4BR4A

Legionella pneumophila ntpdase1 crystal form i, open, apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
b'PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
molecule tags Hydrolase
source organism Legionella pneumophila
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br4A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br4A02
2J4RA 4FWLA 3O6WA 3MDQA 3FGUA 3CJCA 3VESA 4J8FA 4M7XA 5BREA 5AQMA 3LL3A 3QB0A 2I7NA 4K41A 1U2VB 1NM1A 1NGAA 4FOIA 4BC2A 2FSJA 1BDGA 1XUPO 2A5XA 2P9KB 4I6MA 1QQMA 4BR7A 4BRAA 5AQZA 3A5MC 4H03B 2QXLA 5JLHA 1NGGA 3LM2A 3UKUB 5AQFA 2P9SA 3GOIA 3AARA 4KBOA 4QS9A 3FZLA 3ZETB 2V7ZA 4H0PA 1RDWX 4QS8A 3CQXA 3F9MA 3VEWA 4DHYA 1NGFA 1WOQA 3M3ZA 3CJAA 3IFRA 1YXQA 1CZAN 4DB3A 5KPRA 5CE3A 1NBWA 1T44A 2FF3B 2FSKA 4XH5A 2CGJA 4YDUA 4B1YB 1R59O 3KVGA 4WQ4C 5AQHA 5ADXH 1C0GA 3I33A 4ISGA 4JHDA 5BRHA 1NGBA 2A40A 5FPDA 4BRPA 1LOTB 3LDPA 2FSNA 4CZLA 3L0QA 3FE1A 4M63C 5BN9A 2QWOA 3L4IA 4B1XB 4LC9B 3EO3A 4Y0WA 2QWMA 3D2FB 4K43A 5AQKA 4BRDA 3EN9A 4FWPA 4BGAA 4B1VA 5KQDA 1IJJA 2E2OA 4BRCA 3A8YA 3VF2A 3IUCA 3B8AX 3SMSA 4CBXA 2YHYA 3O5BA 4BRMA 4BRKA 1T6DA 3DJCA 4CZEA 5AQQA 5AQWA 2IIRA 1TUYA 2IVOA 3O4WA 2QW9A 3WXIA 2E20A 3VGKA 4EAHD 3WQUA 1TUUA 3LM9A 3DXKA 3FZMA 3BEXA 1QQNA 3VGLA 4B9QA 2A42A 5AQYA 2CGKA 2I7PA 5AR0A 3VEZA 3CERA 1DEJA 1OKJA 1JCEA 5AQIA 1ATNA 2QWRA 1NGHA 3DAWA 3VENA 2D0PA 1E4GT 1YUWA 3DXMB 3SJHA 2P9LB 3KHYA 1NWKA 3WUHA 4H5TA 4FPAA 3QMLA 4FWRA 3UE5A 3UKUA 4BG8A 1GLAG 3ZEUB 5AZJA 3O08A 4JHDB 3AAQA 4DQ8A 4Z94A 3LDNA 4BQLA 5BPLA 1GLDG 3EZWA 1V4TA 4ISEA 2OANA 5EX5A 2GWKA 3MCPA 1GLCG 3A5NC 1QZ6A 1TYQB 5AZIA 3ULEA 1V4SA 4YDUC 3HBTA 4WQ4A 4XH4A 3H3NO 1H1VA 2BUPA 2GTDA 1QQOA 1HPMA 3O1BA 4IWVA 5B8HA 1D4XA 3H46O 1MA9B 1GLJO 4A2BA 5BRFA 2HMPA 4K25A 2E8AA 3O8MA 4EIAA 3GE1A 2V52B 3WEEA 1HX1A 3CETA 3IMXA 1HLUA 1LCUA 1MWKA 2NLXA 4CZGA 1U2VA 2ZGZA 5AQTA 4BG9A 4ISFA 1YVNA 4BR9A 3WXJA 3FLCO 2NZTA 3RSEB 3CJ9A 3MN5A 2FLOA 5AFUA 1RGIA 4B1ZA 1NGJA 5JICA 3C7NA 3DXMA 2VCPA 3BUZB 3D2EB 5FPEA 4FWMA 4AM7A 1BO5O 1DGKN 3J8AA 3QFPA 2P9IB 1KAZA 5BRDA 1SZ2A 2P9IA 1E4FT 1TYQA 4B1UB 4BRGA 4EHUA 4XEIA 3MK6A 1HUXA 2A6AA 4F9OA 3AY9A 3CJ1A 3CI5A 2YJFA 3HZ6A 2CH5A 5EXWA 4A61A 3MN6A 5KPTA 5AQNA 1NGDA 3S41A 4C23A 2ASOA 5TKYA 4FWOA 4BR0A 4EHTA 1GLBG 3HSCA 3VOVA 4BC5A 4IXCA 4CZHA 5F2RA 4BR2A 2GWJA 3VETA 1T6CA 3CJBA 5E84A 4JAXA 1J6ZA 3G25A 4FO0A 2ZGYA 4H0XB 2ZF5O 4WQ5A 3U8XA 4FL9A 1BG3A 2P9KA 1P8ZA 4PKHA 3QBXA 3H3OB 4FWNA 5AQUA 3ULEB 1BOTO 2CH6A 4PL7A 2QWLA 1HKBA 3HM8A 1JCGA 2E2PA 1WUAA 3ZEUA 4GNIA 4H0OA 3EKUA 3MN7A 2W40A 3ENHA 4JNEA 2E1YA 1U6ZA 3ENOA 1BA1A 1GLEG 5KPZA 2P9LA 2AA4A 2YHWA 3BF1A 4IJAA 4E1JA 5FPMA 1X9JA 4FPBA 3I8BA 2Q1NA 3TPQA 4I6MB 2VYPA 2AP1A 3QICA 1HKCA 2Q97A 3D2FA 5AQXA 5EOYA 2E88A 2YJEA 2YHXA 4BROA 5ELZA 4IJNA 3TU5A 4IO8A 3AAPA 1BU6O 2HOEA 4IZ9A 4FOEA 3CQYA 4BRIA 2IVNA 1Q18A 2CGLA 4CD3A 5LJVA 2Q0UA 4H5WA 4AM6A 3FFKB 4B1WB 4BVOA 3H6EA 4RWTA 2ZWHA 5FPNA 2BTFA 3ZX3A 3LDLA 5AQVA 2QWNA 3U9DA 4MO4A 2ASPA 3JXUA 3ZX0A 1S22A 4CZIA 3W0LA 4FWQA 2P9SB 5AQSA 5AQLA 3GBTA 4O5FA 1XQSC 1Z05A 3O80A 4BREA 4CI6A 1SAZA 3RSEA 4WYBA 2Q0RA 5I9EB 3R9PA 2E1ZA 2QWPA 3FR0A 4WQ5C 1HJOA 1X3MA 2A41A 3VGMA 1QHAA 4BRQA 2A3ZA 2HF3A 3QDKA 5AQJA 1MWMA 1MDUB 4H0YB 1ATSA 3ATUA 1GLFO 2QM1A 1BUPA 3VEVA 3EKSA 3ZETA 3OHRA 3WQTA 2GEMA 2FF6A 1NMDA 2IVPA 3MN9A 3UB5A 4L3QA 3C7NB 4CBUA 1K8KA 5AQGA 4CZKA 5AFUH 4XH1A 5BPMA 5AQPA 2GELA 1GLLO 2DPNA 4CZMA 2H3GX 3QBWA 5AQRA 3KZBA 4GY2B 3VERA 2WUSA 1X3NA 3WXKA 2Q31A 1G99A 2D1KA 3H45C 1BWFO 1NGIA 1DKGD 2VWBA 4FSVA 3WEEB 2ASMA 1RFQA 3H1VX 4HTLA 5JMVA 3O1WA 5AZJB 2F9WA 3SK3A 1Y64A 4JD2A 1ATRA 4MO5A 1IG8A 2EWSA 3EL2A 3FZHA 3U4LA 1K8KB 4CJ7A 4BRLA 2NRHA 4A2AA 2UYTA 3LDQA 5AQOA 1KXPA 3BF3A 1KAYA 1HKGA 5EY4A 3MMVA 2P9NB 4BRNA 1ZBSA 4CBWA 3H1QA 2E2QA 3D2EA 3VF6A 3M1FA 4MLEA 1SQKA 2D4WA 4BC4A 5LY3A 4QS7A 5E26A 2YCHA 5F0XA 3R8EA 3R6MA 4K42A 1Z6RA 4CD1A 1ZXOA 3VF4A 3BP8A 4H0TB 3FZFA 4RCHA 3CIPA 1NLVA 3JS6A 4NO7A 3CJ7A 2Q36A 5BN8A 3VPZA 4BQZA 2P9PB 3DWLA 4NB4A 2ITMA 3WT0A 4BRFA 5F1XA 2P9UA 5JLFA 1ZC6A 3D7EO 4M7YA 4PKIA 4O8KA 3VEXA 4BC3A 4BR5A 4H0VB 4H5RA 3WXLA 3W3DA 3ZX2A 4BVPA 2YI1A 2FXUA 2F9TA 4JN4A 1KAXA 4BRHA 5ADXA 3U9ZA 3M6GA 5KQ8A 5EVZA 5BR9A 3VEOA 3HI0A 4EFHA 3SLCA 3P4IA 3GG4A 2P9PA 3GL1A 4BGBA 2PAVA 5LJWA 4PKGA 2P9NA 4BR4A 2QWQA 3ATVA 3L6QA 4DCHA 3IDHA 4A62A 4H5VA 5AZIB 3VEYA 1BA0A 4RTFD 3UKRA 2HF4A 4H5NA 4CZJA 1YAGA 3GDQA 4JD2B 2D0OA 4PL8A 1QZ5A 2E2NA 3A0IX 3A5LC 3LDOA 3DXKB 3HTVA 1XC3A 4CZFA 3FZKA 1EQYA 2V7YA 4MLHA 3QFUA 3CHWA 2PBDA 4FWKA 2V51B 1C0FA 3UKRB 3C0BA 1ESVA 2W41A 5BPNA 1NGCA 3ID8A 1NGEA 4HWIA 2KHOA 1S3XA 2P9UB 1JCFA 3A5OC 2GUPA 2Q2RA 4FWSA 3SMPA
chains in the Genus database with same CATH superfamily
1BIUA 2J4RA 3O4NA 2FC0A 3CJCA 3VESA 4J8FA 5BREA 3ULDA 4LF9K 1IKVA 1TKTA 1RT5A 1U45A 2DY4A 4Q0BA 3AA4A 1N6QA 4H03B 3TTDA 3ZSQA 5AQFA 4JYAK 4A5BA 5E41A 1RDWX 4FK4A 4BE2A 3F9MA 3DOLA 3I56N 1B9FA 5KRSA 1CZAN 1FJGK 1TAUA 5CE3A 1NBWA 3AVJA 2O8EA 3OA9A 1LAWA 2GBZA 4LF6K 4B1YB 1R59O 2D0AA 5AQHA 4B8CA 4JV5K 4HCCA 1YTUA 5FPDA 2RE2A 4DV0K 3AVLA 3SQ0A 4QOZB 1Q9YA 4CZLA 4CHNA 5BN9A 4X64K 4JKGB 2QEXN 4JI2K 4M3UA 3VQAA 3D2FB 4K43A 5AQKA 4B8AB 1YJWN 4O44A 4B1VA 5KQDA 4FJHA 1IJJA 4AF1A 2QI2A 3O3GA 3LWLA 1J9AA 4IOCL 5AQWA 2HHXA 2VG7A 3O4WA 2IS3A 3WQUA 1J54A 3LM9A 2BH1A 3HXMA 4WFBL 3DXKA 1X9MA 4W5QA 1I3AA 3VGLA 4FJLA 3MX5A 2I7PA 1K6YA 5AR0A 4JKFA 1JCEA 1BI4B 1VQ5N 3K9JA 3G6EN 4PQUA 1E4GT 1YUWA 2P9LB 2KQ2A 1NWKA 3KHYA 3TSUA 1L3UA 4BY9C 3O3HA 4F2SA 2Z1GA 3UKUA 1VQNN 3CYMA 1GLAG 4OX9K 3NVMA 3O08A 3OJUA 2RPIA 4DF4A 4BQLA 5BPLA 1GLDG 3EZWA 1HMVA 1RTHA 2GWKA 5CHIA 1EX4A 3NDKA 4FW2A 4DFKA 4FVMA 1V4SA 2VG6A 5HRPA 2EHGA 4NCAA 1DTQA 2BUPA 3H3NO 3SBGA 3HP6A 4NYNA 3JYTA 3OS2A 5B8HA 4CFBA 3KD1E 5D3GA 4A2BA 1GLJO 2HVIA 3VMFB 4K25A 3O8MA 1BL3A 2YNHA 2V52B 4JI6K 3WEEA 3IMXA 3CCJN 4CIFA 2NRXA 1HQUA 4JKEA 4IFVA 2NLXA 4CZGA 2ZGZA 3BY5A 1N33K 2LSNA 3T1YK 1TAQA 1IG9A 3FLCO 1VSJA 1HNWK 2FLOA 1ILYA 4B1ZA 1NGJA 5JICA 3DXMA 2Y1JA 4BE1A 2RKIA 3D2EB 3M8PA 2VQFK 4CF8A 4CJLA 4FWMA 3MCAB 1WSHA 1BO5O 3RTVA 4KTZA 1KAZA 4DMNA 3PLAA 3SAFA 4BWMA 1KTQA 4DUYK 3QESA 1KLMA 4OKKA 3HZ6A 5EXWA 4A61A 4DV2K 2FBXA 5HRSA 3EE9A 5KGWA 3D45A 4PA1A 3HSCA 4OLBA 1KVCA 3HK2A 3PIPL 4FJMA 1T6CA 1KLNA 1GOBA 3CJBA 5E84A 4Z4IA 3TSPA 4BACA 1KCFA 2HNYA 4JKBA 4LH4A 3AVNA 4PHTX 3G25A 3KTQA 3O4QA 2ZF5O 4FL9A 4K8XA 1UWBA 1T3VA 3O3FA 2Z1HA 1T05A 1C6VA 4FWNA 2Z1JA 2XY6A 3SYZA 3PO5A 1RT1A 2F7TA 4YFUA 3HM8A 1Q82O 4IEEA 2P51A 2ETJA 5M1FA 3ZEUA 4GNIA 1RT4A 3DLHA 1VQ9N 1CXQA 1VSMA 3HVTA 3TTFA 4E1JA 1YITN 4B9LA 5A2QO 1X9WA 4DQQA 4KB1A 2G8HA 3D2FA 1O13A 2YKMA 4OLAA 2YHXA 1VSHA 4JKGA 1KFDA 1L3VA 3TU5A 3QEXA 4IO8A 2XY8A 5MLCQ 4CJQA 3CC4N 3E9OA 3OVNA 2HOEA 4FOEA 4H5WA 3IKMA 4X66K 3D0PA 1RT6A 4B1WB 3L3VA 3G4SN 1LV5A 4RWTA 2WFBA 2ZWHA 3HJFA 3ZX3A 3G10A 3LDLA 5AQVA 1HYSA 5BR8K 4DSIA 1C1BA 4CZIA 3W0LA 4KREA 4FWQA 3SAHA 4JK9A 3LAMA 2QA4N 3KWIA 4O5FA 1Z05A 1JKHA 2E6MA 1HYVA 3RSEA 3OBWA 4M3ZA 3T1AA 1Q9XA 3R9PA 1KD1O 1HJOA 4Y1CA 3HVRA 1QHAA 3C6TA 3QDKA 5M1NA 1ATSA 3CCQN 4IOAL 1BISA 4FLUA 4E0DA 3ZETA 5FDLA 1NKBA 3OHRA 3WQTA 5JS2A 4UQGA 2VWKA 2FF6A 5SWMA 3V9XA 4CK1A 3MN9A 3UB5A 3Q7BA 3VA3A 1K8KA 5FRMA 5GIPA 4LF5K 4DR7K 5AFUH 4XH1A 3HOTA 5BPMA 2DPNA 4I2QA 2H3GX 5AQRA 4B3SK 2WUSA 3V1QA 3H45C 1VSEA 1NGIA 1VQ7N 4FSVA 3WEEB 3VQEA 4DSKA 3H1VX 4FZZA 4CJTA 5JMVA 1J5EK 3IAYA 2F9WA 3SK3A 1NKCA 2GX9A 3IRXA 1J53A 4UY8O 4Z4EA 3EL2A 1K8KB 4A2AA 5AQOA 3LDQA 3DRSA 1SKWA 2UUAK 3OYAA 3TAPA 1HKGA 1N32K 5EY4A 1ZBSA 3I55N 3OYNA 3H1QA 3TWHA 2PYJA 1VSIA 1SQKA 3V81A 4ID1A 3BZCA 4LFAK 4CVNE 4QS7A 4DQRA 4ELVA 1S1VA 4O0JA 3V9ZA 1Z6RA 1WBDA 3K0SA 1S9GA 3VF4A 4RCHA 3AVHA 3G0ZA 3CIPA 5FLXO 3J80O 3DLLL 1SL1A 1K73O 3RR8A 4CFCA 3DM2A 1XHZA 1NOZA 1S1UA 2BGGA 2Q36A 3QNNA 2OCEA 5GAGP 4BRFA 3WT0A 3P38A 3NF9A 5KTQA 2HHTA 3OJSA 4M3TA 4GV3A 1EETA 4OKEA 4BR5A 1N36K 5JVHL 3VQ6A 1LWCA 3ZX2A 3O9UA 1NOYA 1BCMA 3R3LA 5ADXA 4DU3A 1U4BA 1VQKN 2ITGA 1OH6A 4JKHA 1IBLK 3LZIA 4PKGA 2P9NA 4CFAA 4DV3K 4BR4A 1XMOK 4DSEA 1ITGA 1WSFA 4W5NA 5KGXA 5GAHP 1MU2A 2HF4A 4ZTJA 4B3OA 2R7YA 3SQ1A 1QZ5A 3AO1A 2OYQA 4CGJA 3T69A 3LDOA 4MDAA 3S9HA 3SQ2A 1EQYA 4MLHA 5HRNA 3UIQA 2O8EB 2HHSA 1BQNA 3CQ8A 2PBDA 3K2PA 3KLFA 3NAEA 2HW3A 3AO5A 1HNXK 3RMCA 1T7PA 3LZJA 3ID8A 3NFAA 4AQYK 1OH8A 4HWIA 1JCFA 2Q2RA 2IAJA 4FJXA 1IKXA 4IDKA 4M7XA 1QSLA 1NGAA 3TARA 4FOIA 2PY5A 3J7AP 3SCXA 4PWDA 4IEIA 1BDGA 2ZQBA 1XUPO 3K57A 2DFEA 4BR7A 4NCGA 1N34K 4KV8A 5J2PA 4BRAA 3A5MC 3PY8A 2QXLA 3EZ5A 1NGGA 3UKUB 4CJKA 4EZ6A 2UUBK 2O8FB 4H0PA 4QS8A 4Z4FA 3VEWA 4DHYA 4FJKA 1NGFA 1RILA 2KLAA 1CLQA 3C65A 2FF3B 1T44A 3L2RA 5C10A 4YDUA 1D5AA 4WQ4C 3PV8A 5K14A 1C0GA 5BRHA 4JHDA 1NGBA 1NG9A 4BRPA 1LOTB 3QEWA 4K8ZA 1E3MA 1S5JA 3L0QA 3C94A 4M63C 3MXIA 2IDOA 5M1PA 1VQON 4B1XB 4Y0WA 4I2PA 3OYGA 2E5LK 4BRDA 3ID6A 2BE2A 4JK7A 4MQ3A 4Z4CA 3VQPA 1JJ2M 3A8YA 3SBTA 3SMSA 4CK3A 4F3OA 4IKFA 1T6DA 4Z0UA 4CZEA 2IIRA 5IWAK 5DM7L 4M45A 2QW9A 3WXIA 1VK0A 4FLXA 2E20A 3CCSN 3OYIA 4DV4K 4EAHD 3CF5L 3L2VA 4HUGA 1VSLA 3TAMA 4DFMA 1SV5A 3BEXA 1QQNA 1TVRA 2CGKA 3LP1A 3CERA 2W6KA 1DEJA 3VTIA 1NGHA 2WC9A 1A5WA 1CXUA 3NHGA 3VQBA 2UUCK 3DXMB 4ZHRA 3OYMA 4WE1A 3WUHA 3EYZA 4FPAA 4GMJB 4FWRA 1LWFA 1C1AA 4JHDB 4DQ8A 4Z94A 4YOYA 1NK6A 4YOWA 1YIJN 4B9VA 2D0BA 1CZBA 3NF6A 2YNIA 3J7YP 2HB5A 3V9WA 3CCVN 4KFBA 3L8BA 1A5XA 3ULEA 4E7JA 5HBMA 5C25A 2OPSA 1ASVA 3QERA 5EU7A 4XIUA 3SI6A 1QQOA 1D4XA 1JLQA 2O8BB 1MA9B 3HOSA 1JXEA 1IO2A 2RHKA 3GE1A 2RN2A 2YNFA 4N5SA 1YJNN 1HX1A 1RT7A 1XWLA 2O4IA 1NJIO 3OS1A 1C0UA 3P1GA 3HRGA 5AQTA 2HBKA 4BG9A 4ISFA 4H8KA 5AJ3K 3RSEB 3TAFA 3MN5A 1RGIA 2ZD1A 1XC9A 3MXJA 3V1RA 4NYFA 3C7NA 3K5OA 1YI2N 3BUZB 5FPEA 3K59A 3DRRA 3E66A 4KH6A 1QE1A 4DR5K 4GW6A 4CJUA 1DGKN 4KHPK 5BRDA 4LF7K 2P9IA 1E4FT 4HVJA 1FK9A 3U6FA 4EHUA 4XEIA 2OZMA 4X65K 3LDSA 1M90O 4EP5A 1UA0A 4M3RA 3CI5A 2YJFA 5KPTA 1NGDA 3S41A 4C23A 4CEBA 2ASOA 5TKYA 4DTNA 4EHTA 1JL2A 1LWEA 4E3SA 3TANA 3VETA 4FJ5A 2D5RA 4CE9A 4Z4GA 4DU1A 2G8VA 1JXBA 5LL6Z 3OYFA 4FO0A 4H0XB 3HPOA 1RBRA 4E7IA 1BG3A 1XNQK 1S1TA 4CEFA 4PKHA 3BDPA 3H3OB 5AQUA 3TI0A 2CH6A 4B08A 4FVUA 1QHTA 1JCGA 3O9RA 3HPHA 5DM6L 1W9HA 4LF4K 1W2BM 3MN7A 4CJ3A 3AVCA 3DYAA 3ENHA 4JNEA 1BA1A 2EX3A 3M8RA 1HRHA 3K5NA 2AA4A 4WCEL 2XY5A 4G1QA 4FPBA 4V19S 4Y1DA 4I6MB 2VYPA 1TKXA 3QICA 3ZSRA 1HKCA 2Q97A 1T03A 5EOYA 1L3TA 4O4GA 4IJNA 2P5GA 3HYFA 4DTJA 1YF5L 3AAPA 4IZ9A 3CQYA 4KTQA 4FK0A 4FZXC 4IDHA 1TKDA 1HNZK 2YKNA 2Q0UA 4AM6A 1ZBIA 1LW0A 2XRIA 5FPNA 1IBKK 2X6NA 1BI4A 4OO1J 3K5LA 4AH9A 3ZT0A 1R0AA 2P9SB 5AQLA 4NLBA 1NNEA 2KKZA 4BREA 1U48A 4CI6A 4WYBA 1U49A 4F4KA 4WQ5C 1X3MA 1DTTA 4BRQA 1SL0A 2E6LA 5AQJA 3OTOK 1MWMA 4YOTA 1MDUB 3ATUA 3RR7A 3THXA 1RT3A 1VQPN 4B9NA 2Z1IA 4LD0A 4N76A 2IVPA 4CBUA 1J5OA 4BDZA 5DMRA 4CZKA 3CCMN 3LAKA 1Y97A 2GELA 5AQPA 1UOCA 3VERA 3H08A 1HJRA 4CF9A 3KLGA 2F8TA 1BWFO 4CERA 2ZJRL 1RTIA 4KHNA 2KTQA 1RFQA 4YNQA 3T1HK 4CHZA 4HTLA 1YHQN 1ASUA 1Y64A 4JD2A 4HHTA 1ATRA 4MO5A 1YT3A 3ZSOA 2NRHA 4DV6K 1UA1A 3Q7CA 2GUIA 1KAYA 3BF3A 4PUOA 4N56A 3O9TA 4CBWA 3RWUA 3VQQA 3E1YA 1VSKA 3M1FA 3B6OA 5H1SQ 5E26A 4E1NA 2G8KA 2YCHA 3R8EA 3R6MA 4EZ9A 2WONA 1SS6A 3BP8A 1K8AO 4DTSA 3PUFA 3FZFA 1F21A 1BQMA 4CEDA 1SKRA 1EXQA 2O8FA 4LSLA 3C95A 5C2FA 3CJ7A 3VQ8A 4AILC 5JS1A 3RMBA 5CZ2A 3CMAN 4KI4A 3DLBA 4BQZA 4NB4A 2P9UA 3SPYA 3D7EO 4M7YA 2HBMA 3ZT3A 1RDUA 1ZBUA 1Q81O 3VEXA 4CEAA 4DSLA 3SV4A 4JN4A 1YJ9N 5I42A 3U9ZA 4M42A 1QVFM 3M6GA 5EVZA 1BIZA 3MWPA 3VEOA 3HI0A 3PIOL 3P4IA 4DTMA 2PAVA 1FXXA 1C0TA 1Z25A 3L6QA 3IDHA 3CCEN 4KI6A 3NF7A 2DFFA 2HNZA 3UKRA 4DQSA 3G71N 4CZJA 1YAGA 4NCBA 2E2NA 3A5LC 5C15A 1UAXA 3PX6A 3FZKA 1IBMK 2V7YA 4M3XA 3CD6N 3QFUA 4FWKA 4JRPA 3UKRB 1ESVA 4M41A 4IO9L 3MWTA 2VGNA 3SUOA 1NGCA 2ZJPL 1S6QA 3MAQA 3WNEA 2KHOA 1S3XA 1JL1A 2GUPA 4X62K 1IV0A 3NH0A 2KW4A 4FLVA 3R1XA 2FBTA 2WOMA 5AQMA 3LL3A 3QB0A 1OH5A 2B6AA 2IOCA 4K41A 3PX0A 3BZKA 2HBJA 2FSJA 4I7FA 3CG7A 3TAEA 3L2QA 3EEQA 2P9KB 1HYZA 3DLKA 1Q7YO 2HHQA 2O8BA 3LM2A 2P9SA 3AARA 4KBOA 1OVYA 3FZLA 3ZETB 2V7ZA 4J2DA 4A5AA 3CFPA 1HQEA 3CJAA 3IFRA 4I9LA 1EP4A 5KPRA 5C12A 1XMQK 3AVMA 3CC2N 3KK2A 2FSKA 2CGJA 1HNVA 4LFBK 4FLZA 4FJIA 4F2RA 2A40A 2BDPA 3LDPA 2FSNA 2VWJA 2HHWA 3FE1A 4M3YA 2P1JA 3VQ7A 5HL7L 3IG1A 5HP1A 3L4IA 3P39A 4LC9B 1SL2A 2QWMA 2O8CA 4J2BA 4JI0K 4CJ4A 3ZSXA 3EN9A 1JLAA 4FWPA 2I5JA 3SZ2A 2O8DB 3CCRN 1QQCA 3WXMB 3VF2A 3B8AX 1D8YA 4CBXA 4B3MK 3O5BA 1QSSA 4OGEA 4E19A 3NBPA 4W5OA 4DSJA 3VGKA 2UXCK 4JI1K 3OY9A 1X9SA 4FCYA 3HL8A 4CF2A 5JVGL 3FZMA 4B9QA 3MXMA 2A42A 4JI5K 4CCHA 5AQYA 1IKWA 3KKRA 3VEZA 1CZ9A 3M8SA 3NCIA 5C0YA 3TR8A 5J2QA 3ALYA 2ZE2A 3P31A 4E1MA 5CY4A 1TGOA 4QAGA 4WF9L 4AHUA 2HHUA 1RDBA 3QMLA 3UE5A 4DTRA 3ZEUB 4O0IA 1JLEA 3LDNA 4ISEA 3C6HA 4YHHK 4C8KA 1S1WA 3MCPA 2NRTA 4LH5A 1QZ6A 3NVKA 3AA5X 5AZIA 2KZZA 4CF1A 1OH7A 4XH4A 1BGXT 4DQPA 1VRUA 4CF0A 4DV1K 1HPMA 4RG8A 4FJJA 3WNFA 5BRFA 1S1XA 2HNDA 4MDBA 4L8RB 2E8AA 1VQ4N 3V1OA 4KH5A 2OTJN 5FROA 3CETA 1NK8A 1HLUA 5FRNA 1Q86O 1MWKA 4R5PA 1WSEA 1YVNA 1NJXA 4G9ZA 3WXJA 5DK5A 3KK7A 1HR0K 4CJVA 3CJ9A 5AFUA 2BANA 4CFDA 2NRWA 3CFRA 3T3FA 4CEQA 1BCOA 4AM7A 3J8AA 1RCHA 3QFPA 1ZBFA 2P9IB 3SV3A 4CJFA 2X78A 1TYQA 4KHQA 4BRGA 3EY1A 3F73A 3PX4A 1FW6A 4JI3K 3TAQA 1FKOA 1EWQA 5IT9O 2A6AA 3AY9A 3AVBA 3CJ1A 2G8FA 3MN6A 2X6SA 3SUQA 1RBVA 4FWOA 4BR0A 1GLBG 3VOVA 4BC5A 4I9QA 1TV6A 4CZHA 5F2RA 1NMNA 2GWJA 3ZCMA 4JLHA 2NNWA 4CGFA 4JAXA 4GKKK 1J6ZA 2HHVA 2ZGYA 4DTOA 2P9KA 3MX2A 2YNGA 3QBXA 3ULEB 1NJYA 1BOTO 4J2EA 3M8QA 2B5JA 1HKBA 1VQ8N 4YY3K 3ENBA 2JWLA 3AA2A 4H0OA 4CHPA 3EKUA 4C8LA 2W40A 3O9QA 4ILJA 4DS5A 1HNIA 5C42A 1EKEA 2GV9A 4B9SA 1O1WA 5FPMA 1X9JA 4AHRA 1FKPA 2QKKA 3QEPA 3ZT1A 1NKEA 4F8RA 4A59A 5I3UA 1WB9A 3TSQA 1WN7A 1ZBLA 4ZTFA 3K9KA 4CGDA 3KK3A 3CMEN 4F3TA 1BU6O 4WFNL 3KLIA 2IVNA 3VN5A 1Q18A 2CGLA 4OKJA 3T19A 5LJVA 4KHSA 3FFKB 5CYQA 2D0CA 3V9UA 4H4MA 2BTFA 4JS5A 4DR2K 3ZSWA 4K0KK 4MO4A 2ASPA 3JXUA 3VTHA 2NRVA 3ZLJA 3ZX0A 1S22A 1WAJA 5HRRA 4LFCK 3AVIA 5J1EA 4IG0A 3QNOA 1RNHA 3O80A 5J2NA 2QTDA 1SAZA 2Q0RA 4RW7A 3FR0A 2QWPA 3KJVA 2A3ZA 3VQ4A 4U7BA 3CCUN 5GADP 2QM1A 3EKSA 3NH1A 3C6UA 2YV0X 3SUPA 4R79A 2GEMA 1RDAA 1NMDA 4L3QA 2XO7A 5AQGA 1RT2A 4CHOA 4JKCA 2OPRA 1SKSA 4KHUA 3HPGA 1GLLO 4E7HA 1KFSA 3QBWA 4GY2B 4A57A 2Q31A 3L2UA 3V9SA 3HT3A 4CJRA 1VQ6N 3SUNA 3OYBA 1DKGD 3O9SA 1TK5A 3KK1A 4OPAA 2IC3A 2HBLA 2YHAA 4FW1A 2VGMA 3A2FA 1YVUA 1IG8A 3FZHA 2VQEK 3HP9A 3U4LA 2A1RA 4BDYA 1I94K 2UYTA 1KXPA 2XHBA 4AHCA 4FJ7A 1NJWA 3MMVA 3S3NA 4BDPA 2NRRA 1A5VA 3D2EA 3DOKA 4CIEA 3CM6A 2Q3SA 3U3GA 1KRPA 1EO1A 2D4WA 4BC4A 3THVA 3D6RA 5F0XA 4KHWA 2UXDK 4K42A 3K5MA 4E89A 1ZXOA 4DFPA 4FJ9A 1EWRA 2KFNA 3J81O 1N8RO 5LMNK 4RW4A 3JS6A 4NO7A 4DLEA 4OGCA 3VA0A 5BN8A 4RW6A 3VPZA 3TAGA 2P9PB 3DWLA 2ITMA 4CEOA 4O5BA 5M1QA 1ZC6A 3HM9A 4PKIA 3MEEA 4O8KA 1C1CA 4BC3A 4H0VB 1QVGM 3WXLA 3W3DA 5CYMA 1VSFA 1X1PA 3QEVA 3F9KA 4BVPA 2YI1A 2F9TA 3ASMA 4KPYA 4GV6A 4NXMK 3PSFA 3VQ9A 2UU9K 5KQ8A 1RBTA 4EFHA 3GG4A 4IG3A 5LJWA 4CJSA 3AO4A 1WSIA 3THYA 4DCHA 3THXB 2HHHK 4H5VA 3I0SA 3VEYA 1BA0A 4RTFD 2DFHA 4H5NA 5HOOA 4PY5A 4JD2B 4PL8A 4CIGA 3C6AA 1M1KO 3HTVA 3KIOA 3F2KA 5M1KA 3CXCM 4KAZA 1S6PA 1VSDA 4BE0A 1C0FA 3T7ZA 4KHYA 2W41A 4IOXA 3AO2A 3KLHA 1NGEA 3I0RA 2HVHA 3A5OC 4FWSA 1GOAA 1W7AA 4NXNK 4GVEA 3SMPA 4M3WA 4DQIA 4FWLA 3O6WA 4LF8K 4CHQA 1BHLA 3MDQA 3FGUA 4HTUA 1KSPA 3QIPA 4CJWA 4JI8K 4DKWA 2I7NA 4HCBA 1KC8O 4IBNA 1U2VB 1NM1A 3MEDA 3QO9A 4BC2A 4CJEA 1TKZA 3V6DA 1NK0A 3EE8A 1VHXA 2A5XA 4I6MA 1QQMA 1G15A 4IFYA 2O8DA 5AQZA 4DR4K 4EP4A 5JLHA 3ZT4A 3GOIA 2E4LA 4QS9A 4FJ8A 2XY7A 3SPZA 5GINA 4B9UA 1TL1A 4JI7K 3SAGA 3I8DA 3CQXA 3HO1A 3THYB 1WOQA 3WNHA 3M3ZA 4DB3A 1YXQA 1WAFA 4FLWA 1RDDA 3LPUA 3LPTA 3P83D 4XH5A 3N4PA 1ZBHA 1NJZA 3KVGA 3V4IA 1JLFA 3ZSYA 5ADXH 3I33A 4ISGA 3AA3A 4B9MA 1TK0A 2QWOA 1KVAA 1B92A 4KH4A 3DI6A 3EO3A 2OZSA 2G8WA 3CC7N 4KB0A 4BGAA 3OYHA 4E7LA 3ISNC 2E2OA 4C8OA 4DR3K 4BRCA 1WBBA 3SJJA 3IUCA 1I39A 5HROA 4TSXA 4GV9A 2YHYA 4BRKA 4BRMA 4E7KA 2OTLN 3DJCA 3LP0A 5AQQA 3THWB 1TUYA 1NK9A 2IVOA 1U04A 1IH7A 4U67L 1TUUA 4GKJK 1DLOA 2O4GA 4YORA 4CEZA 3OS0A 4OPKA 3MEGA 1OKJA 4C1NK 5AQIA 1ATNA 2QWRA 3DAWA 3VENA 2D0PA 1S72N 5C24A 3KKSA 3SJHA 4FM2A 4H5TA 3HSTB 2OPPA 1KQSM 4BG8A 5AZJA 1D9FA 3AAQA 1DT9A 3SQ4A 4FYDA 4GVMA 4DTUA 5M1OA 1V4TA 4C1NI 2OANA 5EX5A 1NK7A 1L3SA 4DLGA 1GLCG 3A5NC 3DMJA 4KO0A 1QTMA 3AVGA 1TYQB 3VQ5A 4YDUC 4JEPA 3HBTA 3TABA 4WQ4A 1H1VA 2GTDA 2PFUA 2HMIA 3O1BA 4IWVA 4Q5VA 2P5OA 3H46O 2HMPA 1WNSA 5GAEP 4JK8A 1JLGA 4EIAA 3OYDA 3E01A 3NE6A 2O8CB 1IKYA 1HPZA 3OBYA 5T7BA 1ASWA 1L5UA 3TTCA 1LCUA 1U2VA 1P90A 4OVLA 3M5RA 4BR9A 4H4OA 4DTXA 2NZTA 2RF2A 5CZ1A 2QXFA 3DRPA 3OYCA 2VCPA 4CJ5A 3OYJA 1WLJA 3AVFA 5LMUK 2VG5A 1W97L 1SZ2A 3QIOA 4FM1A 4B1UB 4B9TA 1LW2A 3QLHA 3L3UA 3NGZA 5TKWA 1XHXA 3MK6A 1HUXA 3FFIA 3S3OA 4F9OA 1QSYA 4KRFA 2WTUA 1D9DA 2JWKA 4CGHA 2CH5A 5AQNA 3RVCA 5KRTA 1JLBA 4IXCA 4W5RA 3E9LA 3VQDA 4BR2A 2KFZA 3K58A 4B3RK 1RBUA 3E9PA 4FK2A 4NLCA 3LP3A 2F96A 3J7ZO 2W6LA 4DV7K 3CM5A 3RMAA 4WQ5A 3U8XA 1P8ZA 3PO4A 1VQMN 4ILHA 4OJRA 4FJNA 1JLCA 1RTJA 4CHYA 1TL3A 4FLYA 4PL7A 3OYKA 1WSGA 2QWLA 3P5JA 2E2PA 2IGIA 1WUAA 1S9EA 4DSFA 3QINA 2W42A 3QETA 1VQLN 2E1YA 1U6ZA 1YTAA 3ENOA 1TK8A 4QCLA 1XI1A 1OVQA 1GLEG 5KPZA 4FLTA 2P9LA 3AVAA 4ICLA 2QK9A 2YHWA 3BF1A 4IJAA 3DLGA 4MFBA 4OPHA 3I8BA 2Q1NA 3TPQA 1K9MO 1NK4A 4N41A 2AP1A 4O55A 5AQXA 4KTWA 2E88A 2YJEA 3KLEA 1KVBA 4BROA 5ELZA 5J2MA 4B3TK 4AHSA 4DUZK 2AJQA 3JAMO 3L4QA 4BRIA 4CGGA 3LALA 4CD3A 4ELTA 2YX6A 3L2WA 4HUEA 5SZTA 4BVOA 3H6EA 4Z4HA 1QS4A 2HSTA 4DS4A 4KKOA 3PSIA 1VRTA 2QWNA 3U9DA 3CPEA 4C8MA 1NK5A 4FM0A 3ZSVA 3CPWM 5AQSA 1LAVA 4C8NA 3GBTA 3SNNA 1U47A 1XQSC 3ITHA 4JS4A 1N5YA 4BWJA 2FBYA 1RBSA 5I9EB 4LY7A 2E1ZA 3AGRA 2DTUA 2A41A 2Y1IA 2WBNA 3VGMA 4WFAL 3LP2A 2HF3A 3AVKA 4CECA 4H0YB 4FZYA 2PYLA 1GLFO 1BUPA 3VEVA 3LANA 5GIOA 1RTDA 4DTPA 2OA8A 3C7NB 4ID5A 4YOXA 4YOVA 3U3YA 4CZMA 4ILGB 4DV5K 3KZBA 3DLEA 1X3NA 3WXKA 3CCLN 2G8UA 1G99A 3MECA 2D1KA 4J2AA 3QEIA 2VWBA 5HLFA 2ASMA 4CESA 1Q8IA 3KD5E 1XNRK 3O1WA 5AZJB 2EWSA 3B6PA 5CR4A 3KWGA 4CJ7A 3NGIA 4BRLA 3OYEA 4CEEA 4DR1K 4YOUA 2P9NB 4BRNA 2E2QA 3VF6A 4DF8A 4MLEA 3S3MA 4RW9A 2X74A 5LY3A 3AO3A 4JKDA 3WNGA 3OW2M 2YHBA 2OPQA 3ZYYX 4CD1A 1W0HA 3AGKA 4DR6K 4H0TB 3RRGA 4O8UA 1NLVA 2QKBA 2F4VK 2JGUA 1ZYQA 2A1SA 4RW8A 1Z26A 5F1XA 5JLFA 3ZT2A 4DG1A 4AHVA 3NGYA 1NU0A 4H5RA 3NH2A 1VAZA 4JKAA 2KZMA 5C2DA 4DU4A 2ZJQL 2FXUA 3RRHA 4DWIA 1KAXA 4BRHA 1B9DA 3N4QA 4JI4K 3LWMA 4CJPA 5BR9A 2NRZA 4FXDA 3SLCA 2P9PA 2G8IA 3GL1A 4BGBA 2FBVA 2B4JA 4N47A 2PZSA 4W5TA 2QWQA 4DFJA 3ATVA 3ZSZA 3JSMA 4AHTA 1WSJA 4IFEA 4A62A 1RDCA 4HUFA 5AZIB 3NMUA 3BGRA 3GDQA 2D0OA 4JRQA 3VQCA 3A0IX 4CW7B 3DXKB 1XC3A 4CZFA 4LSNA 2ZM6K 3NF8A 1GOCA 5KI6A 4OPJA 1T8EA 3CHWA 3RMDA 2JLEA 2V51B 2F8SA 1C0MA 3DLRA 1SUQA 3THWA 3AV9A 3C0BA 4ELUA 3F5TA 5BPNA 3OYLA 2UXBK 1REVA 4CGIA 4CK2A 2NUBA 3CFOA 2P9UB 3IS9A 4FJGA 2ATQA
chains in the Genus database with same CATH topology
2J4RA 4FWLA 3O6WA 3MDQA 3FGUA 3CJCA 3VESA 3R1XA 4J8FA 4M7XA 5BREA 5AQMA 3LL3A 4DKWA 3QB0A 2I7NA 4K41A 1KC8O 1U2VB 1NM1A 1NGAA 2HBJA 4FOIA 4BC2A 2FSJA 3EE8A 4IEIA 1BDGA 1XUPO 2A5XA 2P9KB 4I6MA 1QQMA 4BR7A 4BRAA 1Q7YO 5AQZA 3A5MC 4H03B 2QXLA 5JLHA 3TTDA 1NGGA 3LM2A 3UKUB 5AQFA 2P9SA 3GOIA 3AARA 4KBOA 1OVYA 4QS9A 3FZLA 5GINA 4A5BA 3ZETB 2V7ZA 4H0PA 1RDWX 4QS8A 3SAGA 3CQXA 3F9MA 3VEWA 4DHYA 4A5AA 3I56N 1NGFA 1WOQA 3M3ZA 2KLAA 3CJAA 1YXQA 1CZAN 3IFRA 3C65A 4DB3A 5C12A 5CE3A 5KPRA 3CC2N 1NBWA 1T44A 2FF3B 2FSKA 3OA9A 4XH5A 2CGJA 3N4PA 5C10A 4YDUA 4B1YB 1R59O 3KVGA 4WQ4C 5AQHA 5ADXH 1C0GA 3I33A 4ISGA 4JHDA 5BRHA 1NGBA 2A40A 5FPDA 2RE2A 1LOTB 4BRPA 3LDPA 2FSNA 4CZLA 3L0QA 3FE1A 4M63C 1VQON 5M1PA 5BN9A 2QWOA 4JKGB 5HL7L 2QEXN 3L4IA 4KH4A 4B1XB 3P39A 4LC9B 3EO3A 4Y0WA 3CC7N 2QWMA 3D2FB 4K43A 5AQKA 1YJWN 4BRDA 3EN9A 4FWPA 3ID6A 4B1VA 4BGAA 4JK7A 5KQDA 1IJJA 2E2OA 4AF1A 2QI2A 4BRCA 1JJ2M 3A8YA 3CCRN 3WXMB 3SBTA 3VF2A 3IUCA 3B8AX 3SMSA 4CBXA 4GV9A 2YHYA 3O5BA 4BRMA 4BRKA 4IOCL 2OTLN 1T6DA 3DJCA 4CZEA 5AQQA 5AQWA 2IIRA 1TUYA 2IVOA 3O4WA 5DM7L 2QW9A 3WXIA 2E20A 3VGKA 3CCSN 4U67L 4EAHD 3CF5L 3WQUA 1TUUA 2BH1A 3LM9A 4WFBL 3DXKA 5JVGL 3FZMA 3BEXA 1QQNA 3VGLA 4B9QA 2A42A 4YORA 5AQYA 2CGKA 3MX5A 2I7PA 5AR0A 3VEZA 3CERA 4JKFA 1DEJA 1OKJA 3VTIA 5C0YA 1JCEA 5AQIA 4C1NK 1ATNA 2QWRA 1NGHA 3DAWA 2WC9A 3K9JA 2D0PA 3VENA 3P31A 3G6EN 1VQ5N 1E4GT 1YUWA 1S72N 3DXMB 3SJHA 4WF9L 2P9LB 3KHYA 1NWKA 3TSUA 3WUHA 4BY9C 4H5TA 4FPAA 3QMLA 4FWRA 3UE5A 3UKUA 1KQSM 1VQNN 4BG8A 1GLAG 3ZEUB 3NVMA 5AZJA 3O08A 4YOYA 4JHDB 3AAQA 4DQ8A 1DT9A 4Z94A 3LDNA 4BQLA 5BPLA 1GLDG 3EZWA 4YOWA 5M1OA 1YIJN 1V4TA 4C1NI 4ISEA 2OANA 3C6HA 5EX5A 2GWKA 3MCPA 5CHIA 1GLCG 3A5NC 2NRTA 1QZ6A 3NVKA 1TYQB 5AZIA 3CCVN 3ULEA 1V4SA 4JEPA 3HBTA 4YDUC 4WQ4A 4XH4A 3H3NO 1H1VA 2BUPA 3SBGA 2GTDA 2PFUA 1QQOA 1HPMA 3O1BA 4IWVA 5B8HA 1D4XA 3H46O 1MA9B 1GLJO 4A2BA 5BRFA 2HMPA 3VMFB 3HOSA 4MDBA 5GAEP 4K25A 2E8AA 2RHKA 3O8MA 4JK8A 4EIAA 3GE1A 1VQ4N 4KH5A 2OTJN 2V52B 3WEEA 1YJNN 1HX1A 3CETA 3OBYA 3IMXA 3CCJN 1NJIO 2NRXA 1HLUA 4JKEA 3TTCA 1Q86O 1LCUA 1MWKA 2NLXA 4CZGA 3HRGA 1U2VA 2ZGZA 5AQTA 2HBKA 4BG9A 4ISFA 1P90A 1YVNA 3M5RA 4G9ZA 4BR9A 3WXJA 3KK7A 3FLCO 2NZTA 3RSEB 3CJ9A 3MN5A 2FLOA 5AFUA 1RGIA 1ILYA 4B1ZA 1NGJA 5JICA 3C7NA 3DXMA 1YI2N 2NRWA 2VCPA 3BUZB 3D2EB 5FPEA 3E66A 4FWMA 4KH6A 3MCAB 4AM7A 1BO5O 1DGKN 3J8AA 3QFPA 2P9IB 1KAZA 1W97L 5BRDA 1SZ2A 2P9IA 1E4FT 3PLAA 1TYQA 4B1UB 3SAFA 4BRGA 5TKWA 4EHUA 4XEIA 3MK6A 1HUXA 1M90O 2A6AA 4F9OA 3AY9A 3CJ1A 2JWKA 3CI5A 2YJFA 3HZ6A 2CH5A 5EXWA 4A61A 3MN6A 5KPTA 5AQNA 1NGDA 3S41A 3RVCA 4C23A 2ASOA 3EE9A 4FWOA 5TKYA 4BR0A 4EHTA 1GLBG 3HSCA 3VOVA 4BC5A 4IXCA 3E9LA 4CZHA 3PIPL 5F2RA 4BR2A 2GWJA 3VETA 1T6CA 3CJBA 5E84A 2NNWA 3TSPA 3E9PA 4JAXA 4NLCA 1J6ZA 4JKBA 4PHTX 3G25A 4FO0A 2ZGYA 4H0XB 2ZF5O 3J7ZO 4WQ5A 3U8XA 4FL9A 1BG3A 2P9KA 3MX2A 1P8ZA 1T3VA 4PKHA 3QBXA 3H3OB 1VQMN 4ILHA 4FWNA 5AQUA 3ULEB 1BOTO 2CH6A 4FVUA 2F7TA 4PL7A 2QWLA 1HKBA 3HM8A 1Q82O 1VQ8N 1JCGA 3O9RA 4IEEA 2E2PA 1WUAA 3ENBA 5DM6L 2JWLA 5M1FA 3ZEUA 1W2BM 4GNIA 4H0OA 3EKUA 3MN7A 1VQLN 2W40A 3ENHA 4JNEA 2E1YA 1U6ZA 1VQ9N 3ENOA 1BA1A 3O9QA 4ILJA 1GLEG 5KPZA 2P9LA 2AA4A 2YHWA 3BF1A 3TTFA 4WCEL 4IJAA 4E1JA 1YITN 5FPMA 1X9JA 4FPBA 4OPHA 3I8BA 2Q1NA 3TPQA 4I6MB 2VYPA 1K9MO 2AP1A 3QICA 4A59A 1HKCA 2Q97A 3D2FA 1O13A 5EOYA 5AQXA 2E88A 2YJEA 3TSQA 2YHXA 4BROA 5ELZA 4JKGA 4IJNA 1YF5L 3K9KA 3TU5A 3CMEN 4IO8A 5MLCQ 3AAPA 3CC4N 1BU6O 3E9OA 4WFNL 2HOEA 4IZ9A 3L4QA 4FOEA 3CQYA 4BRIA 2IVNA 1Q18A 4IDHA 2CGLA 4CD3A 5LJVA 2Q0UA 4H5WA 2YX6A 3IKMA 3FFKB 4AM6A 4B1WB 3G4SN 4BVOA 3H6EA 2WFBA 4RWTA 2HSTA 2ZWHA 5FPNA 2BTFA 3ZX3A 3LDLA 5AQVA 2QWNA 3U9DA 3CPEA 4MO4A 2ASPA 3JXUA 3VTHA 2NRVA 3ZX0A 1S22A 4OO1J 4CZIA 3W0LA 4FWQA 3SAHA 2P9SB 3CPWM 5AQSA 5AQLA 4NLBA 3GBTA 4JK9A 2QA4N 3KWIA 4O5FA 1XQSC 1Z05A 2KKZA 3O80A 4BREA 2QTDA 1SAZA 4CI6A 3RSEA 4WYBA 3OBWA 2Q0RA 5I9EB 3R9PA 1KD1O 2E1ZA 2QWPA 3FR0A 4WQ5C 3AGRA 1HJOA 1X3MA 2A41A 2WBNA 1QHAA 3VGMA 4BRQA 4WFAL 2A3ZA 2HF3A 3QDKA 5AQJA 4U7BA 3CCUN 1MWMA 4YOTA 1MDUB 5M1NA 5GADP 4H0YB 1ATSA 3ATUA 1GLFO 2QM1A 1BUPA 3CCQN 3VEVA 4IOAL 1VQPN 3EKSA 3ZETA 5GIOA 3OHRA 3WQTA 4R79A 2GEMA 2FF6A 1NMDA 2IVPA 3MN9A 3UB5A 3Q7BA 3C7NB 4L3QA 1K8KA 5AQGA 4CBUA 5GIPA 4CZKA 4JKCA 5AFUH 4YOXA 4XH1A 4YOVA 3CCMN 3HOTA 5BPMA 5AQPA 2GELA 1GLLO 2DPNA 4CZMA 2H3GX 3QBWA 4ILGB 3KZBA 4GY2B 5AQRA 3VERA 2WUSA 1X3NA 3WXKA 4A57A 3CCLN 2Q31A 1G99A 2D1KA 3H45C 1VQ6N 1BWFO 1NGIA 1VQ7N 1DKGD 3O9SA 2ZJRL 2VWBA 4FSVA 3WEEB 4OPAA 2ASMA 1RFQA 3H1VX 2HBLA 4HTLA 5JMVA 1YHQN 3O1WA 5AZJB 2F9WA 2VGMA 1Y64A 3SK3A 4JD2A 1ATRA 2GX9A 4MO5A 4UY8O 1IG8A 2EWSA 3EL2A 3FZHA 5CR4A 3KWGA 3U4LA 1K8KB 4CJ7A 4BRLA 2NRHA 4A2AA 2UYTA 3LDQA 5AQOA 1KXPA 3Q7CA 3BF3A 1KAYA 1HKGA 5EY4A 3MMVA 3O9TA 4YOUA 2P9NB 4BRNA 1ZBSA 4CBWA 2NRRA 3H1QA 2E2QA 3D2EA 3I55N 3VF6A 3E1YA 3M1FA 4MLEA 1EO1A 1SQKA 2D4WA 4BC4A 5H1SQ 5LY3A 4JKDA 4QS7A 5E26A 3D6RA 3OW2M 2YCHA 5F0XA 3R8EA 3R6MA 3ZYYX 4K42A 1Z6RA 4CD1A 1ZXOA 3AGKA 3VF4A 1SS6A 3BP8A 1K8AO 4H0TB 3FZFA 4RCHA 3CIPA 4O8UA 3DLLL 1K73O 1NLVA 1N8RO 3JS6A 4NO7A 5C2FA 3CJ7A 2Q36A 5BN8A 3VPZA 3CMAN 4BQZA 5GAGP 2P9PB 3DWLA 4NB4A 3P38A 2ITMA 3WT0A 4BRFA 5F1XA 2P9UA 5M1QA 1ZC6A 3D7EO 4M7YA 5JLFA 2HBMA 4PKIA 1RDUA 4GV3A 4O8KA 1Q81O 3VEXA 4BC3A 4BR5A 4H0VB 4H5RA 5JVHL 1QVGM 3WXLA 1VAZA 3W3DA 3ZX2A 3O9UA 4JKAA 4BVPA 5C2DA 2ZJQL 2YI1A 2FXUA 2F9TA 4JN4A 1YJ9N 4GV6A 1KAXA 3R3LA 4BRHA 5ADXA 3U9ZA 3N4QA 1VQKN 1QVFM 3M6GA 5KQ8A 5EVZA 5BR9A 3MWPA 2NRZA 3VEOA 3HI0A 3PIOL 4EFHA 3SLCA 3P4IA 3GG4A 4JKHA 2P9PA 3GL1A 4BGBA 2PAVA 5LJWA 4PKGA 2P9NA 4BR4A 2QWQA 3ATVA 3L6QA 4DCHA 3IDHA 5GAHP 4IFEA 4A62A 3CCEN 4H5VA 5AZIB 3VEYA 1BA0A 4RTFD 3NMUA 3UKRA 3G71N 2HF4A 4H5NA 4CZJA 1YAGA 3GDQA 5HOOA 4JD2B 2D0OA 4PL8A 1QZ5A 2E2NA 3C6AA 3A0IX 3A5LC 1M1KO 5C15A 3T69A 3LDOA 3DXKB 3HTVA 4MDAA 1XC3A 4CZFA 3F2KA 3FZKA 1EQYA 2V7YA 4MLHA 3CD6N 3QFUA 5M1KA 3CHWA 3CXCM 2PBDA 4FWKA 2V51B 1C0FA 3T7ZA 3UKRB 3C0BA 1ESVA 2W41A 4IOXA 4IO9L 3F5TA 5BPNA 3MWTA 2VGNA 1NGCA 3ID8A 1NGEA 4HWIA 2ZJPL 2KHOA 1S3XA 2P9UB 1JCFA 3A5OC 2GUPA 2Q2RA 4FWSA 4GVEA 3SMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4R A;  4FWL A;  3O6W A;  3MDQ A;  3FGU A;  3CJC A;  3VES A;  4J8F A;  4M7X A;  5BRE A;  5AQM A;  3LL3 A;  3QB0 A;  2I7N A;  4K41 A;  1U2V B;  1NM1 A;  1NGA A;  4FOI A;  4BC2 A;  2FSJ A;  1BDG A;  1XUP O;  2A5X A;  2P9K B;  4I6M A;  1QQM A;  4BR7 A;  4BRA A;  5AQZ A;  3A5M C;  4H03 B;  2QXL A;  5JLH A;  1NGG A;  3LM2 A;  3UKU B;  5AQF A;  2P9S A;  3GOI A;  3AAR A;  4KBO A;  4QS9 A;  3FZL A;  3ZET B;  2V7Z A;  4H0P A;  1RDW X;  4QS8 A;  3CQX A;  3F9M A;  3VEW A;  4DHY A;  1NGF A;  1WOQ A;  3M3Z A;  3CJA A;  3IFR A;  1YXQ A;  1CZA N;  4DB3 A;  5KPR A;  5CE3 A;  1NBW A;  1T44 A;  2FF3 B;  2FSK A;  4XH5 A;  2CGJ A;  4YDU A;  4B1Y B;  1R59 O;  3KVG A;  4WQ4 C;  5AQH A;  5ADX H;  1C0G A;  3I33 A;  4ISG A;  4JHD A;  5BRH A;  1NGB A;  2A40 A;  5FPD A;  4BRP A;  1LOT B;  3LDP A;  2FSN A;  4CZL A;  3L0Q A;  3FE1 A;  4M63 C;  5BN9 A;  2QWO A;  3L4I A;  4B1X B;  4LC9 B;  3EO3 A;  4Y0W A;  2QWM A;  3D2F B;  4K43 A;  5AQK A;  4BRD A;  3EN9 A;  4FWP A;  4BGA A;  4B1V A;  5KQD A;  1IJJ A;  2E2O A;  4BRC A;  3A8Y A;  3VF2 A;  3IUC A;  3B8A X;  3SMS A;  4CBX A;  2YHY A;  3O5B A;  4BRM A;  4BRK A;  1T6D A;  3DJC A;  4CZE A;  5AQQ A;  5AQW A;  2IIR A;  1TUY A;  2IVO A;  3O4W A;  2QW9 A;  3WXI A;  2E20 A;  3VGK A;  4EAH D;  3WQU A;  1TUU A;  3LM9 A;  3DXK A;  3FZM A;  3BEX A;  1QQN A;  3VGL A;  4B9Q A;  2A42 A;  5AQY A;  2CGK A;  2I7P A;  5AR0 A;  3VEZ A;  3CER A;  1DEJ A;  1OKJ A;  1JCE A;  5AQI A;  1ATN A;  2QWR A;  1NGH A;  3DAW A;  3VEN A;  2D0P A;  1E4G T;  1YUW A;  3DXM B;  3SJH A;  2P9L B;  3KHY A;  1NWK A;  3WUH A;  4H5T A;  4FPA A;  3QML A;  4FWR A;  3UE5 A;  3UKU A;  4BG8 A;  1GLA G;  3ZEU B;  5AZJ A;  3O08 A;  4JHD B;  3AAQ A;  4DQ8 A;  4Z94 A;  3LDN A;  4BQL A;  5BPL A;  1GLD G;  3EZW A;  1V4T A;  4ISE A;  2OAN A;  5EX5 A;  2GWK A;  3MCP A;  1GLC G;  3A5N C;  1QZ6 A;  1TYQ B;  5AZI A;  3ULE A;  1V4S A;  4YDU C;  3HBT A;  4WQ4 A;  4XH4 A;  3H3N O;  1H1V A;  2BUP A;  2GTD A;  1QQO A;  1HPM A;  3O1B A;  4IWV A;  5B8H A;  1D4X A;  3H46 O;  1MA9 B;  1GLJ O;  4A2B A;  5BRF A;  2HMP A;  4K25 A;  2E8A A;  3O8M A;  4EIA A;  3GE1 A;  2V52 B;  3WEE A;  1HX1 A;  3CET A;  3IMX A;  1HLU A;  1LCU A;  1MWK A;  2NLX A;  4CZG A;  1U2V A;  2ZGZ A;  5AQT A;  4BG9 A;  4ISF A;  1YVN A;  4BR9 A;  3WXJ A;  3FLC O;  2NZT A;  3RSE B;  3CJ9 A;  3MN5 A;  2FLO A;  5AFU A;  1RGI A;  4B1Z A;  1NGJ A;  5JIC A;  3C7N A;  3DXM A;  2VCP A;  3BUZ B;  3D2E B;  5FPE A;  4FWM A;  4AM7 A;  1BO5 O;  1DGK N;  3J8A A;  3QFP A;  2P9I B;  1KAZ A;  5BRD A;  1SZ2 A;  2P9I A;  1E4F T;  1TYQ A;  4B1U B;  4BRG A;  4EHU A;  4XEI A;  3MK6 A;  1HUX A;  2A6A A;  4F9O A;  3AY9 A;  3CJ1 A;  3CI5 A;  2YJF A;  3HZ6 A;  2CH5 A;  5EXW A;  4A61 A;  3MN6 A;  5KPT A;  5AQN A;  1NGD A;  3S41 A;  4C23 A;  2ASO A;  5TKY A;  4FWO A;  4BR0 A;  4EHT A;  1GLB G;  3HSC A;  3VOV A;  4BC5 A;  4IXC A;  4CZH A;  5F2R A;  4BR2 A;  2GWJ A;  3VET A;  1T6C A;  3CJB A;  5E84 A;  4JAX A;  1J6Z A;  3G25 A;  4FO0 A;  2ZGY A;  4H0X B;  2ZF5 O;  4WQ5 A;  3U8X A;  4FL9 A;  1BG3 A;  2P9K A;  1P8Z A;  4PKH A;  3QBX A;  3H3O B;  4FWN A;  5AQU A;  3ULE B;  1BOT O;  2CH6 A;  4PL7 A;  2QWL A;  1HKB A;  3HM8 A;  1JCG A;  2E2P A;  1WUA A;  3ZEU A;  4GNI A;  4H0O A;  3EKU A;  3MN7 A;  2W40 A;  3ENH A;  4JNE A;  2E1Y A;  1U6Z A;  3ENO A;  1BA1 A;  1GLE G;  5KPZ A;  2P9L A;  2AA4 A;  2YHW A;  3BF1 A;  4IJA A;  4E1J A;  5FPM A;  1X9J A;  4FPB A;  3I8B A;  2Q1N A;  3TPQ A;  4I6M B;  2VYP A;  2AP1 A;  3QIC A;  1HKC A;  2Q97 A;  3D2F A;  5AQX A;  5EOY A;  2E88 A;  2YJE A;  2YHX A;  4BRO A;  5ELZ A;  4IJN A;  3TU5 A;  4IO8 A;  3AAP A;  1BU6 O;  2HOE A;  4IZ9 A;  4FOE A;  3CQY A;  4BRI A;  2IVN A;  1Q18 A;  2CGL A;  4CD3 A;  5LJV A;  2Q0U A;  4H5W A;  4AM6 A;  3FFK B;  4B1W B;  4BVO A;  3H6E A;  4RWT A;  2ZWH A;  5FPN A;  2BTF A;  3ZX3 A;  3LDL A;  5AQV A;  2QWN A;  3U9D A;  4MO4 A;  2ASP A;  3JXU A;  3ZX0 A;  1S22 A;  4CZI A;  3W0L A;  4FWQ A;  2P9S B;  5AQS A;  5AQL A;  3GBT A;  4O5F A;  1XQS C;  1Z05 A;  3O80 A;  4BRE A;  4CI6 A;  1SAZ A;  3RSE A;  4WYB A;  2Q0R A;  5I9E B;  3R9P A;  2E1Z A;  2QWP A;  3FR0 A;  4WQ5 C;  1HJO A;  1X3M A;  2A41 A;  3VGM A;  1QHA A;  4BRQ A;  2A3Z A;  2HF3 A;  3QDK A;  5AQJ A;  1MWM A;  1MDU B;  4H0Y B;  1ATS A;  3ATU A;  1GLF O;  2QM1 A;  1BUP A;  3VEV A;  3EKS A;  3ZET A;  3OHR A;  3WQT A;  2GEM A;  2FF6 A;  1NMD A;  2IVP A;  3MN9 A;  3UB5 A;  4L3Q A;  3C7N B;  4CBU A;  1K8K A;  5AQG A;  4CZK A;  5AFU H;  4XH1 A;  5BPM A;  5AQP A;  2GEL A;  1GLL O;  2DPN A;  4CZM A;  2H3G X;  3QBW A;  5AQR A;  3KZB A;  4GY2 B;  3VER A;  2WUS A;  1X3N A;  3WXK A;  2Q31 A;  1G99 A;  2D1K A;  3H45 C;  1BWF O;  1NGI A;  1DKG D;  2VWB A;  4FSV A;  3WEE B;  2ASM A;  1RFQ A;  3H1V X;  4HTL A;  5JMV A;  3O1W A;  5AZJ B;  2F9W A;  3SK3 A;  1Y64 A;  4JD2 A;  1ATR A;  4MO5 A;  1IG8 A;  2EWS A;  3EL2 A;  3FZH A;  3U4L A;  1K8K B;  4CJ7 A;  4BRL A;  2NRH A;  4A2A A;  2UYT A;  3LDQ A;  5AQO A;  1KXP A;  3BF3 A;  1KAY A;  1HKG A;  5EY4 A;  3MMV A;  2P9N B;  4BRN A;  1ZBS A;  4CBW A;  3H1Q A;  2E2Q A;  3D2E A;  3VF6 A;  3M1F A;  4MLE A;  1SQK A;  2D4W A;  4BC4 A;  5LY3 A;  4QS7 A;  5E26 A;  2YCH A;  5F0X A;  3R8E A;  3R6M A;  4K42 A;  1Z6R A;  4CD1 A;  1ZXO A;  3VF4 A;  3BP8 A;  4H0T B;  3FZF A;  4RCH A;  3CIP A;  1NLV A;  3JS6 A;  4NO7 A;  3CJ7 A;  2Q36 A;  5BN8 A;  3VPZ A;  4BQZ A;  2P9P B;  3DWL A;  4NB4 A;  2ITM A;  3WT0 A;  4BRF A;  5F1X A;  2P9U A;  5JLF A;  1ZC6 A;  3D7E O;  4M7Y A;  4PKI A;  4O8K A;  3VEX A;  4BC3 A;  4BR5 A;  4H0V B;  4H5R A;  3WXL A;  3W3D A;  3ZX2 A;  4BVP A;  2YI1 A;  2FXU A;  2F9T A;  4JN4 A;  1KAX A;  4BRH A;  5ADX A;  3U9Z A;  3M6G A;  5KQ8 A;  5EVZ A;  5BR9 A;  3VEO A;  3HI0 A;  4EFH A;  3SLC A;  3P4I A;  3GG4 A;  2P9P A;  3GL1 A;  4BGB A;  2PAV A;  5LJW A;  4PKG A;  2P9N A;  4BR4 A;  2QWQ A;  3ATV A;  3L6Q A;  4DCH A;  3IDH A;  4A62 A;  4H5V A;  5AZI B;  3VEY A;  1BA0 A;  4RTF D;  3UKR A;  2HF4 A;  4H5N A;  4CZJ A;  1YAG A;  3GDQ A;  4JD2 B;  2D0O A;  4PL8 A;  1QZ5 A;  2E2N A;  3A0I X;  3A5L C;  3LDO A;  3DXK B;  3HTV A;  1XC3 A;  4CZF A;  3FZK A;  1EQY A;  2V7Y A;  4MLH A;  3QFU A;  3CHW A;  2PBD A;  4FWK A;  2V51 B;  1C0F A;  3UKR B;  3C0B A;  1ESV A;  2W41 A;  5BPN A;  1NGC A;  3ID8 A;  1NGE A;  4HWI A;  2KHO A;  1S3X A;  2P9U B;  1JCF A;  3A5O C;  2GUP A;  2Q2R A;  4FWS A;  3SMP A; 
#chains in the Genus database with same CATH topology
 1BIU A;  2J4R A;  3O4N A;  2FC0 A;  3CJC A;  3VES A;  4J8F A;  5BRE A;  3ULD A;  4LF9 K;  1IKV A;  1TKT A;  1RT5 A;  1U45 A;  2DY4 A;  4Q0B A;  3AA4 A;  1N6Q A;  4H03 B;  3TTD A;  3ZSQ A;  5AQF A;  4JYA K;  4A5B A;  5E41 A;  1RDW X;  4FK4 A;  4BE2 A;  3F9M A;  3DOL A;  3I56 N;  1B9F A;  5KRS A;  1CZA N;  1FJG K;  1TAU A;  5CE3 A;  1NBW A;  3AVJ A;  2O8E A;  3OA9 A;  1LAW A;  2GBZ A;  4LF6 K;  4B1Y B;  1R59 O;  2D0A A;  5AQH A;  4B8C A;  4JV5 K;  4HCC A;  1YTU A;  5FPD A;  2RE2 A;  4DV0 K;  3AVL A;  3SQ0 A;  4QOZ B;  1Q9Y A;  4CZL A;  4CHN A;  5BN9 A;  4X64 K;  4JKG B;  2QEX N;  4JI2 K;  4M3U A;  3VQA A;  3D2F B;  4K43 A;  5AQK A;  4B8A B;  1YJW N;  4O44 A;  4B1V A;  5KQD A;  4FJH A;  1IJJ A;  4AF1 A;  2QI2 A;  3O3G A;  3LWL A;  1J9A A;  4IOC L;  5AQW A;  2HHX A;  2VG7 A;  3O4W A;  2IS3 A;  3WQU A;  1J54 A;  3LM9 A;  2BH1 A;  3HXM A;  4WFB L;  3DXK A;  1X9M A;  4W5Q A;  1I3A A;  3VGL A;  4FJL A;  3MX5 A;  2I7P A;  1K6Y A;  5AR0 A;  4JKF A;  1JCE A;  1BI4 B;  1VQ5 N;  3K9J A;  3G6E N;  4PQU A;  1E4G T;  1YUW A;  2P9L B;  2KQ2 A;  1NWK A;  3KHY A;  3TSU A;  1L3U A;  4BY9 C;  3O3H A;  4F2S A;  2Z1G A;  3UKU A;  1VQN N;  3CYM A;  1GLA G;  4OX9 K;  3NVM A;  3O08 A;  3OJU A;  2RPI A;  4DF4 A;  4BQL A;  5BPL A;  1GLD G;  3EZW A;  1HMV A;  1RTH A;  2GWK A;  5CHI A;  1EX4 A;  3NDK A;  4FW2 A;  4DFK A;  4FVM A;  1V4S A;  2VG6 A;  5HRP A;  2EHG A;  4NCA A;  1DTQ A;  2BUP A;  3H3N O;  3SBG A;  3HP6 A;  4NYN A;  3JYT A;  3OS2 A;  5B8H A;  4CFB A;  3KD1 E;  5D3G A;  4A2B A;  1GLJ O;  2HVI A;  3VMF B;  4K25 A;  3O8M A;  1BL3 A;  2YNH A;  2V52 B;  4JI6 K;  3WEE A;  3IMX A;  3CCJ N;  4CIF A;  2NRX A;  1HQU A;  4JKE A;  4IFV A;  2NLX A;  4CZG A;  2ZGZ A;  3BY5 A;  1N33 K;  2LSN A;  3T1Y K;  1TAQ A;  1IG9 A;  3FLC O;  1VSJ A;  1HNW K;  2FLO A;  1ILY A;  4B1Z A;  1NGJ A;  5JIC A;  3DXM A;  2Y1J A;  4BE1 A;  2RKI A;  3D2E B;  3M8P A;  2VQF K;  4CF8 A;  4CJL A;  4FWM A;  3MCA B;  1WSH A;  1BO5 O;  3RTV A;  4KTZ A;  1KAZ A;  4DMN A;  3PLA A;  3SAF A;  4BWM A;  1KTQ A;  4DUY K;  3QES A;  1KLM A;  4OKK A;  3HZ6 A;  5EXW A;  4A61 A;  4DV2 K;  2FBX A;  5HRS A;  3EE9 A;  5KGW A;  3D45 A;  4PA1 A;  3HSC A;  4OLB A;  1KVC A;  3HK2 A;  3PIP L;  4FJM A;  1T6C A;  1KLN A;  1GOB A;  3CJB A;  5E84 A;  4Z4I A;  3TSP A;  4BAC A;  1KCF A;  2HNY A;  4JKB A;  4LH4 A;  3AVN A;  4PHT X;  3G25 A;  3KTQ A;  3O4Q A;  2ZF5 O;  4FL9 A;  4K8X A;  1UWB A;  1T3V A;  3O3F A;  2Z1H A;  1T05 A;  1C6V A;  4FWN A;  2Z1J A;  2XY6 A;  3SYZ A;  3PO5 A;  1RT1 A;  2F7T A;  4YFU A;  3HM8 A;  1Q82 O;  4IEE A;  2P51 A;  2ETJ A;  5M1F A;  3ZEU A;  4GNI A;  1RT4 A;  3DLH A;  1VQ9 N;  1CXQ A;  1VSM A;  3HVT A;  3TTF A;  4E1J A;  1YIT N;  4B9L A;  5A2Q O;  1X9W A;  4DQQ A;  4KB1 A;  2G8H A;  3D2F A;  1O13 A;  2YKM A;  4OLA A;  2YHX A;  1VSH A;  4JKG A;  1KFD A;  1L3V A;  3TU5 A;  3QEX A;  4IO8 A;  2XY8 A;  5MLC Q;  4CJQ A;  3CC4 N;  3E9O A;  3OVN A;  2HOE A;  4FOE A;  4H5W A;  3IKM A;  4X66 K;  3D0P A;  1RT6 A;  4B1W B;  3L3V A;  3G4S N;  1LV5 A;  4RWT A;  2WFB A;  2ZWH A;  3HJF A;  3ZX3 A;  3G10 A;  3LDL A;  5AQV A;  1HYS A;  5BR8 K;  4DSI A;  1C1B A;  4CZI A;  3W0L A;  4KRE A;  4FWQ A;  3SAH A;  4JK9 A;  3LAM A;  2QA4 N;  3KWI A;  4O5F A;  1Z05 A;  1JKH A;  2E6M A;  1HYV A;  3RSE A;  3OBW A;  4M3Z A;  3T1A A;  1Q9X A;  3R9P A;  1KD1 O;  1HJO A;  4Y1C A;  3HVR A;  1QHA A;  3C6T A;  3QDK A;  5M1N A;  1ATS A;  3CCQ N;  4IOA L;  1BIS A;  4FLU A;  4E0D A;  3ZET A;  5FDL A;  1NKB A;  3OHR A;  3WQT A;  5JS2 A;  4UQG A;  2VWK A;  2FF6 A;  5SWM A;  3V9X A;  4CK1 A;  3MN9 A;  3UB5 A;  3Q7B A;  3VA3 A;  1K8K A;  5FRM A;  5GIP A;  4LF5 K;  4DR7 K;  5AFU H;  4XH1 A;  3HOT A;  5BPM A;  2DPN A;  4I2Q A;  2H3G X;  5AQR A;  4B3S K;  2WUS A;  3V1Q A;  3H45 C;  1VSE A;  1NGI A;  1VQ7 N;  4FSV A;  3WEE B;  3VQE A;  4DSK A;  3H1V X;  4FZZ A;  4CJT A;  5JMV A;  1J5E K;  3IAY A;  2F9W A;  3SK3 A;  1NKC A;  2GX9 A;  3IRX A;  1J53 A;  4UY8 O;  4Z4E A;  3EL2 A;  1K8K B;  4A2A A;  5AQO A;  3LDQ A;  3DRS A;  1SKW A;  2UUA K;  3OYA A;  3TAP A;  1HKG A;  1N32 K;  5EY4 A;  1ZBS A;  3I55 N;  3OYN A;  3H1Q A;  3TWH A;  2PYJ A;  1VSI A;  1SQK A;  3V81 A;  4ID1 A;  3BZC A;  4LFA K;  4CVN E;  4QS7 A;  4DQR A;  4ELV A;  1S1V A;  4O0J A;  3V9Z A;  1Z6R A;  1WBD A;  3K0S A;  1S9G A;  3VF4 A;  4RCH A;  3AVH A;  3G0Z A;  3CIP A;  5FLX O;  3J80 O;  3DLL L;  1SL1 A;  1K73 O;  3RR8 A;  4CFC A;  3DM2 A;  1XHZ A;  1NOZ A;  1S1U A;  2BGG A;  2Q36 A;  3QNN A;  2OCE A;  5GAG P;  4BRF A;  3WT0 A;  3P38 A;  3NF9 A;  5KTQ A;  2HHT A;  3OJS A;  4M3T A;  4GV3 A;  1EET A;  4OKE A;  4BR5 A;  1N36 K;  5JVH L;  3VQ6 A;  1LWC A;  3ZX2 A;  3O9U A;  1NOY A;  1BCM A;  3R3L A;  5ADX A;  4DU3 A;  1U4B A;  1VQK N;  2ITG A;  1OH6 A;  4JKH A;  1IBL K;  3LZI A;  4PKG A;  2P9N A;  4CFA A;  4DV3 K;  4BR4 A;  1XMO K;  4DSE A;  1ITG A;  1WSF A;  4W5N A;  5KGX A;  5GAH P;  1MU2 A;  2HF4 A;  4ZTJ A;  4B3O A;  2R7Y A;  3SQ1 A;  1QZ5 A;  3AO1 A;  2OYQ A;  4CGJ A;  3T69 A;  3LDO A;  4MDA A;  3S9H A;  3SQ2 A;  1EQY A;  4MLH A;  5HRN A;  3UIQ A;  2O8E B;  2HHS A;  1BQN A;  3CQ8 A;  2PBD A;  3K2P A;  3KLF A;  3NAE A;  2HW3 A;  3AO5 A;  1HNX K;  3RMC A;  1T7P A;  3LZJ A;  3ID8 A;  3NFA A;  4AQY K;  1OH8 A;  4HWI A;  1JCF A;  2Q2R A;  2IAJ A;  4FJX A;  1IKX A;  4IDK A;  4M7X A;  1QSL A;  1NGA A;  3TAR A;  4FOI A;  2PY5 A;  3J7A P;  3SCX A;  4PWD A;  4IEI A;  1BDG A;  2ZQB A;  1XUP O;  3K57 A;  2DFE A;  4BR7 A;  4NCG A;  1N34 K;  4KV8 A;  5J2P A;  4BRA A;  3A5M C;  3PY8 A;  2QXL A;  3EZ5 A;  1NGG A;  3UKU B;  4CJK A;  4EZ6 A;  2UUB K;  2O8F B;  4H0P A;  4QS8 A;  4Z4F A;  3VEW A;  4DHY A;  4FJK A;  1NGF A;  1RIL A;  2KLA A;  1CLQ A;  3C65 A;  2FF3 B;  1T44 A;  3L2R A;  5C10 A;  4YDU A;  1D5A A;  4WQ4 C;  3PV8 A;  5K14 A;  1C0G A;  5BRH A;  4JHD A;  1NGB A;  1NG9 A;  4BRP A;  1LOT B;  3QEW A;  4K8Z A;  1E3M A;  1S5J A;  3L0Q A;  3C94 A;  4M63 C;  3MXI A;  2IDO A;  5M1P A;  1VQO N;  4B1X B;  4Y0W A;  4I2P A;  3OYG A;  2E5L K;  4BRD A;  3ID6 A;  2BE2 A;  4JK7 A;  4MQ3 A;  4Z4C A;  3VQP A;  1JJ2 M;  3A8Y A;  3SBT A;  3SMS A;  4CK3 A;  4F3O A;  4IKF A;  1T6D A;  4Z0U A;  4CZE A;  2IIR A;  5IWA K;  5DM7 L;  4M45 A;  2QW9 A;  3WXI A;  1VK0 A;  4FLX A;  2E20 A;  3CCS N;  3OYI A;  4DV4 K;  4EAH D;  3CF5 L;  3L2V A;  4HUG A;  1VSL A;  3TAM A;  4DFM A;  1SV5 A;  3BEX A;  1QQN A;  1TVR A;  2CGK A;  3LP1 A;  3CER A;  2W6K A;  1DEJ A;  3VTI A;  1NGH A;  2WC9 A;  1A5W A;  1CXU A;  3NHG A;  3VQB A;  2UUC K;  3DXM B;  4ZHR A;  3OYM A;  4WE1 A;  3WUH A;  3EYZ A;  4FPA A;  4GMJ B;  4FWR A;  1LWF A;  1C1A A;  4JHD B;  4DQ8 A;  4Z94 A;  4YOY A;  1NK6 A;  4YOW A;  1YIJ N;  4B9V A;  2D0B A;  1CZB A;  3NF6 A;  2YNI A;  3J7Y P;  2HB5 A;  3V9W A;  3CCV N;  4KFB A;  3L8B A;  1A5X A;  3ULE A;  4E7J A;  5HBM A;  5C25 A;  2OPS A;  1ASV A;  3QER A;  5EU7 A;  4XIU A;  3SI6 A;  1QQO A;  1D4X A;  1JLQ A;  2O8B B;  1MA9 B;  3HOS A;  1JXE A;  1IO2 A;  2RHK A;  3GE1 A;  2RN2 A;  2YNF A;  4N5S A;  1YJN N;  1HX1 A;  1RT7 A;  1XWL A;  2O4I A;  1NJI O;  3OS1 A;  1C0U A;  3P1G A;  3HRG A;  5AQT A;  2HBK A;  4BG9 A;  4ISF A;  4H8K A;  5AJ3 K;  3RSE B;  3TAF A;  3MN5 A;  1RGI A;  2ZD1 A;  1XC9 A;  3MXJ A;  3V1R A;  4NYF A;  3C7N A;  3K5O A;  1YI2 N;  3BUZ B;  5FPE A;  3K59 A;  3DRR A;  3E66 A;  4KH6 A;  1QE1 A;  4DR5 K;  4GW6 A;  4CJU A;  1DGK N;  4KHP K;  5BRD A;  4LF7 K;  2P9I A;  1E4F T;  4HVJ A;  1FK9 A;  3U6F A;  4EHU A;  4XEI A;  2OZM A;  4X65 K;  3LDS A;  1M90 O;  4EP5 A;  1UA0 A;  4M3R A;  3CI5 A;  2YJF A;  5KPT A;  1NGD A;  3S41 A;  4C23 A;  4CEB A;  2ASO A;  5TKY A;  4DTN A;  4EHT A;  1JL2 A;  1LWE A;  4E3S A;  3TAN A;  3VET A;  4FJ5 A;  2D5R A;  4CE9 A;  4Z4G A;  4DU1 A;  2G8V A;  1JXB A;  5LL6 Z;  3OYF A;  4FO0 A;  4H0X B;  3HPO A;  1RBR A;  4E7I A;  1BG3 A;  1XNQ K;  1S1T A;  4CEF A;  4PKH A;  3BDP A;  3H3O B;  5AQU A;  3TI0 A;  2CH6 A;  4B08 A;  4FVU A;  1QHT A;  1JCG A;  3O9R A;  3HPH A;  5DM6 L;  1W9H A;  4LF4 K;  1W2B M;  3MN7 A;  4CJ3 A;  3AVC A;  3DYA A;  3ENH A;  4JNE A;  1BA1 A;  2EX3 A;  3M8R A;  1HRH A;  3K5N A;  2AA4 A;  4WCE L;  2XY5 A;  4G1Q A;  4FPB A;  4V19 S;  4Y1D A;  4I6M B;  2VYP A;  1TKX A;  3QIC A;  3ZSR A;  1HKC A;  2Q97 A;  1T03 A;  5EOY A;  1L3T A;  4O4G A;  4IJN A;  2P5G A;  3HYF A;  4DTJ A;  1YF5 L;  3AAP A;  4IZ9 A;  3CQY A;  4KTQ A;  4FK0 A;  4FZX C;  4IDH A;  1TKD A;  1HNZ K;  2YKN A;  2Q0U A;  4AM6 A;  1ZBI A;  1LW0 A;  2XRI A;  5FPN A;  1IBK K;  2X6N A;  1BI4 A;  4OO1 J;  3K5L A;  4AH9 A;  3ZT0 A;  1R0A A;  2P9S B;  5AQL A;  4NLB A;  1NNE A;  2KKZ A;  4BRE A;  1U48 A;  4CI6 A;  4WYB A;  1U49 A;  4F4K A;  4WQ5 C;  1X3M A;  1DTT A;  4BRQ A;  1SL0 A;  2E6L A;  5AQJ A;  3OTO K;  1MWM A;  4YOT A;  1MDU B;  3ATU A;  3RR7 A;  3THX A;  1RT3 A;  1VQP N;  4B9N A;  2Z1I A;  4LD0 A;  4N76 A;  2IVP A;  4CBU A;  1J5O A;  4BDZ A;  5DMR A;  4CZK A;  3CCM N;  3LAK A;  1Y97 A;  2GEL A;  5AQP A;  1UOC A;  3VER A;  3H08 A;  1HJR A;  4CF9 A;  3KLG A;  2F8T A;  1BWF O;  4CER A;  2ZJR L;  1RTI A;  4KHN A;  2KTQ A;  1RFQ A;  4YNQ A;  3T1H K;  4CHZ A;  4HTL A;  1YHQ N;  1ASU A;  1Y64 A;  4JD2 A;  4HHT A;  1ATR A;  4MO5 A;  1YT3 A;  3ZSO A;  2NRH A;  4DV6 K;  1UA1 A;  3Q7C A;  2GUI A;  1KAY A;  3BF3 A;  4PUO A;  4N56 A;  3O9T A;  4CBW A;  3RWU A;  3VQQ A;  3E1Y A;  1VSK A;  3M1F A;  3B6O A;  5H1S Q;  5E26 A;  4E1N A;  2G8K A;  2YCH A;  3R8E A;  3R6M A;  4EZ9 A;  2WON A;  1SS6 A;  3BP8 A;  1K8A O;  4DTS A;  3PUF A;  3FZF A;  1F21 A;  1BQM A;  4CED A;  1SKR A;  1EXQ A;  2O8F A;  4LSL A;  3C95 A;  5C2F A;  3CJ7 A;  3VQ8 A;  4AIL C;  5JS1 A;  3RMB A;  5CZ2 A;  3CMA N;  4KI4 A;  3DLB A;  4BQZ A;  4NB4 A;  2P9U A;  3SPY A;  3D7E O;  4M7Y A;  2HBM A;  3ZT3 A;  1RDU A;  1ZBU A;  1Q81 O;  3VEX A;  4CEA A;  4DSL A;  3SV4 A;  4JN4 A;  1YJ9 N;  5I42 A;  3U9Z A;  4M42 A;  1QVF M;  3M6G A;  5EVZ A;  1BIZ A;  3MWP A;  3VEO A;  3HI0 A;  3PIO L;  3P4I A;  4DTM A;  2PAV A;  1FXX A;  1C0T A;  1Z25 A;  3L6Q A;  3IDH A;  3CCE N;  4KI6 A;  3NF7 A;  2DFF A;  2HNZ A;  3UKR A;  4DQS A;  3G71 N;  4CZJ A;  1YAG A;  4NCB A;  2E2N A;  3A5L C;  5C15 A;  1UAX A;  3PX6 A;  3FZK A;  1IBM K;  2V7Y A;  4M3X A;  3CD6 N;  3QFU A;  4FWK A;  4JRP A;  3UKR B;  1ESV A;  4M41 A;  4IO9 L;  3MWT A;  2VGN A;  3SUO A;  1NGC A;  2ZJP L;  1S6Q A;  3MAQ A;  3WNE A;  2KHO A;  1S3X A;  1JL1 A;  2GUP A;  4X62 K;  1IV0 A;  3NH0 A;  2KW4 A;  4FLV A;  3R1X A;  2FBT A;  2WOM A;  5AQM A;  3LL3 A;  3QB0 A;  1OH5 A;  2B6A A;  2IOC A;  4K41 A;  3PX0 A;  3BZK A;  2HBJ A;  2FSJ A;  4I7F A;  3CG7 A;  3TAE A;  3L2Q A;  3EEQ A;  2P9K B;  1HYZ A;  3DLK A;  1Q7Y O;  2HHQ A;  2O8B A;  3LM2 A;  2P9S A;  3AAR A;  4KBO A;  1OVY A;  3FZL A;  3ZET B;  2V7Z A;  4J2D A;  4A5A A;  3CFP A;  1HQE A;  3CJA A;  3IFR A;  4I9L A;  1EP4 A;  5KPR A;  5C12 A;  1XMQ K;  3AVM A;  3CC2 N;  3KK2 A;  2FSK A;  2CGJ A;  1HNV A;  4LFB K;  4FLZ A;  4FJI A;  4F2R A;  2A40 A;  2BDP A;  3LDP A;  2FSN A;  2VWJ A;  2HHW A;  3FE1 A;  4M3Y A;  2P1J A;  3VQ7 A;  5HL7 L;  3IG1 A;  5HP1 A;  3L4I A;  3P39 A;  4LC9 B;  1SL2 A;  2QWM A;  2O8C A;  4J2B A;  4JI0 K;  4CJ4 A;  3ZSX A;  3EN9 A;  1JLA A;  4FWP A;  2I5J A;  3SZ2 A;  2O8D B;  3CCR N;  1QQC A;  3WXM B;  3VF2 A;  3B8A X;  1D8Y A;  4CBX A;  4B3M K;  3O5B A;  1QSS A;  4OGE A;  4E19 A;  3NBP A;  4W5O A;  4DSJ A;  3VGK A;  2UXC K;  4JI1 K;  3OY9 A;  1X9S A;  4FCY A;  3HL8 A;  4CF2 A;  5JVG L;  3FZM A;  4B9Q A;  3MXM A;  2A42 A;  4JI5 K;  4CCH A;  5AQY A;  1IKW A;  3KKR A;  3VEZ A;  1CZ9 A;  3M8S A;  3NCI A;  5C0Y A;  3TR8 A;  5J2Q A;  3ALY A;  2ZE2 A;  3P31 A;  4E1M A;  5CY4 A;  1TGO A;  4QAG A;  4WF9 L;  4AHU A;  2HHU A;  1RDB A;  3QML A;  3UE5 A;  4DTR A;  3ZEU B;  4O0I A;  1JLE A;  3LDN A;  4ISE A;  3C6H A;  4YHH K;  4C8K A;  1S1W A;  3MCP A;  2NRT A;  4LH5 A;  1QZ6 A;  3NVK A;  3AA5 X;  5AZI A;  2KZZ A;  4CF1 A;  1OH7 A;  4XH4 A;  1BGX T;  4DQP A;  1VRU A;  4CF0 A;  4DV1 K;  1HPM A;  4RG8 A;  4FJJ A;  3WNF A;  5BRF A;  1S1X A;  2HND A;  4MDB A;  4L8R B;  2E8A A;  1VQ4 N;  3V1O A;  4KH5 A;  2OTJ N;  5FRO A;  3CET A;  1NK8 A;  1HLU A;  5FRN A;  1Q86 O;  1MWK A;  4R5P A;  1WSE A;  1YVN A;  1NJX A;  4G9Z A;  3WXJ A;  5DK5 A;  3KK7 A;  1HR0 K;  4CJV A;  3CJ9 A;  5AFU A;  2BAN A;  4CFD A;  2NRW A;  3CFR A;  3T3F A;  4CEQ A;  1BCO A;  4AM7 A;  3J8A A;  1RCH A;  3QFP A;  1ZBF A;  2P9I B;  3SV3 A;  4CJF A;  2X78 A;  1TYQ A;  4KHQ A;  4BRG A;  3EY1 A;  3F73 A;  3PX4 A;  1FW6 A;  4JI3 K;  3TAQ A;  1FKO A;  1EWQ A;  5IT9 O;  2A6A A;  3AY9 A;  3AVB A;  3CJ1 A;  2G8F A;  3MN6 A;  2X6S A;  3SUQ A;  1RBV A;  4FWO A;  4BR0 A;  1GLB G;  3VOV A;  4BC5 A;  4I9Q A;  1TV6 A;  4CZH A;  5F2R A;  1NMN A;  2GWJ A;  3ZCM A;  4JLH A;  2NNW A;  4CGF A;  4JAX A;  4GKK K;  1J6Z A;  2HHV A;  2ZGY A;  4DTO A;  2P9K A;  3MX2 A;  2YNG A;  3QBX A;  3ULE B;  1NJY A;  1BOT O;  4J2E A;  3M8Q A;  2B5J A;  1HKB A;  1VQ8 N;  4YY3 K;  3ENB A;  2JWL A;  3AA2 A;  4H0O A;  4CHP A;  3EKU A;  4C8L A;  2W40 A;  3O9Q A;  4ILJ A;  4DS5 A;  1HNI A;  5C42 A;  1EKE A;  2GV9 A;  4B9S A;  1O1W A;  5FPM A;  1X9J A;  4AHR A;  1FKP A;  2QKK A;  3QEP A;  3ZT1 A;  1NKE A;  4F8R A;  4A59 A;  5I3U A;  1WB9 A;  3TSQ A;  1WN7 A;  1ZBL A;  4ZTF A;  3K9K A;  4CGD A;  3KK3 A;  3CME N;  4F3T A;  1BU6 O;  4WFN L;  3KLI A;  2IVN A;  3VN5 A;  1Q18 A;  2CGL A;  4OKJ A;  3T19 A;  5LJV A;  4KHS A;  3FFK B;  5CYQ A;  2D0C A;  3V9U A;  4H4M A;  2BTF A;  4JS5 A;  4DR2 K;  3ZSW A;  4K0K K;  4MO4 A;  2ASP A;  3JXU A;  3VTH A;  2NRV A;  3ZLJ A;  3ZX0 A;  1S22 A;  1WAJ A;  5HRR A;  4LFC K;  3AVI A;  5J1E A;  4IG0 A;  3QNO A;  1RNH A;  3O80 A;  5J2N A;  2QTD A;  1SAZ A;  2Q0R A;  4RW7 A;  3FR0 A;  2QWP A;  3KJV A;  2A3Z A;  3VQ4 A;  4U7B A;  3CCU N;  5GAD P;  2QM1 A;  3EKS A;  3NH1 A;  3C6U A;  2YV0 X;  3SUP A;  4R79 A;  2GEM A;  1RDA A;  1NMD A;  4L3Q A;  2XO7 A;  5AQG A;  1RT2 A;  4CHO A;  4JKC A;  2OPR A;  1SKS A;  4KHU A;  3HPG A;  1GLL O;  4E7H A;  1KFS A;  3QBW A;  4GY2 B;  4A57 A;  2Q31 A;  3L2U A;  3V9S A;  3HT3 A;  4CJR A;  1VQ6 N;  3SUN A;  3OYB A;  1DKG D;  3O9S A;  1TK5 A;  3KK1 A;  4OPA A;  2IC3 A;  2HBL A;  2YHA A;  4FW1 A;  2VGM A;  3A2F A;  1YVU A;  1IG8 A;  3FZH A;  2VQE K;  3HP9 A;  3U4L A;  2A1R A;  4BDY A;  1I94 K;  2UYT A;  1KXP A;  2XHB A;  4AHC A;  4FJ7 A;  1NJW A;  3MMV A;  3S3N A;  4BDP A;  2NRR A;  1A5V A;  3D2E A;  3DOK A;  4CIE A;  3CM6 A;  2Q3S A;  3U3G A;  1KRP A;  1EO1 A;  2D4W A;  4BC4 A;  3THV A;  3D6R A;  5F0X A;  4KHW A;  2UXD K;  4K42 A;  3K5M A;  4E89 A;  1ZXO A;  4DFP A;  4FJ9 A;  1EWR A;  2KFN A;  3J81 O;  1N8R O;  5LMN K;  4RW4 A;  3JS6 A;  4NO7 A;  4DLE A;  4OGC A;  3VA0 A;  5BN8 A;  4RW6 A;  3VPZ A;  3TAG A;  2P9P B;  3DWL A;  2ITM A;  4CEO A;  4O5B A;  5M1Q A;  1ZC6 A;  3HM9 A;  4PKI A;  3MEE A;  4O8K A;  1C1C A;  4BC3 A;  4H0V B;  1QVG M;  3WXL A;  3W3D A;  5CYM A;  1VSF A;  1X1P A;  3QEV A;  3F9K A;  4BVP A;  2YI1 A;  2F9T A;  3ASM A;  4KPY A;  4GV6 A;  4NXM K;  3PSF A;  3VQ9 A;  2UU9 K;  5KQ8 A;  1RBT A;  4EFH A;  3GG4 A;  4IG3 A;  5LJW A;  4CJS A;  3AO4 A;  1WSI A;  3THY A;  4DCH A;  3THX B;  2HHH K;  4H5V A;  3I0S A;  3VEY A;  1BA0 A;  4RTF D;  2DFH A;  4H5N A;  5HOO A;  4PY5 A;  4JD2 B;  4PL8 A;  4CIG A;  3C6A A;  1M1K O;  3HTV A;  3KIO A;  3F2K A;  5M1K A;  3CXC M;  4KAZ A;  1S6P A;  1VSD A;  4BE0 A;  1C0F A;  3T7Z A;  4KHY A;  2W41 A;  4IOX A;  3AO2 A;  3KLH A;  1NGE A;  3I0R A;  2HVH A;  3A5O C;  4FWS A;  1GOA A;  1W7A A;  4NXN K;  4GVE A;  3SMP A;  4M3W A;  4DQI A;  4FWL A;  3O6W A;  4LF8 K;  4CHQ A;  1BHL A;  3MDQ A;  3FGU A;  4HTU A;  1KSP A;  3QIP A;  4CJW A;  4JI8 K;  4DKW A;  2I7N A;  4HCB A;  1KC8 O;  4IBN A;  1U2V B;  1NM1 A;  3MED A;  3QO9 A;  4BC2 A;  4CJE A;  1TKZ A;  3V6D A;  1NK0 A;  3EE8 A;  1VHX A;  2A5X A;  4I6M A;  1QQM A;  1G15 A;  4IFY A;  2O8D A;  5AQZ A;  4DR4 K;  4EP4 A;  5JLH A;  3ZT4 A;  3GOI A;  2E4L A;  4QS9 A;  4FJ8 A;  2XY7 A;  3SPZ A;  5GIN A;  4B9U A;  1TL1 A;  4JI7 K;  3SAG A;  3I8D A;  3CQX A;  3HO1 A;  3THY B;  1WOQ A;  3WNH A;  3M3Z A;  4DB3 A;  1YXQ A;  1WAF A;  4FLW A;  1RDD A;  3LPU A;  3LPT A;  3P83 D;  4XH5 A;  3N4P A;  1ZBH A;  1NJZ A;  3KVG A;  3V4I A;  1JLF A;  3ZSY A;  5ADX H;  3I33 A;  4ISG A;  3AA3 A;  4B9M A;  1TK0 A;  2QWO A;  1KVA A;  1B92 A;  4KH4 A;  3DI6 A;  3EO3 A;  2OZS A;  2G8W A;  3CC7 N;  4KB0 A;  4BGA A;  3OYH A;  4E7L A;  3ISN C;  2E2O A;  4C8O A;  4DR3 K;  4BRC A;  1WBB A;  3SJJ A;  3IUC A;  1I39 A;  5HRO A;  4TSX A;  4GV9 A;  2YHY A;  4BRK A;  4BRM A;  4E7K A;  2OTL N;  3DJC A;  3LP0 A;  5AQQ A;  3THW B;  1TUY A;  1NK9 A;  2IVO A;  1U04 A;  1IH7 A;  4U67 L;  1TUU A;  4GKJ K;  1DLO A;  2O4G A;  4YOR A;  4CEZ A;  3OS0 A;  4OPK A;  3MEG A;  1OKJ A;  4C1N K;  5AQI A;  1ATN A;  2QWR A;  3DAW A;  3VEN A;  2D0P A;  1S72 N;  5C24 A;  3KKS A;  3SJH A;  4FM2 A;  4H5T A;  3HST B;  2OPP A;  1KQS M;  4BG8 A;  5AZJ A;  1D9F A;  3AAQ A;  1DT9 A;  3SQ4 A;  4FYD A;  4GVM A;  4DTU A;  5M1O A;  1V4T A;  4C1N I;  2OAN A;  5EX5 A;  1NK7 A;  1L3S A;  4DLG A;  1GLC G;  3A5N C;  3DMJ A;  4KO0 A;  1QTM A;  3AVG A;  1TYQ B;  3VQ5 A;  4YDU C;  4JEP A;  3HBT A;  3TAB A;  4WQ4 A;  1H1V A;  2GTD A;  2PFU A;  2HMI A;  3O1B A;  4IWV A;  4Q5V A;  2P5O A;  3H46 O;  2HMP A;  1WNS A;  5GAE P;  4JK8 A;  1JLG A;  4EIA A;  3OYD A;  3E01 A;  3NE6 A;  2O8C B;  1IKY A;  1HPZ A;  3OBY A;  5T7B A;  1ASW A;  1L5U A;  3TTC A;  1LCU A;  1U2V A;  1P90 A;  4OVL A;  3M5R A;  4BR9 A;  4H4O A;  4DTX A;  2NZT A;  2RF2 A;  5CZ1 A;  2QXF A;  3DRP A;  3OYC A;  2VCP A;  4CJ5 A;  3OYJ A;  1WLJ A;  3AVF A;  5LMU K;  2VG5 A;  1W97 L;  1SZ2 A;  3QIO A;  4FM1 A;  4B1U B;  4B9T A;  1LW2 A;  3QLH A;  3L3U A;  3NGZ A;  5TKW A;  1XHX A;  3MK6 A;  1HUX A;  3FFI A;  3S3O A;  4F9O A;  1QSY A;  4KRF A;  2WTU A;  1D9D A;  2JWK A;  4CGH A;  2CH5 A;  5AQN A;  3RVC A;  5KRT A;  1JLB A;  4IXC A;  4W5R A;  3E9L A;  3VQD A;  4BR2 A;  2KFZ A;  3K58 A;  4B3R K;  1RBU A;  3E9P A;  4FK2 A;  4NLC A;  3LP3 A;  2F96 A;  3J7Z O;  2W6L A;  4DV7 K;  3CM5 A;  3RMA A;  4WQ5 A;  3U8X A;  1P8Z A;  3PO4 A;  1VQM N;  4ILH A;  4OJR A;  4FJN A;  1JLC A;  1RTJ A;  4CHY A;  1TL3 A;  4FLY A;  4PL7 A;  3OYK A;  1WSG A;  2QWL A;  3P5J A;  2E2P A;  2IGI A;  1WUA A;  1S9E A;  4DSF A;  3QIN A;  2W42 A;  3QET A;  1VQL N;  2E1Y A;  1U6Z A;  1YTA A;  3ENO A;  1TK8 A;  4QCL A;  1XI1 A;  1OVQ A;  1GLE G;  5KPZ A;  4FLT A;  2P9L A;  3AVA A;  4ICL A;  2QK9 A;  2YHW A;  3BF1 A;  4IJA A;  3DLG A;  4MFB A;  4OPH A;  3I8B A;  2Q1N A;  3TPQ A;  1K9M O;  1NK4 A;  4N41 A;  2AP1 A;  4O55 A;  5AQX A;  4KTW A;  2E88 A;  2YJE A;  3KLE A;  1KVB A;  4BRO A;  5ELZ A;  5J2M A;  4B3T K;  4AHS A;  4DUZ K;  2AJQ A;  3JAM O;  3L4Q A;  4BRI A;  4CGG A;  3LAL A;  4CD3 A;  4ELT A;  2YX6 A;  3L2W A;  4HUE A;  5SZT A;  4BVO A;  3H6E A;  4Z4H A;  1QS4 A;  2HST A;  4DS4 A;  4KKO A;  3PSI A;  1VRT A;  2QWN A;  3U9D A;  3CPE A;  4C8M A;  1NK5 A;  4FM0 A;  3ZSV A;  3CPW M;  5AQS A;  1LAV A;  4C8N A;  3GBT A;  3SNN A;  1U47 A;  1XQS C;  3ITH A;  4JS4 A;  1N5Y A;  4BWJ A;  2FBY A;  1RBS A;  5I9E B;  4LY7 A;  2E1Z A;  3AGR A;  2DTU A;  2A41 A;  2Y1I A;  2WBN A;  3VGM A;  4WFA L;  3LP2 A;  2HF3 A;  3AVK A;  4CEC A;  4H0Y B;  4FZY A;  2PYL A;  1GLF O;  1BUP A;  3VEV A;  3LAN A;  5GIO A;  1RTD A;  4DTP A;  2OA8 A;  3C7N B;  4ID5 A;  4YOX A;  4YOV A;  3U3Y A;  4CZM A;  4ILG B;  4DV5 K;  3KZB A;  3DLE A;  1X3N A;  3WXK A;  3CCL N;  2G8U A;  1G99 A;  3MEC A;  2D1K A;  4J2A A;  3QEI A;  2VWB A;  5HLF A;  2ASM A;  4CES A;  1Q8I A;  3KD5 E;  1XNR K;  3O1W A;  5AZJ B;  2EWS A;  3B6P A;  5CR4 A;  3KWG A;  4CJ7 A;  3NGI A;  4BRL A;  3OYE A;  4CEE A;  4DR1 K;  4YOU A;  2P9N B;  4BRN A;  2E2Q A;  3VF6 A;  4DF8 A;  4MLE A;  3S3M A;  4RW9 A;  2X74 A;  5LY3 A;  3AO3 A;  4JKD A;  3WNG A;  3OW2 M;  2YHB A;  2OPQ A;  3ZYY X;  4CD1 A;  1W0H A;  3AGK A;  4DR6 K;  4H0T B;  3RRG A;  4O8U A;  1NLV A;  2QKB A;  2F4V K;  2JGU A;  1ZYQ A;  2A1S A;  4RW8 A;  1Z26 A;  5F1X A;  5JLF A;  3ZT2 A;  4DG1 A;  4AHV A;  3NGY A;  1NU0 A;  4H5R A;  3NH2 A;  1VAZ A;  4JKA A;  2KZM A;  5C2D A;  4DU4 A;  2ZJQ L;  2FXU A;  3RRH A;  4DWI A;  1KAX A;  4BRH A;  1B9D A;  3N4Q A;  4JI4 K;  3LWM A;  4CJP A;  5BR9 A;  2NRZ A;  4FXD A;  3SLC A;  2P9P A;  2G8I A;  3GL1 A;  4BGB A;  2FBV A;  2B4J A;  4N47 A;  2PZS A;  4W5T A;  2QWQ A;  4DFJ A;  3ATV A;  3ZSZ A;  3JSM A;  4AHT A;  1WSJ A;  4IFE A;  4A62 A;  1RDC A;  4HUF A;  5AZI B;  3NMU A;  3BGR A;  3GDQ A;  2D0O A;  4JRQ A;  3VQC A;  3A0I X;  4CW7 B;  3DXK B;  1XC3 A;  4CZF A;  4LSN A;  2ZM6 K;  3NF8 A;  1GOC A;  5KI6 A;  4OPJ A;  1T8E A;  3CHW A;  3RMD A;  2JLE A;  2V51 B;  2F8S A;  1C0M A;  3DLR A;  1SUQ A;  3THW A;  3AV9 A;  3C0B A;  4ELU A;  3F5T A;  5BPN A;  3OYL A;  2UXB K;  1REV A;  4CGI A;  4CK2 A;  2NUB A;  3CFO A;  2P9U B;  3IS9 A;  4FJG A;  2ATQ A; 
#chains in the Genus database with same CATH homology
 2J4R A;  4FWL A;  3O6W A;  3MDQ A;  3FGU A;  3CJC A;  3VES A;  3R1X A;  4J8F A;  4M7X A;  5BRE A;  5AQM A;  3LL3 A;  4DKW A;  3QB0 A;  2I7N A;  4K41 A;  1KC8 O;  1U2V B;  1NM1 A;  1NGA A;  2HBJ A;  4FOI A;  4BC2 A;  2FSJ A;  3EE8 A;  4IEI A;  1BDG A;  1XUP O;  2A5X A;  2P9K B;  4I6M A;  1QQM A;  4BR7 A;  4BRA A;  1Q7Y O;  5AQZ A;  3A5M C;  4H03 B;  2QXL A;  5JLH A;  3TTD A;  1NGG A;  3LM2 A;  3UKU B;  5AQF A;  2P9S A;  3GOI A;  3AAR A;  4KBO A;  1OVY A;  4QS9 A;  3FZL A;  5GIN A;  4A5B A;  3ZET B;  2V7Z A;  4H0P A;  1RDW X;  4QS8 A;  3SAG A;  3CQX A;  3F9M A;  3VEW A;  4DHY A;  4A5A A;  3I56 N;  1NGF A;  1WOQ A;  3M3Z A;  2KLA A;  3CJA A;  1YXQ A;  1CZA N;  3IFR A;  3C65 A;  4DB3 A;  5C12 A;  5CE3 A;  5KPR A;  3CC2 N;  1NBW A;  1T44 A;  2FF3 B;  2FSK A;  3OA9 A;  4XH5 A;  2CGJ A;  3N4P A;  5C10 A;  4YDU A;  4B1Y B;  1R59 O;  3KVG A;  4WQ4 C;  5AQH A;  5ADX H;  1C0G A;  3I33 A;  4ISG A;  4JHD A;  5BRH A;  1NGB A;  2A40 A;  5FPD A;  2RE2 A;  1LOT B;  4BRP A;  3LDP A;  2FSN A;  4CZL A;  3L0Q A;  3FE1 A;  4M63 C;  1VQO N;  5M1P A;  5BN9 A;  2QWO A;  4JKG B;  5HL7 L;  2QEX N;  3L4I A;  4KH4 A;  4B1X B;  3P39 A;  4LC9 B;  3EO3 A;  4Y0W A;  3CC7 N;  2QWM A;  3D2F B;  4K43 A;  5AQK A;  1YJW N;  4BRD A;  3EN9 A;  4FWP A;  3ID6 A;  4B1V A;  4BGA A;  4JK7 A;  5KQD A;  1IJJ A;  2E2O A;  4AF1 A;  2QI2 A;  4BRC A;  1JJ2 M;  3A8Y A;  3CCR N;  3WXM B;  3SBT A;  3VF2 A;  3IUC A;  3B8A X;  3SMS A;  4CBX A;  4GV9 A;  2YHY A;  3O5B A;  4BRM A;  4BRK A;  4IOC L;  2OTL N;  1T6D A;  3DJC A;  4CZE A;  5AQQ A;  5AQW A;  2IIR A;  1TUY A;  2IVO A;  3O4W A;  5DM7 L;  2QW9 A;  3WXI A;  2E20 A;  3VGK A;  3CCS N;  4U67 L;  4EAH D;  3CF5 L;  3WQU A;  1TUU A;  2BH1 A;  3LM9 A;  4WFB L;  3DXK A;  5JVG L;  3FZM A;  3BEX A;  1QQN A;  3VGL A;  4B9Q A;  2A42 A;  4YOR A;  5AQY A;  2CGK A;  3MX5 A;  2I7P A;  5AR0 A;  3VEZ A;  3CER A;  4JKF A;  1DEJ A;  1OKJ A;  3VTI A;  5C0Y A;  1JCE A;  5AQI A;  4C1N K;  1ATN A;  2QWR A;  1NGH A;  3DAW A;  2WC9 A;  3K9J A;  2D0P A;  3VEN A;  3P31 A;  3G6E N;  1VQ5 N;  1E4G T;  1YUW A;  1S72 N;  3DXM B;  3SJH A;  4WF9 L;  2P9L B;  3KHY A;  1NWK A;  3TSU A;  3WUH A;  4BY9 C;  4H5T A;  4FPA A;  3QML A;  4FWR A;  3UE5 A;  3UKU A;  1KQS M;  1VQN N;  4BG8 A;  1GLA G;  3ZEU B;  3NVM A;  5AZJ A;  3O08 A;  4YOY A;  4JHD B;  3AAQ A;  4DQ8 A;  1DT9 A;  4Z94 A;  3LDN A;  4BQL A;  5BPL A;  1GLD G;  3EZW A;  4YOW A;  5M1O A;  1YIJ N;  1V4T A;  4C1N I;  4ISE A;  2OAN A;  3C6H A;  5EX5 A;  2GWK A;  3MCP A;  5CHI A;  1GLC G;  3A5N C;  2NRT A;  1QZ6 A;  3NVK A;  1TYQ B;  5AZI A;  3CCV N;  3ULE A;  1V4S A;  4JEP A;  3HBT A;  4YDU C;  4WQ4 A;  4XH4 A;  3H3N O;  1H1V A;  2BUP A;  3SBG A;  2GTD A;  2PFU A;  1QQO A;  1HPM A;  3O1B A;  4IWV A;  5B8H A;  1D4X A;  3H46 O;  1MA9 B;  1GLJ O;  4A2B A;  5BRF A;  2HMP A;  3VMF B;  3HOS A;  4MDB A;  5GAE P;  4K25 A;  2E8A A;  2RHK A;  3O8M A;  4JK8 A;  4EIA A;  3GE1 A;  1VQ4 N;  4KH5 A;  2OTJ N;  2V52 B;  3WEE A;  1YJN N;  1HX1 A;  3CET A;  3OBY A;  3IMX A;  3CCJ N;  1NJI O;  2NRX A;  1HLU A;  4JKE A;  3TTC A;  1Q86 O;  1LCU A;  1MWK A;  2NLX A;  4CZG A;  3HRG A;  1U2V A;  2ZGZ A;  5AQT A;  2HBK A;  4BG9 A;  4ISF A;  1P90 A;  1YVN A;  3M5R A;  4G9Z A;  4BR9 A;  3WXJ A;  3KK7 A;  3FLC O;  2NZT A;  3RSE B;  3CJ9 A;  3MN5 A;  2FLO A;  5AFU A;  1RGI A;  1ILY A;  4B1Z A;  1NGJ A;  5JIC A;  3C7N A;  3DXM A;  1YI2 N;  2NRW A;  2VCP A;  3BUZ B;  3D2E B;  5FPE A;  3E66 A;  4FWM A;  4KH6 A;  3MCA B;  4AM7 A;  1BO5 O;  1DGK N;  3J8A A;  3QFP A;  2P9I B;  1KAZ A;  1W97 L;  5BRD A;  1SZ2 A;  2P9I A;  1E4F T;  3PLA A;  1TYQ A;  4B1U B;  3SAF A;  4BRG A;  5TKW A;  4EHU A;  4XEI A;  3MK6 A;  1HUX A;  1M90 O;  2A6A A;  4F9O A;  3AY9 A;  3CJ1 A;  2JWK A;  3CI5 A;  2YJF A;  3HZ6 A;  2CH5 A;  5EXW A;  4A61 A;  3MN6 A;  5KPT A;  5AQN A;  1NGD A;  3S41 A;  3RVC A;  4C23 A;  2ASO A;  3EE9 A;  4FWO A;  5TKY A;  4BR0 A;  4EHT A;  1GLB G;  3HSC A;  3VOV A;  4BC5 A;  4IXC A;  3E9L A;  4CZH A;  3PIP L;  5F2R A;  4BR2 A;  2GWJ A;  3VET A;  1T6C A;  3CJB A;  5E84 A;  2NNW A;  3TSP A;  3E9P A;  4JAX A;  4NLC A;  1J6Z A;  4JKB A;  4PHT X;  3G25 A;  4FO0 A;  2ZGY A;  4H0X B;  2ZF5 O;  3J7Z O;  4WQ5 A;  3U8X A;  4FL9 A;  1BG3 A;  2P9K A;  3MX2 A;  1P8Z A;  1T3V A;  4PKH A;  3QBX A;  3H3O B;  1VQM N;  4ILH A;  4FWN A;  5AQU A;  3ULE B;  1BOT O;  2CH6 A;  4FVU A;  2F7T A;  4PL7 A;  2QWL A;  1HKB A;  3HM8 A;  1Q82 O;  1VQ8 N;  1JCG A;  3O9R A;  4IEE A;  2E2P A;  1WUA A;  3ENB A;  5DM6 L;  2JWL A;  5M1F A;  3ZEU A;  1W2B M;  4GNI A;  4H0O A;  3EKU A;  3MN7 A;  1VQL N;  2W40 A;  3ENH A;  4JNE A;  2E1Y A;  1U6Z A;  1VQ9 N;  3ENO A;  1BA1 A;  3O9Q A;  4ILJ A;  1GLE G;  5KPZ A;  2P9L A;  2AA4 A;  2YHW A;  3BF1 A;  3TTF A;  4WCE L;  4IJA A;  4E1J A;  1YIT N;  5FPM A;  1X9J A;  4FPB A;  4OPH A;  3I8B A;  2Q1N A;  3TPQ A;  4I6M B;  2VYP A;  1K9M O;  2AP1 A;  3QIC A;  4A59 A;  1HKC A;  2Q97 A;  3D2F A;  1O13 A;  5EOY A;  5AQX A;  2E88 A;  2YJE A;  3TSQ A;  2YHX A;  4BRO A;  5ELZ A;  4JKG A;  4IJN A;  1YF5 L;  3K9K A;  3TU5 A;  3CME N;  4IO8 A;  5MLC Q;  3AAP A;  3CC4 N;  1BU6 O;  3E9O A;  4WFN L;  2HOE A;  4IZ9 A;  3L4Q A;  4FOE A;  3CQY A;  4BRI A;  2IVN A;  1Q18 A;  4IDH A;  2CGL A;  4CD3 A;  5LJV A;  2Q0U A;  4H5W A;  2YX6 A;  3IKM A;  3FFK B;  4AM6 A;  4B1W B;  3G4S N;  4BVO A;  3H6E A;  2WFB A;  4RWT A;  2HST A;  2ZWH A;  5FPN A;  2BTF A;  3ZX3 A;  3LDL A;  5AQV A;  2QWN A;  3U9D A;  3CPE A;  4MO4 A;  2ASP A;  3JXU A;  3VTH A;  2NRV A;  3ZX0 A;  1S22 A;  4OO1 J;  4CZI A;  3W0L A;  4FWQ A;  3SAH A;  2P9S B;  3CPW M;  5AQS A;  5AQL A;  4NLB A;  3GBT A;  4JK9 A;  2QA4 N;  3KWI A;  4O5F A;  1XQS C;  1Z05 A;  2KKZ A;  3O80 A;  4BRE A;  2QTD A;  1SAZ A;  4CI6 A;  3RSE A;  4WYB A;  3OBW A;  2Q0R A;  5I9E B;  3R9P A;  1KD1 O;  2E1Z A;  2QWP A;  3FR0 A;  4WQ5 C;  3AGR A;  1HJO A;  1X3M A;  2A41 A;  2WBN A;  1QHA A;  3VGM A;  4BRQ A;  4WFA L;  2A3Z A;  2HF3 A;  3QDK A;  5AQJ A;  4U7B A;  3CCU N;  1MWM A;  4YOT A;  1MDU B;  5M1N A;  5GAD P;  4H0Y B;  1ATS A;  3ATU A;  1GLF O;  2QM1 A;  1BUP A;  3CCQ N;  3VEV A;  4IOA L;  1VQP N;  3EKS A;  3ZET A;  5GIO A;  3OHR A;  3WQT A;  4R79 A;  2GEM A;  2FF6 A;  1NMD A;  2IVP A;  3MN9 A;  3UB5 A;  3Q7B A;  3C7N B;  4L3Q A;  1K8K A;  5AQG A;  4CBU A;  5GIP A;  4CZK A;  4JKC A;  5AFU H;  4YOX A;  4XH1 A;  4YOV A;  3CCM N;  3HOT A;  5BPM A;  5AQP A;  2GEL A;  1GLL O;  2DPN A;  4CZM A;  2H3G X;  3QBW A;  4ILG B;  3KZB A;  4GY2 B;  5AQR A;  3VER A;  2WUS A;  1X3N A;  3WXK A;  4A57 A;  3CCL N;  2Q31 A;  1G99 A;  2D1K A;  3H45 C;  1VQ6 N;  1BWF O;  1NGI A;  1VQ7 N;  1DKG D;  3O9S A;  2ZJR L;  2VWB A;  4FSV A;  3WEE B;  4OPA A;  2ASM A;  1RFQ A;  3H1V X;  2HBL A;  4HTL A;  5JMV A;  1YHQ N;  3O1W A;  5AZJ B;  2F9W A;  2VGM A;  1Y64 A;  3SK3 A;  4JD2 A;  1ATR A;  2GX9 A;  4MO5 A;  4UY8 O;  1IG8 A;  2EWS A;  3EL2 A;  3FZH A;  5CR4 A;  3KWG A;  3U4L A;  1K8K B;  4CJ7 A;  4BRL A;  2NRH A;  4A2A A;  2UYT A;  3LDQ A;  5AQO A;  1KXP A;  3Q7C A;  3BF3 A;  1KAY A;  1HKG A;  5EY4 A;  3MMV A;  3O9T A;  4YOU A;  2P9N B;  4BRN A;  1ZBS A;  4CBW A;  2NRR A;  3H1Q A;  2E2Q A;  3D2E A;  3I55 N;  3VF6 A;  3E1Y A;  3M1F A;  4MLE A;  1EO1 A;  1SQK A;  2D4W A;  4BC4 A;  5H1S Q;  5LY3 A;  4JKD A;  4QS7 A;  5E26 A;  3D6R A;  3OW2 M;  2YCH A;  5F0X A;  3R8E A;  3R6M A;  3ZYY X;  4K42 A;  1Z6R A;  4CD1 A;  1ZXO A;  3AGK A;  3VF4 A;  1SS6 A;  3BP8 A;  1K8A O;  4H0T B;  3FZF A;  4RCH A;  3CIP A;  4O8U A;  3DLL L;  1K73 O;  1NLV A;  1N8R O;  3JS6 A;  4NO7 A;  5C2F A;  3CJ7 A;  2Q36 A;  5BN8 A;  3VPZ A;  3CMA N;  4BQZ A;  5GAG P;  2P9P B;  3DWL A;  4NB4 A;  3P38 A;  2ITM A;  3WT0 A;  4BRF A;  5F1X A;  2P9U A;  5M1Q A;  1ZC6 A;  3D7E O;  4M7Y A;  5JLF A;  2HBM A;  4PKI A;  1RDU A;  4GV3 A;  4O8K A;  1Q81 O;  3VEX A;  4BC3 A;  4BR5 A;  4H0V B;  4H5R A;  5JVH L;  1QVG M;  3WXL A;  1VAZ A;  3W3D A;  3ZX2 A;  3O9U A;  4JKA A;  4BVP A;  5C2D A;  2ZJQ L;  2YI1 A;  2FXU A;  2F9T A;  4JN4 A;  1YJ9 N;  4GV6 A;  1KAX A;  3R3L A;  4BRH A;  5ADX A;  3U9Z A;  3N4Q A;  1VQK N;  1QVF M;  3M6G A;  5KQ8 A;  5EVZ A;  5BR9 A;  3MWP A;  2NRZ A;  3VEO A;  3HI0 A;  3PIO L;  4EFH A;  3SLC A;  3P4I A;  3GG4 A;  4JKH A;  2P9P A;  3GL1 A;  4BGB A;  2PAV A;  5LJW A;  4PKG A;  2P9N A;  4BR4 A;  2QWQ A;  3ATV A;  3L6Q A;  4DCH A;  3IDH A;  5GAH P;  4IFE A;  4A62 A;  3CCE N;  4H5V A;  5AZI B;  3VEY A;  1BA0 A;  4RTF D;  3NMU A;  3UKR A;  3G71 N;  2HF4 A;  4H5N A;  4CZJ A;  1YAG A;  3GDQ A;  5HOO A;  4JD2 B;  2D0O A;  4PL8 A;  1QZ5 A;  2E2N A;  3C6A A;  3A0I X;  3A5L C;  1M1K O;  5C15 A;  3T69 A;  3LDO A;  3DXK B;  3HTV A;  4MDA A;  1XC3 A;  4CZF A;  3F2K A;  3FZK A;  1EQY A;  2V7Y A;  4MLH A;  3CD6 N;  3QFU A;  5M1K A;  3CHW A;  3CXC M;  2PBD A;  4FWK A;  2V51 B;  1C0F A;  3T7Z A;  3UKR B;  3C0B A;  1ESV A;  2W41 A;  4IOX A;  4IO9 L;  3F5T A;  5BPN A;  3MWT A;  2VGN A;  1NGC A;  3ID8 A;  1NGE A;  4HWI A;  2ZJP L;  2KHO A;  1S3X A;  2P9U B;  1JCF A;  3A5O C;  2GUP A;  2Q2R A;  4FWS A;  4GVE A;  3SMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...