;  2P5O A;  3CQY A;  3MXI A;  4FWL A;  1RTH A;  4CGI A;  3NGY A;  3KLH A;  1KSP A;  3DXK A;  3AVM A;  1L3S A;  2YHW A;  3L2W A;  4EIA A;  4GNI A;  2FBV A;  3AA2 A;  1NK4 A;  5J1E A;  4Z4G A;  3PX4 A;  2E1Y A;  3UKU B;  2E6L A;  4JD2 A;  3SBG A;  4G1Q A;  4WYB A;  3WNF A;  2P9N A;  1VQK N;  3IAY A;  2G8V A;  4H4O A;  3ZT0 A;  3THY B;  3AAR A;  4MQ3 A;  2I7N A;  5ADX H;  2W6K A;  3LAM A;  5C12 A;  4M3T A;  5BRD A;  5C2D A;  3J8A A;  1LAW A;  1NKE A;  3MWP A;  3HVR A;  1HRH A;  4E7J A;  4JI8 K;  1TYQ A;  5J2N A;  4W5N A;  5AZJ B;  2FF6 A;  4C1N I;  4H5V A;  1BWF O;  4CCH A;  1ASV A;  1KAX A;  1YIT N;  1QQM A;  3K9K A;  3R1X A;  1G99 A;  1X9W A;  5FLX O;  2DFE A;  2P9N B;  2HNZ A;  2F9W A;  4YDU C;  3ZT2 A;  4M3Y A;  1VSL A;  3UKR B;  4FOI A;  4YOR A;  2KHO A;  1QZ5 A;  4BQL A;  2HNY A;  2DY4 A;  5AQZ A;  2Z1I A;  3WXM B;  3K2P A;  4I9Q A;  3RSE A;  3M6G A;  3CC2 N;  1N36 K;  4CE9 A;  1SAZ A;  4O8U A;  1KTQ A;  5FPN A;  4DFK A;  5AZJ A;  1SQK A;  4DFP A;  3THX A;  5BN8 A;  3LPT A;  4OPK A;  1GLJ O;  2WBN A;  4CJL A;  4XEI A;  3G0Z A;  2BAN A;  4DU4 A;  2QKK A;  1BL3 A;  5AQG A;  1GLF O;  1VSF A;  2YKN A;  3CI5 A;  4CJV A;  3TPQ A;  1KLM A;  3O9Q A;  2XY8 A;  2BH1 A;  2Y1I A;  4OKE A;  3L2U A;  2XY7 A;  5DK5 A;  3P1G A;  4B1X B;  3Q7B A;  3WUH A;  1NGB A;  4I6M B;  4FWR A;  4DUZ K;  1DTQ A;  1YIJ N;  4WQ5 A;  3CCU N;  4A62 A;  3L3V A;  5E26 A;  5GAE P;  3JXU A;  1VSI A;  3VER A;  3LP1 A;  2AJQ A;  3MK6 A;  3NAE A;  1VQ8 N;  1N33 K;  5GIP A;  1Z26 A;  4KKO A;  4CZF A;  4H8K A;  4BR9 A;  3RRH A;  1C0F A;  1VQM N;  4KHY A;  2ITG A;  3DI6 A;  4AHS A;  2JWK A;  2Z1J A;  4IFY A;  3CFP A;  2J4R A;  5C2F A;  2IVP A;  1BCO A;  1GOB A;  3NH1 A;  3V1R A;  4IG3 A;  3L2V A;  2IC3 A;  3QEI A;  5AZI B;  3MXJ A;  2G8I A;  2IS3 A;  4O0I A;  5CHI A;  4BRI A;  1QSS A;  3BY5 A;  3BP8 A;  1BHL A;  2ATQ A;  3THW A;  2YKM A;  4IG0 A;  1R59 O;  4KI4 A;  3K57 A;  4CEC A;  4JNE A;  1IKY A;  1NJY A;  3SQ1 A;  1B9D A;  1VSH A;  5CY4 A;  4FJX A;  1REV A;  4B9N A;  1ESV A;  3O1B A;  4IJN A;  3OYM A;  1TVR A;  3AO5 A;  3GG4 A;  4DR1 K;  4JI6 K;  3QO9 A;  1HYV A;  2X6S A;  1F21 A;  4OLB A;  2DPN A;  3ATV A;  2IIR A;  4DV6 K;  2Q2R A;  3E01 A;  1J5O A;  1X3N A;  1M90 O;  3LP0 A;  2W42 A;  1BIZ A;  1RT3 A;  3I33 A;  2GEL A;  4Y0W A;  2GUP A;  2G8K A;  1BIS A;  1YF5 L;  4ISE A;  1RBR A;  1N32 K;  3DLB A;  4BR4 A;  5JIC A;  1U49 A;  5M1P A;  1OH7 A;  2HW3 A;  2E88 A;  4U67 L;  3DLR A;  3B8A X;  4B9M A;  4BAC A;  3TI0 A;  3AO4 A;  2CGL A;  1LCU A;  2E2N A;  4CZE A;  3TAB A;  1W9H A;  1WUA A;  2HHT A;  3DYA A;  5HRR A;  1TGO A;  1M1K O;  4F2R A;  1Q8I A;  4BC3 A;  4OO1 J;  3QES A;  3B6P A;  1L3U A;  2OZM A;  2ASP A;  1NGE A;  1NGC A;  3LP3 A;  2ASM A;  1BQM A;  3FFK B;  3ENB A;  2BE2 A;  2D1K A;  2PFU A;  5M1O A;  5EOY A;  3A2F A;  4FM2 A;  5AFU A;  4Y1D A;  2RHK A;  4U7B A;  5LJV A;  4M3Z A;  2NRZ A;  4WFN L;  3DOL A;  3OYG A;  2X78 A;  1BO5 O;  5GAG P;  5TKY A;  4K8Z A;  2VGN A;  1NGI A;  3HVT A;  2VGM A;  4PL8 A;  3VQ7 A;  3T3F A;  1TL3 A;  3P38 A;  1D9F A;  5DMR A;  2VYP A;  3JAM O;  3UE5 A;  1JCF A;  4FWO A;  1J54 A;  4BRQ A;  3OYL A;  5AQY A;  3MEG A;  5HRP A;  2A41 A;  4H0X B;  4CJP A;  2KTQ A;  4W5R A;  2HHV A;  4H0P A;  1GLA G;  3SJH A;  3AVL A;  1KC8 O;  1NK7 A;  1LWF A;  4O4G A;  1NNE A;  3CCQ N;  1SZ2 A;  4W5Q A;  1LW2 A;  4HWI A;  3VEO A;  1FW6 A;  2FBT A;  1NU0 A;  1VSK A;  1CZB A;  4B8A B;  3TAQ A;  2YHB A;  3WXI A;  3P4I A;  1C0T A;  1GLC G;  4DSJ A;  2HND A;  3CJA A;  3FLC O;  3P31 A;  4CJS A;  3U3Y A;  3L6Q A;  3WXL A;  4Z4H A;  4E0D A;  1T6C A;  3LP2 A;  4DQI A;  5HOO A;  3NBP A;  4CEE A;  3ZSQ A;  4IKF A;  5FPD A;  5C24 A;  4CF9 A;  4JV5 K;  2QW9 A;  3A5M C;  2NRH A;  2B4J A;  3CJ7 A;  3V1O A;  3EO3 A;  4CK2 A;  4CEO A;  5AQN A;  4XH4 A;  2KQ2 A;  2QWP A;  3KKR A;  4J2A A;  3CYM A;  3I8B A;  4CZG A;  4FVM A;  1Y97 A;  3S3O A;  4IEE A;  3MEC A;  1Z25 A;  3QIC A;  5KTQ A;  5LY3 A;  1JLA A;  3W3D A;  1VQ9 N;  4GKJ K;  3S3M A;  1OH5 A;  2FBY A;  3DXM A;  2HVI A;  4MDA A;  4FJ5 A;  1XNR K;  4IOX A;  2HHW A;  4Z0U A;  3SAH A;  3A5L C;  2HB5 A;  1A5W A;  1UA0 A;  2A1R A;  3HK2 A;  3VQC A;  1U2V A;  1VSE A;  4OGE A;  1NM1 A;  4PKI A;  4C8K A;  4EP4 A;  2Q36 A;  1RDD A;  3VET A;  3HM9 A;  3MCP A;  4PA1 A;  1EXQ A;  4WCE L;  1K73 O;  4ILH A;  1NGF A;  5AQJ A;  3VTH A;  3D0P A;  3NCI A;  1LW0 A;  3AVA A;  3TAM A;  1U47 A;  3MXM A;  5SWM A;  3GDQ A;  4BWJ A;  4M63 C;  4CGJ A;  3VF4 A;  2UXB K;  1DTT A;  3T19 A;  1NG9 A;  2KFN A;  2QEX N;  1NGG A;  4H0T B;  3L4Q A;  1GOC A;  3CPE A;  2PY5 A;  1Q82 O;  4IXC A;  1FKP A;  2D0O A;  3BZK A;  3GL1 A;  4BRA A;  1NJI O;  3T1H K;  3G25 A;  5BR9 A;  4CJE A;  4H0Y B;  4YOW A;  4JYA K;  3ZCM A;  4GV3 A;  3PUF A;  1ZBU A;  4FZX C;  2QTD A;  3U3G A;  2QA4 N;  4LF7 K;  1D9D A;  1BQN A;  2Z1H A;  3I0R A;  1I94 K;  2PAV A;  1FKO A;  1YUW A;  3ZEU A;  1HQU A;  1WSG A;  3CET A;  2P9I A;  1J6Z A;  3HYF A;  3VQQ A;  1ASU A;  1DLO A;  4CD1 A;  3ATU A;  4KTZ A;  1X9M A;  2XHB A;  3CPW M;  1C0M A;  4LD0 A;  4GV9 A;  3LDQ A;  3HPG A;  4W5O A;  1ILY A;  2UYT A;  2ZJP L;  1RDW X;  3HL8 A;  4FJK A;  1ZBH A;  2Z1G A;  1C1C A;  5HRO A;  3TR8 A;  3HP6 A;  2F8T A;  3AVK A;  3VA3 A;  3THX B;  1WSI A;  4LSL A;  1N8R O;  4YOT A;  3C7N B;  4BRL A;  3QB0 A;  1S5J A;  3PO5 A;  3T1A A;  2D4W A;  4JD2 B;  1TAQ A;  4HUF A;  1U6Z A;  1K9M O;  3O80 A;  4FWS A;  1Z05 A;  4B1U B;  1RT5 A;  2YHX A;  2QM1 A;  4OPJ A;  3VQE A;  4H4M A;  3QDK A;  2WOM A;  1XHX A;  2FXU A;  3V6D A;  3NVK A;  2E2Q A;  1YJW N;  4AF1 A;  2KW4 A;  4CHP A;  1EO1 A;  1HKC A;  1T44 A;  3UKU A;  2Q31 A;  4A57 A;  1JLQ A;  1NLV A;  1OVQ A;  3FZF A;  5MLC Q;  3ZT1 A;  2HOE A;  3VN5 A;  4BR7 A;  2ZJR L;  3OTO K;  4FLW A;  3CCM N;  3NH0 A;  3HOT A;  2AA4 A;  3ISN C;  3AVJ A;  4DG1 A;  1TL1 A;  4NXN K;  1UAX A;  4FJM A;  3C94 A;  5ELZ A;  3MCA B;  4KB0 A;  4IZ9 A;  2A3Z A;  4O8K A;  4CJ4 A;  3EN9 A;  2VWB A;  3DM2 A;  3J80 O;  3OYN A;  3V9S A;  5JLH A;  4B9S A;  1HKB A;  2AP1 A;  4GY2 B;  4CFA A;  5FPE A;  3KWI A;  4DSL A;  4Z4F A;  1JJ2 M;  4CFC A;  1HNV A;  3IKM A;  3ZT3 A;  1KLN A;  3CJC A;  3TSQ A;  2FBX A;  2YI1 A;  1KFD A;  3KLF A;  4A5A A;  3FZM A;  1R0A A;  4FLZ A;  3T69 A;  1BDG A;  4TSX A;  1SS6 A;  3OW2 M;  3U9D A;  1ZXO A;  4DTP A;  3HI0 A;  1RCH A;  3OYH A;  4JS4 A;  4GV6 A;  4OX9 K;  2ZF5 O;  3LZI A;  3NVM A;  4Q0B A;  4C23 A;  4FK4 A;  4FZY A;  4KH6 A;  4MDB A;  4RW4 A;  4DSK A;  2RPI A;  1IKW A;  3LAL A;  1UOC A;  2XRI A;  4EHT A;  3KK2 A;  1QQC A;  3KK1 A;  4WE1 A;  1S6Q A;  4GMJ B;  3QEP A;  3OJS A;  3VQD A;  1JLB A;  3AO2 A;  4F9O A;  5LL6 Z;  2RKI A;  5F1X A;  3OYF A;  3M8S A;  1WAJ A;  1SKS A;  1O1W A;  4FWN A;  1YXQ A;  2YV0 X;  3D2E A;  1V4T A;  3FZL A;  4DV5 K;  1GLB G;  5HRN A;  2ZE2 A;  3SPY A;  5E41 A;  2O8E B;  2WTU A;  1NJX A;  4KFB A;  3HJF A;  3VTI A;  4DB3 A;  3OYI A;  1LV5 A;  3E66 A;  1BU6 O;  4LFC K;  3THW B;  1U48 A;  4BR5 A;  3ZSY A;  2DFF A;  1ATN A;  4PUO A;  1BG3 A;  2P9L B;  4B3T K;  1Q86 O;  1RDU A;  3AVG A;  2O8D A;  4DSE A;  4BDY A;  3HT3 A;  5HP1 A;  3ULE A;  3C7N A;  1ZBI A;  2O8B B;  3M5R A;  4NCB A;  2VCP A;  4GKK K;  4FJN A;  5CYM A;  1S9E A;  3OYA A;  4AM7 A;  3AO3 A;  3T1Y K;  3RR7 A;  2G8F A;  3MDQ A;  4JAX A;  4QCL A;  4WFA L;  3KJV A;  1NGJ A;  3S3N A;  3CMA N;  4C8O A;  4AHT A;  2B5J A;  4DMN A;  2O8C B;  3M1F A;  4A2A A;  2Q0R A;  4X66 K;  4BDP A;  4BR0 A;  5F0X A;  3CM5 A;  3L8B A;  2WON A;  2E8A A;  1S1V A;  2YHA A;  3CM6 A;  3WNG A;  2JGU A;  4NXM K;  3ZSR A;  5JMV A;  2YX6 A;  1HPM A;  1IJJ A;  1BA0 A;  5IWA K;  1RT1 A;  1Q81 O;  1NK0 A;  3VQA A;  1T8E A;  1X9J A;  2GEM A;  1JLE A;  2W40 A;  4XH5 A;  3VMF B;  4B8C A;  5M1K A;  3EYZ A;  3BF3 A;  4CGH A;  1S9G A;  4H5N A;  4JI1 K;  4IDH A;  5JLF A;  2O8E A;  3CJ1 A;  4FSV A;  4PKH A;  3R9P A;  4K43 A;  1E4G T;  2R7Y A;  4JRQ A;  3ZET B;  5AR0 A;  3FE1 A;  1TUU A;  3O3G A;  2PZS A;  4FW1 A;  4CJ3 A;  1T03 A;  2KZZ A;  3PX6 A;  4ICL A;  1ZBF A;  1FK9 A;  1MU2 A;  4ZTJ A;  4FJ7 A;  4F4K A;  3QML A;  3D7E O;  4JKC A;  5BR8 K;  4DF4 A;  4YFU A;  1RGI A;  5AQK A;  4UY8 O;  1YTA A;  5GAD P;  3EZW A;  4O5B A;  2UUC K;  5KGX A;  4KHN A;  1RNH A;  1TKT A;  5FPM A;  4JRP A;  2E5L K;  4DQ8 A;  2X6N A;  2JWL A;  3AAQ A;  5AQO A;  1TKX A;  1JLF A;  3ZYY X;  2KFZ A;  3SYZ A;  1RBU A;  1G15 A;  3WQT A;  5C25 A;  2VQF K;  2FSJ A;  4KO0 A;  1L3T A;  4DQP A;  5JVH L;  1Q7Y O;  3S41 A;  3DXM B;  4CIF A;  3TU5 A;  3ITH A;  3ULE B;  4NLB A;  4ZHR A;  1RBT A;  2QKB A;  5J2P A;  1EET A;  5AQH A;  3SQ4 A;  1OH8 A;  3HOS A;  4CJR A;  1B92 A;  3RTV A;  1YJ9 N;  3QEW A;  4FJ8 A;  2ZM6 K;  1GLD G;  2VWK A;  4DU1 A;  2GX9 A;  2QWL A;  3SBT A;  4RCH A;  3E1Y A;  3H1Q A;  4CHY A;  3TSU A;  2ZJQ L;  4Y1C A;  3OY9 A;  4JKB A;  2QWO A;  4BC5 A;  4DTS A;  2YCH A;  1HX1 A;  4FVU A;  1JL1 A;  3VPZ A;  1T6D A;  4CK1 A;  5AQV A;  3TTD A;  5J2Q A;  2IGI A;  4JKH A;  3LM9 A;  2P9P A;  3ALY A;  1U04 A;  3EKS A;  2HF3 A;  5AQL A;  5I42 A;  3OYK A;  1IBM K;  4DTM A;  1KAZ A;  1EQY A;  3WT0 A;  2WC9 A;  2YJE A;  1LWC A;  4IDK A;  4JKA A;  1MDU B;  3ID6 A;  3LM2 A;  4FLU A;  3RVC A;  3MX2 A;  1RDC A;  2OA8 A;  2HBK A;  3PLA A;  4CJ5 A;  4E1N A;  2D0B A;  3TAE A;  4ELT A;  1XQS C;  4BRN A;  4CEZ A;  4CBU A;  1S1X A;  3JS6 A;  1L3V A;  2NRX A;  4W5T A;  1X9S A;  3LAN A;  4EZ6 A;  1TYQ B;  1NOY A;  1NJZ A;  3VF6 A;  5CZ2 A;  3D2E B;  3WNH A;  3C6T A;  4MFB A;  3SUP A;  2BDP A;  1NBW A;  3AA4 A;  4JHD B;  4FL9 A;  3VA0 A;  3DLE A;  4DU3 A;  1WBB A;  2CGJ A;  4A2B A;  3M8R A;  1DEJ A;  1NGH A;  5BPN A;  4AHC A;  3NHG A;  1O13 A;  3SV4 A;  1HYS A;  2YNG A;  4JS5 A;  3H08 A;  4KB1 A;  1BUP A;  2FF3 B;  2IVO A;  4BC4 A;  5HRS A;  4FM0 A;  3D45 A;  3PO4 A;  1E4F T;  4DS5 A;  3ZSV A;  4MO4 A;  4FLT A;  4OPA A;  4DV0 K;  1W97 L;  5M1F A;  4JI5 K;  4CD3 A;  3CQ8 A;  4O55 A;  1CXU A;  5H1S Q;  4LSN A;  3VQ5 A;  4BRF A;  3WEE B;  4BQZ A;  3QIO A;  3I8D A;  2DTU A;  1SL2 A;  5BPL A;  4IBN A;  3V4I A;  1BI4 B;  1WSH A;  4QOZ B;  4AHV A;  3BEX A;  2NLX A;  3NF7 A;  5EU7 A;  1N6Q A;  5AQW A;  2HHU A;  1NK8 A;  3P83 D;  2YNF A;  3MN9 A;  1S1U A;  2A5X A;  4H0V B;  4JI3 K;  5EXW A;  4DR3 K;  5HL7 L;  3AVI A;  3ULD A;  1KVB A;  3FZK A;  4J8F A;  1EP4 A;  1WBD A;  3VGK A;  4AH9 A;  4E7I A;  1L5U A;  1VQ6 N;  3BF1 A;  2HHH K;  4YOV A;  1JLC A;  4YHH K;  4CHN A;  1K8K B;  2NRV A;  4BRD A;  4MLH A;  3HM8 A;  3O9R A;  2QWQ A;  2DFH A;  4GVM A;  4M3R A;  5I3U A;  3KWG A;  1HKG A;  1DT9 A;  5AQX A;  3RMB A;  2V51 B;  4CED A;  3GE1 A;  5KPT A;  3CC4 N;  4NCG A;  4L3Q A;  5GIO A;  4AHR A;  4LF9 K;  1NKB A;  4LH5 A;  4E89 A;  1YHQ N;  4CJF A;  3UB5 A;  1NGA A;  1JCE A;  4LF8 K;  4PY5 A;  2NRT A;  4BC2 A;  2F4V K;  3CCS N;  2D0P A;  4JHD A;  3RMC A;  3LDL A;  4DHY A;  3PX0 A;  3HPO A;  4YOX A;  3LDS A;  4EP5 A;  2KLA A;  4KHS A;  4M7Y A;  4HUG A;  1CXQ A;  4IOC L;  1RT7 A;  4FJL A;  1VHX A;  1K8A O;  4LY7 A;  3O9T A;  3LAK A;  3VGL A;  3TAF A;  2G8W A;  3KLG A;  3CC7 N;  4FJJ A;  3SQ0 A;  3K59 A;  1E3M A;  3DXK B;  4F8R A;  3AVC A;  2HHQ A;  3PY8 A;  1U2V B;  1B9F A;  4CEA A;  4BVP A;  2FC0 A;  4LF4 K;  3QLH A;  1TAU A;  4HCB A;  3TSP A;  1WAF A;  4M3U A;  3LL3 A;  3VES A;  4M3W A;  3CFO A;  3SMS A;  3NF6 A;  1KCF A;  4CHZ A;  4DTR A;  3WEE A;  2NRR A;  4IFE A;  2F7T A;  1I3A A;  4CZK A;  5EY4 A;  4DSI A;  5M1N A;  2ETJ A;  2BTF A;  4CES A;  3VF2 A;  2O8F B;  3BGR A;  1VQP N;  2PBD A;  3BUZ B;  4K41 A;  4M42 A;  4BG8 A;  1OVY A;  3MAQ A;  3HRG A;  4JEP A;  4F3O A;  4EAH D;  2D0C A;  1IO2 A;  4CBW A;  1BA1 A;  3BZC A;  4B1W B;  4DUY K;  2UU9 K;  1C0G A;  3Q7C A;  3QET A;  1HJO A;  3LDO A;  3NDK A;  4LF5 K;  3AGK A;  1RBV A;  3A8Y A;  4LH4 A;  4BE2 A;  1HMV A;  4FWK A;  5C10 A;  4IEI A;  3IFR A;  3QBX A;  4DV7 K;  4NLC A;  1JLG A;  1VAZ A;  3VEN A;  5AQQ A;  3ZX2 A;  1BI4 A;  4MLE A;  1S1W A;  3E9O A;  1QSL A;  1EWR A;  3KD5 E;  3VQ4 A;  5AQI A;  5T7B A;  1TK8 A;  3SAF A;  5E84 A;  3KLE A;  4N41 A;  3V9X A;  1C6V A;  4CGD A;  1D4X A;  4FJH A;  5C42 A;  4DR6 K;  3EY1 A;  2PYJ A;  4J2E A;  4CHO A;  4N47 A;  3AA5 X;  4YY3 K;  1A5V A;  3UKR A;  3F9K A;  4JK9 A;  3V9Z A;  1VQ7 N;  5KRT A;  4B9L A;  3SUO A;  4FJI A;  4B9U A;  2E2P A;  2YJF A;  4Z94 A;  4V19 S;  1C1B A;  4DTJ A;  3L2R A;  4CBX A;  4RG8 A;  3SUQ A;  1QVG M;  5EX5 A;  3OS2 A;  3G6E N;  4NYN A;  4PWD A;  4DQQ A;  2OPS A;  3SPZ A;  1H1V A;  4KRE A;  3ZT4 A;  1GLL O;  1RT4 A;  4WFB L;  3I56 N;  4NO7 A;  4OKK A;  3JYT A;  5K14 A;  4BGB A;  1SKW A;  4OKJ A;  2A42 A;  3LPU A;  4KTQ A;  4C8L A;  2OPP A;  5ADX A;  3VQB A;  3H6E A;  3VQ9 A;  5I9E B;  3DRR A;  1IKX A;  4DV3 K;  2E1Z A;  2RN2 A;  3OBY A;  5LMU K;  1N5Y A;  5IT9 O;  3OYC A;  4E7H A;  1W0H A;  3GOI A;  4IOA L;  2OTJ N;  4CFB A;  2HHS A;  4FPA A;  5JS2 A;  3QNO A;  4CK3 A;  3V1Q A;  2IDO A;  3FFI A;  3ZEU B;  4CEQ A;  2E6M A;  1NK6 A;  2CH5 A;  3WXK A;  1SL1 A;  3R8E A;  3VOV A;  2W41 A;  3CCL N;  3C6H A;  4E19 A;  1QQN A;  2E2O A;  3I55 N;  1HR0 K;  4J2D A;  3HP9 A;  4UQG A;  4I6M A;  5SZT A;  3J7Z O;  4HUE A;  4JK8 A;  1KQS M;  4B9V A;  1BCM A;  4LC9 B;  1K6Y A;  3LDN A;  1MWK A;  3OHR A;  4CIE A;  4DV4 K;  1X3M A;  3CJ9 A;  3CG7 A;  1OKJ A;  5KGW A;  3DAW A;  4IWV A;  1T3V A;  4CZH A;  1WNS A;  4E7L A;  1J9A A;  4DWI A;  1RFQ A;  1T7P A;  3L4I A;  1YTU A;  2FSK A;  4CF0 A;  3RR8 A;  3CER A;  4CER A;  2GV9 A;  5HBM A;  2F8S A;  1RIL A;  1SUQ A;  2GUI A;  3U4L A;  5JVG L;  1XMO K;  2GWK A;  3AA3 A;  2OTL N;  1Q9Y A;  3CCV N;  3SZ2 A;  3I0S A;  3K9J A;  4YDU A;  3O6W A;  1Q18 A;  4IO8 A;  3T7Z A;  3SK3 A;  3CFR A;  3RMD A;  5FRO A;  4IJA A;  1RDA A;  3K5O A;  4I9L A;  4FWP A;  1BIU A;  4KH4 A;  3M3Z A;  1VSM A;  4DR4 K; 
#chains in the Genus database with same CATH homology
 3PIP L;  3EKS A;  2HF3 A;  5AQL A;  2HBJ A;  4H5W A;  2E20 A;  1GLC G;  3ENH A;  1KAZ A;  1EQY A;  3CJA A;  3FLC O;  3P31 A;  3WT0 A;  2HF4 A;  2WC9 A;  3L6Q A;  5GIN A;  3WXL A;  2F9T A;  1CZA N;  2YHY A;  1T6C A;  3CCJ N;  2YJE A;  5HOO A;  3O5B A;  3E9L A;  4JKF A;  1GLE G;  4JKA A;  3VEX A;  1MDU B;  5FPD A;  3ID6 A;  2QW9 A;  3A5M C;  3LM2 A;  4C1N K;  2NRH A;  3RVC A;  2Q0U A;  3MX2 A;  3CJ7 A;  4BRH A;  2HBK A;  3EO3 A;  2Q1N A;  3PLA A;  1BOT O;  4JK7 A;  1VQL N;  5AQN A;  3ENO A;  4QS7 A;  1YI2 N;  1XQS C;  3ID8 A;  3R3L A;  3EE8 A;  4WQ4 A;  2NNW A;  4BRN A;  4PL7 A;  4XH4 A;  3D6R A;  2A6A A;  2WUS A;  2QWP A;  1VQ4 N;  1YVN A;  4CBU A;  3GBT A;  3JS6 A;  4CZG A;  2NRX A;  3I8B A;  5KQ8 A;  4XH1 A;  4B9Q A;  2ITM A;  4JKG A;  5B8H A;  4IEE A;  3QIC A;  1TYQ B;  2Q97 A;  2A40 A;  2V7Y A;  3HBT A;  4WF9 L;  3VF6 A;  5LY3 A;  4IO9 L;  4KBO A;  4BG9 A;  4DKW A;  3D2E B;  1V4S A;  1NGD A;  3W3D A;  1HUX A;  1VQ9 N;  2P9K A;  3DXM A;  4BRK A;  5BN9 A;  3P39 A;  4KH5 A;  4MDA A;  2WFB A;  4JKE A;  1HLU A;  2IVN A;  2P9U B;  4IOX A;  4B1Y B;  3SAH A;  2FSN A;  3A5L C;  1NBW A;  1P8Z A;  4JHD B;  4FL9 A;  1QHA A;  4B1Z A;  3O1W A;  1U2V A;  2CGJ A;  4A2B A;  3FGU A;  1DEJ A;  3FZH A;  1NGH A;  3L0Q A;  5BPN A;  5DM7 L;  5AFU H;  1NM1 A;  1O13 A;  4OPH A;  4PKI A;  5AQR A;  2Q36 A;  4G9Z A;  3MN7 A;  1NWK A;  3VET A;  2GTD A;  3MCP A;  1JCG A;  5CE3 A;  3DLL L;  4ISF A;  4WCE L;  1BUP A;  1K73 O;  2FF3 B;  1NGF A;  4ILH A;  4K25 A;  4WQ4 C;  3TTF A;  2IVO A;  3A0I X;  4BC4 A;  5AQJ A;  3VEZ A;  3VTH A;  1XUP O;  5GAH P;  4EFH A;  4YOU A;  1DKG D;  1E4F T;  2QWM A;  3CQX A;  3MN5 A;  4BR2 A;  4MO4 A;  3GDQ A;  4OPA A;  4M63 C;  3EE9 A;  3VF4 A;  1W97 L;  1VQ5 N;  5M1F A;  4CD3 A;  2QEX N;  2I7P A;  3CME N;  3CJB A;  2P9I B;  1NGG A;  4H0T B;  4A59 A;  2BUP A;  3L4Q A;  3OBW A;  5H1S Q;  3CPE A;  1XC3 A;  4H5T A;  4BRF A;  4H03 B;  3WEE B;  4BGA A;  4IXC A;  1Q82 O;  4ISG A;  4BQZ A;  3CIP A;  5CR4 A;  1LOT B;  3SMP A;  2D0O A;  3PIO L;  5BPL A;  4A61 A;  3GL1 A;  4BRA A;  1NJI O;  4QS9 A;  2P9S B;  3G25 A;  4H0O A;  1KAY A;  2CGK A;  5BR9 A;  4H0Y B;  4YOW A;  3BEX A;  2NLX A;  4GV3 A;  5AQW A;  4FPB A;  3CD6 N;  2ZWH A;  4RWT A;  1QVF M;  2QTD A;  3F2K A;  3CF5 L;  2QA4 N;  4FWQ A;  3H3N O;  5F2R A;  5TKW A;  3MN9 A;  5DM6 L;  2A5X A;  4H0V B;  1NMD A;  4GVE A;  2PAV A;  3VEY A;  1YAG A;  5EXW A;  5HL7 L;  4FOE A;  1YUW A;  2QI2 A;  1ZC6 A;  2NRW A;  4FO0 A;  3ZEU A;  3N4P A;  2RE2 A;  2H3G X;  3FZK A;  5AQT A;  4J8F A;  3VGM A;  2QXL A;  3VGK A;  1QZ6 A;  1VQ6 N;  3BF1 A;  3CET A;  2P9I A;  4YOV A;  1J6Z A;  3C65 A;  3EL2 A;  4CD1 A;  3ATU A;  2OAN A;  5M1Q A;  4BRE A;  1K8K B;  2NRV A;  4BRD A;  4MLH A;  3CPW M;  3HM8 A;  4CZM A;  4RTF D;  3O9R A;  4GV9 A;  2QWQ A;  3LDQ A;  1S22 A;  2P9U A;  3CCR N;  2HBM A;  2P9S A;  3KWG A;  1HKG A;  1DT9 A;  1S3X A;  1ILY A;  5AQX A;  2UYT A;  2V51 B;  1RDW X;  4ILJ A;  3F5T A;  2ZJP L;  3QFU A;  5KPT A;  3GE1 A;  5AZI A;  3CC4 N;  1K8K A;  4L3Q A;  5GIO A;  2CH6 A;  3E9P A;  3O4W A;  1N8R O;  4YOT A;  3CQY A;  1YHQ N;  3C7N B;  4FWL A;  4BRL A;  3QB0 A;  2ZGY A;  3DXK A;  2D4W A;  3UB5 A;  1NGA A;  4JD2 B;  3C6A A;  1JCE A;  2YHW A;  1U6Z A;  1K9M O;  3O80 A;  4FWS A;  1Z05 A;  2NRT A;  4GNI A;  4B1U B;  4BC2 A;  4EIA A;  2YHX A;  2QM1 A;  3CCS N;  2GWJ A;  5C15 A;  2D0P A;  3QDK A;  4JHD A;  2E1Y A;  3UKU B;  2FXU A;  3LDL A;  3DWL A;  3H46 O;  3NVK A;  2E2Q A;  4JD2 A;  3SBG A;  1YJW N;  4DHY A;  4WYB A;  4B1V A;  2P9N A;  1ATS A;  4AF1 A;  1EO1 A;  1HKC A;  3A5N C;  5KPZ A;  4YOX A;  1VQK N;  1T44 A;  2KLA A;  3UKU A;  2Q31 A;  4M7Y A;  4A57 A;  3QFP A;  3AAR A;  3IDH A;  1NLV A;  4K42 A;  4IOC L;  3VEV A;  2I7N A;  5ADX H;  3FZF A;  5MLC Q;  5C12 A;  2HOE A;  5BRD A;  1K8A O;  4BR7 A;  2ZJR L;  4JKD A;  5C2D A;  3O9T A;  3CCM N;  3VGL A;  3J8A A;  3H3O B;  3HOT A;  2AA4 A;  4R79 A;  3CC7 N;  1MWM A;  3MWP A;  4BRG A;  3AAP A;  3R6M A;  1TYQ A;  3MWT A;  3DXK B;  5AZJ B;  2FF6 A;  1WOQ A;  1YJN N;  4C1N I;  4H5V A;  1U2V B;  3MN6 A;  1BWF O;  4NB4 A;  4BVP A;  5ELZ A;  1KAX A;  3MCA B;  1YIT N;  1QQM A;  4IZ9 A;  3K9K A;  3ZX3 A;  3R1X A;  3TSP A;  1G99 A;  2A3Z A;  4O8K A;  3LL3 A;  3VES A;  2P9N B;  3EN9 A;  2VWB A;  2F9W A;  3SMS A;  5JLH A;  1HKB A;  2AP1 A;  4YDU C;  3O8M A;  4GY2 B;  5FPE A;  3KWI A;  4M7X A;  3UKR B;  1MA9 B;  3D2F A;  4FOI A;  2HMP A;  3WEE A;  4YOR A;  2KHO A;  2NRR A;  1JJ2 M;  2ZGZ A;  3IKM A;  4IFE A;  3CJC A;  1QZ5 A;  2F7T A;  2V52 B;  3TSQ A;  4CZK A;  5AQS A;  5EY4 A;  2YI1 A;  5LJW A;  4CJ7 A;  4BQL A;  5M1N A;  4BY9 C;  3D2F B;  3NMU A;  5AQZ A;  4A5A A;  3WXM B;  3FZM A;  3RSE A;  3M6G A;  3CC2 N;  2BTF A;  3VF2 A;  3T69 A;  1SAZ A;  4O8U A;  1BDG A;  2PBD A;  1VQP N;  3BUZ B;  4K41 A;  4BG8 A;  5FPN A;  1SS6 A;  3OW2 M;  5AZJ A;  1SQK A;  1OVY A;  3U9D A;  1ZXO A;  3HRG A;  3HI0 A;  4JEP A;  4EAH D;  5BN8 A;  4H5R A;  3HTV A;  4GV6 A;  1GLJ O;  2ZF5 O;  4CBW A;  5BRF A;  1VQO N;  3NVM A;  1BA1 A;  2WBN A;  4B1W B;  4XEI A;  4C23 A;  3IUC A;  1C0G A;  1ATR A;  1ZBS A;  4KH6 A;  5AQP A;  5AQG A;  1S72 N;  3Q7C A;  1GLF O;  4MDB A;  3CI5 A;  1HJO A;  3LDO A;  3TPQ A;  3O9Q A;  4PKG A;  2BH1 A;  3AGK A;  4BRC A;  4EHT A;  4B1X B;  3A8Y A;  3Q7B A;  3WUH A;  1NGB A;  4I6M B;  4FWR A;  3O08 A;  4ILG B;  1YIJ N;  4FWK A;  4WQ5 A;  5C10 A;  3CCU N;  4A62 A;  4IEI A;  4F9O A;  3IFR A;  3QBX A;  5F1X A;  5BRH A;  5E26 A;  4HTL A;  4FWN A;  5GAE P;  1YXQ A;  3JXU A;  1W2B M;  3D2E A;  4NLC A;  1V4T A;  3FZL A;  1Z6R A;  1VAZ A;  1GLB G;  3VER A;  3VEN A;  3MK6 A;  1VQ8 N;  3CXC M;  5GIP A;  3VTI A;  4CZF A;  1KXP A;  4DB3 A;  5AQQ A;  4BR9 A;  3E66 A;  1C0F A;  3ZX2 A;  1VQM N;  2KKZ A;  1BU6 O;  4MLE A;  2JWK A;  3E9O A;  4BR5 A;  2J4R A;  5C2F A;  2IVP A;  1ATN A;  2QWN A;  5AQF A;  5AQI A;  1BG3 A;  2P9L B;  3SAF A;  5E84 A;  1VQN N;  5AZI B;  1Q86 O;  4BRO A;  1RDU A;  4E1J A;  4YOY A;  5CHI A;  3LDP A;  1D4X A;  4BRI A;  3N4Q A;  3BP8 A;  4MO5 A;  3VEW A;  3ULE A;  1R59 O;  3C7N A;  2HST A;  2ZJQ L;  3M5R A;  2VCP A;  3UKR A;  4JK9 A;  3SAG A;  4JNE A;  1VQ7 N;  4WQ5 C;  4PHT X;  4AM7 A;  3MDQ A;  3KK7 A;  4JAX A;  2E2P A;  1ESV A;  2YJF A;  3O1B A;  4IJN A;  4CZI A;  4Z94 A;  3F9M A;  5AQM A;  1NGJ A;  4WFA L;  3CMA N;  3LM9 A;  5KQD A;  4CBX A;  1QVG M;  1IG8 A;  3KVG A;  3GG4 A;  5EX5 A;  4DCH A;  3G6E N;  3M1F A;  4A2A A;  1H1V A;  5EVZ A;  2DPN A;  3SLC A;  3ATV A;  2IIR A;  1GLL O;  2Q0R A;  2Q2R A;  1TUY A;  4BR0 A;  5F0X A;  4WFB L;  1X3N A;  1M90 O;  3MX5 A;  3I56 N;  4NO7 A;  4BRP A;  2E8A A;  3CCE N;  3I33 A;  3H45 C;  2GEL A;  3CHW A;  4BGB A;  4Y0W A;  2GUP A;  3KZB A;  2A42 A;  1YF5 L;  4ISE A;  4BR4 A;  4EHU A;  5ADX A;  1QQO A;  2YX6 A;  3WXJ A;  4BRM A;  5JIC A;  5M1P A;  3H6E A;  5JMV A;  1HPM A;  1IJJ A;  1BA0 A;  1DGK N;  2E88 A;  3O9S A;  3H1V X;  5I9E B;  4U67 L;  1Q81 O;  1KD1 O;  2NZT A;  3TTC A;  2E1Z A;  3B8A X;  3OBY A;  1X9J A;  2GEM A;  5M1K A;  2W40 A;  4XH5 A;  3VMF B;  3BF3 A;  4O5F A;  3GOI A;  3U8X A;  2CGL A;  4IOA L;  2OTJ N;  4H5N A;  1LCU A;  4IDH A;  4FPA A;  5JLF A;  2E2N A;  3ZEU B;  4CZE A;  3G71 N;  1WUA A;  4CZJ A;  3FR0 A;  3A5O C;  3CJ1 A;  4FSV A;  4PKH A;  3AGR A;  3R9P A;  4K43 A;  1E4G T;  2CH5 A;  3EKU A;  3WXK A;  5AQU A;  3R8E A;  3VOV A;  4CZL A;  3ZX0 A;  2W41 A;  1M1K O;  3CCL N;  4QS8 A;  3ZET B;  5AR0 A;  3FE1 A;  1TUU A;  4BC3 A;  4OO1 J;  3C6H A;  2V7Z A;  1QQN A;  2ASP A;  2E2O A;  3I55 N;  1NGE A;  1NGC A;  5C0Y A;  2HBL A;  3QML A;  3D7E O;  2ASM A;  4I6M A;  1Y64 A;  4JKC A;  3G4S N;  3J7Z O;  1RGI A;  3MMV A;  3DJC A;  3FFK B;  4JK8 A;  5AQK A;  1KQS M;  4UY8 O;  2QWR A;  3ENB A;  3IMX A;  2D1K A;  3O9U A;  5GAD P;  3EZW A;  3C0B A;  2PFU A;  4LC9 B;  5M1O A;  5EOY A;  4JN4 A;  3LDN A;  5FPM A;  4DQ8 A;  1MWK A;  5AFU A;  3HSC A;  2RHK A;  4U7B A;  3OHR A;  5LJV A;  2JWL A;  3AAQ A;  2NRZ A;  5AQO A;  4CI6 A;  1X3M A;  3CJ9 A;  4WFN L;  1OKJ A;  3ZYY X;  5BRE A;  1P90 A;  3DAW A;  4IWV A;  1T3V A;  4CZH A;  1BO5 O;  5GAG P;  5TKY A;  2VGN A;  1NGI A;  2P9P B;  2VGM A;  4PL8 A;  3WQT A;  3OA9 A;  3W0L A;  4A5B A;  2FSJ A;  1RFQ A;  3P38 A;  3L4I A;  3QBW A;  4FWM A;  5JVH L;  3U9Z A;  3ZET A;  2FSK A;  2VYP A;  1Q7Y O;  2FLO A;  3S41 A;  3DXM B;  3UE5 A;  3TU5 A;  3ULE B;  3CER A;  4NLB A;  1JCF A;  4FWO A;  5BPM A;  5AQH A;  4BRQ A;  3RSE B;  5AQY A;  3HOS A;  3U4L A;  5JVG L;  1YJ9 N;  2A41 A;  4H0X B;  4JKG B;  2GWK A;  3KHY A;  4H0P A;  2OTL N;  1GLD G;  1GLA G;  2EWS A;  3SJH A;  2GX9 A;  3CCV N;  1KC8 O;  2P9K B;  2QWL A;  3SBT A;  4RCH A;  3E1Y A;  3H1Q A;  3K9J A;  3TSU A;  3WQU A;  3AY9 A;  4YDU A;  3O6W A;  1Q18 A;  1SZ2 A;  4IO8 A;  3SK3 A;  4JKB A;  3T7Z A;  3CCQ N;  2P9L A;  2QWO A;  4BC5 A;  2YCH A;  1HX1 A;  4AM6 A;  5KPR A;  3VPZ A;  3HZ6 A;  2ASO A;  4HWI A;  4IJA A;  3VEO A;  4FVU A;  1T6D A;  5AQV A;  3TTD A;  4BVO A;  4FWP A;  4JKH A;  4KH4 A;  3M3Z A;  3WXI A;  2P9P A;  3P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...