4BR9A

Legionella pneumophila ntpdase1 crystal form ii, closed, apo
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
b'MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 120
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4br9A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4br9A02
4BRFA 5AQPA 5EX5A 1R59O 4FPBA 3FZFA 4JHDA 3H3NO 1Y64A 3EZWA 2CGJA 4PL8A 3WUHA 1JCEA 4B9QA 1NGDA 1NM1A 2BUPA 4E1JA 4DQ8A 1IG8A 3ID8A 5AQUA 5EY4A 2Q0UA 5AQSA 3VPZA 3A5NC 1GLJO 3DXMB 4A62A 5ELZA 2CH6A 4BR2A 4EHTA 3D2EA 2V52B 5AFUA 3FZLA 2BTFA 2E88A 4CI6A 2IIRA 3UKRB 1YXQA 3GL1A 4ISGA 1GLAG 4YDUA 3M1FA 3QICA 3CJ1A 4A2BA 2P9PA 3B8AX 3ZEUB 3SLCA 2YI1A 4O8KA 3ENHA 2UYTA 2GTDA 3QB0A 4PKIA 3LDLA 3CJBA 2F9WA 3CQXA 3MCPA 4BC2A 2QWOA 3WT0A 3FGUA 2P9UA 3VEYA 2GELA 3RSEA 1YAGA 2P9LA 3MDQA 2E2OA 4H5NA 3H1VX 5FPNA 2ASOA 2YHXA 4JN4A 4BGAA 4JD2A 4CZKA 2Q31A 3HBTA 4FL9A 4RWTA 3U8XA 5ADXH 2E8AA 1Z05A 3J8AA 3WQUA 5TKYA 1U2VA 1BUPA 3O1WA 3HTVA 4CBWA 3H45C 2D4WA 3VF4A 3D2FA 4M63C 1GLDG 3M6GA 3MMVA 4FWSA 2PAVA 1K8KB 3LM9A 3ZETB 3LDOA 1BA1A 3KZBA 2P9IB 4WQ5A 1ZBSA 4AM6A 1LOTB 4BRCA 2D1KA 3MN6A 5JMVA 2QM1A 2CGKA 2GEMA 4BR5A 3VENA 4CZMA 4CZHA 5AZIA 3SK3A 3WXLA 4BQZA 1QQOA 1MDUB 2Q36A 3M3ZA 5FPEA 1DKGD 5FPDA 3HZ6A 3KHYA 4XH4A 2E2PA 4PKHA 1JCFA 1SQKA 2A6AA 4GY2B 1G99A 2E20A 5AQTA 3ZX2A 3G25A 2VYPA 4B1ZA 1T6DA 4AM7A 4CZFA 3VEVA 3CQYA 5JLHA 2DPNA 2FF6A 2GWKA 1NWKA 4CZGA 2NZTA 3C7NB 5AQIA 5KPTA 1Z6RA 3HSCA 1HPMA 3R6MA 2HF3A 1TUUA 3CI5A 1GLFO 3MN9A 4XEIA 2HMPA 3H6EA 2FSJA 5AQFA 4BRHA 4IJAA 4PL7A 1ZC6A 3CHWA 4I6MA 3QBXA 1HJOA 4HTLA 3TPQA 1MA9B 1TYQA 2PBDA 4BQLA 1NGBA 1NBWA 3FE1A 5BN8A 5EXWA 4QS9A 4JNEA 3O80A 2NLXA 4BRDA 4BG9A 4FWOA 1HX1A 1NGEA 4PKGA 1DGKN 4H0PA 2P9KB 4CBUA 5AR0A 1NGJA 4BRNA 3DXKA 1RDWX 3W3DA 3IFRA 1SAZA 1BG3A 1WOQA 4FO0A 4MO5A 3L4IA 3ULEB 5F2RA 5BPLA 4H5TA 4BR0A 3O4WA 4BRLA 3MN5A 1NMDA 2QWQA 3U9DA 2Q1NA 2P9SA 4FWPA 5CE3A 2FF3B 5EVZA 3UE5A 2Q0RA 5LJVA 3CIPA 1YUWA 3WQTA 4IZ9A 2EWSA 3VEXA 1OKJA 3FZMA 3VERA 4FWKA 5KPRA 3L0QA 3QMLA 1X3MA 1ATSA 3U4LA 4B1UB 4M7XA 4MLHA 5AQOA 4M7YA 4BC3A 1HUXA 3GG4A 3LDNA 3WEEB 5AQLA 1E4GT 2FXUA 4CD1A 1EQYA 2QWLA 2F9TA 1C0GA 3DXMA 3A8YA 1QZ6A 3AARA 2ZGYA 2VWBA 5ADXA 2A41A 4H5RA 1T44A 4FPAA 2P9UB 4H5WA 1V4TA 3ZX0A 3VGLA 4BRPA 4QS7A 3UKRA 4BROA 2I7PA 2YJEA 2V51B 2YJFA 4BVOA 2J4RA 3ZEUA 1NGIA 1BU6O 3FZKA 5BR9A 1YVNA 5AQVA 4BG8A 4A2AA 1T6CA 3JXUA 3BEXA 3U9ZA 4RTFD 1GLEG 3QFPA 3VF6A 4H0YB 5AQWA 3OHRA 3BF1A 1V4SA 2Q2RA 3LL3A 1RFQA 2NRHA 4CZEA 5AQJA 5LY3A 3H1QA 3SMSA 4EAHD 1NGAA 4JAXA 3A0IX 1P8ZA 2A5XA 4CZLA 4IWVA 4B1YB 3BF3A 2KHOA 3UKUB 1HKBA 3LDQA 3DWLA 4XH1A 4WQ4C 4K42A 1ZXOA 5F1XA 4F9OA 1X9JA 1E4FT 4FWQA 4BRKA 3QFUA 2FLOA 1NGFA 2YHYA 5AQYA 1K8KA 1X3NA 3ZETA 1GLBG 3GOIA 4H0XB 2P9IA 3UB5A 4BRQA 3F9MA 1MWKA 4CBXA 5BRDA 2QWRA 2ZGZA 4FOIA 4BR4A 1IJJA 5AQKA 4CD3A 2E2NA 3LDPA 3ATVA 4BC5A 3FZHA 3IDHA 4B1VA 2H3GX 2IVPA 2QWPA 3O5BA 2AP1A 3AY9A 4RCHA 5AQXA 5AQMA 3VEZA 2ITMA 2P9NB 5AQZA 2ASMA 2WUSA 2CH5A 2W40A 1HKGA 3MN7A 2D0PA 2GWJA 4DB3A 1BDGA 5AQRA 3H46O 4H0TB 1BO5O 3O6WA 4HWIA 4CJ7A 4H5VA 1QQMA 4J8FA 3W0LA 2FSNA 1S3XA 2I7NA 3WXJA 4WYBA 2QWMA 4XH5A 1HKCA 3FLCO 1GLLO 4BRGA 3C0BA 2ZWHA 5AZJB 4BGBA 1NGHA 4C23A 3CERA 3FR0A 5E26A 1GLCG 5B8HA 4JHDB 5KQ8A 4B1WB 4QS8A 5JLFA 4FWLA 3VOVA 2V7YA 4B1XB 4BR7A 4BRMA 4FSVA 2AA4A 3IUCA 5AQNA 2QWNA 1RGIA 1ATRA 1MWMA 3D2EB 4Z94A 5JICA 5BPMA 5I9EB 4FWMA 2HF4A 3ULEA 4LC9B 4H03B 5BRFA 4WQ4A 1D4XA 2P9PB 1DEJA 3CJCA 2VCPA 3EKUA 3TU5A 4IXCA 4FWRA 5FPMA 1BWFO 3H3OB 3CJAA 1NGGA 5KQDA 1U6ZA 4BRIA 3DJCA 3RSEB 4ISFA 3MK6A 2P9LB 3QBWA 2IVOA 3WEEA 1KAZA 3ENOA 2W41A 4H0VB 2ASPA 3HI0A 4JD2B 4O5FA 5EOYA 2OANA 2QW9A 1JCGA 4NB4A 3EN9A 4FOEA 3R9PA 5AFUH 1U2VB 1WUAA 4EFHA 1NLVA 3SJHA 4ISEA 5LJWA 4NO7A 3D2FB 3CJ7A 2IVNA 5AQGA 4FWNA 4EHUA 3A5OC 3I33A 2YHWA 3QDKA 4DHYA 3VEWA 4K41A 3O1BA 2GUPA 3BUZB 4L3QA 3VETA 2A40A 3CJ9A 5BN9A 3VGKA 3CETA 1BA0A 3JS6A 5AZIB 1XC3A 4IJNA 3O8MA 2D0OA 1XUPO 1LCUA 3VESA 4BVPA 3D7EO 3ZX3A 3VF2A 3DAWA 5AZJA 2V7ZA 3A5MC 1SZ2A 4DCHA 1KAYA 3I8BA 1S22A 2E2QA 3A5LC 4BC4A 3SMPA 4YDUC 3UKUA 4BR9A 2ZF5O 3VGMA 4KBOA 4K43A 2E1YA 1KXPA 5KPZA 3EL2A 4MLEA 5BREA 3VEOA 1QZ5A 1TUYA 3BP8A 3FFKB 1J6ZA 4I6MB 1QQNA 2Q97A 1Q18A 3EO3A 1TYQB 2FSKA 2A42A 4CZIA 3C7NA 4EIAA 2HOEA 5BRHA 4H0OA 1QHAA 3GBTA 1BOTO 3GE1A 3R8EA 1ATNA 3WXKA 4MO4A 4K25A 4GNIA 2E1ZA 5BPNA 3LM2A 3WXIA 3EKSA 2P9NA 4IO8A 3AAQA 3IMXA 3DXKB 3O08A 4BREA 3ATUA 1ESVA 1C0FA 3S41A 3KVGA 4WQ5C 4A61A 1KAXA 2A3ZA 2QXLA 5E84A 4BRAA 3HM8A 2CGLA 3AAPA 4Y0WA 1NGCA 3P4IA 5F0XA 3GDQA 1H1VA 2P9KA 1CZAN 3L6QA 5AQHA 2P9SB 5AQQA 2YCHA 4CZJA 1XQSC 1HLUA
chains in the Genus database with same CATH superfamily
5AQPA 3TSUA 3F2KA 1TAQA 2PYJA 3H3NO 1U45A 1NM1A 1FXXA 4JK9A 4LF7K 4DR6K 4DV0K 5I42A 4AHSA 5AQUA 5EY4A 1RCHA 5A2QO 4FW2A 3CPWM 2O4GA 4MDBA 2NRRA 2E4LA 1GLAG 3M1FA 3CJ1A 1HNXK 4DSEA 1U04A 2UYTA 2B6AA 3CQ8A 5GAGP 3Q7CA 3OYDA 3FGUA 2P9UA 5C12A 4WFBL 3VA0A 2GELA 3H08A 1YAGA 1N5YA 3MDQA 3PIOL 4O44A 4CJWA 4CZKA 1VSDA 1Z26A 1IKWA 3AVHA 4RWTA 3HSTB 2E8AA 4C1NK 1Z05A 3J8AA 3E1YA 4DWIA 1U2VA 2I5JA 3CCQN 3SJJA 1C1CA 2D4WA 4Q5VA 3D2FA 5HRPA 4HCCA 3LANA 4BY9C 3MMVA 2PAVA 3ZETB 4YNQA 3OYFA 4ICLA 2O8DA 3VQAA 3IAYA 4G1QA 2D1KA 2WC9A 3MN6A 4BR5A 2CGKA 4CGIA 4IFEA 3SK3A 3DLHA 3M3ZA 5FPEA 1DKGD 2OZMA 3CCJN 2VQEK 1R0AA 3LZIA 2E2PA 3VQPA 1JCFA 4GY2B 2W6KA 3AGRA 4ELUA 1TL1A 3LP1A 2QTDA 3NBPA 3DM2A 1ZBLA 3R1XA 4XIUA 3SV3A 4GW6A 2NZTA 3C7NB 1Q81O 5AQIA 1Z6RA 3HSCA 1HPMA 3R6MA 1TUUA 1RBSA 3MN9A 1C1AA 3MXJA 4XEIA 1NJZA 2HMPA 3H6EA 4LY7A 1NJIO 2FSJA 1NKCA 4IJAA 4PL7A 4DR4K 1HQEA 3AA3A 3CHWA 3DLGA 5CR4A 4JV5K 3QEIA 3V4IA 1HJOA 2RF2A 4JKFA 2PBDA 1IBLK 1NGBA 2KLAA 3MWTA 3QLHA 2G8UA 3BDPA 4QS9A 3P1GA 4JNEA 3O80A 3LAKA 4MDAA 1X9SA 3ZCMA 3ZSXA 5IWAK 3HPGA 4CBUA 4F3TA 2HHHK 3PX6A 3DXKA 3AO1A 2VWJA 3CCMN 2FBXA 3IFRA 1HR0K 4GV9A 3AVGA 3NH1A 1X9WA 1WOQA 2NRVA 1HNVA 3L4IA 5F2RA 3ULEB 3M8PA 3QNOA 4BR0A 4PQUA 2VGNA 4HUGA 5CE3A 2FF3B 4DG1A 2Y1IA 3KK2A 2Q0RA 2FC0A 4KHSA 1SV5A 4IOAL 3VEXA 4GV3A 3FZMA 5KPRA 4BDPA 3L0QA 3QMLA 1JLBA 5I3UA 1WSFA 1X3MA 5AQOA 4BC3A 5J2QA 1CLQA 3WEEB 4YHHK 2G8VA 2FXUA 3SUOA 4CD1A 1UOCA 1NK8A 2E5LK 2F9TA 3K5LA 3LALA 4Z4FA 3AARA 1WBBA 4DR3K 3V1QA 4DS4A 3K5OA 1RT3A 3TWHA 3VGLA 4BRPA 3PSIA 4JEPA 3UKRA 1VK0A 1TK8A 4DFKA 3P83D 4BROA 3THWB 2YJEA 2YJFA 3SAGA 3NGZA 2Q3SA 2WONA 1BU6O 3FZKA 2YKMA 3VN5A 1FKPA 1YVNA 5AQVA 1T6CA 1TAUA 1BQNA 4RTFD 1GLEG 3TSQA 3QFPA 3LAMA 4H0YB 4DR7K 4JI2K 3BF1A 3O3GA 3SCXA 5HOOA 3M8RA 1XHXA 4E89A 1ZBIA 4M3XA 4B08A 5J2PA 3KD5E 4JAXA 1DTQA 1KCFA 4OLBA 4B1YB 3BF3A 2VGMA 4WQ4C 2YV0X 2FBVA 4PHTX 4HVJA 1RBVA 4W5TA 4BRKA 3EEQA 4Z4GA 3QFUA 1SKRA 4IG3A 2G8FA 1S1WA 2P51A 3DOLA 3GOIA 2HHWA 2O8EA 5BRDA 3PSFA 1WSHA 5J1EA 3K2PA 4Z4CA 4FOIA 4BR4A 4E7HA 5LMUK 4KB0A 1IJJA 3ZT4A 3T1YK 1BI4B 3ATVA 4CFDA 4JKDA 4CHQA 3CCRN 4C8LA 1L3UA 2IVPA 1VRTA 4J2AA 4FCYA 1SL0A 1HJRA 3AY9A 2Y1JA 5AQMA 2YHBA 1K8AO 3O4NA 2VG5A 1J9AA 3JSMA 2O8BB 1HKGA 4A5BA 2D0PA 4CFBA 1KVBA 3MXMA 3O3HA 1SL2A 5D3GA 4DB3A 3V9SA 5AQRA 3OS0A 1YI2N 2FSNA 2UU9K 5C10A 1GLLO 4JK8A 1WSJA 3KKRA 3SYZA 1HPZA 2UXDK 4BGBA 4YOVA 1NGHA 4FZZA 2X74A 3CERA 3FR0A 3AO2A 3HP6A 5KQ8A 3PUFA 4E0DA 3D6RA 3WXMB 4QS8A 3HT3A 3VOVA 4IG0A 3PY8A 1YTUA 1QSYA 5HP1A 4BR7A 4OJRA 4BRMA 5GAHP 1NNEA 4FXDA 2ZD1A 3IUCA 1B9DA 4RG8A 1NKEA 2YKNA 4KH5A 1VQON 4M3ZA 5I9EB 4FWMA 4B9MA 3ZLJA 4JS5A 2HMIA 4LC9B 1VHXA 4CIEA 3SPYA 5SZTA 3OTOK 3LWMA 4CHNA 3MXIA 2VCPA 4F2SA 1S6PA 5FPMA 4W5OA 1XNRK 1U6ZA 4E7LA 4BRIA 5MLCQ 2KTQA 1N34K 4YY3K 4N56A 5GINA 2OYQA 3HVTA 4H0VB 3HI0A 4O5FA 4OKJA 3KJVA 4FLTA 1JCGA 3EN9A 1IKVA 4FOEA 3R9PA 3M5RA 1VQ8N 1U2VB 2EHGA 4B3OA 2OPRA 5HRSA 4WFAL 2HVIA 1XMOK 3D2FB 2ZJQL 4EHUA 1KFSA 3MEEA 3QDKA 2O8DB 3B6OA 4K41A 3O1BA 4CJRA 1I39A 3VGKA 4U67L 1HNWK 4IJNA 2D0OA 3THYA 4DSKA 3U3GA 4FK0A 2V7ZA 3OJSA 3DLEA 1TKXA 1KAYA 3L2QA 5H1SQ 4DQPA 4BC4A 3RMDA 4YDUC 3UKUA 4CGDA 4AHRA 2UUBK 4JI3K 2WOMA 4ID5A 3EL2A 3ZSRA 4MLEA 3MX2A 4NYFA 3NGIA 2OA8A 4JI8K 4PWDA 3ZSVA 1E3MA 3BZKA 4N5SA 3OYBA 3EO3A 2HHSA 4CZIA 3C7NA 1C0TA 5DMRA 4FM1A 3VQ9A 4HHTA 1UA1A 2HOEA 4LF4K 4JS4A 1ITGA 1ATNA 1N36K 2WTUA 3WXKA 3CFRA 3SUQA 2DTUA 1HRHA 4K25A 4FM0A 4GNIA 3TTFA 5BPNA 3KTQA 4F2RA 4O4GA 4DSIA 5FLXO 2YX6A 3EKSA 4G9ZA 1LAWA 2P9NA 3DXKB 3VQCA 4DV5K 2D0AA 3ISNC 1ESVA 4FK4A 3DOKA 4A61A 3PO5A 1BIUA 2HSTA 3CM5A 4BRAA 1IV0A 3HM8A 2CGLA 3AAPA 4Y0WA 1NGCA 1IH7A 2FBYA 5F0XA 1CZAN 3KWGA 4BWJA 3HYFA 1XQSC 1EXQA 4BRFA 3ZSOA 3FZFA 4JHDA 2LSNA 3EZWA 3WUHA 4B9QA 3J81O 4E1JA 1WB9A 2Q0UA 3VPZA 4M3RA 2W6LA 5ELZA 2CH6A 4FJMA 4DV4K 1RDUA 3CMAN 1UA0A 1O13A 2IIRA 4EP5A 3UKRB 3I8DA 3KK7A 2BE2A 3DI6A 2ZJPL 2P9PA 3B8AX 4O0JA 3M8SA 1TVRA 2GTDA 4BE2A 3LDLA 3CQXA 2P5OA 4BC2A 2QWOA 3SQ2A 4OGEA 3E9OA 3KK1A 1YHQN 1BL3A 5CZ1A 1Q8IA 4M3YA 4QOZB 3LP0A 1XI1A 2ASOA 1VQNN 2X6NA 3SPZA 4JD2A 2RKIA 1K9MO 3HBTA 4FL9A 3K5MA 1X1PA 4CIGA 1C0MA 3VQEA 4I2PA 1HYZA 3AVIA 3AVJA 3HTVA 1IBMK 1GLDG 4DU3A 1WBDA 1RT2A 4C8NA 1L3SA 2WBNA 3LDOA 3KZBA 4J2DA 3TTCA 1LOTB 4JI6K 2QM1A 4CZMA 2GEMA 5JS1A 3CM6A 3LPTA 3L2UA 4JI5K 3WXLA 1D5AA 1VSMA 4DKWA 2Q36A 4KH4A 3HZ6A 2JWKA 2OCEA 1JLEA 3KHYA 4XH4A 3F73A 3NF8A 2A6AA 2E20A 3N4PA 3G25A 4Z4EA 3QEWA 5HROA 3K9JA 4DFMA 5JLHA 4CF8A 2F7TA 2FF6A 4M3UA 4PA1A 3P31A 3HJFA 5DM7L 3MEDA 3CI5A 2YNIA 3NCIA 2PFUA 4BRHA 1U47A 1ZC6A 3NF6A 4J2BA 1D9FA 2HNZA 1VQ9N 1UWBA 1OVYA 4HTLA 2O8BA 1MA9B 4BQLA 4IO9L 3C95A 5BN8A 3FE1A 5EXWA 4DTPA 3O9SA 4BG9A 4R79A 1NGEA 4PKGA 3U6FA 2YNGA 4KB1A 4H0PA 4CK2A 4NYNA 5AR0A 4JKBA 2HBMA 1RDAA 3LWLA 3F9KA 1RDWX 1ZBFA 1JJ2M 2D0CA 1SAZA 1BG3A 3DRPA 3K57A 2IS3A 3NF7A 4B9LA 1RDBA 4H5TA 4FLUA 4M3TA 3O4WA 3MN5A 4FK2A 4LF8K 5EVZA 4CJ3A 4CJVA 4CHOA 1U4BA 4IZ9A 4CF2A 4EZ6A 4GV6A 4M7YA 1VSLA 3QINA 4CJQA 1EQYA 3K9KA 1JLGA 4OGCA 1QZ6A 3QEVA 1JXBA 1OVQA 2ZGYA 5C2FA 4M3WA 4H5RA 1C0UA 3QIOA 1V4TA 3L3UA 4QS7A 3S9HA 1ZYQA 2I7PA 4BVOA 3ZEUA 1NK4A 4CJ4A 4DQQA 1RT7A 3I55N 3JXUA 3BEXA 1RBTA 4FZXC 3THYB 3OHRA 3HXMA 3LL3A 1RFQA 4CZEA 1VAZA 1S1VA 2HBLA 3AVBA 4B9NA 4GKKK 1BQMA 3VTHA 4AHVA 4KTWA 3HOTA 4DTSA 1J5EK 4X65K 4FJXA 1SKSA 1NGAA 4JI7K 2A5XA 4CZLA 4IWVA 3AGKA 2KHOA 3UKUB 4CHZA 1RTIA 3TAGA 2KZMA 4KFBA 2F8SA 2XY8A 3OYIA 4N41A 3QEPA 4H4MA 4FWQA 1BIZA 3CD6N 3E01A 4I2QA 5AQYA 4CGJA 1K8KA 3SAFA 4E7IA 4WE1A 3RR7A 1GLBG 1NOYA 1HQUA 4BDZA 1NOZA 2XRIA 5HBMA 1MWKA 3KLGA 4FJLA 2QWRA 4OKEA 4RW6A 4ZTFA 3P5JA 4WFNL 3LP2A 5AQKA 4CD3A 3EYZA 4ELVA 4H8KA 4AILC 4BC5A 1NKBA 2DY4A 4B1VA 4MQ3A 3VQBA 2E6LA 3S3MA 2FBTA 4JK7A 4QCLA 4K8XA 4RCHA 3TANA 2ITMA 2P9NB 3A2FA 1FW6A 1KFDA 2CH5A 2W40A 5HRNA 2QKBA 4W5RA 4B9TA 1VSKA 4OO1J 4HWIA 3EE9A 3NGYA 4CJ7A 1QQMA 1VSFA 1S3XA 1N6QA 1KTQA 2NRXA 4NCGA 5KGWA 4BRGA 4AF1A 3C0BA 4OX9K 2ZWHA 1EETA 1Q9XA 1GLCG 1LW2A 3AA4A 4LD0A 4JHDB 1JLAA 3CCEN 2P1JA 4UY8O 4KAZA 4B1XB 2F96A 3NVMA 3OBYA 5SWMA 4B8AB 1EWRA 2AA4A 1VSHA 1QS4A 1ATRA 1MWMA 3AVFA 1WSEA 1EO1A 5JICA 4YOWA 2HF4A 3SBGA 4RW8A 3BGRA 2P9PB 4CERA 3ENBA 4Z4IA 1BCMA 1VSIA 2BH1A 3CJCA 3TAQA 3K0SA 3EKUA 2ITGA 2RE2A 4IXCA 5M1OA 1VQ7N 4YFUA 4F3OA 4DV2K 1Z25A 5KQDA 3FFIA 4CE9A 2HBKA 4ISFA 4E3SA 3CYMA 4C8OA 1KD1O 4K0KK 4DUZK 1KAZA 3ENOA 1SL1A 2ASPA 2DFEA 4JD2B 5EOYA 3OYCA 4H4OA 1NK9A 1WAFA 2WFBA 3AVCA 3F5TA 1ASWA 1VQPN 1VQ4N 1NLVA 4ISEA 2IVNA 5AQGA 4FWNA 3E9PA 4IDKA 2YHWA 3PX0A 4DHYA 3VEWA 2QKKA 2VWKA 3OYMA 2A40A 3CJ9A 4FLVA 4DTJA 2VG6A 3E9LA 3JS6A 4IFVA 1RTJA 3V1OA 3T7ZA 1LCUA 3VESA 5CZ2A 5CY4A 3ZX3A 3VF2A 1YIJN 2HB5A 3I8BA 4HUEA 2BDPA 3O3FA 3SUPA 3QERA 3VGMA 2AJQA 1EKEA 4K43A 3WNEA 1OH5A 1Y97A 3LPUA 4DQIA 3I0SA 5KPZA 3OYEA 1ZBHA 3V9ZA 5E41A 1P90A 4FM2A 4Q0BA 3OYLA 4KPYA 3C6TA 3CF5L 1B92A 1TUYA 3BP8A 4C8KA 1JLFA 3HO1A 1Q18A 1RNHA 1TKZA 5TKWA 4LF9K 2FSKA 4A59A 3CC4N 4KHWA 4C1NI 4EIAA 5BRHA 1QHAA 3R8EA 1K6YA 3IKMA 2YNHA 2ZE2A 2E1ZA 4IKFA 5KRTA 4IO8A 1L3TA 1RBUA 4ILHA 3ZT0A 3ATUA 1T7PA 3L4QA 5JVGL 3WNFA 3NH2A 4ELTA 1NK5A 4B3RK 4W5QA 4B9SA 1H1VA 3ULDA 1CXQA 3OJUA 3UIQA 4FW1A 3KLEA 4YOTA 3SAHA 1S1UA 3HL8A 3CPEA 2HNYA 4FPBA 1RILA 3AO3A 1Y64A 5M1PA 1NGDA 1D9DA 4Z4HA 1KVAA 3OYJA 3KLFA 4DQ8A 3ID8A 1ZBUA 3K59A 3CC7N 5AQSA 4FJJA 4FJGA 4CJKA 1GLJO 1L3VA 1XWLA 2KQ2A 4RW7A 4BR2A 2V52B 3FZLA 2BTFA 2QI2A 1YXQA 4W5NA 4JI1K 4FVMA 3ZEUB 3SLCA 3SQ4A 5LL6Z 3C6AA 3QB0A 4PKIA 1JXEA 2F9WA 3HVRA 2ZQBA 3C65A 4OPAA 4NXNK 3WT0A 2QEXN 4OPJA 3V81A 2PY5A 2JGUA 1TK5A 3EE8A 3KWIA 2E2OA 5FRNA 3HPHA 3VQ5A 3VTIA 4OPHA 1NU0A 2YHXA 5FPNA 1JLQA 4JN4A 4BGAA 1T8EA 1IKYA 4E1MA 3C94A 5KRSA 2F8TA 3DMJA 1BISA 3PIPL 5ADXH 4RW9A 1TKDA 4FJIA 1BUPA 3O1WA 4CBWA 3H45C 4IEIA 4KTZA 4FJNA 3V1RA 3V9XA 4FWSA 1K8KB 5GAEP 4KHYA 1K73O 1BA1A 1KLMA 4WQ5A 4AM6A 3NF9A 1D8YA 2JWLA 3M8QA 4BRCA 5JMVA 3VENA 3OYKA 5AZIA 2GUIA 4BQZA 4CK3A 3L8BA 1MDUB 3MX5A 5GIOA 2W42A 1QSLA 3THXA 1BHLA 5FPDA 1LWFA 1SQKA 1G99A 3ZX2A 4DFJA 3G4SN 1OH8A 3N4QA 1IG9A 4B1ZA 3ZT1A 1YT3A 4CZFA 4O0IA 5AJ3K 3CQYA 4Z0UA 2GWKA 4DFPA 3MEGA 1NWKA 4NCBA 3CG7A 4YOYA 1KQSM 3NAEA 3O9RA 1I94K 2QXFA 3B6PA 2P5GA 3O9TA 5AQFA 4LFAK 4I6MA 4DTRA 4KI6A 3TPQA 1TYQA 3NE6A 5HRRA 4CJFA 1NBWA 3QIPA 4DQRA 1S9GA 5M1QA 1RT4A 4ILJA 3RTVA 2NLXA 4BRDA 4FWOA 4PY5A 1DGKN 4FLYA 2XY5A 1QSSA 1NGJA 3DLKA 5C25A 4N47A 1O1WA 5JS2A 3TABA 3IRXA 1L5UA 2HHQA 4DTXA 4BRLA 4BWMA 4CEAA 3CFPA 1M1KO 3HM9A 2QWQA 2IGIA 2Q1NA 4X66K 4FWPA 3TAEA 3TTDA 5LJVA 3CIPA 4FVUA 1WSIA 5M1FA 1OKJA 3VERA 2ZJRL 3SI6A 4R5PA 3AA2A 4B1UB 4M7XA 4MLHA 3VQ6A 4FJKA 4DSFA 3SBTA 1DT9A 5AQLA 1E4GT 3ZT3A 4CJEA 1S9EA 1S5JA 2QWLA 5CYQA 3V6DA 3DXMA 4CEQA 1FKOA 3A8YA 1U48A 1KLNA 1KRPA 4IBNA 4KREA 5CHIA 2VWBA 5ADXA 2A41A 3TAMA 1T44A 3RMBA 4H5WA 1KSPA 1IBKK 4LH4A 4U7BA 1I3AA 5C24A 2V51B 4E7KA 1NGIA 3VQ4A 1F21A 1W7AA 1RT5A 4FJ9A 3NH0A 5GADP 2B5JA 3U9ZA 3S3OA 3VF6A 5AQWA 1YTAA 3NMUA 2NRHA 2VQFK 5C2DA 5LY3A 2G8IA 3SMSA 4LH5A 5CYMA 4EAHD 3A0IX 2BGGA 3RRHA 4M41A 3JAMO 2KFNA 1HKBA 3LDQA 3VQQA 4XH1A 5FROA 2X6SA 4K42A 4TSXA 2YHAA 4F9OA 1X9JA 1E4FT 4BE1A 2FLOA 1CXUA 1XC9A 1QVGM 1X3NA 4B3SK 3ASMA 3LP3A 1RT1A 2P9IA 1UAXA 2Z1GA 3DRSA 1VQMN 1NJWA 1NK7A 2ZGZA 1OH7A 2Z1JA 3HRGA 1C6VA 3QEXA 2E2NA 3LDPA 4CEOA 3IDHA 1VQ5N 5FDLA 1A5XA 1YVUA 2H3GX 2O8FA 3OW2M 2UUCK 4DV1K 4DTNA 1RTHA 3O5BA 3ID6A 2AP1A 1U49A 1KVCA 1VQLN 2WUSA 2D0BA 3CFOA 3MN7A 4LFBK 3OYGA 4GVMA 2GWJA 4JLHA 3OYHA 1BDGA 2RHKA 3H46O 1YJ9N 4DF8A 3DLRA 4H5VA 3W0LA 3V9WA 3AA5X 3T1HK 3SQ0A 4WYBA 4J2EA 3OVNA 1WLJA 3U3YA 4XH5A 1HKCA 1HNZK 4KO0A 3NFAA 4L8RB 4JRQA 3QETA 4C23A 5B8HA 1CZ9A 4DTOA 3DLLL 4FWLA 3HK2A 3P38A 4MFBA 3JYTA 2RN2A 1WAJA 1KC8O 5AQNA 4DLEA 2QWNA 1S6QA 4Z94A 5BPMA 2RPIA 1TK0A 4DR1K 3G71N 2KFZA 5BRFA 4WQ4A 3AO5A 4NCAA 3TU5A 4FWRA 4DQSA 1BWFO 3H3OB 1NGGA 4AQYK 5C0YA 3OA9A 2B4JA 4OKKA 2IVOA 2W41A 4JRPA 4JKAA 4CEDA 2QW9A 4NB4A 1NMNA 4CIFA 1S1XA 3BZCA 5AFUH 1WUAA 1LAVA 4EFHA 3PV8A 4DV3K 2IDOA 4IOCL 4Y1DA 4JYAK 5LJWA 4NO7A 4A57A 5DK5A 3BY5A 3OYNA 3TARA 4LFCK 1NJYA 3A5OC 4DF4A 4O55A 3BUZB 1RDDA 4L3QA 3VETA 3HPOA 3SV4A 5AZIB 4CJTA 3O8MA 4CGHA 5M1NA 4OPKA 2KKZA 3CXCM 1J54A 3D7EO 4CHYA 4BACA 3THXB 4ZHRA 3A5MC 1SZ2A 3VQ7A 4DCHA 4CK1A 1S22A 2ETJA 3AVLA 1EX4A 2ZF5O 2NRTA 4GMJB 3ZSQA 1QTMA 2E1YA 2G8HA 1KXPA 4KHUA 1NG9A 1C1BA 4CEZA 1JL1A 4F4KA 3G0ZA 5BREA 3VEOA 4E19A 1W2BM 3SZ2A 1QZ5A 1FJGK 2XY6A 3FFKB 1RDCA 1J6ZA 2DFFA 1W9HA 1QQNA 4I6MB 2Q97A 3R3LA 4CJSA 3ZSZA 3TAPA 1TYQB 4DSJA 1M90O 1YITN 3GBTA 4HUFA 3GE1A 4JI0K 3J7YP 4B8CA 3DRRA 2GX9A 3MECA 3LM2A 3WXIA 3LDSA 4CEEA 5KTQA 3HOSA 3AVAA 3OY9A 1W0HA 3KVGA 1RTDA 4B3MK 1SKWA 4FJ7A 4DU1A 1KAXA 2QXLA 4E1NA 4EZ9A 5DM6L 4FLWA 3P4IA 3GDQA 3L6QA 2ZM6K 3THVA 5AQHA 3NHGA 3RWUA 5AQQA 4DTUA 2YCHA 4CZJA 4CFAA 4WCEL 1RBRA 4IFYA 5AZJA 5EX5A 1R59O 2CGJA 3ALYA 4PL8A 1JCEA 2BUPA 4CJLA 1SUQA 1TGOA 1IG8A 4ILGB 1VQ6N 4X64K 1BGXT 3A5NC 3DXMB 4A62A 4I7FA 3C6UA 4KHNA 4CECA 3O9UA 4GVEA 3J7AP 4EHTA 3D2EA 1N32K 5AFUA 4B9UA 1MU2A 2E88A 4CI6A 4FJ5A 3GL1A 4ISGA 4RW4A 4YDUA 3QICA 4PUOA 4A2BA 1EP4A 1QHTA 2YI1A 4O8KA 1HYVA 4V19S 3ENHA 4I9QA 3CJBA 2X78A 3MCPA 4ID1A 5FRMA 3KLIA 3HP9A 1IO2A 3VEYA 3ZSYA 5J2MA 3RSEA 2PYLA 4HTUA 2P9LA 1XMQK 3DLBA 4AH9A 1XNQK 2EX3A 4H5NA 4CF1A 3H1VX 5IT9O 4NLCA 3WNGA 2Q31A 1Q9YA 4FJHA 4OVLA 3U8XA 3WQUA 3CMEN 5TKYA 2PZSA 4BE0A 1TKTA 4JKEA 4DS5A 1FK9A 3VF4A 4M63C 3M6GA 2HBJA 3LM9A 4CF9A 5C15A 1XHZA 2P9IB 1ZBSA 4CZHA 3E66A 2F4VK 4CFCA 1QQOA 1T03A 3IS9A 2Z1HA 4CW7B 3AVMA 4DSLA 4HCBA 4PKHA 4DV6K 3ITHA 5AQTA 4FZYA 2O8FB 3TI0A 4LF6K 2VYPA 1T6DA 4AM7A 2IC3A 4QAGA 4CESA 3SNNA 3VEVA 2DPNA 4CZGA 3RMCA 5KPTA 2HF3A 3G6EN 1GLFO 1VSJA 2O8CA 2UXCK 3KK3A 3QBXA 4IOXA 2UXBK 5EU7A 2ATQA 2G8WA 3ZYYX 4JKGA 4OLAA 1X9MA 1J53A 3O9QA 5BR8K 4KKOA 1HX1A 4CJUA 1QQCA 2P9KB 3I56N 3KKSA 3VMFB 3VA3A 4BRNA 3K58A 2HHUA 3W3DA 2E6MA 3IG1A 3J80O 3RVCA 1LW0A 4FO0A 4MO5A 5BPLA 4AHUA 4CGFA 4UQGA 2DFHA 3PLAA 3CCUN 1NMDA 4FLZA 3U9DA 2P9SA 4AHCA 4JKHA 3UE5A 3G10A 1YUWA 3WQTA 4CJ5A 2EWSA 2XO7A 4A5AA 4FWKA 2YNFA 4LSNA 3QNNA 1ATSA 3U4LA 2HHVA 4CCHA 1HUXA 4GKJK 3GG4A 3LDNA 4K8ZA 2HHXA 4FLXA 2O4IA 2G8KA 1C0GA 4YOXA 4BDYA 2HHTA 5C42A 2OTLN 4Y1CA 4DLGA 4I9LA 4CEBA 4FPAA 2P9UB 1LV5A 3ZX0A 3T69A 4KV8A 1YJNN 4CEFA 3ZT2A 2NUBA 2J4RA 4WF9L 5BR9A 3CCVN 1EWQA 4BG8A 1NJXA 4FJ8A 4A2AA 1T05A 2OZSA 2JLEA 4KI4A 2HW3A 2OPQA 5GIPA 1V4SA 2Q2RA 4ZTJA 2QK9A 5AQJA 3H1QA 3KLHA 3AV9A 3NVKA 4B3TK 1P8ZA 5KI6A 4CVNE 4KHQA 3DWLA 1YJWN 3L3VA 1ASUA 3EY1A 1QE1A 1ZXOA 5F1XA 3L2RA 1J5OA 1SS6A 1VQKN 3MAQA 1NK6A 1NGFA 2YHYA 2KZZA 4YOUA 5HL7L 4DR2K 3ZETA 4KRFA 4H0XB 2BANA 4IDHA 3UB5A 3DYAA 4BRQA 3F9MA 2HVHA 4CF0A 4CBXA 3RMAA 4JI4K 3SQ1A 2R7YA 3RR8A 1WNSA 1TV6A 2D5RA 4YORA 4M45A 1YF5L 3FZHA 4IEEA 5M1KA 4KTQA 2GV9A 3J7ZO 2QWPA 3I0RA 5KGXA 5AQXA 3KD1E 3VEZA 1N33K 1WN7A 5AQZA 2ASMA 3OBWA 3PX4A 3T1AA 5T7BA 2HNDA 4KH6A 3D0PA 2KW4A 1A5VA 1B9FA 4H0TB 1BO5O 3MCAB 3O6WA 1REVA 4C8MA 4CGGA 4J8FA 2I7NA 3WXJA 3OYAA 1Q82O 2QWMA 3P39A 3FLCO 5AZJB 4F8RA 4DMNA 2GBZA 4EP4A 3CCLN 5E26A 1DLOA 2OTJN 4B1WB 3OS2A 3Q7BA 5JLFA 3AVNA 3S3NA 3AO4A 1GOBA 1VSEA 2V7YA 2IAJA 3TSPA 4FSVA 1DTTA 1RGIA 3KIOA 5K14A 3D2EB 3QO9A 3PO4A 3ULEA 4B9VA 4H03B 3TR8A 1D4XA 1LWCA 3ZSWA 1DEJA 2NNWA 2A1RA 2OPPA 5JVHL 3O4QA 2NRWA 1GOCA 3CC2N 3CJAA 2XHBA 4DUYK 3TAFA 3DJCA 3WNHA 3RSEB 3MK6A 1RT6A 2P9LB 3QBWA 1HYSA 3WEEA 2OANA 4FYDA 3EZ5A 3RRGA 5J2NA 3D45A 4CJPA 2QA4N 3L2WA 1QVFM 3C6HA 3VQDA 3SUNA 1T3VA 4E7JA 3SJHA 4NXMK 3CJ7A 3THWA 2A1SA 2OPSA 3AVKA 4M42A 4JKCA 3I33A 3T19A 1Q7YO 1G15A 1S1TA 2GUPA 1ILYA 3MWPA 5BN9A 4X62K 3CETA 1HMVA 1BA0A 1XC3A 1XUPO 5LMNK 2Z1IA 3NDKA 4BVPA 3T3FA 4N76A 3QESA 4DTMA 3DAWA 1A5WA 2E2QA 1BCOA 3A5LC 1HNIA 3SMPA 3V9UA 4BR9A 1S72N 2O8EB 4KBOA 3L2VA 1VRUA 4DV7K 1WSGA 1JLCA 2O8CB 1TL3A 4NLBA 2UUAK 4O8UA 4DU4A 4LSLA 2IOCA 3VQ8A 2A42A 4JKGB 1NK0A 1ASVA 1JKHA 4H0OA 1BI4A 1BOTO 4CHPA 1IKXA 1W97L 4O5BA 4DR5K 4MO4A 1Q86O 3CCSN 1CZBA 1JL2A 3OS1A 5HLFA 3AAQA 3IMXA 3O08A 4BREA 1LWEA 1C0FA 3S41A 4KHPK 4WQ5C 3LZJA 1N8RO 2A3ZA 5E84A 2NRZA 2XY7A 3K5NA 2P9KA 2P9SB 4AHTA 1GOAA 2VG7A 1OH6A 1HLUA 4LF5K
chains in the Genus database with same CATH topology
4BRFA 5AQPA 3TSUA 5EX5A 1R59O 3F2KA 4FPBA 3FZFA 4JHDA 3H3NO 1Y64A 3EZWA 2CGJA 5M1PA 4PL8A 3WUHA 1JCEA 4B9QA 1NGDA 1NM1A 2BUPA 4JK9A 4E1JA 4DQ8A 1IG8A 3ID8A 4ILGB 5AQUA 1VQ6N 5EY4A 2Q0UA 5AQSA 3VPZA 3CC7N 3A5NC 1GLJO 3DXMB 4A62A 5ELZA 3O9UA 2CH6A 4GVEA 4BR2A 3CPWM 4EHTA 3D2EA 2V52B 1RDUA 4MDBA 5AFUA 3FZLA 2BTFA 3CMAN 2E88A 1O13A 4CI6A 2IIRA 2QI2A 3UKRB 1YXQA 2NRRA 3GL1A 1GLAG 3KK7A 4ISGA 4YDUA 3M1FA 3QICA 3CJ1A 4A2BA 2ZJPL 2P9PA 3B8AX 3ZEUB 3SLCA 2YI1A 4O8KA 3ENHA 2UYTA 3C6AA 2GTDA 3QB0A 4PKIA 5GAGP 3LDLA 3CJBA 2F9WA 3CQXA 3MCPA 3Q7CA 4BC2A 2QWOA 3C65A 4OPAA 3WT0A 3FGUA 3E9OA 2P9UA 3VEYA 5C12A 4WFBL 2QEXN 1YHQN 2GELA 3RSEA 1YAGA 3EE8A 2P9LA 3KWIA 3MDQA 2E2OA 3PIOL 3VTIA 4H5NA 4OPHA 3H1VX 5FPNA 2ASOA 2YHXA 4JN4A 4BGAA 4JD2A 4NLCA 4CZKA 1VQNN 2Q31A 1K9MO 3HBTA 4FL9A 4RWTA 3U8XA 3PIPL 5ADXH 2E8AA 4C1NK 1Z05A 3J8AA 3E1YA 3WQUA 3CMEN 5TKYA 1U2VA 1BUPA 3CCQN 4JKEA 3O1WA 3HTVA 4CBWA 3H45C 4IEIA 2D4WA 3VF4A 3D2FA 4M63C 1GLDG 3M6GA 2HBJA 4BY9C 3MMVA 4FWSA 2PAVA 1K8KB 3LM9A 5GAEP 3ZETB 5C15A 2WBNA 3LDOA 1BA1A 3KZBA 1K73O 2P9IB 4WQ5A 1ZBSA 4AM6A 3TTCA 1LOTB 2JWLA 4BRCA 2D1KA 2WC9A 3MN6A 2QM1A 2CGKA 2GEMA 3E66A 3VENA 4BR5A 4CZMA 4CZHA 4IFEA 5AZIA 3SK3A 3WXLA 4BQZA 1QQOA 4DKWA 1MDUB 2Q36A 3MX5A 3M3ZA 4KH4A 1DKGD 5FPEA 5FPDA 3HZ6A 2JWKA 3KHYA 5GIOA 3CCJN 4XH4A 2E2PA 4PKHA 1JCFA 1SQKA 2A6AA 4GY2B 1G99A 2E20A 3N4PA 5AQTA 3ZX2A 3G4SN 3G25A 3AGRA 3N4QA 2VYPA 4B1ZA 1T6DA 4AM7A 2QTDA 4CZFA 3K9JA 3VEVA 3CQYA 5JLHA 3R1XA 2F7TA 2DPNA 2FF6A 2GWKA 1NWKA 4CZGA 2NZTA 3C7NB 1Q81O 3P31A 5AQIA 5KPTA 1Z6RA 3HSCA 1HPMA 4YOYA 1KQSM 3R6MA 2HF3A 3O9RA 5DM7L 1TUUA 3CI5A 1GLFO 3G6EN 3MN9A 2PFUA 4XEIA 2HMPA 3H6EA 1NJIO 3O9TA 2FSJA 5AQFA 4BRHA 4IJAA 4PL7A 1ZC6A 3CHWA 4I6MA 3QBXA 4IOXA 5CR4A 1VQ9N 1OVYA 1HJOA 4HTLA 3TPQA 1MA9B 1TYQA 3ZYYX 4JKGA 4JKFA 2PBDA 4BQLA 4IO9L 1NGBA 1NBWA 3FE1A 5BN8A 2KLAA 3MWTA 5EXWA 5M1QA 4QS9A 3O9QA 3O9SA 4ILJA 4JNEA 3O80A 2NLXA 4BRDA 4BG9A 4FWOA 4MDAA 1HX1A 4R79A 1NGEA 4PKGA 1DGKN 4H0PA 2P9KB 3I56N 4CBUA 5AR0A 3VMFB 1NGJA 4JKBA 2HBMA 4BRNA 3DXKA 3CCMN 1RDWX 1JJ2M 3W3DA 3IFRA 1SAZA 4GV9A 3RVCA 1BG3A 1WOQA 4FO0A 4MO5A 2NRVA 3L4IA 3ULEB 5F2RA 5BPLA 4H5TA 3PLAA 4BR0A 3O4WA 2VGNA 3MN5A 4BRLA 3CCUN 1NMDA 1M1KO 2QWQA 3U9DA 2Q1NA 2P9SA 4FWPA 4JKHA 2FF3B 5EVZA 3UE5A 5CE3A 3TTDA 2Q0RA 5LJVA 3CIPA 1YUWA 3WQTA 4IZ9A 2EWSA 4FVUA 3VEXA 4IOAL 5M1FA 4GV3A 1OKJA 3FZMA 3VERA 4A5AA 4FWKA 5KPRA 3L0QA 3QMLA 2ZJRL 1X3MA 1ATSA 3U4LA 4GV6A 4B1UB 4M7XA 4MLHA 5AQOA 4M7YA 4BC3A 1HUXA 3GG4A 3LDNA 3WEEB 3SBTA 1DT9A 5AQLA 1E4GT 2FXUA 4CD1A 1EQYA 3K9KA 2QWLA 2F9TA 1C0GA 4YOXA 3DXMA 3A8YA 1QZ6A 2OTLN 3AARA 2ZGYA 2VWBA 5C2FA 2A41A 5ADXA 5CHIA 4H5RA 1T44A 4FPAA 2P9UB 4H5WA 1V4TA 3T69A 3ZX0A 3VGLA 4BRPA 4JEPA 4QS7A 3UKRA 1YJNN 4BROA 2I7PA 4U7BA 2YJEA 2V51B 2YJFA 4BVOA 3SAGA 2J4RA 3ZEUA 1NGIA 1BU6O 4WF9L 3FZKA 5BR9A 3CCVN 1YVNA 5AQVA 4BG8A 3I55N 4A2AA 1T6CA 3JXUA 3BEXA 5GADP 3U9ZA 4RTFD 1GLEG 3TSQA 3QFPA 3VF6A 4H0YB 5AQWA 3OHRA 5GIPA 3BF1A 1V4SA 2Q2RA 3LL3A 1RFQA 2NRHA 4CZEA 1VAZA 3NMUA 2HBLA 5C2DA 5HOOA 5AQJA 3VTHA 5LY3A 3H1QA 3SMSA 3HOTA 3NVKA 4EAHD 1NGAA 4JAXA 3A0IX 1P8ZA 2A5XA 4CZLA 4IWVA 3AGKA 4B1YB 3BF3A 2KHOA 2VGMA 3UKUB 1HKBA 3LDQA 3DWLA 4XH1A 4WQ4C 1YJWN 4PHTX 4K42A 1ZXOA 5F1XA 4F9OA 1X9JA 1E4FT 1SS6A 4FWQA 4BRKA 3QFUA 3CD6N 2FLOA 1VQKN 1NGFA 2YHYA 5AQYA 4YOUA 1QVGM 5HL7L 1K8KA 1X3NA 3ZETA 3SAFA 1GLBG 3GOIA 4H0XB 2P9IA 4IDHA 3UB5A 4BRQA 3F9MA 1VQMN 1MWKA 4CBXA 5BRDA 2QWRA 2ZGZA 4FOIA 4BR4A 3HRGA 4WFNL 1IJJA 5AQKA 4CD3A 2E2NA 3LDPA 3ATVA 4YORA 4JKDA 4BC5A 1YF5L 3FZHA 3IDHA 4IEEA 4B1VA 5M1KA 3CCRN 1VQ5N 2H3GX 2IVPA 3J7ZO 3OW2M 4JK7A 2QWPA 3O5BA 3ID6A 2AP1A 3AY9A 4RCHA 5AQXA 5AQMA 3VEZA 2ITMA 2P9NB 1K8AO 5AQZA 2ASMA 1VQLN 2WUSA 3OBWA 2CH5A 2W40A 1HKGA 3MN7A 4A5BA 2D0PA 2GWJA 4KH6A 4DB3A 1BDGA 2RHKA 5AQRA 3H46O 4OO1J 1YJ9N 4H0TB 1BO5O 3MCAB 3EE9A 3O6WA 4HWIA 4CJ7A 1YI2N 4H5VA 1QQMA 4J8FA 3W0LA 2FSNA 1S3XA 2I7NA 3WXJA 1Q82O 4WYBA 2QWMA 4XH5A 1HKCA 3P39A 2NRXA 3FLCO 5C10A 1GLLO 4AF1A 3C0BA 4JK8A 4BRGA 2ZWHA 5AZJB 4BGBA 4YOVA 1NGHA 4C23A 3CERA 3CCLN 3FR0A 5E26A 1GLCG 5B8HA 4JHDB 5KQ8A 2OTJN 4B1WB 3CCEN 3D6RA 3Q7BA 3DLLL 3WXMB 4QS8A 5JLFA 4FWLA 3VOVA 4UY8O 3P38A 2V7YA 4B1XB 4BR7A 3TSPA 3NVMA 4BRMA 5GAHP 3OBYA 4FSVA 2AA4A 3IUCA 1KC8O 5AQNA 2QWNA 1RGIA 1ATRA 1MWMA 4KH5A 3D2EB 4Z94A 5JICA 5BPMA 5I9EB 1VQON 4FWMA 4YOWA 1EO1A 2HF4A 3SBGA 3ULEA 3G71N 4LC9B 4H03B 5BRFA 4WQ4A 1D4XA 2P9PB 3ENBA 1DEJA 2NNWA 2BH1A 3CJCA 2VCPA 5JVHL 3EKUA 2RE2A 3TU5A 4IXCA 2NRWA 4FWRA 5M1OA 1VQ7N 5FPMA 1BWFO 3H3OB 3CC2N 3CJAA 1NGGA 5KQDA 1U6ZA 4BRIA 3DJCA 3RSEB 5MLCQ 2HBKA 4ISFA 3MK6A 2P9LB 5C0YA 3QBWA 3OA9A 2IVOA 5GINA 1KD1O 3WEEA 1KAZA 3ENOA 2W41A 4H0VB 2ASPA 3HI0A 4JD2B 4JKAA 4O5FA 2OANA 5EOYA 2WFBA 1VQPN 3F5TA 2QW9A 1JCGA 4NB4A 3EN9A 4FOEA 3R9PA 2QA4N 3M5RA 5AFUH 1VQ8N 3C6HA 1U2VB 1QVFM 1WUAA 4EFHA 1VQ4N 4WFAL 4IOCL 1T3VA 1NLVA 3SJHA 4ISEA 5LJWA 4NO7A 3D2FB 4A57A 3CJ7A 2IVNA 5AQGA 4FWNA 3E9PA 2ZJQL 4EHUA 3A5OC 4JKCA 3I33A 2YHWA 3QDKA 4DHYA 3VEWA 1Q7YO 4K41A 3O1BA 2GUPA 1ILYA 3BUZB 4L3QA 3VETA 3MWPA 2A40A 3CJ9A 5BN9A 3VGKA 4U67L 3CETA 5JMVA 1BA0A 3E9LA 3JS6A 5AZIB 1XC3A 4IJNA 3O8MA 2D0OA 1XUPO 3T7ZA 5M1NA 2KKZA 1LCUA 3VESA 3CXCM 4BVPA 3D7EO 3ZX3A 3VF2A 3DAWA 1YIJN 5AZJA 2V7ZA 3A5MC 1SZ2A 4DCHA 1KAYA 3I8BA 1S22A 2E2QA 5H1SQ 3A5LC 4BC4A 3SMPA 4YDUC 3UKUA 4BR9A 1S72N 2ZF5O 3VGMA 2NRTA 4KBOA 4K43A 2E1YA 1KXPA 5KPZA 3EL2A 4MLEA 3MX2A 5BREA 3VEOA 1P90A 1W2BM 4NLBA 1QZ5A 3CF5L 4O8UA 1TUYA 3BP8A 3FFKB 1J6ZA 4I6MB 1QQNA 2Q97A 3R3LA 1Q18A 3EO3A 5TKWA 1TYQB 2FSKA 2A42A 4JKGB 4A59A 3CC4N 4CZIA 3C7NA 1M90O 4C1NI 4EIAA 2HOEA 5BRHA 1YITN 4H0OA 1QHAA 3GBTA 1BOTO 3GE1A 1W97L 3R8EA 1ATNA 3WXKA 4MO4A 1Q86O 4K25A 3IKMA 3CCSN 2GX9A 4GNIA 2E1ZA 3TTFA 3LM2A 5BPNA 3WXIA 2YX6A 3EKSA 4G9ZA 2P9NA 4IO8A 3AAQA 3IMXA 3DXKB 3O08A 4ILHA 4BREA 3ATUA 3HOSA 1ESVA 1C0FA 3S41A 3L4QA 4WCEL 3KVGA 5JVGL 4WQ5C 1N8RO 4A61A 1KAXA 2A3ZA 2HSTA 2QXLA 5E84A 4BRAA 3HM8A 2NRZA 5DM6L 2CGLA 3AAPA 4Y0WA 1NGCA 3P4IA 5F0XA 3GDQA 1H1VA 2P9KA 1CZAN 3L6QA 5AQHA 2P9SB 3KWGA 5AQQA 4YOTA 3SAHA 2YCHA 4CZJA 1XQSC 1HLUA 3CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRF A;  5AQP A;  5EX5 A;  1R59 O;  4FPB A;  3FZF A;  4JHD A;  3H3N O;  1Y64 A;  3EZW A;  2CGJ A;  4PL8 A;  3WUH A;  1JCE A;  4B9Q A;  1NGD A;  1NM1 A;  2BUP A;  4E1J A;  4DQ8 A;  1IG8 A;  3ID8 A;  5AQU A;  5EY4 A;  2Q0U A;  5AQS A;  3VPZ A;  3A5N C;  1GLJ O;  3DXM B;  4A62 A;  5ELZ A;  2CH6 A;  4BR2 A;  4EHT A;  3D2E A;  2V52 B;  5AFU A;  3FZL A;  2BTF A;  2E88 A;  4CI6 A;  2IIR A;  3UKR B;  1YXQ A;  3GL1 A;  4ISG A;  1GLA G;  4YDU A;  3M1F A;  3QIC A;  3CJ1 A;  4A2B A;  2P9P A;  3B8A X;  3ZEU B;  3SLC A;  2YI1 A;  4O8K A;  3ENH A;  2UYT A;  2GTD A;  3QB0 A;  4PKI A;  3LDL A;  3CJB A;  2F9W A;  3CQX A;  3MCP A;  4BC2 A;  2QWO A;  3WT0 A;  3FGU A;  2P9U A;  3VEY A;  2GEL A;  3RSE A;  1YAG A;  2P9L A;  3MDQ A;  2E2O A;  4H5N A;  3H1V X;  5FPN A;  2ASO A;  2YHX A;  4JN4 A;  4BGA A;  4JD2 A;  4CZK A;  2Q31 A;  3HBT A;  4FL9 A;  4RWT A;  3U8X A;  5ADX H;  2E8A A;  1Z05 A;  3J8A A;  3WQU A;  5TKY A;  1U2V A;  1BUP A;  3O1W A;  3HTV A;  4CBW A;  3H45 C;  2D4W A;  3VF4 A;  3D2F A;  4M63 C;  1GLD G;  3M6G A;  3MMV A;  4FWS A;  2PAV A;  1K8K B;  3LM9 A;  3ZET B;  3LDO A;  1BA1 A;  3KZB A;  2P9I B;  4WQ5 A;  1ZBS A;  4AM6 A;  1LOT B;  4BRC A;  2D1K A;  3MN6 A;  5JMV A;  2QM1 A;  2CGK A;  2GEM A;  4BR5 A;  3VEN A;  4CZM A;  4CZH A;  5AZI A;  3SK3 A;  3WXL A;  4BQZ A;  1QQO A;  1MDU B;  2Q36 A;  3M3Z A;  5FPE A;  1DKG D;  5FPD A;  3HZ6 A;  3KHY A;  4XH4 A;  2E2P A;  4PKH A;  1JCF A;  1SQK A;  2A6A A;  4GY2 B;  1G99 A;  2E20 A;  5AQT A;  3ZX2 A;  3G25 A;  2VYP A;  4B1Z A;  1T6D A;  4AM7 A;  4CZF A;  3VEV A;  3CQY A;  5JLH A;  2DPN A;  2FF6 A;  2GWK A;  1NWK A;  4CZG A;  2NZT A;  3C7N B;  5AQI A;  5KPT A;  1Z6R A;  3HSC A;  1HPM A;  3R6M A;  2HF3 A;  1TUU A;  3CI5 A;  1GLF O;  3MN9 A;  4XEI A;  2HMP A;  3H6E A;  2FSJ A;  5AQF A;  4BRH A;  4IJA A;  4PL7 A;  1ZC6 A;  3CHW A;  4I6M A;  3QBX A;  1HJO A;  4HTL A;  3TPQ A;  1MA9 B;  1TYQ A;  2PBD A;  4BQL A;  1NGB A;  1NBW A;  3FE1 A;  5BN8 A;  5EXW A;  4QS9 A;  4JNE A;  3O80 A;  2NLX A;  4BRD A;  4BG9 A;  4FWO A;  1HX1 A;  1NGE A;  4PKG A;  1DGK N;  4H0P A;  2P9K B;  4CBU A;  5AR0 A;  1NGJ A;  4BRN A;  3DXK A;  1RDW X;  3W3D A;  3IFR A;  1SAZ A;  1BG3 A;  1WOQ A;  4FO0 A;  4MO5 A;  3L4I A;  3ULE B;  5F2R A;  5BPL A;  4H5T A;  4BR0 A;  3O4W A;  4BRL A;  3MN5 A;  1NMD A;  2QWQ A;  3U9D A;  2Q1N A;  2P9S A;  4FWP A;  5CE3 A;  2FF3 B;  5EVZ A;  3UE5 A;  2Q0R A;  5LJV A;  3CIP A;  1YUW A;  3WQT A;  4IZ9 A;  2EWS A;  3VEX A;  1OKJ A;  3FZM A;  3VER A;  4FWK A;  5KPR A;  3L0Q A;  3QML A;  1X3M A;  1ATS A;  3U4L A;  4B1U B;  4M7X A;  4MLH A;  5AQO A;  4M7Y A;  4BC3 A;  1HUX A;  3GG4 A;  3LDN A;  3WEE B;  5AQL A;  1E4G T;  2FXU A;  4CD1 A;  1EQY A;  2QWL A;  2F9T A;  1C0G A;  3DXM A;  3A8Y A;  1QZ6 A;  3AAR A;  2ZGY A;  2VWB A;  5ADX A;  2A41 A;  4H5R A;  1T44 A;  4FPA A;  2P9U B;  4H5W A;  1V4T A;  3ZX0 A;  3VGL A;  4BRP A;  4QS7 A;  3UKR A;  4BRO A;  2I7P A;  2YJE A;  2V51 B;  2YJF A;  4BVO A;  2J4R A;  3ZEU A;  1NGI A;  1BU6 O;  3FZK A;  5BR9 A;  1YVN A;  5AQV A;  4BG8 A;  4A2A A;  1T6C A;  3JXU A;  3BEX A;  3U9Z A;  4RTF D;  1GLE G;  3QFP A;  3VF6 A;  4H0Y B;  5AQW A;  3OHR A;  3BF1 A;  1V4S A;  2Q2R A;  3LL3 A;  1RFQ A;  2NRH A;  4CZE A;  5AQJ A;  5LY3 A;  3H1Q A;  3SMS A;  4EAH D;  1NGA A;  4JAX A;  3A0I X;  1P8Z A;  2A5X A;  4CZL A;  4IWV A;  4B1Y B;  3BF3 A;  2KHO A;  3UKU B;  1HKB A;  3LDQ A;  3DWL A;  4XH1 A;  4WQ4 C;  4K42 A;  1ZXO A;  5F1X A;  4F9O A;  1X9J A;  1E4F T;  4FWQ A;  4BRK A;  3QFU A;  2FLO A;  1NGF A;  2YHY A;  5AQY A;  1K8K A;  1X3N A;  3ZET A;  1GLB G;  3GOI A;  4H0X B;  2P9I A;  3UB5 A;  4BRQ A;  3F9M A;  1MWK A;  4CBX A;  5BRD A;  2QWR A;  2ZGZ A;  4FOI A;  4BR4 A;  1IJJ A;  5AQK A;  4CD3 A;  2E2N A;  3LDP A;  3ATV A;  4BC5 A;  3FZH A;  3IDH A;  4B1V A;  2H3G X;  2IVP A;  2QWP A;  3O5B A;  2AP1 A;  3AY9 A;  4RCH A;  5AQX A;  5AQM A;  3VEZ A;  2ITM A;  2P9N B;  5AQZ A;  2ASM A;  2WUS A;  2CH5 A;  2W40 A;  1HKG A;  3MN7 A;  2D0P A;  2GWJ A;  4DB3 A;  1BDG A;  5AQR A;  3H46 O;  4H0T B;  1BO5 O;  3O6W A;  4HWI A;  4CJ7 A;  4H5V A;  1QQM A;  4J8F A;  3W0L A;  2FSN A;  1S3X A;  2I7N A;  3WXJ A;  4WYB A;  2QWM A;  4XH5 A;  1HKC A;  3FLC O;  1GLL O;  4BRG A;  3C0B A;  2ZWH A;  5AZJ B;  4BGB A;  1NGH A;  4C23 A;  3CER A;  3FR0 A;  5E26 A;  1GLC G;  5B8H A;  4JHD B;  5KQ8 A;  4B1W B;  4QS8 A;  5JLF A;  4FWL A;  3VOV A;  2V7Y A;  4B1X B;  4BR7 A;  4BRM A;  4FSV A;  2AA4 A;  3IUC A;  5AQN A;  2QWN A;  1RGI A;  1ATR A;  1MWM A;  3D2E B;  4Z94 A;  5JIC A;  5BPM A;  5I9E B;  4FWM A;  2HF4 A;  3ULE A;  4LC9 B;  4H03 B;  5BRF A;  4WQ4 A;  1D4X A;  2P9P B;  1DEJ A;  3CJC A;  2VCP A;  3EKU A;  3TU5 A;  4IXC A;  4FWR A;  5FPM A;  1BWF O;  3H3O B;  3CJA A;  1NGG A;  5KQD A;  1U6Z A;  4BRI A;  3DJC A;  3RSE B;  4ISF A;  3MK6 A;  2P9L B;  3QBW A;  2IVO A;  3WEE A;  1KAZ A;  3ENO A;  2W41 A;  4H0V B;  2ASP A;  3HI0 A;  4JD2 B;  4O5F A;  5EOY A;  2OAN A;  2QW9 A;  1JCG A;  4NB4 A;  3EN9 A;  4FOE A;  3R9P A;  5AFU H;  1U2V B;  1WUA A;  4EFH A;  1NLV A;  3SJH A;  4ISE A;  5LJW A;  4NO7 A;  3D2F B;  3CJ7 A;  2IVN A;  5AQG A;  4FWN A;  4EHU A;  3A5O C;  3I33 A;  2YHW A;  3QDK A;  4DHY A;  3VEW A;  4K41 A;  3O1B A;  2GUP A;  3BUZ B;  4L3Q A;  3VET A;  2A40 A;  3CJ9 A;  5BN9 A;  3VGK A;  3CET A;  1BA0 A;  3JS6 A;  5AZI B;  1XC3 A;  4IJN A;  3O8M A;  2D0O A;  1XUP O;  1LCU A;  3VES A;  4BVP A;  3D7E O;  3ZX3 A;  3VF2 A;  3DAW A;  5AZJ A;  2V7Z A;  3A5M C;  1SZ2 A;  4DCH A;  1KAY A;  3I8B A;  1S22 A;  2E2Q A;  3A5L C;  4BC4 A;  3SMP A;  4YDU C;  3UKU A;  4BR9 A;  2ZF5 O;  3VGM A;  4KBO A;  4K43 A;  2E1Y A;  1KXP A;  5KPZ A;  3EL2 A;  4MLE A;  5BRE A;  3VEO A;  1QZ5 A;  1TUY A;  3BP8 A;  3FFK B;  1J6Z A;  4I6M B;  1QQN A;  2Q97 A;  1Q18 A;  3EO3 A;  1TYQ B;  2FSK A;  2A42 A;  4CZI A;  3C7N A;  4EIA A;  2HOE A;  5BRH A;  4H0O A;  1QHA A;  3GBT A;  1BOT O;  3GE1 A;  3R8E A;  1ATN A;  3WXK A;  4MO4 A;  4K25 A;  4GNI A;  2E1Z A;  5BPN A;  3LM2 A;  3WXI A;  3EKS A;  2P9N A;  4IO8 A;  3AAQ A;  3IMX A;  3DXK B;  3O08 A;  4BRE A;  3ATU A;  1ESV A;  1C0F A;  3S41 A;  3KVG A;  4WQ5 C;  4A61 A;  1KAX A;  2A3Z A;  2QXL A;  5E84 A;  4BRA A;  3HM8 A;  2CGL A;  3AAP A;  4Y0W A;  1NGC A;  3P4I A;  5F0X A;  3GDQ A;  1H1V A;  2P9K A;  1CZA N;  3L6Q A;  5AQH A;  2P9S B;  5AQQ A;  2YCH A;  4CZJ A;  1XQS C;  1HLU A; 
#chains in the Genus database with same CATH topology
 5AQP A;  3TSU A;  3F2K A;  1TAQ A;  2PYJ A;  3H3N O;  1U45 A;  1NM1 A;  1FXX A;  4JK9 A;  4LF7 K;  4DR6 K;  4DV0 K;  5I42 A;  4AHS A;  5AQU A;  5EY4 A;  1RCH A;  5A2Q O;  4FW2 A;  3CPW M;  2O4G A;  4MDB A;  2NRR A;  2E4L A;  1GLA G;  3M1F A;  3CJ1 A;  1HNX K;  4DSE A;  1U04 A;  2UYT A;  2B6A A;  3CQ8 A;  5GAG P;  3Q7C A;  3OYD A;  3FGU A;  2P9U A;  5C12 A;  4WFB L;  3VA0 A;  2GEL A;  3H08 A;  1YAG A;  1N5Y A;  3MDQ A;  3PIO L;  4O44 A;  4CJW A;  4CZK A;  1VSD A;  1Z26 A;  1IKW A;  3AVH A;  4RWT A;  3HST B;  2E8A A;  4C1N K;  1Z05 A;  3J8A A;  3E1Y A;  4DWI A;  1U2V A;  2I5J A;  3CCQ N;  3SJJ A;  1C1C A;  2D4W A;  4Q5V A;  3D2F A;  5HRP A;  4HCC A;  3LAN A;  4BY9 C;  3MMV A;  2PAV A;  3ZET B;  4YNQ A;  3OYF A;  4ICL A;  2O8D A;  3VQA A;  3IAY A;  4G1Q A;  2D1K A;  2WC9 A;  3MN6 A;  4BR5 A;  2CGK A;  4CGI A;  4IFE A;  3SK3 A;  3DLH A;  3M3Z A;  5FPE A;  1DKG D;  2OZM A;  3CCJ N;  2VQE K;  1R0A A;  3LZI A;  2E2P A;  3VQP A;  1JCF A;  4GY2 B;  2W6K A;  3AGR A;  4ELU A;  1TL1 A;  3LP1 A;  2QTD A;  3NBP A;  3DM2 A;  1ZBL A;  3R1X A;  4XIU A;  3SV3 A;  4GW6 A;  2NZT A;  3C7N B;  1Q81 O;  5AQI A;  1Z6R A;  3HSC A;  1HPM A;  3R6M A;  1TUU A;  1RBS A;  3MN9 A;  1C1A A;  3MXJ A;  4XEI A;  1NJZ A;  2HMP A;  3H6E A;  4LY7 A;  1NJI O;  2FSJ A;  1NKC A;  4IJA A;  4PL7 A;  4DR4 K;  1HQE A;  3AA3 A;  3CHW A;  3DLG A;  5CR4 A;  4JV5 K;  3QEI A;  3V4I A;  1HJO A;  2RF2 A;  4JKF A;  2PBD A;  1IBL K;  1NGB A;  2KLA A;  3MWT A;  3QLH A;  2G8U A;  3BDP A;  4QS9 A;  3P1G A;  4JNE A;  3O80 A;  3LAK A;  4MDA A;  1X9S A;  3ZCM A;  3ZSX A;  5IWA K;  3HPG A;  4CBU A;  4F3T A;  2HHH K;  3PX6 A;  3DXK A;  3AO1 A;  2VWJ A;  3CCM N;  2FBX A;  3IFR A;  1HR0 K;  4GV9 A;  3AVG A;  3NH1 A;  1X9W A;  1WOQ A;  2NRV A;  1HNV A;  3L4I A;  5F2R A;  3ULE B;  3M8P A;  3QNO A;  4BR0 A;  4PQU A;  2VGN A;  4HUG A;  5CE3 A;  2FF3 B;  4DG1 A;  2Y1I A;  3KK2 A;  2Q0R A;  2FC0 A;  4KHS A;  1SV5 A;  4IOA L;  3VEX A;  4GV3 A;  3FZM A;  5KPR A;  4BDP A;  3L0Q A;  3QML A;  1JLB A;  5I3U A;  1WSF A;  1X3M A;  5AQO A;  4BC3 A;  5J2Q A;  1CLQ A;  3WEE B;  4YHH K;  2G8V A;  2FXU A;  3SUO A;  4CD1 A;  1UOC A;  1NK8 A;  2E5L K;  2F9T A;  3K5L A;  3LAL A;  4Z4F A;  3AAR A;  1WBB A;  4DR3 K;  3V1Q A;  4DS4 A;  3K5O A;  1RT3 A;  3TWH A;  3VGL A;  4BRP A;  3PSI A;  4JEP A;  3UKR A;  1VK0 A;  1TK8 A;  4DFK A;  3P83 D;  4BRO A;  3THW B;  2YJE A;  2YJF A;  3SAG A;  3NGZ A;  2Q3S A;  2WON A;  1BU6 O;  3FZK A;  2YKM A;  3VN5 A;  1FKP A;  1YVN A;  5AQV A;  1T6C A;  1TAU A;  1BQN A;  4RTF D;  1GLE G;  3TSQ A;  3QFP A;  3LAM A;  4H0Y B;  4DR7 K;  4JI2 K;  3BF1 A;  3O3G A;  3SCX A;  5HOO A;  3M8R A;  1XHX A;  4E89 A;  1ZBI A;  4M3X A;  4B08 A;  5J2P A;  3KD5 E;  4JAX A;  1DTQ A;  1KCF A;  4OLB A;  4B1Y B;  3BF3 A;  2VGM A;  4WQ4 C;  2YV0 X;  2FBV A;  4PHT X;  4HVJ A;  1RBV A;  4W5T A;  4BRK A;  3EEQ A;  4Z4G A;  3QFU A;  1SKR A;  4IG3 A;  2G8F A;  1S1W A;  2P51 A;  3DOL A;  3GOI A;  2HHW A;  2O8E A;  5BRD A;  3PSF A;  1WSH A;  5J1E A;  3K2P A;  4Z4C A;  4FOI A;  4BR4 A;  4E7H A;  5LMU K;  4KB0 A;  1IJJ A;  3ZT4 A;  3T1Y K;  1BI4 B;  3ATV A;  4CFD A;  4JKD A;  4CHQ A;  3CCR N;  4C8L A;  1L3U A;  2IVP A;  1VRT A;  4J2A A;  4FCY A;  1SL0 A;  1HJR A;  3AY9 A;  2Y1J A;  5AQM A;  2YHB A;  1K8A O;  3O4N A;  2VG5 A;  1J9A A;  3JSM A;  2O8B B;  1HKG A;  4A5B A;  2D0P A;  4CFB A;  1KVB A;  3MXM A;  3O3H A;  1SL2 A;  5D3G A;  4DB3 A;  3V9S A;  5AQR A;  3OS0 A;  1YI2 N;  2FSN A;  2UU9 K;  5C10 A;  1GLL O;  4JK8 A;  1WSJ A;  3KKR A;  3SYZ A;  1HPZ A;  2UXD K;  4BGB A;  4YOV A;  1NGH A;  4FZZ A;  2X74 A;  3CER A;  3FR0 A;  3AO2 A;  3HP6 A;  5KQ8 A;  3PUF A;  4E0D A;  3D6R A;  3WXM B;  4QS8 A;  3HT3 A;  3VOV A;  4IG0 A;  3PY8 A;  1YTU A;  1QSY A;  5HP1 A;  4BR7 A;  4OJR A;  4BRM A;  5GAH P;  1NNE A;  4FXD A;  2ZD1 A;  3IUC A;  1B9D A;  4RG8 A;  1NKE A;  2YKN A;  4KH5 A;  1VQO N;  4M3Z A;  5I9E B;  4FWM A;  4B9M A;  3ZLJ A;  4JS5 A;  2HMI A;  4LC9 B;  1VHX A;  4CIE A;  3SPY A;  5SZT A;  3OTO K;  3LWM A;  4CHN A;  3MXI A;  2VCP A;  4F2S A;  1S6P A;  5FPM A;  4W5O A;  1XNR K;  1U6Z A;  4E7L A;  4BRI A;  5MLC Q;  2KTQ A;  1N34 K;  4YY3 K;  4N56 A;  5GIN A;  2OYQ A;  3HVT A;  4H0V B;  3HI0 A;  4O5F A;  4OKJ A;  3KJV A;  4FLT A;  1JCG A;  3EN9 A;  1IKV A;  4FOE A;  3R9P A;  3M5R A;  1VQ8 N;  1U2V B;  2EHG A;  4B3O A;  2OPR A;  5HRS A;  4WFA L;  2HVI A;  1XMO K;  3D2F B;  2ZJQ L;  4EHU A;  1KFS A;  3MEE A;  3QDK A;  2O8D B;  3B6O A;  4K41 A;  3O1B A;  4CJR A;  1I39 A;  3VGK A;  4U67 L;  1HNW K;  4IJN A;  2D0O A;  3THY A;  4DSK A;  3U3G A;  4FK0 A;  2V7Z A;  3OJS A;  3DLE A;  1TKX A;  1KAY A;  3L2Q A;  5H1S Q;  4DQP A;  4BC4 A;  3RMD A;  4YDU C;  3UKU A;  4CGD A;  4AHR A;  2UUB K;  4JI3 K;  2WOM A;  4ID5 A;  3EL2 A;  3ZSR A;  4MLE A;  3MX2 A;  4NYF A;  3NGI A;  2OA8 A;  4JI8 K;  4PWD A;  3ZSV A;  1E3M A;  3BZK A;  4N5S A;  3OYB A;  3EO3 A;  2HHS A;  4CZI A;  3C7N A;  1C0T A;  5DMR A;  4FM1 A;  3VQ9 A;  4HHT A;  1UA1 A;  2HOE A;  4LF4 K;  4JS4 A;  1ITG A;  1ATN A;  1N36 K;  2WTU A;  3WXK A;  3CFR A;  3SUQ A;  2DTU A;  1HRH A;  4K25 A;  4FM0 A;  4GNI A;  3TTF A;  5BPN A;  3KTQ A;  4F2R A;  4O4G A;  4DSI A;  5FLX O;  2YX6 A;  3EKS A;  4G9Z A;  1LAW A;  2P9N A;  3DXK B;  3VQC A;  4DV5 K;  2D0A A;  3ISN C;  1ESV A;  4FK4 A;  3DOK A;  4A61 A;  3PO5 A;  1BIU A;  2HST A;  3CM5 A;  4BRA A;  1IV0 A;  3HM8 A;  2CGL A;  3AAP A;  4Y0W A;  1NGC A;  1IH7 A;  2FBY A;  5F0X A;  1CZA N;  3KWG A;  4BWJ A;  3HYF A;  1XQS C;  1EXQ A;  4BRF A;  3ZSO A;  3FZF A;  4JHD A;  2LSN A;  3EZW A;  3WUH A;  4B9Q A;  3J81 O;  4E1J A;  1WB9 A;  2Q0U A;  3VPZ A;  4M3R A;  2W6L A;  5ELZ A;  2CH6 A;  4FJM A;  4DV4 K;  1RDU A;  3CMA N;  1UA0 A;  1O13 A;  2IIR A;  4EP5 A;  3UKR B;  3I8D A;  3KK7 A;  2BE2 A;  3DI6 A;  2ZJP L;  2P9P A;  3B8A X;  4O0J A;  3M8S A;  1TVR A;  2GTD A;  4BE2 A;  3LDL A;  3CQX A;  2P5O A;  4BC2 A;  2QWO A;  3SQ2 A;  4OGE A;  3E9O A;  3KK1 A;  1YHQ N;  1BL3 A;  5CZ1 A;  1Q8I A;  4M3Y A;  4QOZ B;  3LP0 A;  1XI1 A;  2ASO A;  1VQN N;  2X6N A;  3SPZ A;  4JD2 A;  2RKI A;  1K9M O;  3HBT A;  4FL9 A;  3K5M A;  1X1P A;  4CIG A;  1C0M A;  3VQE A;  4I2P A;  1HYZ A;  3AVI A;  3AVJ A;  3HTV A;  1IBM K;  1GLD G;  4DU3 A;  1WBD A;  1RT2 A;  4C8N A;  1L3S A;  2WBN A;  3LDO A;  3KZB A;  4J2D A;  3TTC A;  1LOT B;  4JI6 K;  2QM1 A;  4CZM A;  2GEM A;  5JS1 A;  3CM6 A;  3LPT A;  3L2U A;  4JI5 K;  3WXL A;  1D5A A;  1VSM A;  4DKW A;  2Q36 A;  4KH4 A;  3HZ6 A;  2JWK A;  2OCE A;  1JLE A;  3KHY A;  4XH4 A;  3F73 A;  3NF8 A;  2A6A A;  2E20 A;  3N4P A;  3G25 A;  4Z4E A;  3QEW A;  5HRO A;  3K9J A;  4DFM A;  5JLH A;  4CF8 A;  2F7T A;  2FF6 A;  4M3U A;  4PA1 A;  3P31 A;  3HJF A;  5DM7 L;  3MED A;  3CI5 A;  2YNI A;  3NCI A;  2PFU A;  4BRH A;  1U47 A;  1ZC6 A;  3NF6 A;  4J2B A;  1D9F A;  2HNZ A;  1VQ9 N;  1UWB A;  1OVY A;  4HTL A;  2O8B A;  1MA9 B;  4BQL A;  4IO9 L;  3C95 A;  5BN8 A;  3FE1 A;  5EXW A;  4DTP A;  3O9S A;  4BG9 A;  4R79 A;  1NGE A;  4PKG A;  3U6F A;  2YNG A;  4KB1 A;  4H0P A;  4CK2 A;  4NYN A;  5AR0 A;  4JKB A;  2HBM A;  1RDA A;  3LWL A;  3F9K A;  1RDW X;  1ZBF A;  1JJ2 M;  2D0C A;  1SAZ A;  1BG3 A;  3DRP A;  3K57 A;  2IS3 A;  3NF7 A;  4B9L A;  1RDB A;  4H5T A;  4FLU A;  4M3T A;  3O4W A;  3MN5 A;  4FK2 A;  4LF8 K;  5EVZ A;  4CJ3 A;  4CJV A;  4CHO A;  1U4B A;  4IZ9 A;  4CF2 A;  4EZ6 A;  4GV6 A;  4M7Y A;  1VSL A;  3QIN A;  4CJQ A;  1EQY A;  3K9K A;  1JLG A;  4OGC A;  1QZ6 A;  3QEV A;  1JXB A;  1OVQ A;  2ZGY A;  5C2F A;  4M3W A;  4H5R A;  1C0U A;  3QIO A;  1V4T A;  3L3U A;  4QS7 A;  3S9H A;  1ZYQ A;  2I7P A;  4BVO A;  3ZEU A;  1NK4 A;  4CJ4 A;  4DQQ A;  1RT7 A;  3I55 N;  3JXU A;  3BEX A;  1RBT A;  4FZX C;  3THY B;  3OHR A;  3HXM A;  3LL3 A;  1RFQ A;  4CZE A;  1VAZ A;  1S1V A;  2HBL A;  3AVB A;  4B9N A;  4GKK K;  1BQM A;  3VTH A;  4AHV A;  4KTW A;  3HOT A;  4DTS A;  1J5E K;  4X65 K;  4FJX A;  1SKS A;  1NGA A;  4JI7 K;  2A5X A;  4CZL A;  4IWV A;  3AGK A;  2KHO A;  3UKU B;  4CHZ A;  1RTI A;  3TAG A;  2KZM A;  4KFB A;  2F8S A;  2XY8 A;  3OYI A;  4N41 A;  3QEP A;  4H4M A;  4FWQ A;  1BIZ A;  3CD6 N;  3E01 A;  4I2Q A;  5AQY A;  4CGJ A;  1K8K A;  3SAF A;  4E7I A;  4WE1 A;  3RR7 A;  1GLB G;  1NOY A;  1HQU A;  4BDZ A;  1NOZ A;  2XRI A;  5HBM A;  1MWK A;  3KLG A;  4FJL A;  2QWR A;  4OKE A;  4RW6 A;  4ZTF A;  3P5J A;  4WFN L;  3LP2 A;  5AQK A;  4CD3 A;  3EYZ A;  4ELV A;  4H8K A;  4AIL C;  4BC5 A;  1NKB A;  2DY4 A;  4B1V A;  4MQ3 A;  3VQB A;  2E6L A;  3S3M A;  2FBT A;  4JK7 A;  4QCL A;  4K8X A;  4RCH A;  3TAN A;  2ITM A;  2P9N B;  3A2F A;  1FW6 A;  1KFD A;  2CH5 A;  2W40 A;  5HRN A;  2QKB A;  4W5R A;  4B9T A;  1VSK A;  4OO1 J;  4HWI A;  3EE9 A;  3NGY A;  4CJ7 A;  1QQM A;  1VSF A;  1S3X A;  1N6Q A;  1KTQ A;  2NRX A;  4NCG A;  5KGW A;  4BRG A;  4AF1 A;  3C0B A;  4OX9 K;  2ZWH A;  1EET A;  1Q9X A;  1GLC G;  1LW2 A;  3AA4 A;  4LD0 A;  4JHD B;  1JLA A;  3CCE N;  2P1J A;  4UY8 O;  4KAZ A;  4B1X B;  2F96 A;  3NVM A;  3OBY A;  5SWM A;  4B8A B;  1EWR A;  2AA4 A;  1VSH A;  1QS4 A;  1ATR A;  1MWM A;  3AVF A;  1WSE A;  1EO1 A;  5JIC A;  4YOW A;  2HF4 A;  3SBG A;  4RW8 A;  3BGR A;  2P9P B;  4CER A;  3ENB A;  4Z4I A;  1BCM A;  1VSI A;  2BH1 A;  3CJC A;  3TAQ A;  3K0S A;  3EKU A;  2ITG A;  2RE2 A;  4IXC A;  5M1O A;  1VQ7 N;  4YFU A;  4F3O A;  4DV2 K;  1Z25 A;  5KQD A;  3FFI A;  4CE9 A;  2HBK A;  4ISF A;  4E3S A;  3CYM A;  4C8O A;  1KD1 O;  4K0K K;  4DUZ K;  1KAZ A;  3ENO A;  1SL1 A;  2ASP A;  2DFE A;  4JD2 B;  5EOY A;  3OYC A;  4H4O A;  1NK9 A;  1WAF A;  2WFB A;  3AVC A;  3F5T A;  1ASW A;  1VQP N;  1VQ4 N;  1NLV A;  4ISE A;  2IVN A;  5AQG A;  4FWN A;  3E9P A;  4IDK A;  2YHW A;  3PX0 A;  4DHY A;  3VEW A;  2QKK A;  2VWK A;  3OYM A;  2A40 A;  3CJ9 A;  4FLV A;  4DTJ A;  2VG6 A;  3E9L A;  3JS6 A;  4IFV A;  1RTJ A;  3V1O A;  3T7Z A;  1LCU A;  3VES A;  5CZ2 A;  5CY4 A;  3ZX3 A;  3VF2 A;  1YIJ N;  2HB5 A;  3I8B A;  4HUE A;  2BDP A;  3O3F A;  3SUP A;  3QER A;  3VGM A;  2AJQ A;  1EKE A;  4K43 A;  3WNE A;  1OH5 A;  1Y97 A;  3LPU A;  4DQI A;  3I0S A;  5KPZ A;  3OYE A;  1ZBH A;  3V9Z A;  5E41 A;  1P90 A;  4FM2 A;  4Q0B A;  3OYL A;  4KPY A;  3C6T A;  3CF5 L;  1B92 A;  1TUY A;  3BP8 A;  4C8K A;  1JLF A;  3HO1 A;  1Q18 A;  1RNH A;  1TKZ A;  5TKW A;  4LF9 K;  2FSK A;  4A59 A;  3CC4 N;  4KHW A;  4C1N I;  4EIA A;  5BRH A;  1QHA A;  3R8E A;  1K6Y A;  3IKM A;  2YNH A;  2ZE2 A;  2E1Z A;  4IKF A;  5KRT A;  4IO8 A;  1L3T A;  1RBU A;  4ILH A;  3ZT0 A;  3ATU A;  1T7P A;  3L4Q A;  5JVG L;  3WNF A;  3NH2 A;  4ELT A;  1NK5 A;  4B3R K;  4W5Q A;  4B9S A;  1H1V A;  3ULD A;  1CXQ A;  3OJU A;  3UIQ A;  4FW1 A;  3KLE A;  4YOT A;  3SAH A;  1S1U A;  3HL8 A;  3CPE A;  2HNY A;  4FPB A;  1RIL A;  3AO3 A;  1Y64 A;  5M1P A;  1NGD A;  1D9D A;  4Z4H A;  1KVA A;  3OYJ A;  3KLF A;  4DQ8 A;  3ID8 A;  1ZBU A;  3K59 A;  3CC7 N;  5AQS A;  4FJJ A;  4FJG A;  4CJK A;  1GLJ O;  1L3V A;  1XWL A;  2KQ2 A;  4RW7 A;  4BR2 A;  2V52 B;  3FZL A;  2BTF A;  2QI2 A;  1YXQ A;  4W5N A;  4JI1 K;  4FVM A;  3ZEU B;  3SLC A;  3SQ4 A;  5LL6 Z;  3C6A A;  3QB0 A;  4PKI A;  1JXE A;  2F9W A;  3HVR A;  2ZQB A;  3C65 A;  4OPA A;  4NXN K;  3WT0 A;  2QEX N;  4OPJ A;  3V81 A;  2PY5 A;  2JGU A;  1TK5 A;  3EE8 A;  3KWI A;  2E2O A;  5FRN A;  3HPH A;  3VQ5 A;  3VTI A;  4OPH A;  1NU0 A;  2YHX A;  5FPN A;  1JLQ A;  4JN4 A;  4BGA A;  1T8E A;  1IKY A;  4E1M A;  3C94 A;  5KRS A;  2F8T A;  3DMJ A;  1BIS A;  3PIP L;  5ADX H;  4RW9 A;  1TKD A;  4FJI A;  1BUP A;  3O1W A;  4CBW A;  3H45 C;  4IEI A;  4KTZ A;  4FJN A;  3V1R A;  3V9X A;  4FWS A;  1K8K B;  5GAE P;  4KHY A;  1K73 O;  1BA1 A;  1KLM A;  4WQ5 A;  4AM6 A;  3NF9 A;  1D8Y A;  2JWL A;  3M8Q A;  4BRC A;  5JMV A;  3VEN A;  3OYK A;  5AZI A;  2GUI A;  4BQZ A;  4CK3 A;  3L8B A;  1MDU B;  3MX5 A;  5GIO A;  2W42 A;  1QSL A;  3THX A;  1BHL A;  5FPD A;  1LWF A;  1SQK A;  1G99 A;  3ZX2 A;  4DFJ A;  3G4S N;  1OH8 A;  3N4Q A;  1IG9 A;  4B1Z A;  3ZT1 A;  1YT3 A;  4CZF A;  4O0I A;  5AJ3 K;  3CQY A;  4Z0U A;  2GWK A;  4DFP A;  3MEG A;  1NWK A;  4NCB A;  3CG7 A;  4YOY A;  1KQS M;  3NAE A;  3O9R A;  1I94 K;  2QXF A;  3B6P A;  2P5G A;  3O9T A;  5AQF A;  4LFA K;  4I6M A;  4DTR A;  4KI6 A;  3TPQ A;  1TYQ A;  3NE6 A;  5HRR A;  4CJF A;  1NBW A;  3QIP A;  4DQR A;  1S9G A;  5M1Q A;  1RT4 A;  4ILJ A;  3RTV A;  2NLX A;  4BRD A;  4FWO A;  4PY5 A;  1DGK N;  4FLY A;  2XY5 A;  1QSS A;  1NGJ A;  3DLK A;  5C25 A;  4N47 A;  1O1W A;  5JS2 A;  3TAB A;  3IRX A;  1L5U A;  2HHQ A;  4DTX A;  4BRL A;  4BWM A;  4CEA A;  3CFP A;  1M1K O;  3HM9 A;  2QWQ A;  2IGI A;  2Q1N A;  4X66 K;  4FWP A;  3TAE A;  3TTD A;  5LJV A;  3CIP A;  4FVU A;  1WSI A;  5M1F A;  1OKJ A;  3VER A;  2ZJR L;  3SI6 A;  4R5P A;  3AA2 A;  4B1U B;  4M7X A;  4MLH A;  3VQ6 A;  4FJK A;  4DSF A;  3SBT A;  1DT9 A;  5AQL A;  1E4G T;  3ZT3 A;  4CJE A;  1S9E A;  1S5J A;  2QWL A;  5CYQ A;  3V6D A;  3DXM A;  4CEQ A;  1FKO A;  3A8Y A;  1U48 A;  1KLN A;  1KRP A;  4IBN A;  4KRE A;  5CHI A;  2VWB A;  5ADX A;  2A41 A;  3TAM A;  1T44 A;  3RMB A;  4H5W A;  1KSP A;  1IBK K;  4LH4 A;  4U7B A;  1I3A A;  5C24 A;  2V51 B;  4E7K A;  1NGI A;  3VQ4 A;  1F21 A;  1W7A A;  1RT5 A;  4FJ9 A;  3NH0 A;  5GAD P;  2B5J A;  3U9Z A;  3S3O A;  3VF6 A;  5AQW A;  1YTA A;  3NMU A;  2NRH A;  2VQF K;  5C2D A;  5LY3 A;  2G8I A;  3SMS A;  4LH5 A;  5CYM A;  4EAH D;  3A0I X;  2BGG A;  3RRH A;  4M41 A;  3JAM O;  2KFN A;  1HKB A;  3LDQ A;  3VQQ A;  4XH1 A;  5FRO A;  2X6S A;  4K42 A;  4TSX A;  2YHA A;  4F9O A;  1X9J A;  1E4F T;  4BE1 A;  2FLO A;  1CXU A;  1XC9 A;  1QVG M;  1X3N A;  4B3S K;  3ASM A;  3LP3 A;  1RT1 A;  2P9I A;  1UAX A;  2Z1G A;  3DRS A;  1VQM N;  1NJW A;  1NK7 A;  2ZGZ A;  1OH7 A;  2Z1J A;  3HRG A;  1C6V A;  3QEX A;  2E2N A;  3LDP A;  4CEO A;  3IDH A;  1VQ5 N;  5FDL A;  1A5X A;  1YVU A;  2H3G X;  2O8F A;  3OW2 M;  2UUC K;  4DV1 K;  4DTN A;  1RTH A;  3O5B A;  3ID6 A;  2AP1 A;  1U49 A;  1KVC A;  1VQL N;  2WUS A;  2D0B A;  3CFO A;  3MN7 A;  4LFB K;  3OYG A;  4GVM A;  2GWJ A;  4JLH A;  3OYH A;  1BDG A;  2RHK A;  3H46 O;  1YJ9 N;  4DF8 A;  3DLR A;  4H5V A;  3W0L A;  3V9W A;  3AA5 X;  3T1H K;  3SQ0 A;  4WYB A;  4J2E A;  3OVN A;  1WLJ A;  3U3Y A;  4XH5 A;  1HKC A;  1HNZ K;  4KO0 A;  3NFA A;  4L8R B;  4JRQ A;  3QET A;  4C23 A;  5B8H A;  1CZ9 A;  4DTO A;  3DLL L;  4FWL A;  3HK2 A;  3P38 A;  4MFB A;  3JYT A;  2RN2 A;  1WAJ A;  1KC8 O;  5AQN A;  4DLE A;  2QWN A;  1S6Q A;  4Z94 A;  5BPM A;  2RPI A;  1TK0 A;  4DR1 K;  3G71 N;  2KFZ A;  5BRF A;  4WQ4 A;  3AO5 A;  4NCA A;  3TU5 A;  4FWR A;  4DQS A;  1BWF O;  3H3O B;  1NGG A;  4AQY K;  5C0Y A;  3OA9 A;  2B4J A;  4OKK A;  2IVO A;  2W41 A;  4JRP A;  4JKA A;  4CED A;  2QW9 A;  4NB4 A;  1NMN A;  4CIF A;  1S1X A;  3BZC A;  5AFU H;  1WUA A;  1LAV A;  4EFH A;  3PV8 A;  4DV3 K;  2IDO A;  4IOC L;  4Y1D A;  4JYA K;  5LJW A;  4NO7 A;  4A57 A;  5DK5 A;  3BY5 A;  3OYN A;  3TAR A;  4LFC K;  1NJY A;  3A5O C;  4DF4 A;  4O55 A;  3BUZ B;  1RDD A;  4L3Q A;  3VET A;  3HPO A;  3SV4 A;  5AZI B;  4CJT A;  3O8M A;  4CGH A;  5M1N A;  4OPK A;  2KKZ A;  3CXC M;  1J54 A;  3D7E O;  4CHY A;  4BAC A;  3THX B;  4ZHR A;  3A5M C;  1SZ2 A;  3VQ7 A;  4DCH A;  4CK1 A;  1S22 A;  2ETJ A;  3AVL A;  1EX4 A;  2ZF5 O;  2NRT A;  4GMJ B;  3ZSQ A;  1QTM A;  2E1Y A;  2G8H A;  1KXP A;  4KHU A;  1NG9 A;  1C1B A;  4CEZ A;  1JL1 A;  4F4K A;  3G0Z A;  5BRE A;  3VEO A;  4E19 A;  1W2B M;  3SZ2 A;  1QZ5 A;  1FJG K;  2XY6 A;  3FFK B;  1RDC A;  1J6Z A;  2DFF A;  1W9H A;  1QQN A;  4I6M B;  2Q97 A;  3R3L A;  4CJS A;  3ZSZ A;  3TAP A;  1TYQ B;  4DSJ A;  1M90 O;  1YIT N;  3GBT A;  4HUF A;  3GE1 A;  4JI0 K;  3J7Y P;  4B8C A;  3DRR A;  2GX9 A;  3MEC A;  3LM2 A;  3WXI A;  3LDS A;  4CEE A;  5KTQ A;  3HOS A;  3AVA A;  3OY9 A;  1W0H A;  3KVG A;  1RTD A;  4B3M K;  1SKW A;  4FJ7 A;  4DU1 A;  1KAX A;  2QXL A;  4E1N A;  4EZ9 A;  5DM6 L;  4FLW A;  3P4I A;  3GDQ A;  3L6Q A;  2ZM6 K;  3THV A;  5AQH A;  3NHG A;  3RWU A;  5AQQ A;  4DTU A;  2YCH A;  4CZJ A;  4CFA A;  4WCE L;  1RBR A;  4IFY A;  5AZJ A;  5EX5 A;  1R59 O;  2CGJ A;  3ALY A;  4PL8 A;  1JCE A;  2BUP A;  4CJL A;  1SUQ A;  1TGO A;  1IG8 A;  4ILG B;  1VQ6 N;  4X64 K;  1BGX T;  3A5N C;  3DXM B;  4A62 A;  4I7F A;  3C6U A;  4KHN A;  4CEC A;  3O9U A;  4GVE A;  3J7A P;  4EHT A;  3D2E A;  1N32 K;  5AFU A;  4B9U A;  1MU2 A;  2E88 A;  4CI6 A;  4FJ5 A;  3GL1 A;  4ISG A;  4RW4 A;  4YDU A;  3QIC A;  4PUO A;  4A2B A;  1EP4 A;  1QHT A;  2YI1 A;  4O8K A;  1HYV A;  4V19 S;  3ENH A;  4I9Q A;  3CJB A;  2X78 A;  3MCP A;  4ID1 A;  5FRM A;  3KLI A;  3HP9 A;  1IO2 A;  3VEY A;  3ZSY A;  5J2M A;  3RSE A;  2PYL A;  4HTU A;  2P9L A;  1XMQ K;  3DLB A;  4AH9 A;  1XNQ K;  2EX3 A;  4H5N A;  4CF1 A;  3H1V X;  5IT9 O;  4NLC A;  3WNG A;  2Q31 A;  1Q9Y A;  4FJH A;  4OVL A;  3U8X A;  3WQU A;  3CME N;  5TKY A;  2PZS A;  4BE0 A;  1TKT A;  4JKE A;  4DS5 A;  1FK9 A;  3VF4 A;  4M63 C;  3M6G A;  2HBJ A;  3LM9 A;  4CF9 A;  5C15 A;  1XHZ A;  2P9I B;  1ZBS A;  4CZH A;  3E66 A;  2F4V K;  4CFC A;  1QQO A;  1T03 A;  3IS9 A;  2Z1H A;  4CW7 B;  3AVM A;  4DSL A;  4HCB A;  4PKH A;  4DV6 K;  3ITH A;  5AQT A;  4FZY A;  2O8F B;  3TI0 A;  4LF6 K;  2VYP A;  1T6D A;  4AM7 A;  2IC3 A;  4QAG A;  4CES A;  3SNN A;  3VEV A;  2DPN A;  4CZG A;  3RMC A;  5KPT A;  2HF3 A;  3G6E N;  1GLF O;  1VSJ A;  2O8C A;  2UXC K;  3KK3 A;  3QBX A;  4IOX A;  2UXB K;  5EU7 A;  2ATQ A;  2G8W A;  3ZYY X;  4JKG A;  4OLA A;  1X9M A;  1J53 A;  3O9Q A;  5BR8 K;  4KKO A;  1HX1 A;  4CJU A;  1QQC A;  2P9K B;  3I56 N;  3KKS A;  3VMF B;  3VA3 A;  4BRN A;  3K58 A;  2HHU A;  3W3D A;  2E6M A;  3IG1 A;  3J80 O;  3RVC A;  1LW0 A;  4FO0 A;  4MO5 A;  5BPL A;  4AHU A;  4CGF A;  4UQG A;  2DFH A;  3PLA A;  3CCU N;  1NMD A;  4FLZ A;  3U9D A;  2P9S A;  4AHC A;  4JKH A;  3UE5 A;  3G10 A;  1YUW A;  3WQT A;  4CJ5 A;  2EWS A;  2XO7 A;  4A5A A;  4FWK A;  2YNF A;  4LSN A;  3QNN A;  1ATS A;  3U4L A;  2HHV A;  4CCH A;  1HUX A;  4GKJ K;  3GG4 A;  3LDN A;  4K8Z A;  2HHX A;  4FLX A;  2O4I A;  2G8K A;  1C0G A;  4YOX A;  4BDY A;  2HHT A;  5C42 A;  2OTL N;  4Y1C A;  4DLG A;  4I9L A;  4CEB A;  4FPA A;  2P9U B;  1LV5 A;  3ZX0 A;  3T69 A;  4KV8 A;  1YJN N;  4CEF A;  3ZT2 A;  2NUB A;  2J4R A;  4WF9 L;  5BR9 A;  3CCV N;  1EWQ A;  4BG8 A;  1NJX A;  4FJ8 A;  4A2A A;  1T05 A;  2OZS A;  2JLE A;  4KI4 A;  2HW3 A;  2OPQ A;  5GIP A;  1V4S A;  2Q2R A;  4ZTJ A;  2QK9 A;  5AQJ A;  3H1Q A;  3KLH A;  3AV9 A;  3NVK A;  4B3T K;  1P8Z A;  5KI6 A;  4CVN E;  4KHQ A;  3DWL A;  1YJW N;  3L3V A;  1ASU A;  3EY1 A;  1QE1 A;  1ZXO A;  5F1X A;  3L2R A;  1J5O A;  1SS6 A;  1VQK N;  3MAQ A;  1NK6 A;  1NGF A;  2YHY A;  2KZZ A;  4YOU A;  5HL7 L;  4DR2 K;  3ZET A;  4KRF A;  4H0X B;  2BAN A;  4IDH A;  3UB5 A;  3DYA A;  4BRQ A;  3F9M A;  2HVH A;  4CF0 A;  4CBX A;  3RMA A;  4JI4 K;  3SQ1 A;  2R7Y A;  3RR8 A;  1WNS A;  1TV6 A;  2D5R A;  4YOR A;  4M45 A;  1YF5 L;  3FZH A;  4IEE A;  5M1K A;  4KTQ A;  2GV9 A;  3J7Z O;  2QWP A;  3I0R A;  5KGX A;  5AQX A;  3KD1 E;  3VEZ A;  1N33 K;  1WN7 A;  5AQZ A;  2ASM A;  3OBW A;  3PX4 A;  3T1A A;  5T7B A;  2HND A;  4KH6 A;  3D0P A;  2KW4 A;  1A5V A;  1B9F A;  4H0T B;  1BO5 O;  3MCA B;  3O6W A;  1REV A;  4C8M A;  4CGG A;  4J8F A;  2I7N A;  3WXJ A;  3OYA A;  1Q82 O;  2QWM A;  3P39 A;  3FLC O;  5AZJ B;  4F8R A;  4DMN A;  2GBZ A;  4EP4 A;  3CCL N;  5E26 A;  1DLO A;  2OTJ N;  4B1W B;  3OS2 A;  3Q7B A;  5JLF A;  3AVN A;  3S3N A;  3AO4 A;  1GOB A;  1VSE A;  2V7Y A;  2IAJ A;  3TSP A;  4FSV A;  1DTT A;  1RGI A;  3KIO A;  5K14 A;  3D2E B;  3QO9 A;  3PO4 A;  3ULE A;  4B9V A;  4H03 B;  3TR8 A;  1D4X A;  1LWC A;  3ZSW A;  1DEJ A;  2NNW A;  2A1R A;  2OPP A;  5JVH L;  3O4Q A;  2NRW A;  1GOC A;  3CC2 N;  3CJA A;  2XHB A;  4DUY K;  3TAF A;  3DJC A;  3WNH A;  3RSE B;  3MK6 A;  1RT6 A;  2P9L B;  3QBW A;  1HYS A;  3WEE A;  2OAN A;  4FYD A;  3EZ5 A;  3RRG A;  5J2N A;  3D45 A;  4CJP A;  2QA4 N;  3L2W A;  1QVF M;  3C6H A;  3VQD A;  3SUN A;  1T3V A;  4E7J A;  3SJH A;  4NXM K;  3CJ7 A;  3THW A;  2A1S A;  2OPS A;  3AVK A;  4M42 A;  4JKC A;  3I33 A;  3T19 A;  1Q7Y O;  1G15 A;  1S1T A;  2GUP A;  1ILY A;  3MWP A;  5BN9 A;  4X62 K;  3CET A;  1HMV A;  1BA0 A;  1XC3 A;  1XUP O;  5LMN K;  2Z1I A;  3NDK A;  4BVP A;  3T3F A;  4N76 A;  3QES A;  4DTM A;  3DAW A;  1A5W A;  2E2Q A;  1BCO A;  3A5L C;  1HNI A;  3SMP A;  3V9U A;  4BR9 A;  1S72 N;  2O8E B;  4KBO A;  3L2V A;  1VRU A;  4DV7 K;  1WSG A;  1JLC A;  2O8C B;  1TL3 A;  4NLB A;  2UUA K;  4O8U A;  4DU4 A;  4LSL A;  2IOC A;  3VQ8 A;  2A42 A;  4JKG B;  1NK0 A;  1ASV A;  1JKH A;  4H0O A;  1BI4 A;  1BOT O;  4CHP A;  1IKX A;  1W97 L;  4O5B A;  4DR5 K;  4MO4 A;  1Q86 O;  3CCS N;  1CZB A;  1JL2 A;  3OS1 A;  5HLF A;  3AAQ A;  3IMX A;  3O08 A;  4BRE A;  1LWE A;  1C0F A;  3S41 A;  4KHP K;  4WQ5 C;  3LZJ A;  1N8R O;  2A3Z A;  5E84 A;  2NRZ A;  2XY7 A;  3K5N A;  2P9K A;  2P9S B;  4AHT A;  1GOA A;  2VG7 A;  1OH6 A;  1HLU A;  4LF5 K; 
#chains in the Genus database with same CATH homology
 4BRF A;  5AQP A;  3TSU A;  5EX5 A;  1R59 O;  3F2K A;  4FPB A;  3FZF A;  4JHD A;  3H3N O;  1Y64 A;  3EZW A;  2CGJ A;  5M1P A;  4PL8 A;  3WUH A;  1JCE A;  4B9Q A;  1NGD A;  1NM1 A;  2BUP A;  4JK9 A;  4E1J A;  4DQ8 A;  1IG8 A;  3ID8 A;  4ILG B;  5AQU A;  1VQ6 N;  5EY4 A;  2Q0U A;  5AQS A;  3VPZ A;  3CC7 N;  3A5N C;  1GLJ O;  3DXM B;  4A62 A;  5ELZ A;  3O9U A;  2CH6 A;  4GVE A;  4BR2 A;  3CPW M;  4EHT A;  3D2E A;  2V52 B;  1RDU A;  4MDB A;  5AFU A;  3FZL A;  2BTF A;  3CMA N;  2E88 A;  1O13 A;  4CI6 A;  2IIR A;  2QI2 A;  3UKR B;  1YXQ A;  2NRR A;  3GL1 A;  1GLA G;  3KK7 A;  4ISG A;  4YDU A;  3M1F A;  3QIC A;  3CJ1 A;  4A2B A;  2ZJP L;  2P9P A;  3B8A X;  3ZEU B;  3SLC A;  2YI1 A;  4O8K A;  3ENH A;  2UYT A;  3C6A A;  2GTD A;  3QB0 A;  4PKI A;  5GAG P;  3LDL A;  3CJB A;  2F9W A;  3CQX A;  3MCP A;  3Q7C A;  4BC2 A;  2QWO A;  3C65 A;  4OPA A;  3WT0 A;  3FGU A;  3E9O A;  2P9U A;  3VEY A;  5C12 A;  4WFB L;  2QEX N;  1YHQ N;  2GEL A;  3RSE A;  1YAG A;  3EE8 A;  2P9L A;  3KWI A;  3MDQ A;  2E2O A;  3PIO L;  3VTI A;  4H5N A;  4OPH A;  3H1V X;  5FPN A;  2ASO A;  2YHX A;  4JN4 A;  4BGA A;  4JD2 A;  4NLC A;  4CZK A;  1VQN N;  2Q31 A;  1K9M O;  3HBT A;  4FL9 A;  4RWT A;  3U8X A;  3PIP L;  5ADX H;  2E8A A;  4C1N K;  1Z05 A;  3J8A A;  3E1Y A;  3WQU A;  3CME N;  5TKY A;  1U2V A;  1BUP A;  3CCQ N;  4JKE A;  3O1W A;  3HTV A;  4CBW A;  3H45 C;  4IEI A;  2D4W A;  3VF4 A;  3D2F A;  4M63 C;  1GLD G;  3M6G A;  2HBJ A;  4BY9 C;  3MMV A;  4FWS A;  2PAV A;  1K8K B;  3LM9 A;  5GAE P;  3ZET B;  5C15 A;  2WBN A;  3LDO A;  1BA1 A;  3KZB A;  1K73 O;  2P9I B;  4WQ5 A;  1ZBS A;  4AM6 A;  3TTC A;  1LOT B;  2JWL A;  4BRC A;  2D1K A;  2WC9 A;  3MN6 A;  2QM1 A;  2CGK A;  2GEM A;  3E66 A;  3VEN A;  4BR5 A;  4CZM A;  4CZH A;  4IFE A;  5AZI A;  3SK3 A;  3WXL A;  4BQZ A;  1QQO A;  4DKW A;  1MDU B;  2Q36 A;  3MX5 A;  3M3Z A;  4KH4 A;  1DKG D;  5FPE A;  5FPD A;  3HZ6 A;  2JWK A;  3KHY A;  5GIO A;  3CCJ N;  4XH4 A;  2E2P A;  4PKH A;  1JCF A;  1SQK A;  2A6A A;  4GY2 B;  1G99 A;  2E20 A;  3N4P A;  5AQT A;  3ZX2 A;  3G4S N;  3G25 A;  3AGR A;  3N4Q A;  2VYP A;  4B1Z A;  1T6D A;  4AM7 A;  2QTD A;  4CZF A;  3K9J A;  3VEV A;  3CQY A;  5JLH A;  3R1X A;  2F7T A;  2DPN A;  2FF6 A;  2GWK A;  1NWK A;  4CZG A;  2NZT A;  3C7N B;  1Q81 O;  3P31 A;  5AQI A;  5KPT A;  1Z6R A;  3HSC A;  1HPM A;  4YOY A;  1KQS M;  3R6M A;  2HF3 A;  3O9R A;  5DM7 L;  1TUU A;  3CI5 A;  1GLF O;  3G6E N;  3MN9 A;  2PFU A;  4XEI A;  2HMP A;  3H6E A;  1NJI O;  3O9T A;  2FSJ A;  5AQF A;  4BRH A;  4IJA A;  4PL7 A;  1ZC6 A;  3CHW A;  4I6M A;  3QBX A;  4IOX A;  5CR4 A;  1VQ9 N;  1OVY A;  1HJO A;  4HTL A;  3TPQ A;  1MA9 B;  1TYQ A;  3ZYY X;  4JKG A;  4JKF A;  2PBD A;  4BQL A;  4IO9 L;  1NGB A;  1NBW A;  3FE1 A;  5BN8 A;  2KLA A;  3MWT A;  5EXW A;  5M1Q A;  4QS9 A;  3O9Q A;  3O9S A;  4ILJ A;  4JNE A;  3O80 A;  2NLX A;  4BRD A;  4BG9 A;  4FWO A;  4MDA A;  1HX1 A;  4R79 A;  1NGE A;  4PKG A;  1DGK N;  4H0P A;  2P9K B;  3I56 N;  4CBU A;  5AR0 A;  3VMF B;  1NGJ A;  4JKB A;  2HBM A;  4BRN A;  3DXK A;  3CCM N;  1RDW X;  1JJ2 M;  3W3D A;  3IFR A;  1SAZ A;  4GV9 A;  3RVC A;  1BG3 A;  1WOQ A;  4FO0 A;  4MO5 A;  2NRV A;  3L4I A;  3ULE B;  5F2R A;  5BPL A;  4H5T A;  3PLA A;  4BR0 A;  3O4W A;  2VGN A;  3MN5 A;  4BRL A;  3CCU N;  1NMD A;  1M1K O;  2QWQ A;  3U9D A;  2Q1N A;  2P9S A;  4FWP A;  4JKH A;  2FF3 B;  5EVZ A;  3UE5 A;  5CE3 A;  3TTD A;  2Q0R A;  5LJV A;  3CIP A;  1YUW A;  3WQT A;  4IZ9 A;  2EWS A;  4FVU A;  3VEX A;  4IOA L;  5M1F A;  4GV3 A;  1OKJ A;  3FZM A;  3VER A;  4A5A A;  4FWK A;  5KPR A;  3L0Q A;  3QML A;  2ZJR L;  1X3M A;  1ATS A;  3U4L A;  4GV6 A;  4B1U B;  4M7X A;  4MLH A;  5AQO A;  4M7Y A;  4BC3 A;  1HUX A;  3GG4 A;  3LDN A;  3WEE B;  3SBT A;  1DT9 A;  5AQL A;  1E4G T;  2FXU A;  4CD1 A;  1EQY A;  3K9K A;  2QWL A;  2F9T A;  1C0G A;  4YOX A;  3DXM A;  3A8Y A;  1QZ6 A;  2OTL N;  3AAR A;  2ZGY A;  2VWB A;  5C2F A;  2A41 A;  5ADX A;  5CHI A;  4H5R A;  1T44 A;  4FPA A;  2P9U B;  4H5W A;  1V4T A;  3T69 A;  3ZX0 A;  3VGL A;  4BRP A;  4JEP A;  4QS7 A;  3UKR A;  1YJN N;  4BRO A;  2I7P A;  4U7B A;  2YJE A;  2V51 B;  2YJF A;  4BVO A;  3SAG A;  2J4R A;  3ZEU A;  1NGI A;  1BU6 O;  4WF9 L;  3FZK A;  5BR9 A;  3CCV N;  1YVN A;  5AQV A;  4BG8 A;  3I55 N;  4A2A A;  1T6C A;  3JXU A;  3BEX A;  5GAD P;  3U9Z A;  4RTF D;  1GLE G;  3TSQ A;  3QFP A;  3VF6 A;  4H0Y B;  5AQW A;  3OHR A;  5GIP A;  3BF1 A;  1V4S A;  2Q2R A;  3LL3 A;  1RFQ A;  2NRH A;  4CZE A;  1VAZ A;  3NMU A;  2HBL A;  5C2D A;  5HOO A;  5AQJ A;  3VTH A;  5LY3 A;  3H1Q A;  3SMS A;  3HOT A;  3NVK A;  4EAH D;  1NGA A;  4JAX A;  3A0I X;  1P8Z A;  2A5X A;  4CZL A;  4IWV A;  3AGK A;  4B1Y B;  3BF3 A;  2KHO A;  2VGM A;  3UKU B;  1HKB A;  3LDQ A;  3DWL A;  4XH1 A;  4WQ4 C;  1YJW N;  4PHT X;  4K42 A;  1ZXO A;  5F1X A;  4F9O A;  1X9J A;  1E4F T;  1SS6 A;  4FWQ A;  4BRK A;  3QFU A;  3CD6 N;  2FLO A;  1VQK N;  1NGF A;  2YHY A;  5AQY A;  4YOU A;  1QVG M;  5HL7 L;  1K8K A;  1X3N A;  3ZET A;  3SAF A;  1GLB G;  3GOI A;  4H0X B;  2P9I A;  4IDH A;  3UB5 A;  4BRQ A;  3F9M A;  1VQM N;  1MWK A;  4CBX A;  5BRD A;  2QWR A;  2ZGZ A;  4FOI A;  4BR4 A;  3HRG A;  4WFN L;  1IJJ A;  5AQK A;  4CD3 A;  2E2N A;  3LDP A;  3ATV A;  4YOR A;  4JKD A;  4BC5 A;  1YF5 L;  3FZH A;  3IDH A;  4IEE A;  4B1V A;  5M1K A;  3CCR N;  1VQ5 N;  2H3G X;  2IVP A;  3J7Z O;  3OW2 M;  4JK7 A;  2QWP A;  3O5B A;  3ID6 A;  2AP1 A;  3AY9 A;  4RCH A;  5AQX A;  5AQM A;  3VEZ A;  2ITM A;  2P9N B;  1K8A O;  5AQZ A;  2ASM A;  1VQL N;  2WUS A;  3OBW A;  2CH5 A;  2W40 A;  1HKG A;  3MN7 A;  4A5B A;  2D0P A;  2GWJ A;  4KH6 A;  4DB3 A;  1BDG A;  2RHK A;  5AQR A;  3H46 O;  4OO1 J;  1YJ9 N;  4H0T B;  1BO5 O;  3MCA B;  3EE9 A;  3O6W A;  4HWI A;  4CJ7 A;  1YI2 N;  4H5V A;  1QQM A;  4J8F A;  3W0L A;  2FSN A;  1S3X A;  2I7N A;  3WXJ A;  1Q82 O;  4WYB A;  2QWM A;  4XH5 A;  1HKC A;  3P39 A;  2NRX A;  3FLC O;  5C10 A;  1GLL O;  4AF1 A;  3C0B A;  4JK8 A;  4BRG A;  2ZWH A;  5AZJ B;  4BGB A;  4YOV A;  1NGH A;  4C23 A;  3CER A;  3CCL N;  3FR0 A;  5E26 A;  1GLC G;  5B8H A;  4JHD B;  5KQ8 A;  2OTJ N;  4B1W B;  3CCE N;  3D6R A;  3Q7B A;  3DLL L;  3WXM B;  4QS8 A;  5JLF A;  4FWL A;  3VOV A;  4UY8 O;  3P38 A;  2V7Y A;  4B1X B;  4BR7 A;  3TSP A;  3NVM A;  4BRM A;  5GAH P;  3OBY A;  4FSV A;  2AA4 A;  3IUC A;  1KC8 O;  5AQN A;  2QWN A;  1RGI A;  1ATR A;  1MWM A;  4KH5 A;  3D2E B;  4Z94 A;  5JIC A;  5BPM A;  5I9E B;  1VQO N;  4FWM A;  4YOW A;  1EO1 A;  2HF4 A;  3SBG A;  3ULE A;  3G71 N;  4LC9 B;  4H03 B;  5BRF A;  4WQ4 A;  1D4X A;  2P9P B;  3ENB A;  1DEJ A;  2NNW A;  2BH1 A;  3CJC A;  2VCP A;  5JVH L;  3EKU A;  2RE2 A;  3TU5 A;  4IXC A;  2NRW A;  4FWR A;  5M1O A;  1VQ7 N;  5FPM A;  1BWF O;  3H3O B;  3CC2 N;  3CJA A;  1NGG A;  5KQD A;  1U6Z A;  4BRI A;  3DJC A;  3RSE B;  5MLC Q;  2HBK A;  4ISF A;  3MK6 A;  2P9L B;  5C0Y A;  3QBW A;  3OA9 A;  2IVO A;  5GIN A;  1KD1 O;  3WEE A;  1KAZ A;  3ENO A;  2W41 A;  4H0V B;  2ASP A;  3HI0 A;  4JD2 B;  4JKA A;  4O5F A;  2OAN A;  5EOY A;  2WFB A;  1VQP N;  3F5T A;  2QW9 A;  1JCG A;  4NB4 A;  3EN9 A;  4FOE A;  3R9P A;  2QA4 N;  3M5R A;  5AFU H;  1VQ8 N;  3C6H A;  1U2V B;  1QVF M;  1WUA A;  4EFH A;  1VQ4 N;  4WFA L;  4IOC L;  1T3V A;  1NLV A;  3SJH A;  4ISE A;  5LJW A;  4NO7 A;  3D2F B;  4A57 A;  3CJ7 A;  2IVN A;  5AQG A;  4FWN A;  3E9P A;  2ZJQ L;  4EHU A;  3A5O C;  4JKC A;  3I33 A;  2YHW A;  3QDK A;  4DHY A;  3VEW A;  1Q7Y O;  4K41 A;  3O1B A;  2GUP A;  1ILY A;  3BUZ B;  4L3Q A;  3VET A;  3MWP A;  2A40 A;  3CJ9 A;  5BN9 A;  3VGK A;  4U67 L;  3CET A;  5JMV A;  1BA0 A;  3E9L A;  3JS6 A;  5AZI B;  1XC3 A;  4IJN A;  3O8M A;  2D0O A;  1XUP O;  3T7Z A;  5M1N A;  2KKZ A;  1LCU A;  3VES A;  3CXC M;  4BVP A;  3D7E O;  3ZX3 A;  3VF2 A;  3DAW A;  1YIJ N;  5AZJ A;  2V7Z A;  3A5M C;  1SZ2 A;  4DCH A;  1KAY A;  3I8B A;  1S22 A;  2E2Q A;  5H1S Q;  3A5L C;  4BC4 A;  3SMP A;  4YDU C;  3UKU A;  4BR9 A;  1S72 N;  2ZF5 O;  3VGM A;  2NRT A;  4KBO A;  4K43 A;  2E1Y A;  1KXP A;  5KPZ A;  3EL2 A;  4MLE A;  3MX2 A;  5BRE A;  3VEO A;  1P90 A;  1W2B M;  4NLB A;  1QZ5 A;  3CF5 L;  4O8U A;  1TUY A;  3BP8 A;  3FFK B;  1J6Z A;  4I6M B;  1QQN A;  2Q97 A;  3R3L A;  1Q18 A;  3EO3 A;  5TKW A;  1TYQ B;  2FSK A;  2A42 A;  4JKG B;  4A59 A;  3CC4 N;  4CZI A;  3C7N A;  1M90 O;  4C1N I;  4EIA A;  2HOE A;  5BRH A;  1YIT N;  4H0O A;  1QHA A;  3GBT A;  1BOT O;  3GE1 A;  1W97 L;  3R8E A;  1ATN A;  3WXK A;  4MO4 A;  1Q86 O;  4K25 A;  3IKM A;  3CCS N;  2GX9 A;  4GNI A;  2E1Z A;  3TTF A;  3LM2 A;  5BPN A;  3WXI A;  2YX6 A;  3EKS A;  4G9Z A;  2P9N A;  4IO8 A;  3AAQ A;  3IMX A;  3DXK B;  3O08 A;  4ILH A;  4BRE A;  3ATU A;  3HOS A;  1ESV A;  1C0F A;  3S41 A;  3L4Q A;  4WCE L;  3KVG A;  5JVG L;  4WQ5 C;  1N8R O;  4A61 A;  1KAX A;  2A3Z A;  2HST A;  2QXL A;  5E84 A;  4BRA A;  3HM8 A;  2NRZ A;  5DM6 L;  2CGL A;  3AAP A;  4Y0W A;  1NGC A;  3P4I A;  5F0X A;  3GDQ A;  1H1V A;  2P9K A;  1CZA N;  3L6Q A;  5AQH A;  2P9S B;  3KWG A;  5AQQ A;  4YOT A;  3SAH A;  2YCH A;  4CZJ A;  1XQS C;  1HLU A;  3CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...