4BR4A

Legionella pneumophila ntpdase1 crystal form i, open, apo
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br4A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br4A02
4O5FA 3ATUA 5EX5A 1R59O 1MWMA 3ATVA 3QFPA 3FFKB 2J4RA 2P9KA 2IVOA 2E2NA 1ZC6A 5JLHA 2V7ZA 2QWPA 3MK6A 4FOIA 3O6WA 1GLAG 1OKJA 2YHWA 4KBOA 5AZIA 1ZXOA 1MWKA 3VEYA 5EXWA 2GUPA 2ZWHA 3VF2A 4FWSA 3ULEA 3OHRA 3QMLA 1NBWA 5AQVA 4BG9A 3A8YA 2HF3A 4EAHD 2A3ZA 5EVZA 4FWRA 3CJBA 1H1VA 2OANA 3H1VX 3QBWA 4XEIA 2IVPA 4PKHA 4A2AA 4BRDA 3EN9A 1RGIA 4FPAA 3M3ZA 2QXLA 5ADXH 3W3DA 2D4WA 3QBXA 5BRFA 4RCHA 4FSVA 3GDQA 1GLFO 4BRCA 2P9SB 4I6MA 4BC2A 4CD3A 2BUPA 3HI0A 3HZ6A 4K42A 1Z05A 4GNIA 3D2FB 2NLXA 3LDPA 2P9LA 4Y0WA 1YXQA 5AQUA 4CZGA 4BRKA 3RSEA 3BUZB 2ZGZA 2E8AA 3CJAA 4MLHA 2V51B 5AQLA 3ENOA 2YJFA 3FZKA 3MDQA 1V4TA 2W41A 3ZX0A 2P9NB 3L0QA 3U9DA 3WXLA 2KHOA 4K25A 1QZ6A 2CH5A 4DHYA 2V7YA 2P9UA 3CI5A 5AQOA 4PL7A 1P8ZA 4B1UB 3ZX3A 4XH4A 1BA1A 4WYBA 2HOEA 1XUPO 4H0OA 3HSCA 1NM1A 4WQ5C 3A5OC 3BF1A 3ZX2A 2D1KA 3VF6A 5CE3A 1SQKA 3UB5A 3D2EB 5BPLA 1KAZA 3CETA 3FR0A 3R8EA 3CJ1A 2Q36A 3ZETA 2E1ZA 4HTLA 3JXUA 2E1YA 2IIRA 4FWOA 1XC3A 5LJVA 3EO3A 1JCEA 1NWKA 3AY9A 3R6MA 2IVNA 4BQLA 3CERA 4FO0A 2E2QA 1GLLO 4GY2B 1IG8A 2AA4A 2WUSA 2ITMA 1V4SA 2FXUA 3EL2A 3VF4A 4BC4A 4BVPA 1QQNA 5BREA 1D4XA 3TU5A 5AQZA 2P9KB 4FL9A 3ZEUA 3DJCA 2FLOA 4BRGA 4BRNA 1S3XA 4PKIA 2GEMA 1GLJO 3GOIA 2QWLA 4QS8A 1NGGA 3LM9A 5EY4A 5FPNA 5AZIB 3UE5A 1HX1A 3LM2A 4JD2A 3EKUA 1HLUA 5F0XA 4BRQA 3IFRA 4B1ZA 3A5LC 3HBTA 4RWTA 3UKUB 2NZTA 5E84A 3ULEB 4A61A 1BWFO 4H0TB 3SMPA 4B1VA 3C7NA 2YHYA 2I7NA 4HWIA 4NO7A 2CH6A 4BC5A 1K8KA 2PAVA 3IMXA 1NLVA 3H46O 3UKRA 2NRHA 3QB0A 3DXMB 4BR4A 2PBDA 2V52B 4IO8A 1U2VA 3FZFA 1ATRA 3LDNA 1KAYA 4MO4A 1CZAN 4M7YA 3WT0A 3BP8A 1WOQA 4FWMA 1X3NA 1NGAA 2CGLA 4CD1A 5KPRA 5KQDA 3WXKA 4YDUA 4PKGA 5BPNA 1KXPA 3O08A 4CI6A 4IJAA 4K41A 4NB4A 4Z94A 4FWKA 4PL8A 3AAQA 3I33A 4DCHA 1TYQA 2Q31A 3GE1A 3BF3A 3CQXA 1YUWA 2D0OA 3S41A 5AQMA 3AAPA 2YHXA 2CGKA 5AQQA 4BR9A 2Q0RA 5KPTA 4J8FA 4LC9B 3MN6A 2P9IA 1HUXA 3A5NC 2QWQA 3DXKA 4ISGA 4RTFD 4QS7A 4BRMA 2QM1A 3J8AA 3IDHA 3WEEB 5BR9A 3EKSA 2AP1A 2A6AA 2ASMA 1GLDG 3LL3A 2FSJA 2GELA 3LDLA 4FWPA 2ZGYA 3VEWA 1T44A 1IJJA 3U8XA 5I9EB 1T6DA 5AQSA 4WQ5A 5AQYA 3ZEUB 4CBXA 5JICA 3SLCA 3B8AX 4E1JA 1NGDA 4EHTA 3TPQA 4BR0A 4M7XA 4BRPA 1DKGD 4EFHA 4WQ4C 2Q97A 3CJCA 4FWLA 2H3GX 2W40A 3A0IX 2Q0UA 1C0GA 1XQSC 1ATSA 5FPEA 5AQRA 3VERA 2VWBA 4H0YB 1HJOA 1E4GT 5FPMA 5BN9A 4C23A 4M63C 4JHDB 1EQYA 3LDQA 5E26A 3IUCA 3P4IA 4ISEA 3ID8A 1QZ5A 2FSNA 5AFUH 3VEVA 1NGBA 4IJNA 1NGIA 3WQUA 3D2FA 4JNEA 3SK3A 3W0LA 1GLCG 3O5BA 4CZEA 3QICA 4MLEA 1QQOA 2Q2RA 2E20A 3WXIA 4BG8A 2P9NA 4H5VA 1S22A 2QWNA 3O4WA 3VEZA 1RDWX 2VCPA 4H5RA 4DQ8A 3FLCO 4FOEA 4BGAA 3G25A 2ASPA 5F1XA 2YI1A 3FZLA 4BR5A 3KVGA 1JCGA 3VOVA 4B9QA 2FF6A 1BU6O 3VGKA 3VPZA 1LOTB 4F9OA 3ENHA 3FZHA 5BRHA 2VYPA 5AZJA 1G99A 4L3QA 4H0PA 5AQIA 2E2OA 4H5TA 3CQYA 1QQMA 4EHUA 1BA0A 4I6MB 5LY3A 2A41A 4H03B 5ELZA 2P9IB 4AM6A 2P9LB 3VEOA 4B1XB 1MA9B 3RSEB 1X3MA 3O8MA 4BR2A 4CBUA 3DAWA 4BRAA 3H45C 5AQJA 1HKGA 3M1FA 1NGEA 4BREA 5AQGA 1Z6RA 5EOYA 3EZWA 1U6ZA 2P9UB 1RFQA 3CJ9A 2YJEA 3JS6A 3WQTA 3VGLA 1BDGA 4IXCA 4B1WB 3SMSA 1MDUB 2HF4A 3O80A 1NGHA 2QWOA 1HKCA 4JN4A 4CZKA 5ADXA 3U4LA 3UKUA 4CJ7A 5LJWA 2QW9A 2UYTA 1SZ2A 3ZETB 2P9PA 3SJHA 2CGJA 4YDUC 4FPBA 1J6ZA 5AR0A 3H6EA 2F9WA 3MMVA 3A5MC 4CBWA 2E88A 1HPMA 4H0VB 4IZ9A 5BPMA 5AQXA 1E4FT 1GLBG 2Q1NA 5AQHA 3GG4A 3DXMA 3WXJA 2F9TA 4H5WA 3CHWA 1DGKN 4H0XB 1QHAA 1NGCA 4BRLA 3VENA 2GWKA 1NGJA 2FSKA 3QFUA 3HM8A 4XH1A 3FE1A 2ASOA 4O8KA 3MN9A 2FF3B 3MCPA 4FWNA 4WQ4A 1TUYA 3KZBA 3D7EO 4CZLA 2E2PA 3O1BA 4CZHA 2HMPA 3DWLA 4JD2B 1NGFA 3FGUA 2QWRA 3KHYA 1BG3A 3H1QA 4MO5A 1NMDA 3L6QA 5BRDA 3H3NO 2A40A 4BROA 5KPZA 1KAXA 3GBTA 5AQTA 3C7NB 5B8HA 1Y64A 2GTDA 1ESVA 2YCHA 1K8KB 4BC3A 1BOTO 4FWQA 1X9JA 3LDOA 5AQPA 4QS9A 4XH5A 4K43A 3HTVA 5AZJB 3UKRB 2P9SA 2EWSA 4BQZA 3WUHA 1WUAA 1DEJA 2A5XA 2QWMA 5AFUA 4A2BA 4IWVA 1U2VB 3QDKA 3C0BA 4BRIA 4B1YB 3WEEA 3I8BA 1BO5O 2GWJA 1ATNA 4A62A 3AARA 3VESA 1T6CA 5F2RA 3FZMA 3H3OB 3GL1A 4BRFA 2DPNA 4ISFA 4CZJA 4H5NA 3CJ7A 2I7PA 4EIAA 4AM7A 1TYQB 3M6GA 3F9MA 3VEXA 4JAXA 1SAZA 1C0FA 3BEXA 3D2EA 1JCFA 3VGMA 5KQ8A 3O1WA 5AQWA 4BVOA 4CZFA 4BR7A 3L4IA 1YAGA 2D0PA 3MN7A 2BTFA 1TUUA 3MN5A 5AQFA 4BRHA 4DB3A 4CZMA 4BGBA 5JMVA 3VETA 5JLFA 1YVNA 1LCUA 2A42A 5AQNA 3U9ZA 1HKBA 4CZIA 2P9PB 1BUPA 1GLEG 3CIPA 3DXKB 5BN8A 4JHDA 3R9PA 5FPDA 2ZF5O 5TKYA 5AQKA 1ZBSA 1Q18A
chains in the Genus database with same CATH superfamily
3OJSA 1IH7A 5EX5A 1XNQK 1R59O 3EY1A 3QFPA 1JXBA 1N5YA 2P9KA 3E1YA 1ZC6A 3I0RA 2W42A 1J54A 4CGJA 2G8VA 4CW7B 3VA3A 3NH0A 3AO5A 4KBOA 4JI4K 4UQGA 3M8QA 4W5TA 1RT7A 4DFJA 4CGHA 4I9QA 3VEYA 2O8EB 4LF6K 5IT9O 4KO0A 2G8IA 4IKFA 5EVZA 4PUOA 3OY9A 4KHQA 4FWRA 3K9KA 1CXUA 3H1VX 1S72N 4YHHK 3AVJA 2IVPA 3O3HA 5DMRA 3J80O 3PX6A 4RCHA 3SQ1A 3GDQA 3CCUN 4BRCA 4FLXA 3HI0A 4DR2K 3Q7BA 5KRSA 5EU7A 4K42A 3ZT1A 3D2FB 3DLGA 3LDPA 3QNNA 1BCOA 1EETA 1I39A 2XY7A 4JYAK 2DFHA 3HVTA 4MLHA 4A5AA 3DMJA 5AQLA 1N33K 2XHBA 1IKYA 4YOYA 3C6HA 3CYMA 3FZKA 1QZ6A 5TKWA 3TAQA 2P9UA 4B1UB 1WSFA 4AF1A 1TKTA 1BA1A 3M5RA 2WOMA 1IBKK 1XUPO 1NM1A 4JKFA 1S1WA 1LAVA 1J5OA 3ZX2A 3VF6A 1SQKA 3UB5A 3D2EB 2XY6A 2OA8A 1WBBA 3CETA 4DS5A 3ZETA 2FBXA 2QEXN 3CPWM 1KC8O 2RE2A 1A5WA 3CCSN 3T19A 3RRHA 1NWKA 3P1GA 4BQLA 4DLEA 3CERA 4GY2B 1UAXA 2KTQA 3EE9A 4CERA 1V4SA 4JKHA 1NG9A 4KPYA 4BVPA 2OCEA 2ZJQL 1QQNA 1D4XA 1LW2A 3TU5A 3ZEUA 4FL9A 4CEEA 4FM1A 4BRNA 1S3XA 4PKIA 4OPJA 2GEMA 1EX4A 4AHTA 1RTIA 3LM9A 4FLYA 5AZIB 5A2QO 2DTUA 3VQ7A 3UE5A 5J2QA 1WLJA 2ZE2A 3I55N 1HQUA 4F4KA 3O4NA 1JJ2M 1TAUA 4DSKA 4EZ6A 3ZYYX 2HBJA 1NLVA 2KW4A 3H46O 1NJYA 1J9AA 2NRHA 2NRTA 2VG6A 3QB0A 3Q7CA 4DTSA 4FJKA 4CJWA 4CJ5A 3BDPA 3RMBA 1U2VA 1HYSA 2P1JA 5J1EA 1ATRA 2YV0X 1LW0A 2NRVA 4M7YA 4IOXA 3CCVN 1WOQA 4DS4A 2BANA 3WXKA 4YDUA 4LH4A 1P90A 5BPNA 4CI6A 3VQ8A 4K41A 3EYZA 4MFBA 1IO2A 5JS1A 3AAQA 4CEZA 4CJKA 4DCHA 1TYQA 4Q5VA 3BY5A 1FJGK 5C2DA 1HNIA 1KLMA 2NRRA 1QHTA 3SAHA 5AQQA 4BR9A 3D45A 3CQ8A 5KPTA 1RT3A 4LC9B 2HHVA 4DV1K 1IKXA 1RBUA 2ETJA 2QWQA 3DXKA 4ISGA 4NYNA 4AHUA 3RWUA 4E3SA 4M3YA 5HRNA 4RW7A 4BRMA 3J8AA 2VGMA 2FC0A 2PY5A 3IRXA 1VSHA 5GAEP 2UUCK 3VEWA 1SS6A 4FZZA 1VSJA 4H8KA 4WQ5A 1YIJN 4FYDA 2FBVA 2O4GA 3QNOA 4YOTA 3THYB 4C1NI 4BY9C 4E1JA 2ATQA 4BR0A 3OTOK 4KTQA 1DKGD 4LFCK 4WQ4C 1S1UA 3F2KA 1RDAA 3R3LA 3NE6A 3DLHA 1XQSC 5KTQA 1HJOA 4M3RA 1E4GT 4Z4HA 3LPTA 4CE9A 1VQMN 1Q86O 3HO1A 4LF5K 4DR7K 1REVA 1I94K 3ID6A 3VEVA 1IBLK 3HOTA 1NGIA 3WQUA 3OYJA 4JNEA 4RW8A 1GLCG 3AVAA 4CZEA 2Q2RA 4BG8A 2HVHA 3KK2A 3AO4A 4H5VA 1S22A 3AA4A 4CF2A 3O4QA 1YJNN 5H1SQ 2O8BA 4B9NA 4HCCA 3K5MA 1ZBSA 2PZSA 4FJXA 3VGKA 2GV9A 1YJ9N 1VQ5N 4H4MA 1SKWA 3ENHA 5GADP 3CCQN 2E6MA 5AZJA 1G99A 1VQLN 1VSMA 1XNRK 1FKOA 4H0PA 1ILYA 2E2OA 3AA5X 4GKJK 4H5TA 4YOXA 1IV0A 2G8WA 2QKBA 5C2FA 1BA0A 4I6MB 1W9HA 4GV6A 4H03B 1JXEA 4AM6A 1NKBA 3J81O 1MA9B 4IBNA 4M3ZA 4CBUA 1Q7YO 4DTNA 1U4BA 1TKXA 4BREA 3DLRA 5AQGA 2HBMA 5EOYA 1TK5A 1U6ZA 1S1XA 2UXDK 3JS6A 1ZBUA 3VGLA 1XC9A 1BDGA 4B1WB 1MDUB 3CFPA 4JN4A 1YJWN 1VQPN 3UKUA 4L8RB 3OJUA 4B3RK 3IKMA 1QS4A 4JV5K 4YDUC 3UIQA 1J6ZA 4JK8A 5AR0A 3MMVA 3TI0A 2RN2A 3ULDA 4K0KK 2HNYA 4CJTA 4OX9K 2HHXA 3GG4A 3RVCA 4O44A 4AHVA 3CHWA 1TGOA 1NGCA 3CCJN 1M90O 4BRLA 3THXB 3VENA 2GWKA 4FJHA 1NOYA 4IDKA 3ZSXA 4NYFA 1NGJA 4F2SA 3OYMA 2IGIA 2KKZA 3HM8A 3FE1A 3AV9A 2ASOA 2O8CB 4CGIA 3MCPA 1O1WA 3D7EO 4CZLA 3AA3A 2E2PA 4CZHA 3ISNC 4W5RA 2Z1GA 1NGFA 4MO5A 3FGUA 1DT9A 1HYZA 1NMDA 3L6QA 4IG3A 5KPZA 4N76A 3C7NB 1L3SA 2HSTA 4F8RA 4CJUA 3MXJA 4WFNL 1BOTO 1KRPA 4G9ZA 3HTVA 1NK9A 1WUAA 5CYMA 1DEJA 2EHGA 2QWMA 5AFUA 3QDKA 3C0BA 4ZTFA 3L3UA 1S9GA 3I8BA 4FJNA 4HVJA 3THWB 4FZXC 3FZMA 1C1BA 3EZ5A 1UWBA 4M42A 3NH1A 2P51A 3V9XA 4H5NA 3CJ7A 4ID1A 3ITHA 5M1NA 2I7PA 2HMIA 3ZCMA 5KGWA 4U67L 1VAZA 3BEXA 1C0FA 3VGMA 3G4SN 5KQ8A 3O1WA 2OPQA 4BVOA 4CZFA 1YAGA 2BTFA 4GV3A 2B6AA 3KK7A 1IKWA 4BRHA 4CZMA 1FW6A 3HT3A 3VETA 5AQNA 2HBLA 3WNEA 3U9ZA 1KFDA 3SCXA 1BUPA 3ASMA 5BN8A 3R9PA 4M45A 5FPDA 4R5PA 3VQAA 2ZF5O 2PFUA 5M1KA 4O5FA 1NNEA 3JSMA 1MWMA 3D0PA 3A2FA 2J4RA 2IVOA 1B9FA 5M1FA 5JLHA 3KLHA 5C12A 3DRPA 3SV3A 3O6WA 3K2PA 1GOCA 4A5BA 4IEEA 3T3FA 4DU4A 1CZBA 1MWKA 3SQ2A 2GUPA 4JI2K 3AVMA 3HJFA 4ICLA 4NXMK 1WB9A 2KZZA 4RW6A 3ZT3A 3QMLA 1SV5A 5AQVA 3A8YA 2HF3A 3PSFA 2A3ZA 4BE1A 3J7AP 4YORA 1HQEA 1ASUA 3L2RA 1RGIA 4AH9A 3LWMA 4DQQA 2QXLA 3DYAA 3W3DA 5BRFA 3QBXA 2B4JA 4EZ9A 1GLFO 1SKRA 2P9SB 4B8CA 4BC2A 4CD3A 1BGXT 1Q9XA 3TAFA 4B9SA 1Y97A 4HHTA 1Z05A 4GNIA 2P9LA 3RSEA 3BUZB 2I5JA 3ENOA 3MDQA 3QIOA 2P9NB 3U9DA 4DHYA 2ZJRL 3CI5A 1JLBA 4CJPA 3SZ2A 3MEGA 3SQ0A 5AQOA 1P8ZA 2F8SA 4BWMA 3OYBA 4HUFA 1VK0A 4XH4A 1ZBIA 2HOEA 2E4LA 4H0OA 3WNHA 2XRIA 4FLTA 3PIOL 5LMUK 2O8DB 3CJ1A 4RW4A 1VRUA 1YVUA 4G1QA 2D5RA 2E1ZA 2GBZA 4FJLA 1XC3A 1R0AA 1DLOA 1NK8A 4U7BA 3EO3A 1BCMA 3R6MA 2IVNA 3HPGA 3N4PA 1WSJA 2E2QA 3F5TA 1GLLO 1IG8A 5CR4A 1L3VA 4BC4A 3CC2N 3L8BA 4ELVA 2VG5A 3VQCA 1U45A 4UY8O 4J2BA 1BI4A 2P9KB 4BRGA 3DJCA 2FLOA 3CXCM 1S6QA 1GLJO 4OO1J 4Y1DA 2QWLA 4GKKK 5FPNA 2EX3A 5M1QA 4DU1A 5HBMA 1JL2A 3VQ6A 3EKUA 3AVKA 3A5LC 2YKNA 3HBTA 2P5OA 1KCFA 3NCIA 4FK4A 3AGRA 4KI4A 4B1VA 3QINA 3AVLA 4X64K 2YHYA 2I7NA 3ZSYA 3SYZA 4HWIA 3R1XA 5M1OA 4DV7K 2HVIA 4ZHRA 3QEXA 3UKRA 3O3FA 3OS2A 1IBMK 3AVNA 1L3TA 2V52B 1HMVA 2UXCK 3TABA 1W2BM 1KAYA 1NJWA 3SPYA 3NVMA 3NAEA 3IS9A 3SNNA 1KVAA 3VQ9A 2YHBA 4N41A 1W0HA 3H08A 2A1SA 4LF4K 3M8PA 3MECA 4CK2A 4DTPA 1QQCA 4FWKA 2RKIA 3ZT0A 1W97L 5GIPA 1RT6A 4CHPA 4CEQA 3CFOA 3CQXA 4NCAA 5GAHP 3OS0A 1YUWA 2D0OA 4JLHA 3SUNA 3S41A 4JRPA 2CGKA 1FKPA 5D3GA 4EP4A 4JKAA 3ENBA 2P9IA 1WSEA 4OGEA 3NGZA 4OPHA 4JKBA 4QS7A 5FRMA 1VRTA 3IDHA 4TSXA 2F96A 1D9FA 2AP1A 2A6AA 3J7ZO 4DV0K 5C10A 2FSJA 3EEQA 3SJJA 4JEPA 1O13A 2ZGYA 3NMUA 1RDBA 1T44A 1T6DA 5AQYA 3ZEUB 4ELUA 4DSEA 4JI3K 4WE1A 1NGDA 1WBDA 2O8EA 1T3VA 2PYJA 4JS4A 2NNWA 1NK0A 4FWLA 2H3GX 1ZBLA 3A0IX 3NGIA 1BQMA 5FPEA 3NF9A 3MAQA 3T1HK 3DI6A 1U47A 1S1VA 4DQPA 4M63C 3KJVA 2F8TA 3CM5A 1RT5A 4DV2K 4ISEA 1NGBA 3D2FA 3V9SA 1WSGA 1QSYA 3QICA 4GW6A 4OKJA 1TVRA 4FJ8A 3VEZA 4KV8A 4H5RA 3VQ5A 3HP6A 3MEDA 3G25A 1SKSA 2ASPA 5F1XA 3K57A 5LMNK 4BR5A 4Z4IA 3KVGA 4JRQA 3VPZA 4F9OA 5BRHA 2VYPA 4L3QA 4B9LA 3HM9A 3THVA 4MDAA 4MDBA 4Z4CA 2OTLN 4YNQA 3CF5L 1QQMA 4CJQA 2ITGA 3TAPA 4BDPA 2A41A 1OVQA 5ELZA 1TK0A 1UA0A 2UUAK 1XMOK 3L2WA 4B1XB 4E7JA 3DAWA 3H45C 4AHRA 3KLIA 3OVNA 4Z4FA 3I56N 4DKWA 4KREA 3RR8A 3VQEA 2OPSA 3EZWA 2WTUA 4W5NA 4DSJA 3LALA 2VQEK 4IXCA 1BL3A 1HNVA 3O80A 1NGHA 4CF0A 5ADXA 1HKCA 3B6PA 3ZSRA 2QW9A 1SZ2A 1UOCA 2P9PA 2CGJA 3QERA 1JLQA 4CHQA 3PO5A 1B92A 2F9WA 3OYDA 2HHUA 3A5MC 4FLVA 4CBWA 1WAJA 4IZ9A 5IWAK 4B08A 1E4FT 2YX6A 3LZIA 4CECA 4DSIA 5AQHA 4MQ3A 4H5WA 3CCLN 4CJLA 2YNFA 3E01A 4FK0A 3C6TA 4FVUA 4DV5K 4BE2A 2D0CA 1C1CA 1TUYA 2W6LA 4B3TK 4FJ5A 4ILJA 4FZYA 3E9OA 2Y1JA 4JD2B 2QWRA 5BRDA 4DU3A 3VQQA 4BROA 4DFPA 3OBWA 1KAXA 1C0TA 3K9JA 2YCHA 1K8KB 4FWQA 1VSIA 1X9JA 5AQPA 4QS9A 4XH5A 5AZJB 4I9LA 2EWSA 4BQZA 3WUHA 4DR4K 4CJ4A 3PSIA 4ZTJA 4JI1K 4FJJA 1KVCA 3F9KA 3SUQA 4FLUA 4BRIA 4O55A 1YI2N 4B1YB 4IOAL 4Q0BA 3OYIA 4AHCA 3H3OB 3OYHA 3GL1A 2DFEA 3QIPA 4ISFA 1Z26A 3TTDA 3NF7A 3P38A 4W5QA 1Q82O 3M6GA 4M3WA 2KFZA 4JAXA 2BE2A 2HHSA 1JCFA 4IOCL 5AQWA 3RTVA 4BR7A 4E7LA 3KD1E 5BR8K 3MN7A 1UA1A 4LH5A 3MN5A 5AQFA 4E1NA 4AQYK 5JMVA 1JLCA 3SAGA 4FJ9A 2DY4A 4PWDA 3DLEA 2IC3A 3CFRA 3LAMA 5HRRA 3M8SA 5AQKA 4DF4A 3PY8A 1EP4A 2NUBA 4CJFA 4JI0K 4CEBA 3WNFA 1RBTA 3AVCA 2E2NA 4KTWA 2V7ZA 2QWPA 3AO1A 4IFYA 4FOIA 1VQKN 5KRTA 3RMDA 1OKJA 2YHWA 3VTIA 5CYQA 4PHTX 1NMNA 5J2NA 4B9VA 1KFSA 3ULEA 3LDSA 3K59A 3OHRA 4BG9A 4FM2A 4B8AB 4OKKA 1K9MO 2XO7A 3T1AA 1EKEA 2R7YA 2O8FB 1H1VA 2OANA 4BDZA 3VTHA 3OW2M 3QBWA 4OJRA 4A2AA 4BRDA 3EN9A 3KWIA 3M3ZA 5ADXH 2D4WA 3V9ZA 1VSKA 4KHNA 4FSVA 3N4QA 4FJGA 4I6MA 2QI2A 3HZ6A 4O8UA 4CJ3A 2XY5A 2HHTA 4Y0WA 4YOUA 4OKEA 1YXQA 3O9SA 5T7BA 2HW3A 1VSDA 1RBSA 2ZGZA 5JS2A 3CJAA 1QVGM 3O9TA 2YJFA 3C94A 3CM6A 2W41A 3SBGA 3AVIA 3L0QA 4FCYA 3WXLA 2KHOA 1VQON 2CH5A 3CMEN 4JKGB 3SAFA 3QEWA 3AO2A 3DM2A 3ZX3A 3OYNA 3P5JA 3NH2A 3O9QA 4WQ5C 3V4IA 5M1PA 2D1KA 5CE3A 4B3MK 5LL6Z 4DR1K 1YF5L 4FJMA 2Q36A 3LP0A 4HTLA 2E1YA 1U48A 2IIRA 3OS1A 4F3OA 5LJVA 3MX2A 2LSNA 1JCEA 3AY9A 1VQ7N 4CF8A 4DMNA 4DQSA 3KWGA 1KD1O 3HP9A 3WXMB 3TANA 4O5BA 2WUSA 1ITGA 2ITMA 1L3UA 3VF4A 1WN7A 5BREA 1SL2A 3AVHA 5AQZA 2GX9A 4HTUA 5JVHL 4QS8A 1NGGA 5SZTA 3TAMA 4FLWA 3K5LA 1TK8A 1RDUA 3DRSA 3ZSVA 2OZMA 1XMQK 4FJIA 2HHQA 4ILGB 3KD5E 4BRQA 3IFRA 4B1ZA 3NF6A 4WFAL 2NZTA 5E84A 4A61A 1SL0A 1BWFO 4H0TB 3SMPA 3C7NA 4O0JA 1YTUA 4DF8A 4PY5A 4NO7A 2CH6A 1ASVA 4J2AA 1W7AA 3PV8A 3DXMB 4BR4A 3V1QA 2Y1IA 4JKEA 4IO8A 1T05A 3TARA 2BGGA 3SPZA 3C65A 1CZAN 2D0AA 3BP8A 4FWMA 1X3NA 1X9WA 1Q81O 1NGAA 2CGLA 5KPRA 4CJEA 5J2PA 3TSUA 5KQDA 3F73A 3HYFA 1FXXA 1GOBA 4PKGA 1RBRA 1KXPA 3O08A 3DLLL 5HP1A 3LP2A 4Z94A 1NU0A 4PL8A 3VMFB 3GE1A 3BF3A 1RBVA 3U3YA 4B9MA 4NXNK 4DTJA 3EE8A 1RTHA 3FFIA 4CHNA 3AAPA 2YHXA 3KLEA 2YHAA 2Q0RA 3NVKA 1HYVA 3MN6A 4RTFD 1LV5A 4C8OA 2YNHA 3WEEB 1Q9YA 5BR9A 4C1NK 5CZ1A 2G8KA 2ASMA 1GLDG 4PQUA 1VSFA 4F2RA 1T7PA 2X6SA 3LDLA 4FWPA 1X1PA 3BZCA 1IJJA 4J2EA 3U8XA 5I9EB 5AQSA 1U49A 4K8XA 4CBXA 4Y1CA 3U3GA 3B8AX 2UXBK 3SI6A 4M7XA 4BRPA 4ELTA 3RMCA 4EFHA 2Q97A 3CJCA 1J53A 2W40A 4JKCA 3HPOA 3QEIA 2Q0UA 1WNSA 5AQRA 3VERA 1JLEA 1LWEA 2VWBA 4DTOA 1F21A 4Z4GA 4JHDB 1EQYA 1VSLA 3LDQA 5E26A 3DRRA 1Z25A 3TR8A 5HOOA 3S3NA 1NJXA 1WSHA 2KFNA 4F3TA 1X9MA 1CXQA 4YY3K 5AFUH 1X9SA 4IJNA 3O3GA 3NGYA 4YOVA 3O5BA 3PX0A 2YKMA 5FRNA 1QQOA 3WXIA 2E20A 5C0YA 2P9NA 4KFBA 2VWKA 1RTJA 2OPRA 2QWNA 3O4WA 4DSFA 1EO1A 5DM7L 1NKEA 4FOEA 4I2QA 4DV4K 2OZSA 1JCGA 3ZT4A 4B9QA 2FF6A 1BU6O 4KRFA 1NK7A 4AHSA 3FZHA 2O8DA 2VQFK 4CVNE 3PIPL 3CQYA 3VN5A 4KHPK 4LSNA 2G8HA 1XWLA 5LY3A 1VQ6N 4B9UA 5K14A 3CMAN 4KAZA 2P9IB 2RPIA 1X3MA 2Z1JA 4BR2A 4CEFA 4BRAA 3V6DA 5AQJA 3OYFA 1JLFA 1NGEA 1BHLA 2IS3A 4DFMA 3MXIA 3RMAA 4GMJB 4DR6K 1Z6RA 2P9UB 3VQPA 1RFQA 4KH4A 1YITN 2YNIA 3AA2A 3KKSA 3KK1A 2KQ2A 2HF4A 1RCHA 2QWOA 4GV9A 1JL1A 3U4LA 4CJ7A 3KIOA 3OYGA 2UUBK 2UYTA 3HSTB 3QO9A 3ZETB 3SJHA 4FK2A 3ZT2A 3QEPA 4FPBA 2G8FA 3H6EA 4E0DA 4H0VB 1HRHA 1HNXK 2VWJA 3HK2A 4RW9A 4CCHA 4CEDA 3CC4N 2F9TA 1DGKN 1N32K 1QHAA 4JI8K 4JKDA 3BGRA 3VQ4A 1JLGA 3QFUA 5I3UA 3KTQA 1LAWA 4ID5A 4O8KA 3MN9A 2FF3B 4FWNA 4WQ4A 3S3OA 3LP3A 3D6RA 2Q3SA 3DWLA 1D8YA 3KHYA 1BG3A 1S1TA 2A40A 1RDDA 4CHOA 1NK6A 4JK7A 1C0MA 5AQTA 2X6NA 3C95A 4N56A 5B8HA 1Y64A 4KHUA 2GTDA 3P83D 3V9WA 3LP1A 4K8ZA 3K58A 3OA9A 2WC9A 4WCEL 4M3XA 3CCEN 4A2BA 1U2VB 3OYEA 5MLCQ 4DFKA 2F7TA 4X65K 1TAQA 1I3AA 4NLBA 1QSLA 1BO5O 2GWJA 4DLGA 1ATNA 1TKDA 4M41A 3L2QA 1TV6A 5F2RA 4BDYA 4Z0UA 1DTQA 4OPAA 2DPNA 3PO4A 3LPUA 2HHHK 3O9RA 3OYKA 1A5XA 4EIAA 1KSPA 4AM7A 4CJSA 1TYQB 5C25A 3F9MA 3VEXA 3P31A 1SAZA 2JWLA 3D2EA 1XI1A 1IKVA 4DR5K 3L2UA 3S3MA 4OVLA 3L4IA 4RG8A 2D0PA 3ZSWA 3V1RA 5DM6L 4DR3K 2B5JA 2E5LK 4HCBA 4CIGA 1YVNA 2D0BA 1LCUA 3OYCA 1HKBA 4CZIA 2P9PB 1GLEG 3DXKB 1T8EA 3TAEA 1GOAA 2IDOA 5TKYA 4XEIA 1M1KO 4NLCA 3ATUA 3KK3A 3VQDA 4IFVA 1G15A 3JYTA 3ATVA 3FFKB 4IG0A 5C42A 3V9UA 4FW1A 2VGNA 2GUIA 3MK6A 4DV6K 2AJQA 4V19S 4QCLA 1RILA 5KI6A 2PYLA 3ZLJA 1GLAG 5AZIA 3TWHA 1ZXOA 3I8DA 3DLKA 5EXWA 3K5NA 4JK9A 2ZWHA 3VF2A 4DTRA 4FWSA 1K6YA 2JWKA 2OTJN 1NBWA 5FROA 4WFBL 4EAHD 1L5UA 4KTZA 1EWQA 2RHKA 3AVGA 1HNWK 3CJBA 1TL3A 3IG1A 4CFDA 2VG7A 3HPHA 3CCMN 4PKHA 4FPAA 3SBTA 4DV3K 4OLAA 1SL1A 4QOZB 1B9DA 3CD6N 3IAYA 1QTMA 1QE1A 2BUPA 3G10A 3T7ZA 2NLXA 5CY4A 5AQUA 4CZGA 3AVBA 4BRKA 2E8AA 4DTUA 2V51B 1V4TA 3MEEA 3ZX0A 4B3SK 2QA4N 4K25A 2V7YA 1ZBFA 3MWPA 4J2DA 4PL7A 2O8BB 4JI7K 3NDKA 4KH5A 4CFBA 3SV4A 4E19A 4WYBA 2Z1HA 4YOWA 2QXFA 3HSCA 3A5OC 3BF1A 5FLXO 3CC7N 4CGFA 1HPZA 5BPLA 3NBPA 3SUOA 1KAZA 3FR0A 3R8EA 4FM0A 4C8LA 2ZQBA 5GAGP 3JXUA 1T03A 3KKRA 4FWOA 1NKCA 3E9PA 4GVEA 5HRPA 1J5EK 1ZYQA 2JLEA 1C1AA 1LWFA 4FO0A 1TKZA 4H4OA 3T69A 4FJ7A 3E66A 2AA4A 1QSSA 4IO9L 4LD0A 2FXUA 3EL2A 1RT1A 1FK9A 4LF8K 1E3MA 3PLAA 3TAGA 5C24A 3THYA 2W6KA 3PUFA 4C8MA 3GOIA 4W5OA 1VQ9N 5EY4A 1XHXA 3ZSOA 4A57A 5C15A 1HX1A 3LM2A 4JD2A 1HLUA 5F0XA 3DOLA 4LFBK 2XY8A 4RWTA 3UKUB 3ULEB 3CCRN 2NRZA 1HJRA 3HRGA 2HHWA 1JKHA 4CGGA 4BC5A 2QTDA 1K8KA 2PAVA 2X74A 3IMXA 4HUEA 2BH1A 3I0SA 4KB1A 4M3UA 1RT4A 4E1MA 3V81A 4FXDA 2PBDA 1RNHA 1NK4A 2RF2A 1HNZK 2F4VK 3FZFA 3MCAB 3WNGA 3LDNA 2IAJA 4MO4A 4CHZA 3WT0A 1IG9A 5I42A 2A1RA 4I7FA 1A5VA 4CD1A 3T1YK 4N5SA 1LWCA 1CLQA 3DLBA 3LAKA 4X66K 2FBTA 3LZJA 4CFAA 2NRXA 5HRSA 1QVFM 4IJAA 4C8NA 1D5AA 4NB4A 5E41A 3I33A 2Q31A 4CHYA 3CPEA 1KTQA 1VQNN 2ZM6K 1RT2A 2X78A 5AQMA 4O0IA 3RR7A 4C8KA 4QAGA 1RTDA 3J7YP 1K73O 3O9UA 4DQIA 4DTMA 4J8FA 4CESA 1HUXA 3A5NC 2IOCA 2HBKA 1S5JA 2QM1A 3ALYA 4X62K 1S6PA 3L3VA 1N6QA 3EKSA 1N36K 3LL3A 4KHWA 2GELA 4BWJA 4LF7K 4B3OA 4KH6A 2OPPA 4CIFA 5JICA 1XHZA 3MXMA 1MU2A 3SLCA 4BACA 3LWLA 4EHTA 3TPQA 1NJIO 4CEOA 4KHYA 2DFFA 4O4GA 1WSIA 2HNZA 3HL8A 1OVYA 3JAMO 3L2VA 2O8FA 1C0GA 1ATSA 1EXQA 3V1OA 1BIUA 3SQ4A 4H0YB 3DOKA 5FPMA 5BN9A 1WAFA 4C23A 5GIOA 3OYAA 4DUZK 1EWRA 3LANA 4LY7A 5SWMA 4I2PA 3IUCA 4LFAK 3P4IA 5CZ2A 3KLFA 4FW2A 3ID8A 3THXA 1QZ5A 2FSNA 2QK9A 3SK3A 2O8CA 4CK1A 3W0LA 4KKOA 3QEVA 3OYLA 3VQBA 4E7KA 4MLEA 4E7HA 1KVBA 3QETA 1KQSM 1VSEA 4GVMA 1N8RO 1RDWX 4JKGA 2VCPA 4DQ8A 3FLCO 4BGAA 3CG7A 4ILHA 2HNDA 2YI1A 3FZLA 3M8RA 3MX5A 3NF8A 3E9LA 2NRWA 4CF9A 4WF9L 1NJZA 2YNGA 4YFUA 3RRGA 4JI6K 1LOTB 4DUYK 1D9DA 2ZJPL 4DWIA 5AQIA 2OYQA 3HOSA 2JGUA 3TTCA 1K8AO 4CJRA 4EHUA 4HUGA 4E7IA 3THWA 3G0ZA 3AVFA 2P9LB 3VEOA 1ZBHA 1VQ4N 3RSEB 5HLFA 3O8MA 4FVMA 4JS5A 4KB0A 1HKGA 4IDHA 3HXMA 3M1FA 1Q8IA 1ASWA 3TSQA 4FLZA 3CJ9A 3VA0A 2YJEA 1HR0K 3KLGA 3WQTA 3PX4A 1OH8A 3P39A 1YHQN 4E89A 3SMSA 1C0UA 3K5OA 4CFCA 4B9TA 4CZKA 4LSLA 1YTAA 5LJWA 1JLAA 5AJ3K 4OGCA 4DSLA 5HROA 5BPMA 2E88A 1HPMA 4PA1A 5AQXA 1GLBG 2Q1NA 4A59A 1BISA 3C6UA 3DXMA 4OPKA 3WXJA 1SUQA 4H0XB 3S9HA 4DG1A 3QESA 1OH6A 5GINA 1BI4B 2O4IA 2FSKA 3C6AA 4XH1A 1DTTA 2Z1IA 4BE0A 2WFBA 4CJVA 4OLBA 3KZBA 1TL1A 1OH7A 1YT3A 3OBYA 3O1BA 1OH5A 3MWTA 3G71N 2HMPA 4CIEA 5CHIA 4JI5K 3H1QA 3K0SA 2KLAA 4AILC 4LF9K 3H3NO 1NOZA 4IFEA 4CF1A 4KI6A 4CEAA 3GBTA 3HVRA 3TSPA 1U04A 2QKKA 1ESVA 4BC3A 4NCGA 3LDOA 3G6EN 4K43A 3ZSQA 3UKRB 3U6FA 2P9SA 3TTFA 5DK5A 4XIUA 2UU9K 1C6VA 1VHXA 2WBNA 2A5XA 1NK5A 4R79A 3L4QA 4IWVA 1KLNA 2FBYA 5KGXA 4CK3A 5HL7L 3WEEA 4KHSA 1VQ8N 1S9EA 3NHGA 3NFAA 1N34K 4A62A 4DTXA 3AARA 3VESA 1T6CA 2E6LA 3ZSZA 1BIZA 4BRFA 1RDCA 2P5GA 4CZJA 1CZ9A 2G8UA 2BDPA 1BQNA 4EP5A 2ZD1A 4IEIA 1TUUA 3QLHA 4DQRA 4DB3A 3SUPA 5FDLA 3AGKA 4BGBA 3AO3A 5JLFA 4NCBA 5JVGL 2A42A 3B6OA 5J2MA 2WONA 3CIPA 4JHDA 4CGDA 2HB5A 4Z4EA 2KZMA 4N47A 1Q18A 4M3TA 3BZKA 3VOVA
chains in the Genus database with same CATH topology
5M1KA 4O5FA 4NLCA 3ATUA 5EX5A 1R59O 1MWMA 3ATVA 3QFPA 3FFKB 2J4RA 2P9KA 2IVOA 3E1YA 2E2NA 1ZC6A 5M1FA 5JLHA 2VGNA 2V7ZA 2QWPA 3MK6A 5C12A 4FOIA 1VQKN 3O6WA 1GLAG 1OKJA 2YHWA 4KBOA 5AZIA 1ZXOA 3VTIA 4A5BA 4IEEA 4PHTX 1MWKA 3VEYA 5EXWA 2GUPA 4JK9A 2ZWHA 3VF2A 4FWSA 2JWKA 3ULEA 2OTJN 3OHRA 3QMLA 1NBWA 5AQVA 4BG9A 3A8YA 2HF3A 4WFBL 1K9MO 4EAHD 2A3ZA 5EVZA 2RHKA 4YORA 4FWRA 3CJBA 3K9KA 1H1VA 2OANA 3H1VX 3VTHA 1S72N 3OW2M 3QBWA 4XEIA 2IVPA 3CCMN 4PKHA 4A2AA 4BRDA 3EN9A 1RGIA 3KWIA 4FPAA 3M3ZA 3SBTA 2QXLA 5ADXH 3W3DA 2D4WA 3QBXA 5BRFA 4RCHA 4FSVA 3GDQA 1GLFO 3N4QA 4BRCA 3CCUN 3CD6N 2P9SB 4I6MA 4BC2A 4CD3A 2QI2A 2BUPA 3HI0A 3HZ6A 4O8UA 3Q7BA 4K42A 1Z05A 4GNIA 3D2FB 3T7ZA 2NLXA 3LDPA 2P9LA 4Y0WA 1YXQA 3O9SA 4YOUA 5AQUA 4BRKA 3RSEA 3BUZB 4CZGA 2ZGZA 2E8AA 3CJAA 4MLHA 2V51B 4A5AA 5AQLA 3ENOA 1QVGM 3O9TA 4YOYA 2YJFA 3C6HA 3FZKA 3MDQA 1V4TA 2W41A 3SBGA 3ZX0A 2P9NB 3L0QA 3U9DA 2QA4N 3WXLA 2KHOA 4K25A 1QZ6A 2CH5A 5TKWA 2V7YA 2P9UA 3CI5A 4JKGB 4DHYA 2ZJRL 3CMEN 3SAFA 3MWPA 5AQOA 4PL7A 1P8ZA 4B1UB 4AF1A 5CHIA 3ZX3A 4KH5A 4XH4A 1BA1A 3M5RA 4WYBA 2HOEA 1XUPO 4H0OA 3HSCA 1NM1A 4YOWA 3O9QA 4JKFA 3A5OC 3BF1A 4WQ5C 5M1PA 3CC7N 3ZX2A 2D1KA 3VF6A 5CE3A 3PIOL 1SQKA 3UB5A 3D2EB 5BPLA 1KAZA 3CETA 3FR0A 3R8EA 3CJ1A 1YF5L 2Q36A 3ZETA 5GAGP 2E1ZA 4HTLA 3CPWM 1KC8O 3JXUA 2E1YA 1VQON 2RE2A 2QEXN 2IIRA 4FWOA 1XC3A 3CCSN 5LJVA 4U7BA 3EO3A 3MX2A 3E9PA 4GVEA 1JCEA 1NWKA 3AY9A 3R6MA 1VQ7N 2IVNA 4BQLA 3CERA 4FO0A 3N4PA 3KWGA 2E2QA 3F5TA 1KD1O 1GLLO 3T69A 3E66A 4GY2B 3WXMB 1IG8A 2AA4A 5CR4A 2WUSA 4IO9L 2ITMA 3EE9A 1V4SA 2FXUA 3EL2A 3VF4A 4BC4A 4JKHA 3CC2N 4BVPA 2ZJQL 1QQNA 5BREA 4UY8O 1D4XA 3TU5A 5AQZA 2P9KB 4FL9A 3ZEUA 3DJCA 2FLOA 4BRGA 3CXCM 3PLAA 2GX9A 4BRNA 1S3XA 4PKIA 2GEMA 5JVHL 1GLJO 4OO1J 3GOIA 2QWLA 4QS8A 1NGGA 1VQ9N 3LM9A 5EY4A 5FPNA 5AZIB 5M1QA 1RDUA 3UE5A 4A57A 5C15A 1HX1A 3LM2A 4JD2A 3EKUA 1HLUA 4ILGB 4BRQA 5F0XA 3IFRA 4B1ZA 3A5LC 3HBTA 3I55N 4RWTA 3UKUB 2NZTA 5E84A 3ULEB 4WFAL 4A61A 3CCRN 2NRZA 3AGRA 1BWFO 4H0TB 3SMPA 1JJ2M 4B1VA 3C7NA 3HRGA 2YHYA 2I7NA 4HWIA 4NO7A 2CH6A 3R1XA 5M1OA 2QTDA 4BC5A 3ZYYX 1K8KA 2PAVA 2HBJA 3IMXA 1NLVA 2BH1A 3H46O 2NRTA 2NRHA 3UKRA 3QB0A 3Q7CA 3DXMB 4BR4A 2PBDA 2V52B 4JKEA 4IO8A 1U2VA 3FZFA 3MCAB 1W2BM 1ATRA 3LDNA 1KAYA 3C65A 2NRVA 3NVMA 4MO4A 1CZAN 4IOXA 4M7YA 3CCVN 3WT0A 3BP8A 1WOQA 4FWMA 1X3NA 1Q81O 1NGAA 2CGLA 4CD1A 5KPRA 3TSUA 5KQDA 3WXKA 4YDUA 4PKGA 1P90A 5BPNA 1KXPA 2NRXA 3O08A 3DLLL 4CI6A 4IJAA 1QVFM 4K41A 4NB4A 4Z94A 4FWKA 4PL8A 1W97L 5GIPA 3AAQA 3VMFB 3I33A 4DCHA 1TYQA 2Q31A 3GE1A 3BF3A 3CQXA 3CPEA 5GAHP 1YUWA 1VQNN 2D0OA 3EE8A 3S41A 5C2DA 2NRRA 5AQMA 3AAPA 2YHXA 2CGKA 3SAHA 5AQQA 4BR9A 1K73O 2Q0RA 3O9UA 5KPTA 4J8FA 4JKAA 3NVKA 3ENBA 3MN6A 4LC9B 2P9IA 1HUXA 3A5NC 2QWQA 3DXKA 4ISGA 4RTFD 4OPHA 4JKBA 4QS7A 2HBKA 4BRMA 2QM1A 3J8AA 2VGMA 3IDHA 3WEEB 5BR9A 4C1NK 3EKSA 2AP1A 2A6AA 2ASMA 1GLDG 5GAEP 3J7ZO 5C10A 3LL3A 2FSJA 2GELA 3LDLA 4JEPA 1O13A 4FWPA 2ZGYA 3VEWA 3NMUA 1SS6A 1T44A 1IJJA 3U8XA 5I9EB 1T6DA 5AQSA 4KH6A 4WQ5A 5AQYA 3ZEUB 1YIJN 4CBXA 5JICA 4YOTA 3SLCA 4C1NI 4BY9C 3B8AX 4E1JA 1NGDA 4EHTA 1T3VA 3TPQA 1NJIO 4BR0A 4M7XA 4BRPA 1DKGD 4EFHA 2NNWA 4WQ4C 2Q97A 3CJCA 4FWLA 3F2KA 2H3GX 2W40A 3A0IX 4JKCA 1OVYA 2Q0UA 3R3LA 1C0GA 1XQSC 1ATSA 5FPEA 5AQRA 3VERA 2VWBA 4H0YB 1HJOA 1E4GT 5FPMA 5BN9A 5GIOA 4C23A 4M63C 4JHDB 1Q86O 1VQMN 1EQYA 3LDQA 5E26A 3IUCA 3P4IA 5HOOA 4ISEA 3ID8A 1QZ5A 3ID6A 2FSNA 5AFUH 3VEVA 1NGBA 3HOTA 4IJNA 1NGIA 3WQUA 3D2FA 4JNEA 3SK3A 3W0LA 1GLCG 4YOVA 3O5BA 4CZEA 3QICA 4MLEA 1QQOA 1M1KO 2Q2RA 2E20A 3WXIA 4BG8A 5C0YA 1KQSM 2P9NA 4H5VA 1S22A 2QWNA 3O4WA 3VEZA 1N8RO 1EO1A 1RDWX 5DM7L 4JKGA 2VCPA 4H5RA 4DQ8A 3FLCO 4FOEA 4BGAA 3G25A 4ILHA 2ASPA 5F1XA 5H1SQ 1YJNN 2YI1A 3FZLA 4BR5A 3KVGA 3MX5A 1JCGA 3E9LA 3VOVA 2NRWA 4B9QA 2FF6A 4WF9L 1BU6O 3VGKA 1YJ9N 1VQ5N 3VPZA 1LOTB 4F9OA 3ENHA 5GADP 2ZJPL 3CCQN 3FZHA 5BRHA 2VYPA 5AZJA 1G99A 1VQLN 4L3QA 4H0PA 4MDBA 4MDAA 5AQIA 2OTLN 1ILYA 2E2OA 3PIPL 4H5TA 3CQYA 3HOSA 3CF5L 4YOXA 1QQMA 3TTCA 1K8AO 5C2FA 4EHUA 1BA0A 4I6MB 4GV6A 5LY3A 1VQ6N 2A41A 4H03B 3CMAN 5ELZA 2P9IB 4AM6A 2P9LB 3VEOA 4B1XB 1MA9B 3RSEB 1X3MA 1VQ4N 3O8MA 4BR2A 4CBUA 3DAWA 4BRAA 3H45C 1Q7YO 5AQJA 1HKGA 4IDHA 3M1FA 1NGEA 3I56N 4DKWA 4BREA 5AQGA 1Z6RA 2HBMA 5EOYA 3EZWA 1U6ZA 2P9UB 3TSQA 1RFQA 3CJ9A 2YJEA 3JS6A 4KH4A 3WQTA 1YITN 3P39A 3VGLA 1YHQN 1BDGA 4IXCA 4B1WB 3SMSA 1MDUB 2HF4A 3O80A 1NGHA 2QWOA 1HKCA 4JN4A 4CZKA 5ADXA 4GV9A 1YJWN 3U4LA 3UKUA 4CJ7A 1VQPN 5LJWA 2QW9A 2UYTA 1SZ2A 3IKMA 3ZETB 2P9PA 3SJHA 2CGJA 4YDUC 4FPBA 1J6ZA 4JK8A 5AR0A 3H6EA 2F9WA 3MMVA 3A5MC 4CBWA 2E88A 1HPMA 4H0VB 4IZ9A 5BPMA 5AQXA 1E4FT 1GLBG 2Q1NA 2YX6A 4A59A 5AQHA 3GG4A 3RVCA 3DXMA 3WXJA 2F9TA 3CC4N 4H5WA 3CHWA 3CCLN 1DGKN 4H0XB 1QHAA 4JKDA 1NGCA 3CCJN 1M90O 4BRLA 3VENA 2GWKA 5GINA 1NGJA 2FSKA 3QFUA 4FVUA 3C6AA 2KKZA 3HM8A 4XH1A 3FE1A 2ASOA 4O8KA 3MN9A 2WFBA 2FF3B 3MCPA 4FWNA 4WQ4A 1TUYA 3KZBA 3D7EO 4ILJA 4CZLA 2E2PA 3E9OA 3O1BA 3OBYA 3D6RA 3MWTA 4CZHA 2HMPA 3DWLA 4JD2B 3G71N 1NGFA 3FGUA 1DT9A 2QWRA 1BG3A 3H1QA 3KHYA 1NMDA 2KLAA 3L6QA 4MO5A 5BRDA 3H3NO 4IFEA 2A40A 4BROA 3OBWA 4JK7A 5KPZA 1KAXA 3GBTA 5AQTA 3C7NB 3TSPA 3K9JA 5B8HA 1Y64A 2HSTA 2GTDA 1ESVA 2YCHA 1K8KB 4BC3A 1BOTO 4WFNL 4FWQA 1X9JA 3LDOA 5AQPA 4QS9A 4XH5A 4K43A 3G6EN 4G9ZA 3HTVA 5AZJB 3UKRB 2P9SA 3TTFA 2EWSA 4BQZA 3WUHA 1WUAA 1DEJA 2WBNA 2A5XA 2QWMA 2WC9A 3OA9A 4WCEL 4R79A 3L4QA 5AFUA 4A2BA 3CCEN 4IWVA 1U2VB 3QDKA 3C0BA 4BRIA 5MLCQ 1YI2N 5HL7L 4B1YB 3WEEA 2F7TA 3I8BA 1VQ8N 4NLBA 1BO5O 2GWJA 4IOAL 1ATNA 4A62A 3AARA 3VESA 1T6CA 5F2RA 3FZMA 3H3OB 3GL1A 4OPAA 4BRFA 2DPNA 4ISFA 4CZJA 4H5NA 3O9RA 3TTDA 3CJ7A 5M1NA 2I7PA 3P38A 4EIAA 4U67L 4AM7A 1TYQB 3M6GA 1Q82O 3F9MA 1VAZA 3VEXA 3P31A 1SAZA 1C0FA 2JWLA 3BEXA 1JCFA 3D2EA 4JAXA 3VGMA 5KQ8A 3G4SN 3O1WA 5AQWA 4BVOA 4IEIA 4CZFA 4IOCL 4BR7A 3L4IA 1YAGA 2D0PA 3MN7A 2BTFA 1TUUA 4GV3A 3MN5A 3KK7A 5AQFA 5DM6L 4BRHA 4DB3A 4CZMA 3AGKA 4BGBA 5JMVA 3VETA 5JLFA 1YVNA 1LCUA 2A42A 5AQNA 3SAGA 5JVGL 2HBLA 3U9ZA 1HKBA 4CZIA 2P9PB 1BUPA 1GLEG 3CIPA 3DXKB 5BN8A 4JHDA 3R9PA 5FPDA 2ZF5O 2PFUA 5TKYA 5AQKA 1ZBSA 1Q18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5F A;  3ATU A;  5EX5 A;  1R59 O;  1MWM A;  3ATV A;  3QFP A;  3FFK B;  2J4R A;  2P9K A;  2IVO A;  2E2N A;  1ZC6 A;  5JLH A;  2V7Z A;  2QWP A;  3MK6 A;  4FOI A;  3O6W A;  1GLA G;  1OKJ A;  2YHW A;  4KBO A;  5AZI A;  1ZXO A;  1MWK A;  3VEY A;  5EXW A;  2GUP A;  2ZWH A;  3VF2 A;  4FWS A;  3ULE A;  3OHR A;  3QML A;  1NBW A;  5AQV A;  4BG9 A;  3A8Y A;  2HF3 A;  4EAH D;  2A3Z A;  5EVZ A;  4FWR A;  3CJB A;  1H1V A;  2OAN A;  3H1V X;  3QBW A;  4XEI A;  2IVP A;  4PKH A;  4A2A A;  4BRD A;  3EN9 A;  1RGI A;  4FPA A;  3M3Z A;  2QXL A;  5ADX H;  3W3D A;  2D4W A;  3QBX A;  5BRF A;  4RCH A;  4FSV A;  3GDQ A;  1GLF O;  4BRC A;  2P9S B;  4I6M A;  4BC2 A;  4CD3 A;  2BUP A;  3HI0 A;  3HZ6 A;  4K42 A;  1Z05 A;  4GNI A;  3D2F B;  2NLX A;  3LDP A;  2P9L A;  4Y0W A;  1YXQ A;  5AQU A;  4CZG A;  4BRK A;  3RSE A;  3BUZ B;  2ZGZ A;  2E8A A;  3CJA A;  4MLH A;  2V51 B;  5AQL A;  3ENO A;  2YJF A;  3FZK A;  3MDQ A;  1V4T A;  2W41 A;  3ZX0 A;  2P9N B;  3L0Q A;  3U9D A;  3WXL A;  2KHO A;  4K25 A;  1QZ6 A;  2CH5 A;  4DHY A;  2V7Y A;  2P9U A;  3CI5 A;  5AQO A;  4PL7 A;  1P8Z A;  4B1U B;  3ZX3 A;  4XH4 A;  1BA1 A;  4WYB A;  2HOE A;  1XUP O;  4H0O A;  3HSC A;  1NM1 A;  4WQ5 C;  3A5O C;  3BF1 A;  3ZX2 A;  2D1K A;  3VF6 A;  5CE3 A;  1SQK A;  3UB5 A;  3D2E B;  5BPL A;  1KAZ A;  3CET A;  3FR0 A;  3R8E A;  3CJ1 A;  2Q36 A;  3ZET A;  2E1Z A;  4HTL A;  3JXU A;  2E1Y A;  2IIR A;  4FWO A;  1XC3 A;  5LJV A;  3EO3 A;  1JCE A;  1NWK A;  3AY9 A;  3R6M A;  2IVN A;  4BQL A;  3CER A;  4FO0 A;  2E2Q A;  1GLL O;  4GY2 B;  1IG8 A;  2AA4 A;  2WUS A;  2ITM A;  1V4S A;  2FXU A;  3EL2 A;  3VF4 A;  4BC4 A;  4BVP A;  1QQN A;  5BRE A;  1D4X A;  3TU5 A;  5AQZ A;  2P9K B;  4FL9 A;  3ZEU A;  3DJC A;  2FLO A;  4BRG A;  4BRN A;  1S3X A;  4PKI A;  2GEM A;  1GLJ O;  3GOI A;  2QWL A;  4QS8 A;  1NGG A;  3LM9 A;  5EY4 A;  5FPN A;  5AZI B;  3UE5 A;  1HX1 A;  3LM2 A;  4JD2 A;  3EKU A;  1HLU A;  5F0X A;  4BRQ A;  3IFR A;  4B1Z A;  3A5L C;  3HBT A;  4RWT A;  3UKU B;  2NZT A;  5E84 A;  3ULE B;  4A61 A;  1BWF O;  4H0T B;  3SMP A;  4B1V A;  3C7N A;  2YHY A;  2I7N A;  4HWI A;  4NO7 A;  2CH6 A;  4BC5 A;  1K8K A;  2PAV A;  3IMX A;  1NLV A;  3H46 O;  3UKR A;  2NRH A;  3QB0 A;  3DXM B;  4BR4 A;  2PBD A;  2V52 B;  4IO8 A;  1U2V A;  3FZF A;  1ATR A;  3LDN A;  1KAY A;  4MO4 A;  1CZA N;  4M7Y A;  3WT0 A;  3BP8 A;  1WOQ A;  4FWM A;  1X3N A;  1NGA A;  2CGL A;  4CD1 A;  5KPR A;  5KQD A;  3WXK A;  4YDU A;  4PKG A;  5BPN A;  1KXP A;  3O08 A;  4CI6 A;  4IJA A;  4K41 A;  4NB4 A;  4Z94 A;  4FWK A;  4PL8 A;  3AAQ A;  3I33 A;  4DCH A;  1TYQ A;  2Q31 A;  3GE1 A;  3BF3 A;  3CQX A;  1YUW A;  2D0O A;  3S41 A;  5AQM A;  3AAP A;  2YHX A;  2CGK A;  5AQQ A;  4BR9 A;  2Q0R A;  5KPT A;  4J8F A;  4LC9 B;  3MN6 A;  2P9I A;  1HUX A;  3A5N C;  2QWQ A;  3DXK A;  4ISG A;  4RTF D;  4QS7 A;  4BRM A;  2QM1 A;  3J8A A;  3IDH A;  3WEE B;  5BR9 A;  3EKS A;  2AP1 A;  2A6A A;  2ASM A;  1GLD G;  3LL3 A;  2FSJ A;  2GEL A;  3LDL A;  4FWP A;  2ZGY A;  3VEW A;  1T44 A;  1IJJ A;  3U8X A;  5I9E B;  1T6D A;  5AQS A;  4WQ5 A;  5AQY A;  3ZEU B;  4CBX A;  5JIC A;  3SLC A;  3B8A X;  4E1J A;  1NGD A;  4EHT A;  3TPQ A;  4BR0 A;  4M7X A;  4BRP A;  1DKG D;  4EFH A;  4WQ4 C;  2Q97 A;  3CJC A;  4FWL A;  2H3G X;  2W40 A;  3A0I X;  2Q0U A;  1C0G A;  1XQS C;  1ATS A;  5FPE A;  5AQR A;  3VER A;  2VWB A;  4H0Y B;  1HJO A;  1E4G T;  5FPM A;  5BN9 A;  4C23 A;  4M63 C;  4JHD B;  1EQY A;  3LDQ A;  5E26 A;  3IUC A;  3P4I A;  4ISE A;  3ID8 A;  1QZ5 A;  2FSN A;  5AFU H;  3VEV A;  1NGB A;  4IJN A;  1NGI A;  3WQU A;  3D2F A;  4JNE A;  3SK3 A;  3W0L A;  1GLC G;  3O5B A;  4CZE A;  3QIC A;  4MLE A;  1QQO A;  2Q2R A;  2E20 A;  3WXI A;  4BG8 A;  2P9N A;  4H5V A;  1S22 A;  2QWN A;  3O4W A;  3VEZ A;  1RDW X;  2VCP A;  4H5R A;  4DQ8 A;  3FLC O;  4FOE A;  4BGA A;  3G25 A;  2ASP A;  5F1X A;  2YI1 A;  3FZL A;  4BR5 A;  3KVG A;  1JCG A;  3VOV A;  4B9Q A;  2FF6 A;  1BU6 O;  3VGK A;  3VPZ A;  1LOT B;  4F9O A;  3ENH A;  3FZH A;  5BRH A;  2VYP A;  5AZJ A;  1G99 A;  4L3Q A;  4H0P A;  5AQI A;  2E2O A;  4H5T A;  3CQY A;  1QQM A;  4EHU A;  1BA0 A;  4I6M B;  5LY3 A;  2A41 A;  4H03 B;  5ELZ A;  2P9I B;  4AM6 A;  2P9L B;  3VEO A;  4B1X B;  1MA9 B;  3RSE B;  1X3M A;  3O8M A;  4BR2 A;  4CBU A;  3DAW A;  4BRA A;  3H45 C;  5AQJ A;  1HKG A;  3M1F A;  1NGE A;  4BRE A;  5AQG A;  1Z6R A;  5EOY A;  3EZW A;  1U6Z A;  2P9U B;  1RFQ A;  3CJ9 A;  2YJE A;  3JS6 A;  3WQT A;  3VGL A;  1BDG A;  4IXC A;  4B1W B;  3SMS A;  1MDU B;  2HF4 A;  3O80 A;  1NGH A;  2QWO A;  1HKC A;  4JN4 A;  4CZK A;  5ADX A;  3U4L A;  3UKU A;  4CJ7 A;  5LJW A;  2QW9 A;  2UYT A;  1SZ2 A;  3ZET B;  2P9P A;  3SJH A;  2CGJ A;  4YDU C;  4FPB A;  1J6Z A;  5AR0 A;  3H6E A;  2F9W A;  3MMV A;  3A5M C;  4CBW A;  2E88 A;  1HPM A;  4H0V B;  4IZ9 A;  5BPM A;  5AQX A;  1E4F T;  1GLB G;  2Q1N A;  5AQH A;  3GG4 A;  3DXM A;  3WXJ A;  2F9T A;  4H5W A;  3CHW A;  1DGK N;  4H0X B;  1QHA A;  1NGC A;  4BRL A;  3VEN A;  2GWK A;  1NGJ A;  2FSK A;  3QFU A;  3HM8 A;  4XH1 A;  3FE1 A;  2ASO A;  4O8K A;  3MN9 A;  2FF3 B;  3MCP A;  4FWN A;  4WQ4 A;  1TUY A;  3KZB A;  3D7E O;  4CZL A;  2E2P A;  3O1B A;  4CZH A;  2HMP A;  3DWL A;  4JD2 B;  1NGF A;  3FGU A;  2QWR A;  3KHY A;  1BG3 A;  3H1Q A;  4MO5 A;  1NMD A;  3L6Q A;  5BRD A;  3H3N O;  2A40 A;  4BRO A;  5KPZ A;  1KAX A;  3GBT A;  5AQT A;  3C7N B;  5B8H A;  1Y64 A;  2GTD A;  1ESV A;  2YCH A;  1K8K B;  4BC3 A;  1BOT O;  4FWQ A;  1X9J A;  3LDO A;  5AQP A;  4QS9 A;  4XH5 A;  4K43 A;  3HTV A;  5AZJ B;  3UKR B;  2P9S A;  2EWS A;  4BQZ A;  3WUH A;  1WUA A;  1DEJ A;  2A5X A;  2QWM A;  5AFU A;  4A2B A;  4IWV A;  1U2V B;  3QDK A;  3C0B A;  4BRI A;  4B1Y B;  3WEE A;  3I8B A;  1BO5 O;  2GWJ A;  1ATN A;  4A62 A;  3AAR A;  3VES A;  1T6C A;  5F2R A;  3FZM A;  3H3O B;  3GL1 A;  4BRF A;  2DPN A;  4ISF A;  4CZJ A;  4H5N A;  3CJ7 A;  2I7P A;  4EIA A;  4AM7 A;  1TYQ B;  3M6G A;  3F9M A;  3VEX A;  4JAX A;  1SAZ A;  1C0F A;  3BEX A;  3D2E A;  1JCF A;  3VGM A;  5KQ8 A;  3O1W A;  5AQW A;  4BVO A;  4CZF A;  4BR7 A;  3L4I A;  1YAG A;  2D0P A;  3MN7 A;  2BTF A;  1TUU A;  3MN5 A;  5AQF A;  4BRH A;  4DB3 A;  4CZM A;  4BGB A;  5JMV A;  3VET A;  5JLF A;  1YVN A;  1LCU A;  2A42 A;  5AQN A;  3U9Z A;  1HKB A;  4CZI A;  2P9P B;  1BUP A;  1GLE G;  3CIP A;  3DXK B;  5BN8 A;  4JHD A;  3R9P A;  5FPD A;  2ZF5 O;  5TKY A;  5AQK A;  1ZBS A;  1Q18 A; 
#chains in the Genus database with same CATH topology
 3OJS A;  1IH7 A;  5EX5 A;  1XNQ K;  1R59 O;  3EY1 A;  3QFP A;  1JXB A;  1N5Y A;  2P9K A;  3E1Y A;  1ZC6 A;  3I0R A;  2W42 A;  1J54 A;  4CGJ A;  2G8V A;  4CW7 B;  3VA3 A;  3NH0 A;  3AO5 A;  4KBO A;  4JI4 K;  4UQG A;  3M8Q A;  4W5T A;  1RT7 A;  4DFJ A;  4CGH A;  4I9Q A;  3VEY A;  2O8E B;  4LF6 K;  5IT9 O;  4KO0 A;  2G8I A;  4IKF A;  5EVZ A;  4PUO A;  3OY9 A;  4KHQ A;  4FWR A;  3K9K A;  1CXU A;  3H1V X;  1S72 N;  4YHH K;  3AVJ A;  2IVP A;  3O3H A;  5DMR A;  3J80 O;  3PX6 A;  4RCH A;  3SQ1 A;  3GDQ A;  3CCU N;  4BRC A;  4FLX A;  3HI0 A;  4DR2 K;  3Q7B A;  5KRS A;  5EU7 A;  4K42 A;  3ZT1 A;  3D2F B;  3DLG A;  3LDP A;  3QNN A;  1BCO A;  1EET A;  1I39 A;  2XY7 A;  4JYA K;  2DFH A;  3HVT A;  4MLH A;  4A5A A;  3DMJ A;  5AQL A;  1N33 K;  2XHB A;  1IKY A;  4YOY A;  3C6H A;  3CYM A;  3FZK A;  1QZ6 A;  5TKW A;  3TAQ A;  2P9U A;  4B1U B;  1WSF A;  4AF1 A;  1TKT A;  1BA1 A;  3M5R A;  2WOM A;  1IBK K;  1XUP O;  1NM1 A;  4JKF A;  1S1W A;  1LAV A;  1J5O A;  3ZX2 A;  3VF6 A;  1SQK A;  3UB5 A;  3D2E B;  2XY6 A;  2OA8 A;  1WBB A;  3CET A;  4DS5 A;  3ZET A;  2FBX A;  2QEX N;  3CPW M;  1KC8 O;  2RE2 A;  1A5W A;  3CCS N;  3T19 A;  3RRH A;  1NWK A;  3P1G A;  4BQL A;  4DLE A;  3CER A;  4GY2 B;  1UAX A;  2KTQ A;  3EE9 A;  4CER A;  1V4S A;  4JKH A;  1NG9 A;  4KPY A;  4BVP A;  2OCE A;  2ZJQ L;  1QQN A;  1D4X A;  1LW2 A;  3TU5 A;  3ZEU A;  4FL9 A;  4CEE A;  4FM1 A;  4BRN A;  1S3X A;  4PKI A;  4OPJ A;  2GEM A;  1EX4 A;  4AHT A;  1RTI A;  3LM9 A;  4FLY A;  5AZI B;  5A2Q O;  2DTU A;  3VQ7 A;  3UE5 A;  5J2Q A;  1WLJ A;  2ZE2 A;  3I55 N;  1HQU A;  4F4K A;  3O4N A;  1JJ2 M;  1TAU A;  4DSK A;  4EZ6 A;  3ZYY X;  2HBJ A;  1NLV A;  2KW4 A;  3H46 O;  1NJY A;  1J9A A;  2NRH A;  2NRT A;  2VG6 A;  3QB0 A;  3Q7C A;  4DTS A;  4FJK A;  4CJW A;  4CJ5 A;  3BDP A;  3RMB A;  1U2V A;  1HYS A;  2P1J A;  5J1E A;  1ATR A;  2YV0 X;  1LW0 A;  2NRV A;  4M7Y A;  4IOX A;  3CCV N;  1WOQ A;  4DS4 A;  2BAN A;  3WXK A;  4YDU A;  4LH4 A;  1P90 A;  5BPN A;  4CI6 A;  3VQ8 A;  4K41 A;  3EYZ A;  4MFB A;  1IO2 A;  5JS1 A;  3AAQ A;  4CEZ A;  4CJK A;  4DCH A;  1TYQ A;  4Q5V A;  3BY5 A;  1FJG K;  5C2D A;  1HNI A;  1KLM A;  2NRR A;  1QHT A;  3SAH A;  5AQQ A;  4BR9 A;  3D45 A;  3CQ8 A;  5KPT A;  1RT3 A;  4LC9 B;  2HHV A;  4DV1 K;  1IKX A;  1RBU A;  2ETJ A;  2QWQ A;  3DXK A;  4ISG A;  4NYN A;  4AHU A;  3RWU A;  4E3S A;  4M3Y A;  5HRN A;  4RW7 A;  4BRM A;  3J8A A;  2VGM A;  2FC0 A;  2PY5 A;  3IRX A;  1VSH A;  5GAE P;  2UUC K;  3VEW A;  1SS6 A;  4FZZ A;  1VSJ A;  4H8K A;  4WQ5 A;  1YIJ N;  4FYD A;  2FBV A;  2O4G A;  3QNO A;  4YOT A;  3THY B;  4C1N I;  4BY9 C;  4E1J A;  2ATQ A;  4BR0 A;  3OTO K;  4KTQ A;  1DKG D;  4LFC K;  4WQ4 C;  1S1U A;  3F2K A;  1RDA A;  3R3L A;  3NE6 A;  3DLH A;  1XQS C;  5KTQ A;  1HJO A;  4M3R A;  1E4G T;  4Z4H A;  3LPT A;  4CE9 A;  1VQM N;  1Q86 O;  3HO1 A;  4LF5 K;  4DR7 K;  1REV A;  1I94 K;  3ID6 A;  3VEV A;  1IBL K;  3HOT A;  1NGI A;  3WQU A;  3OYJ A;  4JNE A;  4RW8 A;  1GLC G;  3AVA A;  4CZE A;  2Q2R A;  4BG8 A;  2HVH A;  3KK2 A;  3AO4 A;  4H5V A;  1S22 A;  3AA4 A;  4CF2 A;  3O4Q A;  1YJN N;  5H1S Q;  2O8B A;  4B9N A;  4HCC A;  3K5M A;  1ZBS A;  2PZS A;  4FJX A;  3VGK A;  2GV9 A;  1YJ9 N;  1VQ5 N;  4H4M A;  1SKW A;  3ENH A;  5GAD P;  3CCQ N;  2E6M A;  5AZJ A;  1G99 A;  1VQL N;  1VSM A;  1XNR K;  1FKO A;  4H0P A;  1ILY A;  2E2O A;  3AA5 X;  4GKJ K;  4H5T A;  4YOX A;  1IV0 A;  2G8W A;  2QKB A;  5C2F A;  1BA0 A;  4I6M B;  1W9H A;  4GV6 A;  4H03 B;  1JXE A;  4AM6 A;  1NKB A;  3J81 O;  1MA9 B;  4IBN A;  4M3Z A;  4CBU A;  1Q7Y O;  4DTN A;  1U4B A;  1TKX A;  4BRE A;  3DLR A;  5AQG A;  2HBM A;  5EOY A;  1TK5 A;  1U6Z A;  1S1X A;  2UXD K;  3JS6 A;  1ZBU A;  3VGL A;  1XC9 A;  1BDG A;  4B1W B;  1MDU B;  3CFP A;  4JN4 A;  1YJW N;  1VQP N;  3UKU A;  4L8R B;  3OJU A;  4B3R K;  3IKM A;  1QS4 A;  4JV5 K;  4YDU C;  3UIQ A;  1J6Z A;  4JK8 A;  5AR0 A;  3MMV A;  3TI0 A;  2RN2 A;  3ULD A;  4K0K K;  2HNY A;  4CJT A;  4OX9 K;  2HHX A;  3GG4 A;  3RVC A;  4O44 A;  4AHV A;  3CHW A;  1TGO A;  1NGC A;  3CCJ N;  1M90 O;  4BRL A;  3THX B;  3VEN A;  2GWK A;  4FJH A;  1NOY A;  4IDK A;  3ZSX A;  4NYF A;  1NGJ A;  4F2S A;  3OYM A;  2IGI A;  2KKZ A;  3HM8 A;  3FE1 A;  3AV9 A;  2ASO A;  2O8C B;  4CGI A;  3MCP A;  1O1W A;  3D7E O;  4CZL A;  3AA3 A;  2E2P A;  4CZH A;  3ISN C;  4W5R A;  2Z1G A;  1NGF A;  4MO5 A;  3FGU A;  1DT9 A;  1HYZ A;  1NMD A;  3L6Q A;  4IG3 A;  5KPZ A;  4N76 A;  3C7N B;  1L3S A;  2HST A;  4F8R A;  4CJU A;  3MXJ A;  4WFN L;  1BOT O;  1KRP A;  4G9Z A;  3HTV A;  1NK9 A;  1WUA A;  5CYM A;  1DEJ A;  2EHG A;  2QWM A;  5AFU A;  3QDK A;  3C0B A;  4ZTF A;  3L3U A;  1S9G A;  3I8B A;  4FJN A;  4HVJ A;  3THW B;  4FZX C;  3FZM A;  1C1B A;  3EZ5 A;  1UWB A;  4M42 A;  3NH1 A;  2P51 A;  3V9X A;  4H5N A;  3CJ7 A;  4ID1 A;  3ITH A;  5M1N A;  2I7P A;  2HMI A;  3ZCM A;  5KGW A;  4U67 L;  1VAZ A;  3BEX A;  1C0F A;  3VGM A;  3G4S N;  5KQ8 A;  3O1W A;  2OPQ A;  4BVO A;  4CZF A;  1YAG A;  2BTF A;  4GV3 A;  2B6A A;  3KK7 A;  1IKW A;  4BRH A;  4CZM A;  1FW6 A;  3HT3 A;  3VET A;  5AQN A;  2HBL A;  3WNE A;  3U9Z A;  1KFD A;  3SCX A;  1BUP A;  3ASM A;  5BN8 A;  3R9P A;  4M45 A;  5FPD A;  4R5P A;  3VQA A;  2ZF5 O;  2PFU A;  5M1K A;  4O5F A;  1NNE A;  3JSM A;  1MWM A;  3D0P A;  3A2F A;  2J4R A;  2IVO A;  1B9F A;  5M1F A;  5JLH A;  3KLH A;  5C12 A;  3DRP A;  3SV3 A;  3O6W A;  3K2P A;  1GOC A;  4A5B A;  4IEE A;  3T3F A;  4DU4 A;  1CZB A;  1MWK A;  3SQ2 A;  2GUP A;  4JI2 K;  3AVM A;  3HJF A;  4ICL A;  4NXM K;  1WB9 A;  2KZZ A;  4RW6 A;  3ZT3 A;  3QML A;  1SV5 A;  5AQV A;  3A8Y A;  2HF3 A;  3PSF A;  2A3Z A;  4BE1 A;  3J7A P;  4YOR A;  1HQE A;  1ASU A;  3L2R A;  1RGI A;  4AH9 A;  3LWM A;  4DQQ A;  2QXL A;  3DYA A;  3W3D A;  5BRF A;  3QBX A;  2B4J A;  4EZ9 A;  1GLF O;  1SKR A;  2P9S B;  4B8C A;  4BC2 A;  4CD3 A;  1BGX T;  1Q9X A;  3TAF A;  4B9S A;  1Y97 A;  4HHT A;  1Z05 A;  4GNI A;  2P9L A;  3RSE A;  3BUZ B;  2I5J A;  3ENO A;  3MDQ A;  3QIO A;  2P9N B;  3U9D A;  4DHY A;  2ZJR L;  3CI5 A;  1JLB A;  4CJP A;  3SZ2 A;  3MEG A;  3SQ0 A;  5AQO A;  1P8Z A;  2F8S A;  4BWM A;  3OYB A;  4HUF A;  1VK0 A;  4XH4 A;  1ZBI A;  2HOE A;  2E4L A;  4H0O A;  3WNH A;  2XRI A;  4FLT A;  3PIO L;  5LMU K;  2O8D B;  3CJ1 A;  4RW4 A;  1VRU A;  1YVU A;  4G1Q A;  2D5R A;  2E1Z A;  2GBZ A;  4FJL A;  1XC3 A;  1R0A A;  1DLO A;  1NK8 A;  4U7B A;  3EO3 A;  1BCM A;  3R6M A;  2IVN A;  3HPG A;  3N4P A;  1WSJ A;  2E2Q A;  3F5T A;  1GLL O;  1IG8 A;  5CR4 A;  1L3V A;  4BC4 A;  3CC2 N;  3L8B A;  4ELV A;  2VG5 A;  3VQC A;  1U45 A;  4UY8 O;  4J2B A;  1BI4 A;  2P9K B;  4BRG A;  3DJC A;  2FLO A;  3CXC M;  1S6Q A;  1GLJ O;  4OO1 J;  4Y1D A;  2QWL A;  4GKK K;  5FPN A;  2EX3 A;  5M1Q A;  4DU1 A;  5HBM A;  1JL2 A;  3VQ6 A;  3EKU A;  3AVK A;  3A5L C;  2YKN A;  3HBT A;  2P5O A;  1KCF A;  3NCI A;  4FK4 A;  3AGR A;  4KI4 A;  4B1V A;  3QIN A;  3AVL A;  4X64 K;  2YHY A;  2I7N A;  3ZSY A;  3SYZ A;  4HWI A;  3R1X A;  5M1O A;  4DV7 K;  2HVI A;  4ZHR A;  3QEX A;  3UKR A;  3O3F A;  3OS2 A;  1IBM K;  3AVN A;  1L3T A;  2V52 B;  1HMV A;  2UXC K;  3TAB A;  1W2B M;  1KAY A;  1NJW A;  3SPY A;  3NVM A;  3NAE A;  3IS9 A;  3SNN A;  1KVA A;  3VQ9 A;  2YHB A;  4N41 A;  1W0H A;  3H08 A;  2A1S A;  4LF4 K;  3M8P A;  3MEC A;  4CK2 A;  4DTP A;  1QQC A;  4FWK A;  2RKI A;  3ZT0 A;  1W97 L;  5GIP A;  1RT6 A;  4CHP A;  4CEQ A;  3CFO A;  3CQX A;  4NCA A;  5GAH P;  3OS0 A;  1YUW A;  2D0O A;  4JLH A;  3SUN A;  3S41 A;  4JRP A;  2CGK A;  1FKP A;  5D3G A;  4EP4 A;  4JKA A;  3ENB A;  2P9I A;  1WSE A;  4OGE A;  3NGZ A;  4OPH A;  4JKB A;  4QS7 A;  5FRM A;  1VRT A;  3IDH A;  4TSX A;  2F96 A;  1D9F A;  2AP1 A;  2A6A A;  3J7Z O;  4DV0 K;  5C10 A;  2FSJ A;  3EEQ A;  3SJJ A;  4JEP A;  1O13 A;  2ZGY A;  3NMU A;  1RDB A;  1T44 A;  1T6D A;  5AQY A;  3ZEU B;  4ELU A;  4DSE A;  4JI3 K;  4WE1 A;  1NGD A;  1WBD A;  2O8E A;  1T3V A;  2PYJ A;  4JS4 A;  2NNW A;  1NK0 A;  4FWL A;  2H3G X;  1ZBL A;  3A0I X;  3NGI A;  1BQM A;  5FPE A;  3NF9 A;  3MAQ A;  3T1H K;  3DI6 A;  1U47 A;  1S1V A;  4DQP A;  4M63 C;  3KJV A;  2F8T A;  3CM5 A;  1RT5 A;  4DV2 K;  4ISE A;  1NGB A;  3D2F A;  3V9S A;  1WSG A;  1QSY A;  3QIC A;  4GW6 A;  4OKJ A;  1TVR A;  4FJ8 A;  3VEZ A;  4KV8 A;  4H5R A;  3VQ5 A;  3HP6 A;  3MED A;  3G25 A;  1SKS A;  2ASP A;  5F1X A;  3K57 A;  5LMN K;  4BR5 A;  4Z4I A;  3KVG A;  4JRQ A;  3VPZ A;  4F9O A;  5BRH A;  2VYP A;  4L3Q A;  4B9L A;  3HM9 A;  3THV A;  4MDA A;  4MDB A;  4Z4C A;  2OTL N;  4YNQ A;  3CF5 L;  1QQM A;  4CJQ A;  2ITG A;  3TAP A;  4BDP A;  2A41 A;  1OVQ A;  5ELZ A;  1TK0 A;  1UA0 A;  2UUA K;  1XMO K;  3L2W A;  4B1X B;  4E7J A;  3DAW A;  3H45 C;  4AHR A;  3KLI A;  3OVN A;  4Z4F A;  3I56 N;  4DKW A;  4KRE A;  3RR8 A;  3VQE A;  2OPS A;  3EZW A;  2WTU A;  4W5N A;  4DSJ A;  3LAL A;  2VQE K;  4IXC A;  1BL3 A;  1HNV A;  3O80 A;  1NGH A;  4CF0 A;  5ADX A;  1HKC A;  3B6P A;  3ZSR A;  2QW9 A;  1SZ2 A;  1UOC A;  2P9P A;  2CGJ A;  3QER A;  1JLQ A;  4CHQ A;  3PO5 A;  1B92 A;  2F9W A;  3OYD A;  2HHU A;  3A5M C;  4FLV A;  4CBW A;  1WAJ A;  4IZ9 A;  5IWA K;  4B08 A;  1E4F T;  2YX6 A;  3LZI A;  4CEC A;  4DSI A;  5AQH A;  4MQ3 A;  4H5W A;  3CCL N;  4CJL A;  2YNF A;  3E01 A;  4FK0 A;  3C6T A;  4FVU A;  4DV5 K;  4BE2 A;  2D0C A;  1C1C A;  1TUY A;  2W6L A;  4B3T K;  4FJ5 A;  4ILJ A;  4FZY A;  3E9O A;  2Y1J A;  4JD2 B;  2QWR A;  5BRD A;  4DU3 A;  3VQQ A;  4BRO A;  4DFP A;  3OBW A;  1KAX A;  1C0T A;  3K9J A;  2YCH A;  1K8K B;  4FWQ A;  1VSI A;  1X9J A;  5AQP A;  4QS9 A;  4XH5 A;  5AZJ B;  4I9L A;  2EWS A;  4BQZ A;  3WUH A;  4DR4 K;  4CJ4 A;  3PSI A;  4ZTJ A;  4JI1 K;  4FJJ A;  1KVC A;  3F9K A;  3SUQ A;  4FLU A;  4BRI A;  4O55 A;  1YI2 N;  4B1Y B;  4IOA L;  4Q0B A;  3OYI A;  4AHC A;  3H3O B;  3OYH A;  3GL1 A;  2DFE A;  3QIP A;  4ISF A;  1Z26 A;  3TTD A;  3NF7 A;  3P38 A;  4W5Q A;  1Q82 O;  3M6G A;  4M3W A;  2KFZ A;  4JAX A;  2BE2 A;  2HHS A;  1JCF A;  4IOC L;  5AQW A;  3RTV A;  4BR7 A;  4E7L A;  3KD1 E;  5BR8 K;  3MN7 A;  1UA1 A;  4LH5 A;  3MN5 A;  5AQF A;  4E1N A;  4AQY K;  5JMV A;  1JLC A;  3SAG A;  4FJ9 A;  2DY4 A;  4PWD A;  3DLE A;  2IC3 A;  3CFR A;  3LAM A;  5HRR A;  3M8S A;  5AQK A;  4DF4 A;  3PY8 A;  1EP4 A;  2NUB A;  4CJF A;  4JI0 K;  4CEB A;  3WNF A;  1RBT A;  3AVC A;  2E2N A;  4KTW A;  2V7Z A;  2QWP A;  3AO1 A;  4IFY A;  4FOI A;  1VQK N;  5KRT A;  3RMD A;  1OKJ A;  2YHW A;  3VTI A;  5CYQ A;  4PHT X;  1NMN A;  5J2N A;  4B9V A;  1KFS A;  3ULE A;  3LDS A;  3K59 A;  3OHR A;  4BG9 A;  4FM2 A;  4B8A B;  4OKK A;  1K9M O;  2XO7 A;  3T1A A;  1EKE A;  2R7Y A;  2O8F B;  1H1V A;  2OAN A;  4BDZ A;  3VTH A;  3OW2 M;  3QBW A;  4OJR A;  4A2A A;  4BRD A;  3EN9 A;  3KWI A;  3M3Z A;  5ADX H;  2D4W A;  3V9Z A;  1VSK A;  4KHN A;  4FSV A;  3N4Q A;  4FJG A;  4I6M A;  2QI2 A;  3HZ6 A;  4O8U A;  4CJ3 A;  2XY5 A;  2HHT A;  4Y0W A;  4YOU A;  4OKE A;  1YXQ A;  3O9S A;  5T7B A;  2HW3 A;  1VSD A;  1RBS A;  2ZGZ A;  5JS2 A;  3CJA A;  1QVG M;  3O9T A;  2YJF A;  3C94 A;  3CM6 A;  2W41 A;  3SBG A;  3AVI A;  3L0Q A;  4FCY A;  3WXL A;  2KHO A;  1VQO N;  2CH5 A;  3CME N;  4JKG B;  3SAF A;  3QEW A;  3AO2 A;  3DM2 A;  3ZX3 A;  3OYN A;  3P5J A;  3NH2 A;  3O9Q A;  4WQ5 C;  3V4I A;  5M1P A;  2D1K A;  5CE3 A;  4B3M K;  5LL6 Z;  4DR1 K;  1YF5 L;  4FJM A;  2Q36 A;  3LP0 A;  4HTL A;  2E1Y A;  1U48 A;  2IIR A;  3OS1 A;  4F3O A;  5LJV A;  3MX2 A;  2LSN A;  1JCE A;  3AY9 A;  1VQ7 N;  4CF8 A;  4DMN A;  4DQS A;  3KWG A;  1KD1 O;  3HP9 A;  3WXM B;  3TAN A;  4O5B A;  2WUS A;  1ITG A;  2ITM A;  1L3U A;  3VF4 A;  1WN7 A;  5BRE A;  1SL2 A;  3AVH A;  5AQZ A;  2GX9 A;  4HTU A;  5JVH L;  4QS8 A;  1NGG A;  5SZT A;  3TAM A;  4FLW A;  3K5L A;  1TK8 A;  1RDU A;  3DRS A;  3ZSV A;  2OZM A;  1XMQ K;  4FJI A;  2HHQ A;  4ILG B;  3KD5 E;  4BRQ A;  3IFR A;  4B1Z A;  3NF6 A;  4WFA L;  2NZT A;  5E84 A;  4A61 A;  1SL0 A;  1BWF O;  4H0T B;  3SMP A;  3C7N A;  4O0J A;  1YTU A;  4DF8 A;  4PY5 A;  4NO7 A;  2CH6 A;  1ASV A;  4J2A A;  1W7A A;  3PV8 A;  3DXM B;  4BR4 A;  3V1Q A;  2Y1I A;  4JKE A;  4IO8 A;  1T05 A;  3TAR A;  2BGG A;  3SPZ A;  3C65 A;  1CZA N;  2D0A A;  3BP8 A;  4FWM A;  1X3N A;  1X9W A;  1Q81 O;  1NGA A;  2CGL A;  5KPR A;  4CJE A;  5J2P A;  3TSU A;  5KQD A;  3F73 A;  3HYF A;  1FXX A;  1GOB A;  4PKG A;  1RBR A;  1KXP A;  3O08 A;  3DLL L;  5HP1 A;  3LP2 A;  4Z94 A;  1NU0 A;  4PL8 A;  3VMF B;  3GE1 A;  3BF3 A;  1RBV A;  3U3Y A;  4B9M A;  4NXN K;  4DTJ A;  3EE8 A;  1RTH A;  3FFI A;  4CHN A;  3AAP A;  2YHX A;  3KLE A;  2YHA A;  2Q0R A;  3NVK A;  1HYV A;  3MN6 A;  4RTF D;  1LV5 A;  4C8O A;  2YNH A;  3WEE B;  1Q9Y A;  5BR9 A;  4C1N K;  5CZ1 A;  2G8K A;  2ASM A;  1GLD G;  4PQU A;  1VSF A;  4F2R A;  1T7P A;  2X6S A;  3LDL A;  4FWP A;  1X1P A;  3BZC A;  1IJJ A;  4J2E A;  3U8X A;  5I9E B;  5AQS A;  1U49 A;  4K8X A;  4CBX A;  4Y1C A;  3U3G A;  3B8A X;  2UXB K;  3SI6 A;  4M7X A;  4BRP A;  4ELT A;  3RMC A;  4EFH A;  2Q97 A;  3CJC A;  1J53 A;  2W40 A;  4JKC A;  3HPO A;  3QEI A;  2Q0U A;  1WNS A;  5AQR A;  3VER A;  1JLE A;  1LWE A;  2VWB A;  4DTO A;  1F21 A;  4Z4G A;  4JHD B;  1EQY A;  1VSL A;  3LDQ A;  5E26 A;  3DRR A;  1Z25 A;  3TR8 A;  5HOO A;  3S3N A;  1NJX A;  1WSH A;  2KFN A;  4F3T A;  1X9M A;  1CXQ A;  4YY3 K;  5AFU H;  1X9S A;  4IJN A;  3O3G A;  3NGY A;  4YOV A;  3O5B A;  3PX0 A;  2YKM A;  5FRN A;  1QQO A;  3WXI A;  2E20 A;  5C0Y A;  2P9N A;  4KFB A;  2VWK A;  1RTJ A;  2OPR A;  2QWN A;  3O4W A;  4DSF A;  1EO1 A;  5DM7 L;  1NKE A;  4FOE A;  4I2Q A;  4DV4 K;  2OZS A;  1JCG A;  3ZT4 A;  4B9Q A;  2FF6 A;  1BU6 O;  4KRF A;  1NK7 A;  4AHS A;  3FZH A;  2O8D A;  2VQF K;  4CVN E;  3PIP L;  3CQY A;  3VN5 A;  4KHP K;  4LSN A;  2G8H A;  1XWL A;  5LY3 A;  1VQ6 N;  4B9U A;  5K14 A;  3CMA N;  4KAZ A;  2P9I B;  2RPI A;  1X3M A;  2Z1J A;  4BR2 A;  4CEF A;  4BRA A;  3V6D A;  5AQJ A;  3OYF A;  1JLF A;  1NGE A;  1BHL A;  2IS3 A;  4DFM A;  3MXI A;  3RMA A;  4GMJ B;  4DR6 K;  1Z6R A;  2P9U B;  3VQP A;  1RFQ A;  4KH4 A;  1YIT N;  2YNI A;  3AA2 A;  3KKS A;  3KK1 A;  2KQ2 A;  2HF4 A;  1RCH A;  2QWO A;  4GV9 A;  1JL1 A;  3U4L A;  4CJ7 A;  3KIO A;  3OYG A;  2UUB K;  2UYT A;  3HST B;  3QO9 A;  3ZET B;  3SJH A;  4FK2 A;  3ZT2 A;  3QEP A;  4FPB A;  2G8F A;  3H6E A;  4E0D A;  4H0V B;  1HRH A;  1HNX K;  2VWJ A;  3HK2 A;  4RW9 A;  4CCH A;  4CED A;  3CC4 N;  2F9T A;  1DGK N;  1N32 K;  1QHA A;  4JI8 K;  4JKD A;  3BGR A;  3VQ4 A;  1JLG A;  3QFU A;  5I3U A;  3KTQ A;  1LAW A;  4ID5 A;  4O8K A;  3MN9 A;  2FF3 B;  4FWN A;  4WQ4 A;  3S3O A;  3LP3 A;  3D6R A;  2Q3S A;  3DWL A;  1D8Y A;  3KHY A;  1BG3 A;  1S1T A;  2A40 A;  1RDD A;  4CHO A;  1NK6 A;  4JK7 A;  1C0M A;  5AQT A;  2X6N A;  3C95 A;  4N56 A;  5B8H A;  1Y64 A;  4KHU A;  2GTD A;  3P83 D;  3V9W A;  3LP1 A;  4K8Z A;  3K58 A;  3OA9 A;  2WC9 A;  4WCE L;  4M3X A;  3CCE N;  4A2B A;  1U2V B;  3OYE A;  5MLC Q;  4DFK A;  2F7T A;  4X65 K;  1TAQ A;  1I3A A;  4NLB A;  1QSL A;  1BO5 O;  2GWJ A;  4DLG A;  1ATN A;  1TKD A;  4M41 A;  3L2Q A;  1TV6 A;  5F2R A;  4BDY A;  4Z0U A;  1DTQ A;  4OPA A;  2DPN A;  3PO4 A;  3LPU A;  2HHH K;  3O9R A;  3OYK A;  1A5X A;  4EIA A;  1KSP A;  4AM7 A;  4CJS A;  1TYQ B;  5C25 A;  3F9M A;  3VEX A;  3P31 A;  1SAZ A;  2JWL A;  3D2E A;  1XI1 A;  1IKV A;  4DR5 K;  3L2U A;  3S3M A;  4OVL A;  3L4I A;  4RG8 A;  2D0P A;  3ZSW A;  3V1R A;  5DM6 L;  4DR3 K;  2B5J A;  2E5L K;  4HCB A;  4CIG A;  1YVN A;  2D0B A;  1LCU A;  3OYC A;  1HKB A;  4CZI A;  2P9P B;  1GLE G;  3DXK B;  1T8E A;  3TAE A;  1GOA A;  2IDO A;  5TKY A;  4XEI A;  1M1K O;  4NLC A;  3ATU A;  3KK3 A;  3VQD A;  4IFV A;  1G15 A;  3JYT A;  3ATV A;  3FFK B;  4IG0 A;  5C42 A;  3V9U A;  4FW1 A;  2VGN A;  2GUI A;  3MK6 A;  4DV6 K;  2AJQ A;  4V19 S;  4QCL A;  1RIL A;  5KI6 A;  2PYL A;  3ZLJ A;  1GLA G;  5AZI A;  3TWH A;  1ZXO A;  3I8D A;  3DLK A;  5EXW A;  3K5N A;  4JK9 A;  2ZWH A;  3VF2 A;  4DTR A;  4FWS A;  1K6Y A;  2JWK A;  2OTJ N;  1NBW A;  5FRO A;  4WFB L;  4EAH D;  1L5U A;  4KTZ A;  1EWQ A;  2RHK A;  3AVG A;  1HNW K;  3CJB A;  1TL3 A;  3IG1 A;  4CFD A;  2VG7 A;  3HPH A;  3CCM N;  4PKH A;  4FPA A;  3SBT A;  4DV3 K;  4OLA A;  1SL1 A;  4QOZ B;  1B9D A;  3CD6 N;  3IAY A;  1QTM A;  1QE1 A;  2BUP A;  3G10 A;  3T7Z A;  2NLX A;  5CY4 A;  5AQU A;  4CZG A;  3AVB A;  4BRK A;  2E8A A;  4DTU A;  2V51 B;  1V4T A;  3MEE A;  3ZX0 A;  4B3S K;  2QA4 N;  4K25 A;  2V7Y A;  1ZBF A;  3MWP A;  4J2D A;  4PL7 A;  2O8B B;  4JI7 K;  3NDK A;  4KH5 A;  4CFB A;  3SV4 A;  4E19 A;  4WYB A;  2Z1H A;  4YOW A;  2QXF A;  3HSC A;  3A5O C;  3BF1 A;  5FLX O;  3CC7 N;  4CGF A;  1HPZ A;  5BPL A;  3NBP A;  3SUO A;  1KAZ A;  3FR0 A;  3R8E A;  4FM0 A;  4C8L A;  2ZQB A;  5GAG P;  3JXU A;  1T03 A;  3KKR A;  4FWO A;  1NKC A;  3E9P A;  4GVE A;  5HRP A;  1J5E K;  1ZYQ A;  2JLE A;  1C1A A;  1LWF A;  4FO0 A;  1TKZ A;  4H4O A;  3T69 A;  4FJ7 A;  3E66 A;  2AA4 A;  1QSS A;  4IO9 L;  4LD0 A;  2FXU A;  3EL2 A;  1RT1 A;  1FK9 A;  4LF8 K;  1E3M A;  3PLA A;  3TAG A;  5C24 A;  3THY A;  2W6K A;  3PUF A;  4C8M A;  3GOI A;  4W5O A;  1VQ9 N;  5EY4 A;  1XHX A;  3ZSO A;  4A57 A;  5C15 A;  1HX1 A;  3LM2 A;  4JD2 A;  1HLU A;  5F0X A;  3DOL A;  4LFB K;  2XY8 A;  4RWT A;  3UKU B;  3ULE B;  3CCR N;  2NRZ A;  1HJR A;  3HRG A;  2HHW A;  1JKH A;  4CGG A;  4BC5 A;  2QTD A;  1K8K A;  2PAV A;  2X74 A;  3IMX A;  4HUE A;  2BH1 A;  3I0S A;  4KB1 A;  4M3U A;  1RT4 A;  4E1M A;  3V81 A;  4FXD A;  2PBD A;  1RNH A;  1NK4 A;  2RF2 A;  1HNZ K;  2F4V K;  3FZF A;  3MCA B;  3WNG A;  3LDN A;  2IAJ A;  4MO4 A;  4CHZ A;  3WT0 A;  1IG9 A;  5I42 A;  2A1R A;  4I7F A;  1A5V A;  4CD1 A;  3T1Y K;  4N5S A;  1LWC A;  1CLQ A;  3DLB A;  3LAK A;  4X66 K;  2FBT A;  3LZJ A;  4CFA A;  2NRX A;  5HRS A;  1QVF M;  4IJA A;  4C8N A;  1D5A A;  4NB4 A;  5E41 A;  3I33 A;  2Q31 A;  4CHY A;  3CPE A;  1KTQ A;  1VQN N;  2ZM6 K;  1RT2 A;  2X78 A;  5AQM A;  4O0I A;  3RR7 A;  4C8K A;  4QAG A;  1RTD A;  3J7Y P;  1K73 O;  3O9U A;  4DQI A;  4DTM A;  4J8F A;  4CES A;  1HUX A;  3A5N C;  2IOC A;  2HBK A;  1S5J A;  2QM1 A;  3ALY A;  4X62 K;  1S6P A;  3L3V A;  1N6Q A;  3EKS A;  1N36 K;  3LL3 A;  4KHW A;  2GEL A;  4BWJ A;  4LF7 K;  4B3O A;  4KH6 A;  2OPP A;  4CIF A;  5JIC A;  1XHZ A;  3MXM A;  1MU2 A;  3SLC A;  4BAC A;  3LWL A;  4EHT A;  3TPQ A;  1NJI O;  4CEO A;  4KHY A;  2DFF A;  4O4G A;  1WSI A;  2HNZ A;  3HL8 A;  1OVY A;  3JAM O;  3L2V A;  2O8F A;  1C0G A;  1ATS A;  1EXQ A;  3V1O A;  1BIU A;  3SQ4 A;  4H0Y B;  3DOK A;  5FPM A;  5BN9 A;  1WAF A;  4C23 A;  5GIO A;  3OYA A;  4DUZ K;  1EWR A;  3LAN A;  4LY7 A;  5SWM A;  4I2P A;  3IUC A;  4LFA K;  3P4I A;  5CZ2 A;  3KLF A;  4FW2 A;  3ID8 A;  3THX A;  1QZ5 A;  2FSN A;  2QK9 A;  3SK3 A;  2O8C A;  4CK1 A;  3W0L A;  4KKO A;  3QEV A;  3OYL A;  3VQB A;  4E7K A;  4MLE A;  4E7H A;  1KVB A;  3QET A;  1KQS M;  1VSE A;  4GVM A;  1N8R O;  1RDW X;  4JKG A;  2VCP A;  4DQ8 A;  3FLC O;  4BGA A;  3CG7 A;  4ILH A;  2HND A;  2YI1 A;  3FZL A;  3M8R A;  3MX5 A;  3NF8 A;  3E9L A;  2NRW A;  4CF9 A;  4WF9 L;  1NJZ A;  2YNG A;  4YFU A;  3RRG A;  4JI6 K;  1LOT B;  4DUY K;  1D9D A;  2ZJP L;  4DWI A;  5AQI A;  2OYQ A;  3HOS A;  2JGU A;  3TTC A;  1K8A O;  4CJR A;  4EHU A;  4HUG A;  4E7I A;  3THW A;  3G0Z A;  3AVF A;  2P9L B;  3VEO A;  1ZBH A;  1VQ4 N;  3RSE B;  5HLF A;  3O8M A;  4FVM A;  4JS5 A;  4KB0 A;  1HKG A;  4IDH A;  3HXM A;  3M1F A;  1Q8I A;  1ASW A;  3TSQ A;  4FLZ A;  3CJ9 A;  3VA0 A;  2YJE A;  1HR0 K;  3KLG A;  3WQT A;  3PX4 A;  1OH8 A;  3P39 A;  1YHQ N;  4E89 A;  3SMS A;  1C0U A;  3K5O A;  4CFC A;  4B9T A;  4CZK A;  4LSL A;  1YTA A;  5LJW A;  1JLA A;  5AJ3 K;  4OGC A;  4DSL A;  5HRO A;  5BPM A;  2E88 A;  1HPM A;  4PA1 A;  5AQX A;  1GLB G;  2Q1N A;  4A59 A;  1BIS A;  3C6U A;  3DXM A;  4OPK A;  3WXJ A;  1SUQ A;  4H0X B;  3S9H A;  4DG1 A;  3QES A;  1OH6 A;  5GIN A;  1BI4 B;  2O4I A;  2FSK A;  3C6A A;  4XH1 A;  1DTT A;  2Z1I A;  4BE0 A;  2WFB A;  4CJV A;  4OLB A;  3KZB A;  1TL1 A;  1OH7 A;  1YT3 A;  3OBY A;  3O1B A;  1OH5 A;  3MWT A;  3G71 N;  2HMP A;  4CIE A;  5CHI A;  4JI5 K;  3H1Q A;  3K0S A;  2KLA A;  4AIL C;  4LF9 K;  3H3N O;  1NOZ A;  4IFE A;  4CF1 A;  4KI6 A;  4CEA A;  3GBT A;  3HVR A;  3TSP A;  1U04 A;  2QKK A;  1ESV A;  4BC3 A;  4NCG A;  3LDO A;  3G6E N;  4K43 A;  3ZSQ A;  3UKR B;  3U6F A;  2P9S A;  3TTF A;  5DK5 A;  4XIU A;  2UU9 K;  1C6V A;  1VHX A;  2WBN A;  2A5X A;  1NK5 A;  4R79 A;  3L4Q A;  4IWV A;  1KLN A;  2FBY A;  5KGX A;  4CK3 A;  5HL7 L;  3WEE A;  4KHS A;  1VQ8 N;  1S9E A;  3NHG A;  3NFA A;  1N34 K;  4A62 A;  4DTX A;  3AAR A;  3VES A;  1T6C A;  2E6L A;  3ZSZ A;  1BIZ A;  4BRF A;  1RDC A;  2P5G A;  4CZJ A;  1CZ9 A;  2G8U A;  2BDP A;  1BQN A;  4EP5 A;  2ZD1 A;  4IEI A;  1TUU A;  3QLH A;  4DQR A;  4DB3 A;  3SUP A;  5FDL A;  3AGK A;  4BGB A;  3AO3 A;  5JLF A;  4NCB A;  5JVG L;  2A42 A;  3B6O A;  5J2M A;  2WON A;  3CIP A;  4JHD A;  4CGD A;  2HB5 A;  4Z4E A;  2KZM A;  4N47 A;  1Q18 A;  4M3T A;  3BZK A;  3VOV A; 
#chains in the Genus database with same CATH homology
 5M1K A;  4O5F A;  4NLC A;  3ATU A;  5EX5 A;  1R59 O;  1MWM A;  3ATV A;  3QFP A;  3FFK B;  2J4R A;  2P9K A;  2IVO A;  3E1Y A;  2E2N A;  1ZC6 A;  5M1F A;  5JLH A;  2VGN A;  2V7Z A;  2QWP A;  3MK6 A;  5C12 A;  4FOI A;  1VQK N;  3O6W A;  1GLA G;  1OKJ A;  2YHW A;  4KBO A;  5AZI A;  1ZXO A;  3VTI A;  4A5B A;  4IEE A;  4PHT X;  1MWK A;  3VEY A;  5EXW A;  2GUP A;  4JK9 A;  2ZWH A;  3VF2 A;  4FWS A;  2JWK A;  3ULE A;  2OTJ N;  3OHR A;  3QML A;  1NBW A;  5AQV A;  4BG9 A;  3A8Y A;  2HF3 A;  4WFB L;  1K9M O;  4EAH D;  2A3Z A;  5EVZ A;  2RHK A;  4YOR A;  4FWR A;  3CJB A;  3K9K A;  1H1V A;  2OAN A;  3H1V X;  3VTH A;  1S72 N;  3OW2 M;  3QBW A;  4XEI A;  2IVP A;  3CCM N;  4PKH A;  4A2A A;  4BRD A;  3EN9 A;  1RGI A;  3KWI A;  4FPA A;  3M3Z A;  3SBT A;  2QXL A;  5ADX H;  3W3D A;  2D4W A;  3QBX A;  5BRF A;  4RCH A;  4FSV A;  3GDQ A;  1GLF O;  3N4Q A;  4BRC A;  3CCU N;  3CD6 N;  2P9S B;  4I6M A;  4BC2 A;  4CD3 A;  2QI2 A;  2BUP A;  3HI0 A;  3HZ6 A;  4O8U A;  3Q7B A;  4K42 A;  1Z05 A;  4GNI A;  3D2F B;  3T7Z A;  2NLX A;  3LDP A;  2P9L A;  4Y0W A;  1YXQ A;  3O9S A;  4YOU A;  5AQU A;  4BRK A;  3RSE A;  3BUZ B;  4CZG A;  2ZGZ A;  2E8A A;  3CJA A;  4MLH A;  2V51 B;  4A5A A;  5AQL A;  3ENO A;  1QVG M;  3O9T A;  4YOY A;  2YJF A;  3C6H A;  3FZK A;  3MDQ A;  1V4T A;  2W41 A;  3SBG A;  3ZX0 A;  2P9N B;  3L0Q A;  3U9D A;  2QA4 N;  3WXL A;  2KHO A;  4K25 A;  1QZ6 A;  2CH5 A;  5TKW A;  2V7Y A;  2P9U A;  3CI5 A;  4JKG B;  4DHY A;  2ZJR L;  3CME N;  3SAF A;  3MWP A;  5AQO A;  4PL7 A;  1P8Z A;  4B1U B;  4AF1 A;  5CHI A;  3ZX3 A;  4KH5 A;  4XH4 A;  1BA1 A;  3M5R A;  4WYB A;  2HOE A;  1XUP O;  4H0O A;  3HSC A;  1NM1 A;  4YOW A;  3O9Q A;  4JKF A;  3A5O C;  3BF1 A;  4WQ5 C;  5M1P A;  3CC7 N;  3ZX2 A;  2D1K A;  3VF6 A;  5CE3 A;  3PIO L;  1SQK A;  3UB5 A;  3D2E B;  5BPL A;  1KAZ A;  3CET A;  3FR0 A;  3R8E A;  3CJ1 A;  1YF5 L;  2Q36 A;  3ZET A;  5GAG P;  2E1Z A;  4HTL A;  3CPW M;  1KC8 O;  3JXU A;  2E1Y A;  1VQO N;  2RE2 A;  2QEX N;  2IIR A;  4FWO A;  1XC3 A;  3CCS N;  5LJV A;  4U7B A;  3EO3 A;  3MX2 A;  3E9P A;  4GVE A;  1JCE A;  1NWK A;  3AY9 A;  3R6M A;  1VQ7 N;  2IVN A;  4BQL A;  3CER A;  4FO0 A;  3N4P A;  3KWG A;  2E2Q A;  3F5T A;  1KD1 O;  1GLL O;  3T69 A;  3E66 A;  4GY2 B;  3WXM B;  1IG8 A;  2AA4 A;  5CR4 A;  2WUS A;  4IO9 L;  2ITM A;  3EE9 A;  1V4S A;  2FXU A;  3EL2 A;  3VF4 A;  4BC4 A;  4JKH A;  3CC2 N;  4BVP A;  2ZJQ L;  1QQN A;  5BRE A;  4UY8 O;  1D4X A;  3TU5 A;  5AQZ A;  2P9K B;  4FL9 A;  3ZEU A;  3DJC A;  2FLO A;  4BRG A;  3CXC M;  3PLA A;  2GX9 A;  4BRN A;  1S3X A;  4PKI A;  2GEM A;  5JVH L;  1GLJ O;  4OO1 J;  3GOI A;  2QWL A;  4QS8 A;  1NGG A;  1VQ9 N;  3LM9 A;  5EY4 A;  5FPN A;  5AZI B;  5M1Q A;  1RDU A;  3UE5 A;  4A57 A;  5C15 A;  1HX1 A;  3LM2 A;  4JD2 A;  3EKU A;  1HLU A;  4ILG B;  4BRQ A;  5F0X A;  3IFR A;  4B1Z A;  3A5L C;  3HBT A;  3I55 N;  4RWT A;  3UKU B;  2NZT A;  5E84 A;  3ULE B;  4WFA L;  4A61 A;  3CCR N;  2NRZ A;  3AGR A;  1BWF O;  4H0T B;  3SMP A;  1JJ2 M;  4B1V A;  3C7N A;  3HRG A;  2YHY A;  2I7N A;  4HWI A;  4NO7 A;  2CH6 A;  3R1X A;  5M1O A;  2QTD A;  4BC5 A;  3ZYY X;  1K8K A;  2PAV A;  2HBJ A;  3IMX A;  1NLV A;  2BH1 A;  3H46 O;  2NRT A;  2NRH A;  3UKR A;  3QB0 A;  3Q7C A;  3DXM B;  4BR4 A;  2PBD A;  2V52 B;  4JKE A;  4IO8 A;  1U2V A;  3FZF A;  3MCA B;  1W2B M;  1ATR A;  3LDN A;  1KAY A;  3C65 A;  2NRV A;  3NVM A;  4MO4 A;  1CZA N;  4IOX A;  4M7Y A;  3CCV N;  3WT0 A;  3BP8 A;  1WOQ A;  4FWM A;  1X3N A;  1Q81 O;  1NGA A;  2CGL A;  4CD1 A;  5KPR A;  3TSU A;  5KQD A;  3WXK A;  4YDU A;  4PKG A;  1P90 A;  5BPN A;  1KXP A;  2NRX A;  3O08 A;  3DLL L;  4CI6 A;  4IJA A;  1QVF M;  4K41 A;  4NB4 A;  4Z94 A;  4FWK A;  4PL8 A;  1W97 L;  5GIP A;  3AAQ A;  3VMF B;  3I33 A;  4DCH A;  1TYQ A;  2Q31 A;  3GE1 A;  3BF3 A;  3CQX A;  3CPE A;  5GAH P;  1YUW A;  1VQN N;  2D0O A;  3EE8 A;  3S41 A;  5C2D A;  2NRR A;  5AQM A;  3AAP A;  2YHX A;  2CGK A;  3SAH A;  5AQQ A;  4BR9 A;  1K73 O;  2Q0R A;  3O9U A;  5KPT A;  4J8F A;  4JKA A;  3NVK A;  3ENB A;  3MN6 A;  4LC9 B;  2P9I A;  1HUX A;  3A5N C;  2QWQ A;  3DXK A;  4ISG A;  4RTF D;  4OPH A;  4JKB A;  4QS7 A;  2HBK A;  4BRM A;  2QM1 A;  3J8A A;  2VGM A;  3IDH A;  3WEE B;  5BR9 A;  4C1N K;  3EKS A;  2AP1 A;  2A6A A;  2ASM A;  1GLD G;  5GAE P;  3J7Z O;  5C10 A;  3LL3 A;  2FSJ A;  2GEL A;  3LDL A;  4JEP A;  1O13 A;  4FWP A;  2ZGY A;  3VEW A;  3NMU A;  1SS6 A;  1T44 A;  1IJJ A;  3U8X A;  5I9E B;  1T6D A;  5AQS A;  4KH6 A;  4WQ5 A;  5AQY A;  3ZEU B;  1YIJ N;  4CBX A;  5JIC A;  4YOT A;  3SLC A;  4C1N I;  4BY9 C;  3B8A X;  4E1J A;  1NGD A;  4EHT A;  1T3V A;  3TPQ A;  1NJI O;  4BR0 A;  4M7X A;  4BRP A;  1DKG D;  4EFH A;  2NNW A;  4WQ4 C;  2Q97 A;  3CJC A;  4FWL A;  3F2K A;  2H3G X;  2W40 A;  3A0I X;  4JKC A;  1OVY A;  2Q0U A;  3R3L A;  1C0G A;  1XQS C;  1ATS A;  5FPE A;  5AQR A;  3VER A;  2VWB A;  4H0Y B;  1HJO A;  1E4G T;  5FPM A;  5BN9 A;  5GIO A;  4C23 A;  4M63 C;  4JHD B;  1Q86 O;  1VQM N;  1EQY A;  3LDQ A;  5E26 A;  3IUC A;  3P4I A;  5HOO A;  4ISE A;  3ID8 A;  1QZ5 A;  3ID6 A;  2FSN A;  5AFU H;  3VEV A;  1NGB A;  3HOT A;  4IJN A;  1NGI A;  3WQU A;  3D2F A;  4JNE A;  3SK3 A;  3W0L A;  1GLC G;  4YOV A;  3O5B A;  4CZE A;  3QIC A;  4MLE A;  1QQO A;  1M1K O;  2Q2R A;  2E20 A;  3WXI A;  4BG8 A;  5C0Y A;  1KQS M;  2P9N A;  4H5V A;  1S22 A;  2QWN A;  3O4W A;  3VEZ A;  1N8R O;  1EO1 A;  1RDW X;  5DM7 L;  4JKG A;  2VCP A;  4H5R A;  4DQ8 A;  3FLC O;  4FOE A;  4BGA A;  3G25 A;  4ILH A;  2ASP A;  5F1X A;  5H1S Q;  1YJN N;  2YI1 A;  3FZL A;  4BR5 A;  3KVG A;  3MX5 A;  1JCG A;  3E9L A;  3VOV A;  2NRW A;  4B9Q A;  2FF6 A;  4WF9 L;  1BU6 O;  3VGK A;  1YJ9 N;  1VQ5 N;  3VPZ A;  1LOT B;  4F9O A;  3ENH A;  5GAD P;  2ZJP L;  3CCQ N;  3FZH A;  5BRH A;  2VYP A;  5AZJ A;  1G99 A;  1VQL N;  4L3Q A;  4H0P A;  4MDB A;  4MDA A;  5AQI A;  2OTL N;  1ILY A;  2E2O A;  3PIP L;  4H5T A;  3CQY A;  3HOS A;  3CF5 L;  4YOX A;  1QQM A;  3TTC A;  1K8A O;  5C2F A;  4EHU A;  1BA0 A;  4I6M B;  4GV6 A;  5LY3 A;  1VQ6 N;  2A41 A;  4H03 B;  3CMA N;  5ELZ A;  2P9I B;  4AM6 A;  2P9L B;  3VEO A;  4B1X B;  1MA9 B;  3RSE B;  1X3M A;  1VQ4 N;  3O8M A;  4BR2 A;  4CBU A;  3DAW A;  4BRA A;  3H45 C;  1Q7Y O;  5AQJ A;  1HKG A;  4IDH A;  3M1F A;  1NGE A;  3I56 N;  4DKW A;  4BRE A;  5AQG A;  1Z6R A;  2HBM A;  5EOY A;  3EZW A;  1U6Z A;  2P9U B;  3TSQ A;  1RFQ A;  3CJ9 A;  2YJE A;  3JS6 A;  4KH4 A;  3WQT A;  1YIT N;  3P39 A;  3VGL A;  1YHQ N;  1BDG A;  4IXC A;  4B1W B;  3SMS A;  1MDU B;  2HF4 A;  3O80 A;  1NGH A;  2QWO A;  1HKC A;  4JN4 A;  4CZK A;  5ADX A;  4GV9 A;  1YJW N;  3U4L A;  3UKU A;  4CJ7 A;  1VQP N;  5LJW A;  2QW9 A;  2UYT A;  1SZ2 A;  3IKM A;  3ZET B;  2P9P A;  3SJH A;  2CGJ A;  4YDU C;  4FPB A;  1J6Z A;  4JK8 A;  5AR0 A;  3H6E A;  2F9W A;  3MMV A;  3A5M C;  4CBW A;  2E88 A;  1HPM A;  4H0V B;  4IZ9 A;  5BPM A;  5AQX A;  1E4F T;  1GLB G;  2Q1N A;  2YX6 A;  4A59 A;  5AQH A;  3GG4 A;  3RVC A;  3DXM A;  3WXJ A;  2F9T A;  3CC4 N;  4H5W A;  3CHW A;  3CCL N;  1DGK N;  4H0X B;  1QHA A;  4JKD A;  1NGC A;  3CCJ N;  1M90 O;  4BRL A;  3VEN A;  2GWK A;  5GIN A;  1NGJ A;  2FSK A;  3QFU A;  4FVU A;  3C6A A;  2KKZ A;  3HM8 A;  4XH1 A;  3FE1 A;  2ASO A;  4O8K A;  3MN9 A;  2WFB A;  2FF3 B;  3MCP A;  4FWN A;  4WQ4 A;  1TUY A;  3KZB A;  3D7E O;  4ILJ A;  4CZL A;  2E2P A;  3E9O A;  3O1B A;  3OBY A;  3D6R A;  3MWT A;  4CZH A;  2HMP A;  3DWL A;  4JD2 B;  3G71 N;  1NGF A;  3FGU A;  1DT9 A;  2QWR A;  1BG3 A;  3H1Q A;  3KHY A;  1NMD A;  2KLA A;  3L6Q A;  4MO5 A;  5BRD A;  3H3N O;  4IFE A;  2A40 A;  4BRO A;  3OBW A;  4JK7 A;  5KPZ A;  1KAX A;  3GBT A;  5AQT A;  3C7N B;  3TSP A;  3K9J A;  5B8H A;  1Y64 A;  2HST A;  2GTD A;  1ESV A;  2YCH A;  1K8K B;  4BC3 A;  1BOT O;  4WFN L;  4FWQ A;  1X9J A;  3LDO A;  5AQP A;  4QS9 A;  4XH5 A;  4K43 A;  3G6E N;  4G9Z A;  3HTV A;  5AZJ B;  3UKR B;  2P9S A;  3TTF A;  2EWS A;  4BQZ A;  3WUH A;  1WUA A;  1DEJ A;  2WBN A;  2A5X A;  2QWM A;  2WC9 A;  3OA9 A;  4WCE L;  4R79 A;  3L4Q A;  5AFU A;  4A2B A;  3CCE N;  4IWV A;  1U2V B;  3QDK A;  3C0B A;  4BRI A;  5MLC Q;  1YI2 N;  5HL7 L;  4B1Y B;  3WEE A;  2F7T A;  3I8B A;  1VQ8 N;  4NLB A;  1BO5 O;  2GWJ A;  4IOA L;  1ATN A;  4A62 A;  3AAR A;  3VES A;  1T6C A;  5F2R A;  3FZM A;  3H3O B;  3GL1 A;  4OPA A;  4BRF A;  2DPN A;  4ISF A;  4CZJ A;  4H5N A;  3O9R A;  3TTD A;  3CJ7 A;  5M1N A;  2I7P A;  3P38 A;  4EIA A;  4U67 L;  4AM7 A;  1TYQ B;  3M6G A;  1Q82 O;  3F9M A;  1VAZ A;  3VEX A;  3P31 A;  1SAZ A;  1C0F A;  2JWL A;  3BEX A;  1JCF A;  3D2E A;  4JAX A;  3VGM A;  5KQ8 A;  3G4S N;  3O1W A;  5AQW A;  4BVO A;  4IEI A;  4CZF A;  4IOC L;  4BR7 A;  3L4I A;  1YAG A;  2D0P A;  3MN7 A;  2BTF A;  1TUU A;  4GV3 A;  3MN5 A;  3KK7 A;  5AQF A;  5DM6 L;  4BRH A;  4DB3 A;  4CZM A;  3AGK A;  4BGB A;  5JMV A;  3VET A;  5JLF A;  1YVN A;  1LCU A;  2A42 A;  5AQN A;  3SAG A;  5JVG L;  2HBL A;  3U9Z A;  1HKB A;  4CZI A;  2P9P B;  1BUP A;  1GLE G;  3CIP A;  3DXK B;  5BN8 A;  4JHD A;  3R9P A;  5FPD A;  2ZF5 O;  2PFU A;  5TKY A;  5AQK A;  1ZBS A;  1Q18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...