4BRLA

Legionella pneumophila ntpdase1 crystal form iii (closed) in complex with transition state mimic guanosine 5'-phosphovanadate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 120
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brlA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brlA02
1KAZA 1QZ6A 1YVNA 2ASMA 2P9KA 3D2EA 2IVPA 5AZIB 5F1XA 1GLAG 1RDWX 1WUAA 1GLBG 2D4WA 3B8AX 3CHWA 2GELA 4M7YA 4FOEA 3QFUA 5JLFA 4BVPA 3C7NA 2Q31A 3BF1A 1GLJO 2E2QA 4BQLA 1U2VB 5EY4A 2A5XA 3LM2A 4BRAA 3WT0A 1KAXA 4WQ4C 1E4FT 3FZLA 1CZAN 3HBTA 3UKRB 3MN6A 2E88A 3VEWA 1BU6O 2I7NA 3LDPA 3MDQA 1XQSC 1BUPA 4ISFA 3WXJA 3CQYA 5AQMA 5EX5A 3O6WA 4NB4A 4M7XA 4RWTA 2P9PB 4FWSA 3CJCA 1NGBA 4FO0A 5AQTA 5JICA 1NGIA 5AQHA 4H5RA 5KQDA 2Q0UA 3C0BA 4Z94A 3FE1A 3CJAA 1K8KB 1NGDA 2HF4A 2V7ZA 4A2BA 1ZBSA 3D7EO 1E4GT 3L0QA 5BPLA 4BR2A 2QWMA 4BRPA 1NGHA 5LY3A 1HLUA 2Q97A 2P9SA 3CETA 1ATNA 3H6EA 4YDUC 1T6CA 1S3XA 3H45C 4K43A 2FLOA 3G25A 3EN9A 3P4IA 2P9LB 4O5FA 4FPAA 1T6DA 1ZC6A 2YJFA 1H1VA 4K41A 3AARA 3QBXA 3QFPA 2I7PA 1WOQA 5AQNA 1GLDG 2P9NA 4FWKA 5AZJA 1IG8A 4IJAA 1GLCG 1HPMA 4EAHD 3ZEUB 3DXKA 3VESA 2DPNA 3BEXA 4FWQA 1HJOA 4FOIA 4BC3A 3DXMB 5BR9A 4RCHA 3ATUA 3ENOA 4JN4A 3W3DA 1HKBA 5EVZA 3R8EA 5JLHA 1LOTB 3CJ1A 4JHDB 4H0VB 3QMLA 2ZF5O 4GNIA 1BA0A 2QWPA 4JHDA 2IIRA 3A8YA 2GWKA 4CZIA 1SAZA 3QDKA 5I9EB 1NGJA 4BGAA 1NGCA 2D1KA 5ADXA 5AQQA 5AQOA 4BC2A 3U8XA 4B1YB 5BN8A 4CZJA 4CZKA 4BRQA 3FZHA 5AQRA 4H5VA 2QWOA 5KPTA 5FPNA 4DCHA 3VENA 3TU5A 4BG9A 3MMVA 4BRMA 3KVGA 2NZTA 3LDLA 3SJHA 3GL1A 3FFKB 1V4SA 4JNEA 4I6MB 3GDQA 1OKJA 2OANA 2NLXA 4H5WA 1HUXA 2E1ZA 3BP8A 3AY9A 3BF3A 3CJBA 1X3MA 3A5LC 3A5MC 5BN9A 4WYBA 3VGMA 2YJEA 3MN5A 2KHOA 3LDQA 2QWRA 4I6MA 3ZETB 4AM7A 2P9UA 2A3ZA 4RTFD 4BRKA 4WQ5C 1BO5O 1XC3A 2HF3A 2A40A 3U4LA 3A5NC 4MO5A 4EFHA 3EKUA 3ZEUA 3OHRA 2HOEA 1NGFA 2P9UB 1NWKA 3I33A 3ULEB 2QXLA 2V52B 4CBUA 3O1BA 4H0TB 3HSCA 2CGJA 4M63C 1D4XA 2GUPA 1IJJA 3HM8A 4LC9B 4IXCA 3VF2A 4K42A 2D0OA 1NGGA 3EO3A 3U9ZA 4PKHA 1JCFA 3O80A 3O1WA 5BRFA 4BG8A 3FGUA 1U2VA 3AAQA 2VYPA 2YHYA 3EL2A 2GWJA 3F9MA 1XUPO 3H3NO 4BGBA 2FSNA 4B1UB 4B1XB 4FL9A 1ATRA 3HI0A 5AQKA 4MO4A 3MN9A 3HZ6A 1KAYA 3MK6A 5BRHA 2ZWHA 2E8AA 5BPMA 1ESVA 4EHUA 3LDOA 1SQKA 4BVOA 2Q0RA 1BG3A 2P9LA 5E26A 3WXKA 5KPZA 3ID8A 1EQYA 2P9PA 3GBTA 3ZX0A 1V4TA 3MN7A 5FPMA 2D0PA 2AA4A 3WUHA 4DB3A 3IUCA 1U6ZA 3CJ9A 2IVOA 1YUWA 4BR4A 4EHTA 3JXUA 3VOVA 1BWFO 3DXMA 4FPBA 4L3QA 1C0FA 1X3NA 4CD1A 4C23A 2ZGYA 4WQ5A 4IZ9A 2GTDA 3DJCA 4J8FA 4HWIA 4IO8A 1YXQA 2FXUA 3VF4A 4H03B 3GE1A 4H0PA 2E2OA 2FSJA 1GLEG 1GLFO 2CH5A 1ATSA 5AQUA 5ELZA 3GG4A 2UYTA 4BC4A 4CBWA 3VEXA 5AQSA 2P9NB 5FPDA 2CGKA 4WQ4A 2YHXA 2CH6A 3AAPA 1S22A 2QWLA 4BROA 3L6QA 5BRDA 4CJ7A 2GEMA 3UKRA 4B9QA 3SMPA 4BREA 3EKSA 1LCUA 3IMXA 4XEIA 3IFRA 3QB0A 4CBXA 4CZEA 5CE3A 2J4RA 2PAVA 3L4IA 4FWPA 1YAGA 3S41A 3FR0A 3HTVA 3ULEA 3R6MA 1P8ZA 4K25A 5AFUA 4H0XB 2ITMA 1QZ5A 3FZFA 3W0LA 3D2FB 2QW9A 3VGKA 1MWMA 4A62A 2WUSA 1KXPA 5E84A 4MLEA 3WQTA 4BR5A 4PL7A 4CZFA 4AM6A 2Q1NA 3ZETA 1QQNA 3FZKA 3UKUB 1BOTO 3LDNA 4YDUA 5JMVA 1Z6RA 4CZGA 5KQ8A 4E1JA 4BC5A 4BQZA 3O8MA 1NLVA 2P9SB 4FWLA 3R9PA 4PL8A 2A41A 2V51B 3I8BA 4B1WB 3LM9A 2QWQA 3A5OC 3QICA 5AZJB 3H3OB 1TUUA 5F0XA 4B1ZA 2YI1A 5AQYA 1BDGA 2W40A 5FPEA 3D2EB 3VERA 5ADXH 5B8HA 2P9KB 3CJ7A 4CZHA 3CIPA 1G99A 2BUPA 2E2PA 3WQUA 4BRNA 4H5NA 4H5TA 1MA9B 1Y64A 3WXIA 4CI6A 4O8KA 4FWOA 2E1YA 5AQWA 1DKGD 4JD2B 2A6AA 1HKCA 1K8KA 2Q36A 4DQ8A 3VPZA 1RGIA 4DHYA 1Q18A 4XH5A 5AR0A 5BPNA 2FSKA 1MDUB 2P9IB 4QS9A 5KPRA 3DXKB 4QS7A 3VGLA 3WEEA 1QQOA 2F9TA 3VF6A 1JCEA 2VCPA 4BRIA 4IWVA 3ATVA 4GY2B 1JCGA 3H46O 2HMPA 5AQGA 4ISEA 4QS8A 1J6ZA 2E20A 4BRHA 1QHAA 1TUYA 3H1VX 3ENHA 4BRCA 2CGLA 4PKIA 3VEVA 3JS6A 5LJWA 1NBWA 4BR0A 2PBDA 4BRFA 4BRLA 3FLCO 4JAXA 1T44A 2EWSA 2YHWA 2NRHA 4CZMA 5AQZA 1NGEA 2H3GX 5AZIA 2ASOA 1DGKN 3UB5A 2P9IA 3SMSA 2FF6A 3SLCA 4HTLA 1TYQA 4A61A 1NGAA 3H1QA 4FWRA 1SZ2A 3M3ZA 3RSEB 4CD3A 2A42A 3A0IX 4F9OA 5AQPA 5AQXA 3ZX3A 1TYQB 3VEOA 1MWKA 1NMDA 1HX1A 4Y0WA 3VETA 2V7YA 2AP1A 3D2FA 3GOIA 5F2RA 3ZX2A 5AQLA 2BTFA 1C0GA 3BUZB 1DEJA 3KHYA 4A2AA 4BRGA 3DWLA 5BREA 4MLHA 2Q2RA 4EIAA 3C7NB 1ZXOA 3EZWA 3J8AA 4IJNA 5AQIA 5LJVA 1R59O 4FWNA 1GLLO 3SK3A 1BA1A 1QQMA 3FZMA 5EXWA 5AQFA 4B1VA 2E2NA 3O4WA 4CZLA 5TKYA 2F9WA 3MCPA 5EOYA 3KZBA 4XH1A 2QM1A 3M1FA 5AQVA 3WXLA 3VEZA 3RSEA 3UE5A 3TPQA 1Z05A 1X9JA 2ZGZA 4XH4A 5AFUH 1HKGA 4BR7A 3O5BA 4PKGA 4H0OA 3O08A 5AQJA 1NM1A 4FWMA 4BR9A 2FF3B 1RFQA 3WEEB 3CI5A 3IDHA 2QWNA 4JD2A 3DAWA 3M6GA 2YCHA 3U9DA 2IVNA 4FSVA 4BRDA 2W41A 4ISGA 3CERA 3LL3A 2ASPA 2VWBA 3UKUA 4H0YB 3CQXA 3QBWA 3VEYA 4NO7A 4KBOA
chains in the Genus database with same CATH superfamily
1VQKN 2XY5A 2ASMA 1RT6A 1YITN 1R0AA 3NCIA 3NE6A 3MWTA 1RDWX 1GLBG 3CHWA 3S3NA 3P83D 4LH5A 5J2PA 4BVPA 3BF1A 1GLJO 1NJYA 3O3HA 4CGHA 4BQLA 1U2VB 5GAEP 3AVIA 4CK3A 3WT0A 3NFAA 4WQ4C 1G15A 1KFDA 2E6LA 3EY1A 3HBTA 3WNHA 2F4VK 3QIPA 3OYBA 2ZJQL 3MXMA 3S3MA 3OYFA 1KTQA 4ISFA 5EX5A 4FVUA 3N4QA 3O6WA 4NB4A 4M7XA 4WFAL 5C24A 4NCAA 3K9KA 2P9PB 4BACA 4QOZB 2HW3A 4DR7K 3ZLJA 5JICA 4LF8K 3FE1A 3CJAA 5HRPA 1ZBSA 4E7IA 3PX4A 2VGNA 5BPLA 2QWMA 5LY3A 2B4JA 2ZJRL 4F8RA 2PYJA 1S3XA 1TKTA 2QKBA 2P9LB 1Q86O 4GV6A 4FPAA 3DLBA 4QAGA 1GOBA 3C94A 2Z1HA 4O0JA 3AARA 5AQNA 1TK0A 1NKEA 3VQ4A 5CHIA 1IG8A 1WSJA 3VESA 1YJ9N 2KLAA 3TAEA 3DXMB 1HJRA 3IAYA 3AVGA 4RCHA 1RILA 1HKBA 4OKJA 5JLHA 3IRXA 4JHDB 1M1KO 4C8NA 4NXNK 5J2NA 2KKZA 3J7ZO 4ILJA 1NJZA 1BA0A 4CJUA 4JHDA 4WCEL 3A8YA 4JKFA 4Y1DA 1BQNA 3QDKA 4KTWA 4RW9A 4KTQA 4Y1CA 3U6FA 5AQQA 4LH4A 5AQOA 3OVNA 3SUPA 3OBYA 4PWDA 3MX5A 5AQRA 4OPKA 3DOKA 4H8KA 4E1NA 3HVRA 4E7JA 4LF6K 4OPJA 4ELUA 4BWMA 2O8FB 3NF8A 4DTNA 1KSPA 3GL1A 4EZ6A 3MWPA 5J2QA 1SS6A 3FFKB 3D0PA 4JNEA 4CEAA 3GDQA 3AVCA 4DFKA 3CXCM 3L8BA 1HUXA 3BF3A 3CJBA 3A5LC 4Q0BA 3CFOA 2HNDA 2NRXA 5IT9O 2QWRA 4I6MA 4DV7K 2HNYA 1XI1A 1D9FA 3AVJA 3PSIA 1BO5O 4BE2A 2HF3A 1KFSA 3ISNC 4B8CA 1X9WA 3EKUA 4V19S 3LDSA 1C1BA 1NWKA 3I33A 2QXLA 2XY6A 4FM1A 3CCRN 3HM8A 4LC9B 3SQ1A 2HHUA 2IS3A 3VF2A 3SUQA 1VQ4N 1A5VA 3T19A 4N56A 4FCYA 3DLEA 1OH6A 5BRFA 1U2VA 4AF1A 1KRPA 1ASVA 3PX6A 2X78A 1ATRA 4MO4A 2O4GA 1HNIA 1RBVA 4NCBA 4KHPK 3MAQA 3OTOK 4J2DA 4HUEA 2OZMA 5BPMA 1RT5A 2VG5A 3DOLA 4AQYK 1OVQA 4TSXA 4RW7A 3VQ7A 1BG3A 1LWCA 1XWLA 3ID8A 3THYB 3NGIA 3ZX0A 3V9SA 2R7YA 3SAGA 4DB3A 3HK2A 4YY3K 5M1QA 3CJ9A 4EHTA 1YUWA 4JKDA 3JXUA 1BWFO 1X3NA 4CD1A 4C23A 1JL2A 2GTDA 4N47A 4I9QA 4DU4A 3OS1A 2DTUA 2O8FA 3O9TA 4DKWA 1GLFO 3SPZA 4BC4A 4CBWA 3QEIA 2YHXA 1JJ2M 2E4LA 1VQ7N 3UKRA 4BDZA 4B9QA 4DF4A 1W0HA 1O13A 4XEIA 4YORA 2NNWA 4CBXA 5GADP 4CF9A 3CCEN 3EE9A 3SI6A 3HTVA 4U7BA 4JKHA 4LF5K 1DT9A 4C8OA 4A62A 4CJ3A 2WUSA 5E84A 1VRTA 3QNOA 2P51A 4PL7A 1RCHA 3NF6A 1VQ9N 3VQDA 1B9FA 3UKUB 4CW7B 3LDNA 4E0DA 5KQ8A 4C8LA 1TV6A 1NK4A 4E1JA 4BC5A 5GIOA 1WSGA 1NLVA 4FWLA 2V51B 4B8AB 5JVGL 2UXDK 4B1WB 1C1AA 3EZ5A 3QICA 1HYSA 2YI1A 4E89A 4Z4FA 1YTUA 4KRFA 3VQQA 1BDGA 3MEDA 1K73O 5FPEA 3VERA 3CJ7A 3KWIA 2O8DA 1G99A 3O4NA 4IG0A 1MA9B 2VWKA 3ASMA 1W7AA 5AQWA 1VSHA 2NRVA 2NRTA 2PZSA 1UWBA 3VPZA 4XIUA 3CFRA 4DHYA 1ZBHA 4XH5A 5BPNA 4CIEA 1MDUB 4QS9A 3DXKB 4QS7A 3OJUA 3VGLA 2YNGA 1QQOA 2RE2A 3VA3A 3OS2A 1JCEA 1TL1A 3L4QA 3VQBA 2Y1JA 3V1OA 1JCGA 1BGXT 1NK9A 2HMPA 3I55N 4FXDA 5FRNA 4FLZA 3HP9A 1S6PA 4LFCK 4BDYA 3V4IA 5LL6Z 2HVIA 1EWRA 3ZSXA 4DU3A 4AHVA 4HCCA 4PKIA 1NBWA 4BRLA 4DTXA 3CQ8A 3B6OA 1U49A 1S9EA 1N32K 3RWUA 1L5UA 1S1TA 4CZMA 2QA4N 2FBYA 3TARA 4IKFA 4KHWA 2WTUA 2P9IA 4DSKA 3QEPA 1KQSM 4HTLA 1TYQA 3M3ZA 1SKRA 1S1VA 3DLRA 2A42A 1TYQB 4DQIA 4Z4IA 4Y0WA 3MEGA 2Z1GA 3VETA 3AO3A 3HPOA 4CJ5A 3D2FA 5F2RA 4HHTA 1WBDA 4IFYA 1BQMA 4BE0A 1C0GA 3K5OA 5H1SQ 4CEQA 1CZBA 4NYNA 4BRGA 5BREA 1RTDA 3QEWA 3C7NB 5LJVA 1CLQA 1S1XA 1QQMA 2E6MA 1WSEA 3VMFB 4B1VA 5TKYA 1K6YA 4CHZA 3E9LA 3TAMA 4K0KK 1YI2N 4O4GA 4CJFA 3OA9A 2QM1A 3SBTA 5AQVA 4CF0A 3ZSVA 2X6SA 2QK9A 3VEZA 3KK1A 1RDAA 4DS5A 4KHNA 2QKKA 4M3TA 4IOXA 1HKGA 4AH9A 4BR7A 3CM6A 3CCUN 4FWMA 1UAXA 2FBXA 4DV2K 4AHTA 3WEEB 3IDHA 1HPZA 2RN2A 3DYAA 4FM0A 4JD2A 3CYMA 4CFCA 4NCGA 4FSVA 3T1AA 4BRDA 3LL3A 2VWBA 3PSFA 1IKYA 3E9PA 4EP5A 4KBOA 1KAZA 1YVNA 4GVMA 1QSLA 1GLAG 1TAQA 1WUAA 1K9MO 2D4WA 3B8AX 4YOTA 4YFUA 2GV9A 3IS9A 2OCEA 4FW1A 3CCSN 4DUZK 4CFDA 3AA2A 3C7NA 2Q31A 3NVMA 1KVBA 3LM2A 4QCLA 1KAXA 4O8UA 3DLLL 5LMNK 3UKRB 1RBUA 3MN6A 4DF8A 3DI6A 1BU6O 2I7NA 3M5RA 3S3OA 3LDPA 2NRWA 3MDQA 4LY7A 4KPYA 3WXJA 3CQYA 4DR5K 1C0UA 4DQPA 4FWSA 1XMOK 3QO9A 4RW8A 5KGWA 1QE1A 5DM6L 4DR6K 4FK2A 1NGIA 5TKWA 2BDPA 3P38A 2Q0UA 4IFEA 3OYDA 4Z94A 4X64K 5GAHP 1RDUA 3AVHA 1K8KB 2V7ZA 4WFBL 1E4GT 3O9RA 4CHYA 3L0QA 4BR2A 5EU7A 4HUGA 5DMRA 1HLUA 3CETA 4KHYA 3H6EA 1JXEA 3T7ZA 3H45C 4K43A 2FLOA 3KK2A 3EN9A 4IG3A 4B9MA 3LPTA 2I7PA 1WOQA 4FLXA 1KLMA 1GLDG 3TWHA 4B9NA 1HNWK 3L2VA 1DTQA 4FWKA 3SV4A 1B9DA 4OGCA 3RMDA 3ZEUB 3DXKA 3DRRA 1HJOA 4C1NK 4DG1A 3W3DA 3VN5A 3R8EA 1U4BA 2P1JA 3R3LA 1S1UA 4DTOA 4FLTA 4GNIA 3RRHA 3SQ4A 4Z4CA 3ALYA 2QWPA 4JI0K 3IKMA 1VSDA 4A59A 2IIRA 1BISA 4CZIA 3H08A 4IFVA 2O4IA 4BGAA 3ZSQA 2D1KA 5ADXA 4DS4A 1QVGM 4BC2A 2A1RA 4CK1A 4H5VA 2QWOA 5KPTA 4BG9A 3MMVA 2NZTA 1J9AA 3SJHA 4A5BA 1V4SA 4I6MB 2XRIA 2OANA 1P90A 2KFZA 2QI2A 2NLXA 1T03A 4E1MA 1X3MA 1Z26A 5BN9A 3AGKA 1JLBA 3D6RA 4DV4K 2YJEA 3PIOL 4DTSA 3K2PA 3LDQA 1ASWA 4FJ8A 1B92A 1KVCA 4CJQA 3KWGA 2A40A 3G0ZA 4M3YA 1ZYQA 2HOEA 4CF1A 1ILYA 2P9UB 3ULEB 3O9QA 2V52B 4OLBA 3O1BA 4H0TB 3PY8A 3HSCA 5CZ1A 2CGJA 4BE1A 4M63C 1IJJA 2KZZA 2EX3A 2HBMA 3K9JA 3KLFA 3CC7N 3I0SA 3SQ0A 3ZSWA 3EO3A 5CY4A 3U9ZA 5A2QO 2ZD1A 5GINA 2XY8A 1D8YA 2HMIA 3CM5A 4DV3K 3FGUA 3AAQA 4CJVA 3L2WA 2G8HA 2GWJA 4B1UB 2VG6A 4FW2A 5AQKA 4NXMK 3MN9A 3G71N 3RR8A 3HZ6A 4YNQA 1XNRK 3MK6A 4C8KA 5BRHA 1VSLA 3LP2A 1IG9A 5JVHL 2E8AA 4NYFA 4EHUA 3LDOA 1SQKA 4BVOA 3BGRA 4DR2K 3TTCA 2P9LA 3WXKA 5KPZA 4B9SA 4JKAA 1EQYA 3HM9A 1IKVA 1V4TA 3IG1A 3AO4A 3MN7A 5FPMA 3PIPL 2D0PA 3WNEA 1NJWA 3WUHA 4B9VA 3IUCA 4CHQA 3CCLN 3DXMA 4FPBA 4L3QA 1C0FA 4B3RK 1RBRA 5C15A 4IZ9A 3DJCA 4HWIA 4IO8A 4H03B 2IGIA 1VK0A 4H0PA 4DFJA 1RTIA 5HOOA 4JI2K 3J81O 4KFBA 2CH5A 1ATSA 1LAVA 5ELZA 2UYTA 5FPDA 1JLEA 5AQSA 2P9NB 1WB9A 4FJKA 3AAPA 1IH7A 3AO5A 1SL0A 5HL7L 5BRDA 4CJ7A 4UY8O 3SMPA 4BREA 3IMXA 1LCUA 3TTFA 4CZEA 4KB0A 2PAVA 3L4IA 4FWPA 1LWFA 3S41A 3OYCA 4ZHRA 4E7HA 3NGZA 3R6MA 3ZSZA 3CCMN 4FM2A 4K25A 5AFUA 1JLFA 3FZFA 1EX4A 2YV0X 1Q9XA 1MWMA 1ZBUA 4MLEA 3NAEA 4BR5A 4YOUA 4CZFA 4DR3K 2Q1NA 3ZETA 4LF7K 3AVBA 3L2RA 3C6TA 4YDUA 3HL8A 5JMVA 1NK0A 3LAMA 1Z6RA 4IOAL 3CMEN 4MDAA 3K59A 4BQZA 2P9SB 4ID1A 3R9PA 4CJPA 2A41A 3I8BA 3R1XA 2HHQA 3H3OB 1EWQA 3K58A 2HHHK 3J7YP 3PO4A 2G8VA 3AVNA 3HO1A 5T7BA 2W40A 4CESA 4CJKA 1KD1O 3P5JA 3D2EB 5ADXH 3KKSA 5B8HA 2PY5A 2YKMA 4FJNA 4CZHA 2BUPA 2E2PA 3WQUA 5KRTA 4BRNA 1JLCA 3P1GA 4H5TA 3NVKA 4I2PA 4BY9C 4DQQA 4LF9K 2GUIA 4RG8A 4KREA 4IDKA 4GV3A 3C65A 5JS1A 2A6AA 1K8KA 3VQ6A 1GOAA 1Q18A 1NU0A 2PFUA 1HNZK 2FSKA 2UXBK 3SNNA 1EKEA 4Z4GA 4JEPA 1XC9A 1SKSA 2F9TA 4CEBA 4BRIA 2GBZA 3ZSRA 4CJRA 3M8SA 4F3OA 1VRUA 4DMNA 4KI6A 3AGRA 3QERA 3VQ9A 4FJIA 1YJNN 3LPUA 3V9WA 1WNSA 4BRCA 2CGLA 1QTMA 4AILC 2DFEA 3L2UA 4BR0A 1BHLA 3RMBA 4YOXA 3HP6A 2JGUA 2WBNA 2EWSA 4AHUA 2YHWA 1VQ5N 4KH4A 4DV5K 4W5OA 1NGEA 2H3GX 3I8DA 3AO1A 3OYHA 4GKKK 2XHBA 1YT3A 4FWRA 5E41A 3RSEB 5KTQA 3MECA 3CG7A 4CCHA 3A0IX 3TR8A 3VQEA 1J54A 3SAFA 1HYVA 4LSLA 3VEOA 3ZX3A 4HUFA 3G10A 1VQPN 4O44A 3HVTA 3VQ8A 4FZXC 4M3ZA 2ZQBA 3ZCMA 2V7YA 2AP1A 3HSTB 1IKXA 2HHTA 4FJLA 2O8DB 3LP0A 4A2AA 4Z4HA 4A57A 1C1CA 3HYFA 3EZWA 4IJNA 3N4PA 5AQIA 3OJSA 2BE2A 1EXQA 3LAKA 3JYTA 1WSFA 3O4WA 2FBTA 2D0BA 3MCPA 5EOYA 1S5JA 1OH8A 1HQEA 3WXLA 1C0TA 3RSEA 4KV8A 1S1WA 4LFBK 1Z05A 4X65K 3QNNA 5MLCQ 3OBWA 5AFUH 3C6UA 3O5BA 4CGGA 4PKGA 1EO1A 3THWA 1KLNA 3CCJN 3WNFA 4OPHA 3HPGA 2FF3B 3LZIA 3C6AA 4FZZA 3P39A 3Q7CA 3OYEA 3KK7A 3A2FA 5M1PA 4FYDA 1RTHA 1FKOA 5IWAK 3MEEA 3K5MA 3NH0A 1YHQN 1W97L 4ZTJA 1Q9YA 3HOSA 2O8CA 1WLJA 3CQXA 1NK6A 3QBWA 4NO7A 4OKEA 4YOWA 1QZ6A 3I56N 3CPEA 3TSQA 4JK7A 5K14A 4CF8A 1N5YA 3DLHA 3VQCA 1NOZA 4M7YA 3AA5X 4IEIA 5JLFA 1ZBFA 1RTJA 3KIOA 3MX2A 4DTRA 3F73A 2E2QA 4KH5A 5EY4A 1FK9A 2A5XA 4BRAA 3HT3A 4F2RA 4ILHA 5CR4A 4CHNA 1M90O 4C8MA 5AQMA 5M1NA 1K8AO 4JK8A 1FJGK 4JI6K 4DUYK 5FRMA 1T3VA 3Q7BA 1NGBA 3ZT2A 5AQTA 4M3XA 5AQHA 4H5RA 5KQDA 2RKIA 4DQSA 3WNGA 3HOTA 3KD1E 4CK2A 4JS4A 5HRNA 4A2BA 3D7EO 1A5WA 1SUQA 2JWKA 5KRSA 4BRPA 1NGHA 3VQPA 4I2QA 3TTDA 2P9SA 1NKCA 4J2BA 4YDUC 1T6CA 1S6QA 1TGOA 3J7AP 4E19A 3P4IA 4O5FA 3SCXA 1L3VA 1HMVA 1T6DA 1ZC6A 2YJFA 4K41A 4B3OA 2IDOA 1C6VA 2P9NA 3C6HA 3B6PA 4MQ3A 5AZJA 1N36K 1SL2A 4IJAA 4CGFA 3BY5A 1GLCG 1HPMA 2RF2A 3L3VA 3KJVA 3M8RA 3CCQN 4EAHD 3P31A 1IV0A 3BEXA 4FWQA 4CEEA 4FOIA 3ATUA 4JN4A 3ZSYA 4M3UA 5EVZA 3DM2A 1LOTB 3CJ1A 4PHTX 1TKXA 3NF7A 3QMLA 1LW0A 2ZF5O 4ID5A 2OPQA 3SUNA 3AVKA 3M8PA 2GWKA 1Q82O 1SAZA 3RVCA 1NGJA 4CJTA 4CEDA 4F4KA 1NGCA 1HR0K 5CZ2A 2WOMA 4B1YB 5BN8A 4CZJA 4CZKA 3C95A 5CYMA 1TK5A 3FZHA 3T69A 3QETA 2GX9A 4DCHA 2JWLA 3SYZA 4BRMA 3TSUA 3KVGA 1OH7A 2DFHA 3J80O 5BR8K 1TK8A 1OKJA 2Z1JA 4ILGB 1ASUA 4H5WA 2HVHA 5HP1A 2E1ZA 3BP8A 1IO2A 3NMUA 1X1PA 3A5MC 4KKOA 4WYBA 3AO2A 3VGMA 2IAJA 1I94K 3MN5A 2KHOA 4E7KA 5I3UA 3KLHA 5FROA 4JS5A 1JLQA 4RTFD 4BRKA 4E3SA 1VSIA 4WQ5C 4WE1A 2ZE2A 3LP1A 4ICLA 4GW6A 2P5OA 4MO5A 1U47A 3ZEUA 3OHRA 3TSPA 2W6LA 3EYZA 4DSEA 1D5AA 2QEXN 1D4XA 3T3FA 4AHSA 1JKHA 1NOYA 2DFFA 3EEQA 2I5JA 5J1EA 4DWIA 1NK8A 5SZTA 1W9HA 3SPYA 3TI0A 2KW4A 4DR1K 3O1WA 4CFBA 1BL3A 1Q7YO 2YHYA 3EL2A 2A1SA 3F9MA 1XUPO 3H3NO 2FSNA 4FL9A 2Q3SA 1IKWA 3KLIA 3RR7A 5HRRA 4JLHA 3SAHA 4FLUA 4OPAA 2YNIA 4J2AA 3VQ5A 4KH6A 2QTDA 3JAMO 2P9PA 4Z0UA 4NLBA 1BI4A 1RT4A 1LWEA 2AA4A 2WFBA 1WN7A 3RTVA 4WF9L 1NG9A 4BR4A 2OTJN 3VOVA 2IOCA 1WSHA 5LMUK 4DFPA 4FZYA 4JKGB 5M1OA 3HPHA 1RNHA 4H4MA 3F9KA 1VSKA 4J8FA 4JRPA 3TAFA 4B9LA 2FXUA 3ZT3A 1JXBA 2E2OA 4LD0A 1GLEG 2FSJA 1HNXK 1D9DA 2WONA 5AQUA 3PV8A 3KTQA 1XHXA 4YHHK 2CGKA 1S22A 4LSNA 1LV5A 3L6QA 4MDBA 2VWJA 4ZTFA 2QXFA 3DRPA 4CGDA 3EKSA 3SZ2A 4DFMA 3DLKA 3IFRA 4B3TK 4OVLA 5CE3A 1IBKK 5KGXA 1J5OA 3V9UA 1SL1A 4X62K 1P8ZA 1RDBA 3TAQA 4H0XB 1VSFA 1KVAA 3ULDA 3KD5E 1QZ5A 3D2FB 3MCAB 2QW9A 3TABA 4Z4EA 4I7FA 3WQTA 4AM6A 1QQNA 3FZKA 1BOTO 4CJLA 1RBSA 4KHSA 3LP3A 1QHTA 4KTZA 3THXA 4CVNE 4KHUA 1VQ6N 2G8IA 3LM9A 3RRGA 1TUUA 5F0XA 4B1ZA 4JI7K 2O8BB 1QQCA 3SJJA 4W5QA 1A5XA 4H4OA 4CIFA 4JK9A 3UIQA 1T7PA 4N76A 2P9KB 3CIPA 2OPPA 2ETJA 1JLAA 4GVEA 1Y97A 1YF5L 2IC3A 3ZT1A 5D3GA 2FBVA 3SBGA 5FLXO 2E1YA 2W42A 3V9ZA 1DKGD 4HTUA 1HKCA 2VG7A 2Q36A 4DQ8A 3SQ2A 1RT7A 4I9LA 5AR0A 4CE9A 4PY5A 3THWB 2P9IB 3KLGA 3VF6A 4C1NI 2HHXA 3ATVA 3T1HK 4GY2B 1WAFA 1Q81O 3OY9A 5AQGA 4ISEA 1J6ZA 1YVUA 3NDKA 4JKCA 2B6AA 4BRHA 4JKEA 1QHAA 4B9UA 1TUYA 3ENHA 2OYQA 4NLCA 3VEVA 2W6KA 3JS6A 5LJWA 2PBDA 4BRFA 3FLCO 2G8UA 3OYNA 4KO0A 1T44A 4UQGA 3G4SN 2BGGA 2UXCK 4DV1K 4DLEA 1L3UA 2NRHA 2BH1A 4CJEA 5AQZA 5AZIA 2ASOA 1DGKN 3HRGA 4JI8K 2DY4A 3UB5A 3SMSA 3ZSOA 2O8EA 4FLVA 1VSMA 1QVFM 1NGAA 4JRQA 1BIZA 1SZ2A 3AA3A 5C12A 3V81A 4CD3A 4F9OA 3AV9A 4FLYA 2O8EB 4OKKA 1HX1A 2OPSA 1QSYA 3THVA 3PUFA 2YHBA 3ZX2A 2BTFA 4JKBA 2RPIA 3BUZB 1DEJA 3KHYA 1S72N 4MLHA 4EIAA 3J8AA 2OZSA 4M3RA 3BDPA 1VSEA 4FWNA 4K8XA 3K5NA 3SK3A 3FZMA 4FJXA 2E2NA 4CZLA 5C10A 4GKJK 2Y1IA 4CECA 4DV6K 1N33K 2F9WA 1RDDA 3TAGA 3DMJA 4XH1A 3BZKA 3E9OA 2O8CB 2VQFK 2HHVA 1OH5A 3RMCA 4J2EA 3F5TA 2ZGZA 3CFPA 3PLAA 4H0OA 3O08A 1FW6A 1NM1A 4BR9A 4O55A 1RFQA 1FKPA 3CI5A 2KFNA 4AHCA 1LW2A 3NGYA 1L3TA 4RW4A 1XMQK 3M6GA 3HJFA 2HNZA 2IVNA 2F96A 4ISGA 4DTPA 4CIGA 2ASPA 3AVAA 2F8TA 3MXJA 4HVJA 3KKRA 3VEYA 5KI6A 4CEZA 3G6EN 4IEEA 2P9KA 4KHQA 3D2EA 5GIPA 2IVPA 5AZIB 3E1YA 5F1XA 4W5RA 1JL1A 2GELA 4IDHA 3LANA 1X9MA 3ZT4A 2B5JA 3QFUA 1ITGA 4FOEA 5DK5A 1BIUA 3AA4A 3THXB 1Q8IA 2ITGA 2XO7A 1SV5A 3D45A 3VQAA 1E4FT 3FZLA 1CZAN 5FDLA 3VA0A 1SKWA 1DTTA 1VSJA 2E88A 3VEWA 1E3MA 4OJRA 1XQSC 1BUPA 3CMAN 4RWTA 1VHXA 3DRSA 1OVYA 3CJCA 3O3GA 3U3GA 4FO0A 4W5NA 4CJ4A 5C25A 1O1WA 5SWMA 1NK7A 4FJ7A 3C0BA 4G1QA 4A5AA 4HCBA 1GOCA 3QEXA 1NGDA 2HF4A 1N8RO 2NRZA 4X66K 2BANA 2YX6A 3MXIA 2KTQA 4LF4K 1VAZA 1UA0A 2Q97A 5C2FA 1ATNA 1TL3A 4OGEA 3G25A 3T1YK 3NH2A 3ENBA 3TANA 1H1VA 5HBMA 3QFPA 3QBXA 3NH1A 2HBKA 4B9TA 3QESA 3OYGA 2O8BA 1J5EK 4CEOA 4F3TA 2DPNA 1YIJN 4BC3A 3ZYYX 5BR9A 2F8SA 4G9ZA 3ENOA 2UU9K 3V1QA 4H0VB 1QS4A 4GMJB 4K8ZA 5I42A 1I39A 4CF2A 1VQ8N 5I9EB 2YNFA 3O9SA 4DQRA 1HQUA 4KAZA 3THYA 3OYKA 3U8XA 1NJXA 3QEVA 2UUBK 4BRQA 2KQ2A 5FPNA 3OYAA 3VENA 3TU5A 4IBNA 3PO5A 1T05A 3OYMA 2UUCK 3LDLA 4BWJA 1TAUA 4DTUA 4FJ5A 1X9SA 4JI3K 2HBJA 3LWLA 2YKNA 3WXMB 2OTLN 3LWMA 2HHWA 1DLOA 3AY9A 1W2BM 1L3SA 2LSNA 4FJJA 4FJHA 4O0IA 4OO1J 4DSIA 3ZETB 4AM7A 4N41A 2P9UA 3CC2N 3AVLA 2A3ZA 4JI4K 2NUBA 1XC3A 3U4LA 4JI1K 3A5NC 4DTMA 4EFHA 3DLGA 3QINA 1NGFA 2OPRA 2Z1IA 4CBUA 1U45A 3NHGA 5GAGP 4M45A 2GUPA 2AJQA 2XY7A 4AHRA 2VGMA 4IXCA 3ITHA 1NK5A 4LFAK 2JLEA 4K42A 4EZ9A 2ZM6K 2D0OA 1BI4B 4BDPA 4FJGA 1QSSA 4ELVA 1U48A 1WAJA 4O5BA 1NGGA 1IBMK 2FC0A 4PKHA 1NNEA 1JCFA 3O80A 3SV3A 2X6NA 4BG8A 3OYIA 2VYPA 4BGBA 1KCFA 3V6DA 4FK0A 4CHOA 3O4QA 4B1XB 3HI0A 3OW2M 3QLHA 1TKDA 1JLGA 1KAYA 1TKZA 2ZWHA 5JS2A 3O9UA 1ESVA 2Q0RA 1CXQA 2P5GA 4R5PA 5E26A 3V9XA 4JKGA 3VTHA 3QIOA 3RMAA 1ZBIA 3GBTA 1YJWN 3ID6A 2OA8A 1U6ZA 3VTIA 2IVOA 5HRSA 1NJIO 4CFAA 5J2MA 4DSJA 3OS0A 2ZGYA 4WQ5A 1XHZA 5C42A 1NKBA 4DR4K 1YXQA 2HSTA 3VF4A 3GE1A 4FJMA 4FLWA 1REVA 3FFIA 2WC9A 3BZCA 3GG4A 4F2SA 3CF5L 1WSIA 3VEXA 2G8KA 4WQ4A 4DTJA 2CH6A 3I0RA 2D0CA 3OYLA 2QWLA 1Z25A 4BROA 4YOYA 2GEMA 2F7TA 4IOCL 3KK3A 3QB0A 3SUOA 2YHAA 2J4RA 1YAGA 3CC4N 4JI5K 1RT3A 3FR0A 3ULEA 3S9HA 3L2QA 3ZT0A 3NF9A 2ATQA 2ITMA 2YNHA 3W0LA 1VQLN 4PQUA 2EHGA 3VGKA 1RT1A 1KXPA 2KZMA 3AVMA 4IO9L 2HHSA 1YTAA 1RBTA 4U67L 4FJ9A 4CZGA 4JYAK 3O8MA 4PL8A 4JV5K 5C0YA 2QWQA 3A5OC 1EETA 5AZJB 1IBLK 4FVMA 1RDCA 5AQYA 4MFBA 3JSMA 1UOCA 1CXUA 1C0MA 5C2DA 4L8RB 4CJSA 3E66A 4H5NA 1Y64A 1HNVA 3WXIA 2G8FA 1WBBA 4CI6A 4O8KA 4PA1A 1EP4A 1BCOA 4FWOA 1T8EA 3V1RA 3LZJA 5AJ3K 4WFNL 4R79A 4JD2B 4FK4A 4CJWA 4M3WA 2HBLA 3LALA 1RGIA 4DV0K 1F21A 5KPRA 4ELTA 5HLFA 3WEEA 4CERA 3U3YA 5M1FA 2VCPA 1CZ9A 4IWVA 1I3AA 1N34K 3H46O 2HB5A 1VQMN 4PUOA 1LAWA 4QS8A 3OYJA 1S9GA 2E20A 2D0AA 3E01A 4KB1A 3EE8A 2X74A 3H1VX 1BCMA 4JAXA 5CYQA 2E5LK 4GV9A 3HXMA 3CD6N 1J53A 2FF6A 3TAPA 3SLCA 4DSFA 4EP4A 4A61A 1VQNN 2PYLA 5HROA 3H1QA 4M41A 2D5RA 1NMNA 4CGJA 5AQPA 5AQXA 1MWKA 1N6QA 1NMDA 4YOVA 5DM7L 4KI4A 3GOIA 4DSLA 5AQLA 4DU1A 4W5TA 4DLGA 4M42A 3K57A 3DWLA 2Q2RA 4B3SK 1ZXOA 3O3FA 1FXXA 3AVFA 1HYZA 4RW6A 1R59O 1GLLO 2VQEK 3PX0A 5EXWA 1BA1A 5AQFA 3KLEA 4OX9K 1MU2A 2RHKA 3KZBA 3M1FA 4CGIA 4B08A 4CEFA 5M1KA 2NRRA 3K5LA 3UE5A 3TPQA 3CPWM 1X9JA 3K0SA 3M8QA 4XH4A 4OLAA 3CCVN 5AQJA 4N5SA 4B3MK 3NBPA 2G8WA 3L3UA 4Q5VA 3F2KA 1HRHA 1KC8O 1VQON 1XNQK 2QWNA 2UUAK 3DAWA 1UA1A 1TVRA 2YCHA 1ZBLA 3U9DA 2W41A 4CHPA 4E7LA 3CERA 1RT2A 3UKUA 1U04A 4H0YB 2ZJPL
chains in the Genus database with same CATH topology
4IEEA 1KAZA 1QZ6A 1YVNA 2ASMA 2P9KA 3CPEA 3D2EA 3I56N 1YITN 5GIPA 3TSQA 2IVPA 5AZIB 4JK7A 3E1YA 1GLAG 1RDWX 1WUAA 1GLBG 3MWTA 5F1XA 1K9MO 2D4WA 3B8AX 3CHWA 2GELA 4IDHA 4YOTA 3CCSN 4IEIA 4FOEA 3QFUA 4M7YA 5JLFA 3MX2A 4BVPA 3C7NA 2Q31A 3BF1A 1GLJO 3NVMA 2E2QA 4KH5A 4BQLA 1U2VB 5EY4A 2A5XA 3LM2A 5GAEP 4BRAA 3WT0A 1KAXA 4WQ4C 1E4FT 3FZLA 1CZAN 4O8UA 3DLLL 4ILHA 3HBTA 3UKRB 5CR4A 3MN6A 1M90O 2E88A 3VEWA 2ZJQL 1BU6O 2I7NA 3M5RA 3LDPA 2NRWA 3MDQA 1XQSC 1BUPA 4ISFA 3WXJA 3CQYA 5AQMA 5EX5A 3CMAN 4FVUA 3N4QA 3O6WA 4NB4A 4JK8A 4M7XA 5M1NA 4RWTA 4WFAL 1K8AO 1OVYA 3K9KA 1T3VA 2P9PB 4FWSA 3CJCA 3Q7BA 1NGBA 5DM6L 4FO0A 5AQTA 5JICA 1NGIA 5TKWA 5AQHA 3P38A 4H5RA 5KQDA 2Q0UA 3C0BA 4IFEA 4Z94A 3FE1A 5GAHP 4A5AA 3CJAA 3HOTA 1RDUA 1K8KB 1NGDA 2HF4A 2V7ZA 2NRZA 1ZBSA 4A2BA 3D7EO 1N8RO 4WFBL 1E4GT 2VGNA 2YX6A 3O9RA 3L0QA 2JWKA 5BPLA 4BR2A 2QWMA 4BRPA 1NGHA 1VAZA 5LY3A 3TTDA 1HLUA 2Q97A 2P9SA 3CETA 5C2FA 1ATNA 3H6EA 4YDUC 2ZJRL 1T6CA 3T7ZA 1S3XA 3H45C 4K43A 2FLOA 3G25A 3EN9A 3P4IA 2P9LB 4O5FA 1Q86O 4GV6A 4FPAA 1T6DA 3ENBA 1ZC6A 2YJFA 1H1VA 4K41A 3AARA 3QBXA 3QFPA 2I7PA 1WOQA 2HBKA 5AQNA 1GLDG 2P9NA 4FWKA 3C6HA 5CHIA 5AZJA 1IG8A 4IJAA 1GLCG 1HPMA 3CCQN 4EAHD 3P31A 3ZEUB 3DXKA 3VESA 2DPNA 3BEXA 1YIJN 4FWQA 1YJ9N 1HJOA 4FOIA 2KLAA 4BC3A 3DXMB 3ZYYX 4C1NK 5BR9A 4G9ZA 4RCHA 3ATUA 3ENOA 4JN4A 3W3DA 1HKBA 5EVZA 3R8EA 5JLHA 1LOTB 3CJ1A 4JHDB 3R3LA 4PHTX 4H0VB 1M1KO 3QMLA 2ZF5O 2KKZA 4GNIA 3J7ZO 4ILJA 1BA0A 2QWPA 3IKMA 4A59A 4JHDA 4WCEL 2IIRA 3A8YA 4JKFA 1Q82O 2GWKA 4CZIA 1SAZA 3QDKA 3RVCA 5I9EB 1NGJA 4BGAA 3O9SA 1NGCA 2D1KA 5ADXA 5AQQA 5AQOA 1QVGM 3OBYA 4BC2A 3U8XA 4B1YB 5BN8A 4CZJA 4CZKA 3MX5A 4BRQA 3FZHA 5AQRA 3T69A 4H5VA 2GX9A 2QWOA 5KPTA 5FPNA 4DCHA 3VENA 3TU5A 4BG9A 2JWLA 3MMVA 4BRMA 3TSUA 3KVGA 2NZTA 3LDLA 3SJHA 3GL1A 3MWPA 4A5BA 1SS6A 3FFKB 1V4SA 4JNEA 4I6MB 3GDQA 1OKJA 2OANA 1P90A 4ILGB 2QI2A 2NLXA 2HBJA 4H5WA 3CXCM 3WXMB 2OTLN 1HUXA 2E1ZA 3BP8A 3AY9A 3BF3A 3CJBA 1W2BM 1X3MA 3A5LC 3NMUA 3A5MC 5BN9A 3AGKA 4WYBA 3VGMA 3D6RA 2YJEA 2NRXA 3MN5A 3PIOL 4OO1J 2KHOA 3LDQA 2QWRA 4I6MA 3ZETB 4AM7A 2P9UA 3CC2N 2A3ZA 4RTFD 4BRKA 4WQ5C 3KWGA 1BO5O 1XC3A 2HF3A 2A40A 3U4LA 3A5NC 4MO5A 4EFHA 3EKUA 3ZEUA 3OHRA 2HOEA 1NGFA 3TSPA 1ILYA 2P9UB 1NWKA 3I33A 3O9QA 2QXLA 2V52B 3ULEB 3O1BA 4CBUA 4H0TB 3HSCA 5GAGP 2CGJA 2QEXN 4M63C 1D4XA 2GUPA 3CCRN 1IJJA 3HM8A 4LC9B 2HBMA 2VGMA 3K9JA 4IXCA 3VF2A 4K42A 3CC7N 2D0OA 1VQ4N 1NGGA 3EO3A 3U9ZA 4PKHA 1JCFA 3O80A 5GINA 3O1WA 5BRFA 4BG8A 1U2VA 3AAQA 3FGUA 2VYPA 2YHYA 3EL2A 2GWJA 3F9MA 1XUPO 3H3NO 4AF1A 4BGBA 2FSNA 4B1UB 4B1XB 4FL9A 1ATRA 3HI0A 5AQKA 4MO4A 3G71N 3OW2M 3MN9A 3HZ6A 1KAYA 3MK6A 5BRHA 2ZWHA 3SAHA 5JVHL 2E8AA 5BPMA 3O9UA 1ESVA 4EHUA 3LDOA 1SQKA 4OPAA 2Q0RA 4BVOA 3TTCA 1BG3A 2P9LA 4KH6A 5E26A 2QTDA 3WXKA 5KPZA 3ID8A 1EQYA 2P9PA 4JKGA 4JKAA 3VTHA 3GBTA 4NLBA 3ZX0A 1V4TA 1YJWN 3MN7A 3ID6A 5FPMA 3PIPL 2D0PA 2AA4A 3WUHA 3SAGA 2WFBA 4DB3A 3IUCA 5M1QA 4WF9L 1U6ZA 3CJ9A 2IVOA 1YUWA 4JKDA 3VTIA 4BR4A 4EHTA 3JXUA 3VOVA 1NJIO 1BWFO 3DXMA 4FPBA 4JKGB 4L3QA 1C0FA 1X3NA 5M1OA 4CD1A 4C23A 2ZGYA 4WQ5A 5C15A 4IZ9A 2GTDA 3DJCA 4J8FA 4HWIA 4IO8A 1YXQA 2FXUA 2HSTA 3VF4A 4H03B 3GE1A 4H0PA 2E2OA 5HOOA 3O9TA 2FSJA 1GLEG 4DKWA 2WC9A 1GLFO 2CH5A 1VQKN 1ATSA 5AQUA 5ELZA 3GG4A 2UYTA 4BC4A 4CBWA 3VEXA 5AQSA 2P9NB 5FPDA 3CF5L 2CGKA 4WQ4A 2YHXA 2CH6A 3AAPA 1S22A 1JJ2M 2QWLA 4BROA 3L6QA 5HL7L 4MDBA 5BRDA 4CJ7A 4YOYA 2GEMA 3UKRA 1VQ7N 4UY8O 4B9QA 3SMPA 4BREA 2F7TA 1O13A 3EKSA 1LCUA 3IMXA 4XEIA 4IOCL 4YORA 3IFRA 3QB0A 3TTFA 2NNWA 4CBXA 4CZEA 5CE3A 1Q7YO 5GADP 2J4RA 2PAVA 3L4IA 4FWPA 1YAGA 3S41A 3CC4N 3FR0A 3CCEN 3EE9A 3HTVA 3ULEA 4JKHA 4U7BA 3R6MA 3CCMN 1P8ZA 4K25A 5AFUA 4H0XB 2ITMA 1QZ5A 3FZFA 3W0LA 1DT9A 3D2FB 1VQLN 3MCAB 2QW9A 3VGKA 1MWMA 4A62A 2WUSA 1KXPA 5E84A 4MLEA 3WQTA 4BR5A 4IO9L 4YOUA 4PL7A 4CZFA 4AM6A 2Q1NA 1VQ9N 3ZETA 1QQNA 3FZKA 3UKUB 1BOTO 3LDNA 4YDUA 5JMVA 4IOAL 1Z6RA 4U67L 4CZGA 5KQ8A 4E1JA 3CMEN 4MDAA 4BC5A 5GIOA 4BQZA 3O8MA 1NLVA 2P9SB 4FWLA 3R9PA 4PL8A 2A41A 2V51B 3I8BA 3R1XA 4B1WB 5JVGL 1VQ6N 5C0YA 3LM9A 2QWQA 3A5OC 3QICA 5AZJB 3H3OB 1TUUA 5F0XA 4B1ZA 2YI1A 5AQYA 1BDGA 2W40A 1K73O 5FPEA 1KD1O 4JK9A 3D2EB 3VERA 5ADXH 5B8HA 2P9KB 3CJ7A 3KWIA 5C2DA 4CZHA 3CIPA 3E66A 1G99A 2BUPA 2E2PA 3WQUA 4BRNA 4H5NA 4H5TA 1MA9B 1Y64A 4GVEA 3NVKA 3WXIA 1YF5L 4CI6A 4O8KA 4BY9C 4FWOA 3SBGA 2E1YA 5AQWA 4GV3A 1DKGD 2NRVA 3C65A 4R79A 2NRTA 4JD2B 2A6AA 1HKCA 4WFNL 1K8KA 2Q36A 4DQ8A 3VPZA 2HBLA 1RGIA 4DHYA 1Q18A 4XH5A 2PFUA 5AR0A 5BPNA 2FSKA 3G6EN 1MDUB 2P9IB 4QS9A 5KPRA 3DXKB 4QS7A 3VGLA 4JEPA 3CCLN 3WEEA 1QQOA 2F9TA 2RE2A 3VF6A 4C1NI 5M1FA 1JCEA 2VCPA 4BRIA 3L4QA 4IWVA 3ATVA 4GY2B 1Q81O 1JCGA 3H46O 2HMPA 3I55N 1VQMN 5AQGA 4ISEA 4QS8A 1J6ZA 4JKCA 3AGRA 2E20A 4BRHA 4JKEA 1QHAA 1TUYA 3EE8A 3H1VX 1YJNN 3ENHA 4BRCA 4NLCA 2CGLA 4PKIA 3VEVA 3JS6A 5LJWA 1NBWA 4BR0A 2PBDA 4BRFA 4BRLA 3FLCO 4JAXA 4YOXA 1T44A 2WBNA 3G4SN 2EWSA 2YHWA 2NRHA 4CZMA 2QA4N 1VQ5N 2BH1A 4KH4A 5AQZA 4GV9A 1NGEA 2H3GX 5AZIA 2ASOA 1DGKN 3HRGA 3UB5A 3CD6N 2P9IA 3SMSA 1KQSM 2FF6A 3SLCA 4HTLA 1TYQA 4A61A 1VQNN 1QVFM 1NGAA 3H1QA 4FWRA 1SZ2A 3M3ZA 3RSEB 5C12A 4CD3A 2A42A 3A0IX 4F9OA 5AQPA 5AQXA 3ZX3A 3SAFA 1TYQB 3VEOA 1MWKA 1NMDA 1VQPN 4YOVA 1HX1A 5DM7L 4Y0WA 3VETA 2V7YA 2AP1A 3D2FA 3GOIA 5F2RA 3ZX2A 5AQLA 2BTFA 4JKBA 1C0GA 5H1SQ 3BUZB 1DEJA 3KHYA 4A2AA 4BRGA 3DWLA 5BREA 4MLHA 2Q2RA 4A57A 4EIAA 1S72N 3C7NB 1ZXOA 3EZWA 3J8AA 4IJNA 3N4PA 5AQIA 5LJVA 1R59O 4FWNA 1GLLO 3SK3A 1BA1A 1QQMA 3FZMA 5EXWA 5AQFA 3VMFB 2E2NA 3O4WA 4B1VA 4CZLA 5C10A 5TKYA 2RHKA 2F9WA 3E9LA 3MCPA 5EOYA 1YI2N 3KZBA 4XH1A 3OA9A 2QM1A 3SBTA 3M1FA 3E9OA 5AQVA 3WXLA 5M1KA 2NRRA 3VEZA 3RSEA 3UE5A 3TPQA 3CPWM 1Z05A 3F5TA 1X9JA 2ZGZA 5MLCQ 4XH4A 3OBWA 4IOXA 5AFUH 1HKGA 4BR7A 3O5BA 3CCVN 4PKGA 4H0OA 3O08A 5AQJA 3PLAA 1EO1A 1NM1A 3CCJN 3CCUN 4FWMA 4BR9A 4OPHA 2FF3B 1RFQA 3C6AA 3F2KA 3P39A 1KC8O 3WEEB 3CI5A 3IDHA 3Q7CA 1VQON 3KK7A 2QWNA 5M1PA 4JD2A 3DAWA 3M6GA 2YCHA 3U9DA 2IVNA 4FSVA 1YHQN 4BRDA 2W41A 4ISGA 1VQ8N 1W97L 3CERA 3LL3A 2ASPA 2VWBA 3UKUA 3HOSA 4H0YB 3CQXA 3E9PA 2ZJPL 3QBWA 2OTJN 3VEYA 4NO7A 4KBOA 4YOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAZ A;  1QZ6 A;  1YVN A;  2ASM A;  2P9K A;  3D2E A;  2IVP A;  5AZI B;  5F1X A;  1GLA G;  1RDW X;  1WUA A;  1GLB G;  2D4W A;  3B8A X;  3CHW A;  2GEL A;  4M7Y A;  4FOE A;  3QFU A;  5JLF A;  4BVP A;  3C7N A;  2Q31 A;  3BF1 A;  1GLJ O;  2E2Q A;  4BQL A;  1U2V B;  5EY4 A;  2A5X A;  3LM2 A;  4BRA A;  3WT0 A;  1KAX A;  4WQ4 C;  1E4F T;  3FZL A;  1CZA N;  3HBT A;  3UKR B;  3MN6 A;  2E88 A;  3VEW A;  1BU6 O;  2I7N A;  3LDP A;  3MDQ A;  1XQS C;  1BUP A;  4ISF A;  3WXJ A;  3CQY A;  5AQM A;  5EX5 A;  3O6W A;  4NB4 A;  4M7X A;  4RWT A;  2P9P B;  4FWS A;  3CJC A;  1NGB A;  4FO0 A;  5AQT A;  5JIC A;  1NGI A;  5AQH A;  4H5R A;  5KQD A;  2Q0U A;  3C0B A;  4Z94 A;  3FE1 A;  3CJA A;  1K8K B;  1NGD A;  2HF4 A;  2V7Z A;  4A2B A;  1ZBS A;  3D7E O;  1E4G T;  3L0Q A;  5BPL A;  4BR2 A;  2QWM A;  4BRP A;  1NGH A;  5LY3 A;  1HLU A;  2Q97 A;  2P9S A;  3CET A;  1ATN A;  3H6E A;  4YDU C;  1T6C A;  1S3X A;  3H45 C;  4K43 A;  2FLO A;  3G25 A;  3EN9 A;  3P4I A;  2P9L B;  4O5F A;  4FPA A;  1T6D A;  1ZC6 A;  2YJF A;  1H1V A;  4K41 A;  3AAR A;  3QBX A;  3QFP A;  2I7P A;  1WOQ A;  5AQN A;  1GLD G;  2P9N A;  4FWK A;  5AZJ A;  1IG8 A;  4IJA A;  1GLC G;  1HPM A;  4EAH D;  3ZEU B;  3DXK A;  3VES A;  2DPN A;  3BEX A;  4FWQ A;  1HJO A;  4FOI A;  4BC3 A;  3DXM B;  5BR9 A;  4RCH A;  3ATU A;  3ENO A;  4JN4 A;  3W3D A;  1HKB A;  5EVZ A;  3R8E A;  5JLH A;  1LOT B;  3CJ1 A;  4JHD B;  4H0V B;  3QML A;  2ZF5 O;  4GNI A;  1BA0 A;  2QWP A;  4JHD A;  2IIR A;  3A8Y A;  2GWK A;  4CZI A;  1SAZ A;  3QDK A;  5I9E B;  1NGJ A;  4BGA A;  1NGC A;  2D1K A;  5ADX A;  5AQQ A;  5AQO A;  4BC2 A;  3U8X A;  4B1Y B;  5BN8 A;  4CZJ A;  4CZK A;  4BRQ A;  3FZH A;  5AQR A;  4H5V A;  2QWO A;  5KPT A;  5FPN A;  4DCH A;  3VEN A;  3TU5 A;  4BG9 A;  3MMV A;  4BRM A;  3KVG A;  2NZT A;  3LDL A;  3SJH A;  3GL1 A;  3FFK B;  1V4S A;  4JNE A;  4I6M B;  3GDQ A;  1OKJ A;  2OAN A;  2NLX A;  4H5W A;  1HUX A;  2E1Z A;  3BP8 A;  3AY9 A;  3BF3 A;  3CJB A;  1X3M A;  3A5L C;  3A5M C;  5BN9 A;  4WYB A;  3VGM A;  2YJE A;  3MN5 A;  2KHO A;  3LDQ A;  2QWR A;  4I6M A;  3ZET B;  4AM7 A;  2P9U A;  2A3Z A;  4RTF D;  4BRK A;  4WQ5 C;  1BO5 O;  1XC3 A;  2HF3 A;  2A40 A;  3U4L A;  3A5N C;  4MO5 A;  4EFH A;  3EKU A;  3ZEU A;  3OHR A;  2HOE A;  1NGF A;  2P9U B;  1NWK A;  3I33 A;  3ULE B;  2QXL A;  2V52 B;  4CBU A;  3O1B A;  4H0T B;  3HSC A;  2CGJ A;  4M63 C;  1D4X A;  2GUP A;  1IJJ A;  3HM8 A;  4LC9 B;  4IXC A;  3VF2 A;  4K42 A;  2D0O A;  1NGG A;  3EO3 A;  3U9Z A;  4PKH A;  1JCF A;  3O80 A;  3O1W A;  5BRF A;  4BG8 A;  3FGU A;  1U2V A;  3AAQ A;  2VYP A;  2YHY A;  3EL2 A;  2GWJ A;  3F9M A;  1XUP O;  3H3N O;  4BGB A;  2FSN A;  4B1U B;  4B1X B;  4FL9 A;  1ATR A;  3HI0 A;  5AQK A;  4MO4 A;  3MN9 A;  3HZ6 A;  1KAY A;  3MK6 A;  5BRH A;  2ZWH A;  2E8A A;  5BPM A;  1ESV A;  4EHU A;  3LDO A;  1SQK A;  4BVO A;  2Q0R A;  1BG3 A;  2P9L A;  5E26 A;  3WXK A;  5KPZ A;  3ID8 A;  1EQY A;  2P9P A;  3GBT A;  3ZX0 A;  1V4T A;  3MN7 A;  5FPM A;  2D0P A;  2AA4 A;  3WUH A;  4DB3 A;  3IUC A;  1U6Z A;  3CJ9 A;  2IVO A;  1YUW A;  4BR4 A;  4EHT A;  3JXU A;  3VOV A;  1BWF O;  3DXM A;  4FPB A;  4L3Q A;  1C0F A;  1X3N A;  4CD1 A;  4C23 A;  2ZGY A;  4WQ5 A;  4IZ9 A;  2GTD A;  3DJC A;  4J8F A;  4HWI A;  4IO8 A;  1YXQ A;  2FXU A;  3VF4 A;  4H03 B;  3GE1 A;  4H0P A;  2E2O A;  2FSJ A;  1GLE G;  1GLF O;  2CH5 A;  1ATS A;  5AQU A;  5ELZ A;  3GG4 A;  2UYT A;  4BC4 A;  4CBW A;  3VEX A;  5AQS A;  2P9N B;  5FPD A;  2CGK A;  4WQ4 A;  2YHX A;  2CH6 A;  3AAP A;  1S22 A;  2QWL A;  4BRO A;  3L6Q A;  5BRD A;  4CJ7 A;  2GEM A;  3UKR A;  4B9Q A;  3SMP A;  4BRE A;  3EKS A;  1LCU A;  3IMX A;  4XEI A;  3IFR A;  3QB0 A;  4CBX A;  4CZE A;  5CE3 A;  2J4R A;  2PAV A;  3L4I A;  4FWP A;  1YAG A;  3S41 A;  3FR0 A;  3HTV A;  3ULE A;  3R6M A;  1P8Z A;  4K25 A;  5AFU A;  4H0X B;  2ITM A;  1QZ5 A;  3FZF A;  3W0L A;  3D2F B;  2QW9 A;  3VGK A;  1MWM A;  4A62 A;  2WUS A;  1KXP A;  5E84 A;  4MLE A;  3WQT A;  4BR5 A;  4PL7 A;  4CZF A;  4AM6 A;  2Q1N A;  3ZET A;  1QQN A;  3FZK A;  3UKU B;  1BOT O;  3LDN A;  4YDU A;  5JMV A;  1Z6R A;  4CZG A;  5KQ8 A;  4E1J A;  4BC5 A;  4BQZ A;  3O8M A;  1NLV A;  2P9S B;  4FWL A;  3R9P A;  4PL8 A;  2A41 A;  2V51 B;  3I8B A;  4B1W B;  3LM9 A;  2QWQ A;  3A5O C;  3QIC A;  5AZJ B;  3H3O B;  1TUU A;  5F0X A;  4B1Z A;  2YI1 A;  5AQY A;  1BDG A;  2W40 A;  5FPE A;  3D2E B;  3VER A;  5ADX H;  5B8H A;  2P9K B;  3CJ7 A;  4CZH A;  3CIP A;  1G99 A;  2BUP A;  2E2P A;  3WQU A;  4BRN A;  4H5N A;  4H5T A;  1MA9 B;  1Y64 A;  3WXI A;  4CI6 A;  4O8K A;  4FWO A;  2E1Y A;  5AQW A;  1DKG D;  4JD2 B;  2A6A A;  1HKC A;  1K8K A;  2Q36 A;  4DQ8 A;  3VPZ A;  1RGI A;  4DHY A;  1Q18 A;  4XH5 A;  5AR0 A;  5BPN A;  2FSK A;  1MDU B;  2P9I B;  4QS9 A;  5KPR A;  3DXK B;  4QS7 A;  3VGL A;  3WEE A;  1QQO A;  2F9T A;  3VF6 A;  1JCE A;  2VCP A;  4BRI A;  4IWV A;  3ATV A;  4GY2 B;  1JCG A;  3H46 O;  2HMP A;  5AQG A;  4ISE A;  4QS8 A;  1J6Z A;  2E20 A;  4BRH A;  1QHA A;  1TUY A;  3H1V X;  3ENH A;  4BRC A;  2CGL A;  4PKI A;  3VEV A;  3JS6 A;  5LJW A;  1NBW A;  4BR0 A;  2PBD A;  4BRF A;  4BRL A;  3FLC O;  4JAX A;  1T44 A;  2EWS A;  2YHW A;  2NRH A;  4CZM A;  5AQZ A;  1NGE A;  2H3G X;  5AZI A;  2ASO A;  1DGK N;  3UB5 A;  2P9I A;  3SMS A;  2FF6 A;  3SLC A;  4HTL A;  1TYQ A;  4A61 A;  1NGA A;  3H1Q A;  4FWR A;  1SZ2 A;  3M3Z A;  3RSE B;  4CD3 A;  2A42 A;  3A0I X;  4F9O A;  5AQP A;  5AQX A;  3ZX3 A;  1TYQ B;  3VEO A;  1MWK A;  1NMD A;  1HX1 A;  4Y0W A;  3VET A;  2V7Y A;  2AP1 A;  3D2F A;  3GOI A;  5F2R A;  3ZX2 A;  5AQL A;  2BTF A;  1C0G A;  3BUZ B;  1DEJ A;  3KHY A;  4A2A A;  4BRG A;  3DWL A;  5BRE A;  4MLH A;  2Q2R A;  4EIA A;  3C7N B;  1ZXO A;  3EZW A;  3J8A A;  4IJN A;  5AQI A;  5LJV A;  1R59 O;  4FWN A;  1GLL O;  3SK3 A;  1BA1 A;  1QQM A;  3FZM A;  5EXW A;  5AQF A;  4B1V A;  2E2N A;  3O4W A;  4CZL A;  5TKY A;  2F9W A;  3MCP A;  5EOY A;  3KZB A;  4XH1 A;  2QM1 A;  3M1F A;  5AQV A;  3WXL A;  3VEZ A;  3RSE A;  3UE5 A;  3TPQ A;  1Z05 A;  1X9J A;  2ZGZ A;  4XH4 A;  5AFU H;  1HKG A;  4BR7 A;  3O5B A;  4PKG A;  4H0O A;  3O08 A;  5AQJ A;  1NM1 A;  4FWM A;  4BR9 A;  2FF3 B;  1RFQ A;  3WEE B;  3CI5 A;  3IDH A;  2QWN A;  4JD2 A;  3DAW A;  3M6G A;  2YCH A;  3U9D A;  2IVN A;  4FSV A;  4BRD A;  2W41 A;  4ISG A;  3CER A;  3LL3 A;  2ASP A;  2VWB A;  3UKU A;  4H0Y B;  3CQX A;  3QBW A;  3VEY A;  4NO7 A;  4KBO A; 
#chains in the Genus database with same CATH topology
 1VQK N;  2XY5 A;  2ASM A;  1RT6 A;  1YIT N;  1R0A A;  3NCI A;  3NE6 A;  3MWT A;  1RDW X;  1GLB G;  3CHW A;  3S3N A;  3P83 D;  4LH5 A;  5J2P A;  4BVP A;  3BF1 A;  1GLJ O;  1NJY A;  3O3H A;  4CGH A;  4BQL A;  1U2V B;  5GAE P;  3AVI A;  4CK3 A;  3WT0 A;  3NFA A;  4WQ4 C;  1G15 A;  1KFD A;  2E6L A;  3EY1 A;  3HBT A;  3WNH A;  2F4V K;  3QIP A;  3OYB A;  2ZJQ L;  3MXM A;  3S3M A;  3OYF A;  1KTQ A;  4ISF A;  5EX5 A;  4FVU A;  3N4Q A;  3O6W A;  4NB4 A;  4M7X A;  4WFA L;  5C24 A;  4NCA A;  3K9K A;  2P9P B;  4BAC A;  4QOZ B;  2HW3 A;  4DR7 K;  3ZLJ A;  5JIC A;  4LF8 K;  3FE1 A;  3CJA A;  5HRP A;  1ZBS A;  4E7I A;  3PX4 A;  2VGN A;  5BPL A;  2QWM A;  5LY3 A;  2B4J A;  2ZJR L;  4F8R A;  2PYJ A;  1S3X A;  1TKT A;  2QKB A;  2P9L B;  1Q86 O;  4GV6 A;  4FPA A;  3DLB A;  4QAG A;  1GOB A;  3C94 A;  2Z1H A;  4O0J A;  3AAR A;  5AQN A;  1TK0 A;  1NKE A;  3VQ4 A;  5CHI A;  1IG8 A;  1WSJ A;  3VES A;  1YJ9 N;  2KLA A;  3TAE A;  3DXM B;  1HJR A;  3IAY A;  3AVG A;  4RCH A;  1RIL A;  1HKB A;  4OKJ A;  5JLH A;  3IRX A;  4JHD B;  1M1K O;  4C8N A;  4NXN K;  5J2N A;  2KKZ A;  3J7Z O;  4ILJ A;  1NJZ A;  1BA0 A;  4CJU A;  4JHD A;  4WCE L;  3A8Y A;  4JKF A;  4Y1D A;  1BQN A;  3QDK A;  4KTW A;  4RW9 A;  4KTQ A;  4Y1C A;  3U6F A;  5AQQ A;  4LH4 A;  5AQO A;  3OVN A;  3SUP A;  3OBY A;  4PWD A;  3MX5 A;  5AQR A;  4OPK A;  3DOK A;  4H8K A;  4E1N A;  3HVR A;  4E7J A;  4LF6 K;  4OPJ A;  4ELU A;  4BWM A;  2O8F B;  3NF8 A;  4DTN A;  1KSP A;  3GL1 A;  4EZ6 A;  3MWP A;  5J2Q A;  1SS6 A;  3FFK B;  3D0P A;  4JNE A;  4CEA A;  3GDQ A;  3AVC A;  4DFK A;  3CXC M;  3L8B A;  1HUX A;  3BF3 A;  3CJB A;  3A5L C;  4Q0B A;  3CFO A;  2HND A;  2NRX A;  5IT9 O;  2QWR A;  4I6M A;  4DV7 K;  2HNY A;  1XI1 A;  1D9F A;  3AVJ A;  3PSI A;  1BO5 O;  4BE2 A;  2HF3 A;  1KFS A;  3ISN C;  4B8C A;  1X9W A;  3EKU A;  4V19 S;  3LDS A;  1C1B A;  1NWK A;  3I33 A;  2QXL A;  2XY6 A;  4FM1 A;  3CCR N;  3HM8 A;  4LC9 B;  3SQ1 A;  2HHU A;  2IS3 A;  3VF2 A;  3SUQ A;  1VQ4 N;  1A5V A;  3T19 A;  4N56 A;  4FCY A;  3DLE A;  1OH6 A;  5BRF A;  1U2V A;  4AF1 A;  1KRP A;  1ASV A;  3PX6 A;  2X78 A;  1ATR A;  4MO4 A;  2O4G A;  1HNI A;  1RBV A;  4NCB A;  4KHP K;  3MAQ A;  3OTO K;  4J2D A;  4HUE A;  2OZM A;  5BPM A;  1RT5 A;  2VG5 A;  3DOL A;  4AQY K;  1OVQ A;  4TSX A;  4RW7 A;  3VQ7 A;  1BG3 A;  1LWC A;  1XWL A;  3ID8 A;  3THY B;  3NGI A;  3ZX0 A;  3V9S A;  2R7Y A;  3SAG A;  4DB3 A;  3HK2 A;  4YY3 K;  5M1Q A;  3CJ9 A;  4EHT A;  1YUW A;  4JKD A;  3JXU A;  1BWF O;  1X3N A;  4CD1 A;  4C23 A;  1JL2 A;  2GTD A;  4N47 A;  4I9Q A;  4DU4 A;  3OS1 A;  2DTU A;  2O8F A;  3O9T A;  4DKW A;  1GLF O;  3SPZ A;  4BC4 A;  4CBW A;  3QEI A;  2YHX A;  1JJ2 M;  2E4L A;  1VQ7 N;  3UKR A;  4BDZ A;  4B9Q A;  4DF4 A;  1W0H A;  1O13 A;  4XEI A;  4YOR A;  2NNW A;  4CBX A;  5GAD P;  4CF9 A;  3CCE N;  3EE9 A;  3SI6 A;  3HTV A;  4U7B A;  4JKH A;  4LF5 K;  1DT9 A;  4C8O A;  4A62 A;  4CJ3 A;  2WUS A;  5E84 A;  1VRT A;  3QNO A;  2P51 A;  4PL7 A;  1RCH A;  3NF6 A;  1VQ9 N;  3VQD A;  1B9F A;  3UKU B;  4CW7 B;  3LDN A;  4E0D A;  5KQ8 A;  4C8L A;  1TV6 A;  1NK4 A;  4E1J A;  4BC5 A;  5GIO A;  1WSG A;  1NLV A;  4FWL A;  2V51 B;  4B8A B;  5JVG L;  2UXD K;  4B1W B;  1C1A A;  3EZ5 A;  3QIC A;  1HYS A;  2YI1 A;  4E89 A;  4Z4F A;  1YTU A;  4KRF A;  3VQQ A;  1BDG A;  3MED A;  1K73 O;  5FPE A;  3VER A;  3CJ7 A;  3KWI A;  2O8D A;  1G99 A;  3O4N A;  4IG0 A;  1MA9 B;  2VWK A;  3ASM A;  1W7A A;  5AQW A;  1VSH A;  2NRV A;  2NRT A;  2PZS A;  1UWB A;  3VPZ A;  4XIU A;  3CFR A;  4DHY A;  1ZBH A;  4XH5 A;  5BPN A;  4CIE A;  1MDU B;  4QS9 A;  3DXK B;  4QS7 A;  3OJU A;  3VGL A;  2YNG A;  1QQO A;  2RE2 A;  3VA3 A;  3OS2 A;  1JCE A;  1TL1 A;  3L4Q A;  3VQB A;  2Y1J A;  3V1O A;  1JCG A;  1BGX T;  1NK9 A;  2HMP A;  3I55 N;  4FXD A;  5FRN A;  4FLZ A;  3HP9 A;  1S6P A;  4LFC K;  4BDY A;  3V4I A;  5LL6 Z;  2HVI A;  1EWR A;  3ZSX A;  4DU3 A;  4AHV A;  4HCC A;  4PKI A;  1NBW A;  4BRL A;  4DTX A;  3CQ8 A;  3B6O A;  1U49 A;  1S9E A;  1N32 K;  3RWU A;  1L5U A;  1S1T A;  4CZM A;  2QA4 N;  2FBY A;  3TAR A;  4IKF A;  4KHW A;  2WTU A;  2P9I A;  4DSK A;  3QEP A;  1KQS M;  4HTL A;  1TYQ A;  3M3Z A;  1SKR A;  1S1V A;  3DLR A;  2A42 A;  1TYQ B;  4DQI A;  4Z4I A;  4Y0W A;  3MEG A;  2Z1G A;  3VET A;  3AO3 A;  3HPO A;  4CJ5 A;  3D2F A;  5F2R A;  4HHT A;  1WBD A;  4IFY A;  1BQM A;  4BE0 A;  1C0G A;  3K5O A;  5H1S Q;  4CEQ A;  1CZB A;  4NYN A;  4BRG A;  5BRE A;  1RTD A;  3QEW A;  3C7N B;  5LJV A;  1CLQ A;  1S1X A;  1QQM A;  2E6M A;  1WSE A;  3VMF B;  4B1V A;  5TKY A;  1K6Y A;  4CHZ A;  3E9L A;  3TAM A;  4K0K K;  1YI2 N;  4O4G A;  4CJF A;  3OA9 A;  2QM1 A;  3SBT A;  5AQV A;  4CF0 A;  3ZSV A;  2X6S A;  2QK9 A;  3VEZ A;  3KK1 A;  1RDA A;  4DS5 A;  4KHN A;  2QKK A;  4M3T A;  4IOX A;  1HKG A;  4AH9 A;  4BR7 A;  3CM6 A;  3CCU N;  4FWM A;  1UAX A;  2FBX A;  4DV2 K;  4AHT A;  3WEE B;  3IDH A;  1HPZ A;  2RN2 A;  3DYA A;  4FM0 A;  4JD2 A;  3CYM A;  4CFC A;  4NCG A;  4FSV A;  3T1A A;  4BRD A;  3LL3 A;  2VWB A;  3PSF A;  1IKY A;  3E9P A;  4EP5 A;  4KBO A;  1KAZ A;  1YVN A;  4GVM A;  1QSL A;  1GLA G;  1TAQ A;  1WUA A;  1K9M O;  2D4W A;  3B8A X;  4YOT A;  4YFU A;  2GV9 A;  3IS9 A;  2OCE A;  4FW1 A;  3CCS N;  4DUZ K;  4CFD A;  3AA2 A;  3C7N A;  2Q31 A;  3NVM A;  1KVB A;  3LM2 A;  4QCL A;  1KAX A;  4O8U A;  3DLL L;  5LMN K;  3UKR B;  1RBU A;  3MN6 A;  4DF8 A;  3DI6 A;  1BU6 O;  2I7N A;  3M5R A;  3S3O A;  3LDP A;  2NRW A;  3MDQ A;  4LY7 A;  4KPY A;  3WXJ A;  3CQY A;  4DR5 K;  1C0U A;  4DQP A;  4FWS A;  1XMO K;  3QO9 A;  4RW8 A;  5KGW A;  1QE1 A;  5DM6 L;  4DR6 K;  4FK2 A;  1NGI A;  5TKW A;  2BDP A;  3P38 A;  2Q0U A;  4IFE A;  3OYD A;  4Z94 A;  4X64 K;  5GAH P;  1RDU A;  3AVH A;  1K8K B;  2V7Z A;  4WFB L;  1E4G T;  3O9R A;  4CHY A;  3L0Q A;  4BR2 A;  5EU7 A;  4HUG A;  5DMR A;  1HLU A;  3CET A;  4KHY A;  3H6E A;  1JXE A;  3T7Z A;  3H45 C;  4K43 A;  2FLO A;  3KK2 A;  3EN9 A;  4IG3 A;  4B9M A;  3LPT A;  2I7P A;  1WOQ A;  4FLX A;  1KLM A;  1GLD G;  3TWH A;  4B9N A;  1HNW K;  3L2V A;  1DTQ A;  4FWK A;  3SV4 A;  1B9D A;  4OGC A;  3RMD A;  3ZEU B;  3DXK A;  3DRR A;  1HJO A;  4C1N K;  4DG1 A;  3W3D A;  3VN5 A;  3R8E A;  1U4B A;  2P1J A;  3R3L A;  1S1U A;  4DTO A;  4FLT A;  4GNI A;  3RRH A;  3SQ4 A;  4Z4C A;  3ALY A;  2QWP A;  4JI0 K;  3IKM A;  1VSD A;  4A59 A;  2IIR A;  1BIS A;  4CZI A;  3H08 A;  4IFV A;  2O4I A;  4BGA A;  3ZSQ A;  2D1K A;  5ADX A;  4DS4 A;  1QVG M;  4BC2 A;  2A1R A;  4CK1 A;  4H5V A;  2QWO A;  5KPT A;  4BG9 A;  3MMV A;  2NZT A;  1J9A A;  3SJH A;  4A5B A;  1V4S A;  4I6M B;  2XRI A;  2OAN A;  1P90 A;  2KFZ A;  2QI2 A;  2NLX A;  1T03 A;  4E1M A;  1X3M A;  1Z26 A;  5BN9 A;  3AGK A;  1JLB A;  3D6R A;  4DV4 K;  2YJE A;  3PIO L;  4DTS A;  3K2P A;  3LDQ A;  1ASW A;  4FJ8 A;  1B92 A;  1KVC A;  4CJQ A;  3KWG A;  2A40 A;  3G0Z A;  4M3Y A;  1ZYQ A;  2HOE A;  4CF1 A;  1ILY A;  2P9U B;  3ULE B;  3O9Q A;  2V52 B;  4OLB A;  3O1B A;  4H0T B;  3PY8 A;  3HSC A;  5CZ1 A;  2CGJ A;  4BE1 A;  4M63 C;  1IJJ A;  2KZZ A;  2EX3 A;  2HBM A;  3K9J A;  3KLF A;  3CC7 N;  3I0S A;  3SQ0 A;  3ZSW A;  3EO3 A;  5CY4 A;  3U9Z A;  5A2Q O;  2ZD1 A;  5GIN A;  2XY8 A;  1D8Y A;  2HMI A;  3CM5 A;  4DV3 K;  3FGU A;  3AAQ A;  4CJV A;  3L2W A;  2G8H A;  2GWJ A;  4B1U B;  2VG6 A;  4FW2 A;  5AQK A;  4NXM K;  3MN9 A;  3G71 N;  3RR8 A;  3HZ6 A;  4YNQ A;  1XNR K;  3MK6 A;  4C8K A;  5BRH A;  1VSL A;  3LP2 A;  1IG9 A;  5JVH L;  2E8A A;  4NYF A;  4EHU A;  3LDO A;  1SQK A;  4BVO A;  3BGR A;  4DR2 K;  3TTC A;  2P9L A;  3WXK A;  5KPZ A;  4B9S A;  4JKA A;  1EQY A;  3HM9 A;  1IKV A;  1V4T A;  3IG1 A;  3AO4 A;  3MN7 A;  5FPM A;  3PIP L;  2D0P A;  3WNE A;  1NJW A;  3WUH A;  4B9V A;  3IUC A;  4CHQ A;  3CCL N;  3DXM A;  4FPB A;  4L3Q A;  1C0F A;  4B3R K;  1RBR A;  5C15 A;  4IZ9 A;  3DJC A;  4HWI A;  4IO8 A;  4H03 B;  2IGI A;  1VK0 A;  4H0P A;  4DFJ A;  1RTI A;  5HOO A;  4JI2 K;  3J81 O;  4KFB A;  2CH5 A;  1ATS A;  1LAV A;  5ELZ A;  2UYT A;  5FPD A;  1JLE A;  5AQS A;  2P9N B;  1WB9 A;  4FJK A;  3AAP A;  1IH7 A;  3AO5 A;  1SL0 A;  5HL7 L;  5BRD A;  4CJ7 A;  4UY8 O;  3SMP A;  4BRE A;  3IMX A;  1LCU A;  3TTF A;  4CZE A;  4KB0 A;  2PAV A;  3L4I A;  4FWP A;  1LWF A;  3S41 A;  3OYC A;  4ZHR A;  4E7H A;  3NGZ A;  3R6M A;  3ZSZ A;  3CCM N;  4FM2 A;  4K25 A;  5AFU A;  1JLF A;  3FZF A;  1EX4 A;  2YV0 X;  1Q9X A;  1MWM A;  1ZBU A;  4MLE A;  3NAE A;  4BR5 A;  4YOU A;  4CZF A;  4DR3 K;  2Q1N A;  3ZET A;  4LF7 K;  3AVB A;  3L2R A;  3C6T A;  4YDU A;  3HL8 A;  5JMV A;  1NK0 A;  3LAM A;  1Z6R A;  4IOA L;  3CME N;  4MDA A;  3K59 A;  4BQZ A;  2P9S B;  4ID1 A;  3R9P A;  4CJP A;  2A41 A;  3I8B A;  3R1X A;  2HHQ A;  3H3O B;  1EWQ A;  3K58 A;  2HHH K;  3J7Y P;  3PO4 A;  2G8V A;  3AVN A;  3HO1 A;  5T7B A;  2W40 A;  4CES A;  4CJK A;  1KD1 O;  3P5J A;  3D2E B;  5ADX H;  3KKS A;  5B8H A;  2PY5 A;  2YKM A;  4FJN A;  4CZH A;  2BUP A;  2E2P A;  3WQU A;  5KRT A;  4BRN A;  1JLC A;  3P1G A;  4H5T A;  3NVK A;  4I2P A;  4BY9 C;  4DQQ A;  4LF9 K;  2GUI A;  4RG8 A;  4KRE A;  4IDK A;  4GV3 A;  3C65 A;  5JS1 A;  2A6A A;  1K8K A;  3VQ6 A;  1GOA A;  1Q18 A;  1NU0 A;  2PFU A;  1HNZ K;  2FSK A;  2UXB K;  3SNN A;  1EKE A;  4Z4G A;  4JEP A;  1XC9 A;  1SKS A;  2F9T A;  4CEB A;  4BRI A;  2GBZ A;  3ZSR A;  4CJR A;  3M8S A;  4F3O A;  1VRU A;  4DMN A;  4KI6 A;  3AGR A;  3QER A;  3VQ9 A;  4FJI A;  1YJN N;  3LPU A;  3V9W A;  1WNS A;  4BRC A;  2CGL A;  1QTM A;  4AIL C;  2DFE A;  3L2U A;  4BR0 A;  1BHL A;  3RMB A;  4YOX A;  3HP6 A;  2JGU A;  2WBN A;  2EWS A;  4AHU A;  2YHW A;  1VQ5 N;  4KH4 A;  4DV5 K;  4W5O A;  1NGE A;  2H3G X;  3I8D A;  3AO1 A;  3OYH A;  4GKK K;  2XHB A;  1YT3 A;  4FWR A;  5E41 A;  3RSE B;  5KTQ A;  3MEC A;  3CG7 A;  4CCH A;  3A0I X;  3TR8 A;  3VQE A;  1J54 A;  3SAF A;  1HYV A;  4LSL A;  3VEO A;  3ZX3 A;  4HUF A;  3G10 A;  1VQP N;  4O44 A;  3HVT A;  3VQ8 A;  4FZX C;  4M3Z A;  2ZQB A;  3ZCM A;  2V7Y A;  2AP1 A;  3HST B;  1IKX A;  2HHT A;  4FJL A;  2O8D B;  3LP0 A;  4A2A A;  4Z4H A;  4A57 A;  1C1C A;  3HYF A;  3EZW A;  4IJN A;  3N4P A;  5AQI A;  3OJS A;  2BE2 A;  1EXQ A;  3LAK A;  3JYT A;  1WSF A;  3O4W A;  2FBT A;  2D0B A;  3MCP A;  5EOY A;  1S5J A;  1OH8 A;  1HQE A;  3WXL A;  1C0T A;  3RSE A;  4KV8 A;  1S1W A;  4LFB K;  1Z05 A;  4X65 K;  3QNN A;  5MLC Q;  3OBW A;  5AFU H;  3C6U A;  3O5B A;  4CGG A;  4PKG A;  1EO1 A;  3THW A;  1KLN A;  3CCJ N;  3WNF A;  4OPH A;  3HPG A;  2FF3 B;  3LZI A;  3C6A A;  4FZZ A;  3P39 A;  3Q7C A;  3OYE A;  3KK7 A;  3A2F A;  5M1P A;  4FYD A;  1RTH A;  1FKO A;  5IWA K;  3MEE A;  3K5M A;  3NH0 A;  1YHQ N;  1W97 L;  4ZTJ A;  1Q9Y A;  3HOS A;  2O8C A;  1WLJ A;  3CQX A;  1NK6 A;  3QBW A;  4NO7 A;  4OKE A;  4YOW A;  1QZ6 A;  3I56 N;  3CPE A;  3TSQ A;  4JK7 A;  5K14 A;  4CF8 A;  1N5Y A;  3DLH A;  3VQC A;  1NOZ A;  4M7Y A;  3AA5 X;  4IEI A;  5JLF A;  1ZBF A;  1RTJ A;  3KIO A;  3MX2 A;  4DTR A;  3F73 A;  2E2Q A;  4KH5 A;  5EY4 A;  1FK9 A;  2A5X A;  4BRA A;  3HT3 A;  4F2R A;  4ILH A;  5CR4 A;  4CHN A;  1M90 O;  4C8M A;  5AQM A;  5M1N A;  1K8A O;  4JK8 A;  1FJG K;  4JI6 K;  4DUY K;  5FRM A;  1T3V A;  3Q7B A;  1NGB A;  3ZT2 A;  5AQT A;  4M3X A;  5AQH A;  4H5R A;  5KQD A;  2RKI A;  4DQS A;  3WNG A;  3HOT A;  3KD1 E;  4CK2 A;  4JS4 A;  5HRN A;  4A2B A;  3D7E O;  1A5W A;  1SUQ A;  2JWK A;  5KRS A;  4BRP A;  1NGH A;  3VQP A;  4I2Q A;  3TTD A;  2P9S A;  1NKC A;  4J2B A;  4YDU C;  1T6C A;  1S6Q A;  1TGO A;  3J7A P;  4E19 A;  3P4I A;  4O5F A;  3SCX A;  1L3V A;  1HMV A;  1T6D A;  1ZC6 A;  2YJF A;  4K41 A;  4B3O A;  2IDO A;  1C6V A;  2P9N A;  3C6H A;  3B6P A;  4MQ3 A;  5AZJ A;  1N36 K;  1SL2 A;  4IJA A;  4CGF A;  3BY5 A;  1GLC G;  1HPM A;  2RF2 A;  3L3V A;  3KJV A;  3M8R A;  3CCQ N;  4EAH D;  3P31 A;  1IV0 A;  3BEX A;  4FWQ A;  4CEE A;  4FOI A;  3ATU A;  4JN4 A;  3ZSY A;  4M3U A;  5EVZ A;  3DM2 A;  1LOT B;  3CJ1 A;  4PHT X;  1TKX A;  3NF7 A;  3QML A;  1LW0 A;  2ZF5 O;  4ID5 A;  2OPQ A;  3SUN A;  3AVK A;  3M8P A;  2GWK A;  1Q82 O;  1SAZ A;  3RVC A;  1NGJ A;  4CJT A;  4CED A;  4F4K A;  1NGC A;  1HR0 K;  5CZ2 A;  2WOM A;  4B1Y B;  5BN8 A;  4CZJ A;  4CZK A;  3C95 A;  5CYM A;  1TK5 A;  3FZH A;  3T69 A;  3QET A;  2GX9 A;  4DCH A;  2JWL A;  3SYZ A;  4BRM A;  3TSU A;  3KVG A;  1OH7 A;  2DFH A;  3J80 O;  5BR8 K;  1TK8 A;  1OKJ A;  2Z1J A;  4ILG B;  1ASU A;  4H5W A;  2HVH A;  5HP1 A;  2E1Z A;  3BP8 A;  1IO2 A;  3NMU A;  1X1P A;  3A5M C;  4KKO A;  4WYB A;  3AO2 A;  3VGM A;  2IAJ A;  1I94 K;  3MN5 A;  2KHO A;  4E7K A;  5I3U A;  3KLH A;  5FRO A;  4JS5 A;  1JLQ A;  4RTF D;  4BRK A;  4E3S A;  1VSI A;  4WQ5 C;  4WE1 A;  2ZE2 A;  3LP1 A;  4ICL A;  4GW6 A;  2P5O A;  4MO5 A;  1U47 A;  3ZEU A;  3OHR A;  3TSP A;  2W6L A;  3EYZ A;  4DSE A;  1D5A A;  2QEX N;  1D4X A;  3T3F A;  4AHS A;  1JKH A;  1NOY A;  2DFF A;  3EEQ A;  2I5J A;  5J1E A;  4DWI A;  1NK8 A;  5SZT A;  1W9H A;  3SPY A;  3TI0 A;  2KW4 A;  4DR1 K;  3O1W A;  4CFB A;  1BL3 A;  1Q7Y O;  2YHY A;  3EL2 A;  2A1S A;  3F9M A;  1XUP O;  3H3N O;  2FSN A;  4FL9 A;  2Q3S A;  1IKW A;  3KLI A;  3RR7 A;  5HRR A;  4JLH A;  3SAH A;  4FLU A;  4OPA A;  2YNI A;  4J2A A;  3VQ5 A;  4KH6 A;  2QTD A;  3JAM O;  2P9P A;  4Z0U A;  4NLB A;  1BI4 A;  1RT4 A;  1LWE A;  2AA4 A;  2WFB A;  1WN7 A;  3RTV A;  4WF9 L;  1NG9 A;  4BR4 A;  2OTJ N;  3VOV A;  2IOC A;  1WSH A;  5LMU K;  4DFP A;  4FZY A;  4JKG B;  5M1O A;  3HPH A;  1RNH A;  4H4M A;  3F9K A;  1VSK A;  4J8F A;  4JRP A;  3TAF A;  4B9L A;  2FXU A;  3ZT3 A;  1JXB A;  2E2O A;  4LD0 A;  1GLE G;  2FSJ A;  1HNX K;  1D9D A;  2WON A;  5AQU A;  3PV8 A;  3KTQ A;  1XHX A;  4YHH K;  2CGK A;  1S22 A;  4LSN A;  1LV5 A;  3L6Q A;  4MDB A;  2VWJ A;  4ZTF A;  2QXF A;  3DRP A;  4CGD A;  3EKS A;  3SZ2 A;  4DFM A;  3DLK A;  3IFR A;  4B3T K;  4OVL A;  5CE3 A;  1IBK K;  5KGX A;  1J5O A;  3V9U A;  1SL1 A;  4X62 K;  1P8Z A;  1RDB A;  3TAQ A;  4H0X B;  1VSF A;  1KVA A;  3ULD A;  3KD5 E;  1QZ5 A;  3D2F B;  3MCA B;  2QW9 A;  3TAB A;  4Z4E A;  4I7F A;  3WQT A;  4AM6 A;  1QQN A;  3FZK A;  1BOT O;  4CJL A;  1RBS A;  4KHS A;  3LP3 A;  1QHT A;  4KTZ A;  3THX A;  4CVN E;  4KHU A;  1VQ6 N;  2G8I A;  3LM9 A;  3RRG A;  1TUU A;  5F0X A;  4B1Z A;  4JI7 K;  2O8B B;  1QQC A;  3SJJ A;  4W5Q A;  1A5X A;  4H4O A;  4CIF A;  4JK9 A;  3UIQ A;  1T7P A;  4N76 A;  2P9K B;  3CIP A;  2OPP A;  2ETJ A;  1JLA A;  4GVE A;  1Y97 A;  1YF5 L;  2IC3 A;  3ZT1 A;  5D3G A;  2FBV A;  3SBG A;  5FLX O;  2E1Y A;  2W42 A;  3V9Z A;  1DKG D;  4HTU A;  1HKC A;  2VG7 A;  2Q36 A;  4DQ8 A;  3SQ2 A;  1RT7 A;  4I9L A;  5AR0 A;  4CE9 A;  4PY5 A;  3THW B;  2P9I B;  3KLG A;  3VF6 A;  4C1N I;  2HHX A;  3ATV A;  3T1H K;  4GY2 B;  1WAF A;  1Q81 O;  3OY9 A;  5AQG A;  4ISE A;  1J6Z A;  1YVU A;  3NDK A;  4JKC A;  2B6A A;  4BRH A;  4JKE A;  1QHA A;  4B9U A;  1TUY A;  3ENH A;  2OYQ A;  4NLC A;  3VEV A;  2W6K A;  3JS6 A;  5LJW A;  2PBD A;  4BRF A;  3FLC O;  2G8U A;  3OYN A;  4KO0 A;  1T44 A;  4UQG A;  3G4S N;  2BGG A;  2UXC K;  4DV1 K;  4DLE A;  1L3U A;  2NRH A;  2BH1 A;  4CJE A;  5AQZ A;  5AZI A;  2ASO A;  1DGK N;  3HRG A;  4JI8 K;  2DY4 A;  3UB5 A;  3SMS A;  3ZSO A;  2O8E A;  4FLV A;  1VSM A;  1QVF M;  1NGA A;  4JRQ A;  1BIZ A;  1SZ2 A;  3AA3 A;  5C12 A;  3V81 A;  4CD3 A;  4F9O A;  3AV9 A;  4FLY A;  2O8E B;  4OKK A;  1HX1 A;  2OPS A;  1QSY A;  3THV A;  3PUF A;  2YHB A;  3ZX2 A;  2BTF A;  4JKB A;  2RPI A;  3BUZ B;  1DEJ A;  3KHY A;  1S72 N;  4MLH A;  4EIA A;  3J8A A;  2OZS A;  4M3R A;  3BDP A;  1VSE A;  4FWN A;  4K8X A;  3K5N A;  3SK3 A;  3FZM A;  4FJX A;  2E2N A;  4CZL A;  5C10 A;  4GKJ K;  2Y1I A;  4CEC A;  4DV6 K;  1N33 K;  2F9W A;  1RDD A;  3TAG A;  3DMJ A;  4XH1 A;  3BZK A;  3E9O A;  2O8C B;  2VQF K;  2HHV A;  1OH5 A;  3RMC A;  4J2E A;  3F5T A;  2ZGZ A;  3CFP A;  3PLA A;  4H0O A;  3O08 A;  1FW6 A;  1NM1 A;  4BR9 A;  4O55 A;  1RFQ A;  1FKP A;  3CI5 A;  2KFN A;  4AHC A;  1LW2 A;  3NGY A;  1L3T A;  4RW4 A;  1XMQ K;  3M6G A;  3HJF A;  2HNZ A;  2IVN A;  2F96 A;  4ISG A;  4DTP A;  4CIG A;  2ASP A;  3AVA A;  2F8T A;  3MXJ A;  4HVJ A;  3KKR A;  3VEY A;  5KI6 A;  4CEZ A;  3G6E N;  4IEE A;  2P9K A;  4KHQ A;  3D2E A;  5GIP A;  2IVP A;  5AZI B;  3E1Y A;  5F1X A;  4W5R A;  1JL1 A;  2GEL A;  4IDH A;  3LAN A;  1X9M A;  3ZT4 A;  2B5J A;  3QFU A;  1ITG A;  4FOE A;  5DK5 A;  1BIU A;  3AA4 A;  3THX B;  1Q8I A;  2ITG A;  2XO7 A;  1SV5 A;  3D45 A;  3VQA A;  1E4F T;  3FZL A;  1CZA N;  5FDL A;  3VA0 A;  1SKW A;  1DTT A;  1VSJ A;  2E88 A;  3VEW A;  1E3M A;  4OJR A;  1XQS C;  1BUP A;  3CMA N;  4RWT A;  1VHX A;  3DRS A;  1OVY A;  3CJC A;  3O3G A;  3U3G A;  4FO0 A;  4W5N A;  4CJ4 A;  5C25 A;  1O1W A;  5SWM A;  1NK7 A;  4FJ7 A;  3C0B A;  4G1Q A;  4A5A A;  4HCB A;  1GOC A;  3QEX A;  1NGD A;  2HF4 A;  1N8R O;  2NRZ A;  4X66 K;  2BAN A;  2YX6 A;  3MXI A;  2KTQ A;  4LF4 K;  1VAZ A;  1UA0 A;  2Q97 A;  5C2F A;  1ATN A;  1TL3 A;  4OGE A;  3G25 A;  3T1Y K;  3NH2 A;  3ENB A;  3TAN A;  1H1V A;  5HBM A;  3QFP A;  3QBX A;  3NH1 A;  2HBK A;  4B9T A;  3QES A;  3OYG A;  2O8B A;  1J5E K;  4CEO A;  4F3T A;  2DPN A;  1YIJ N;  4BC3 A;  3ZYY X;  5BR9 A;  2F8S A;  4G9Z A;  3ENO A;  2UU9 K;  3V1Q A;  4H0V B;  1QS4 A;  4GMJ B;  4K8Z A;  5I42 A;  1I39 A;  4CF2 A;  1VQ8 N;  5I9E B;  2YNF A;  3O9S A;  4DQR A;  1HQU A;  4KAZ A;  3THY A;  3OYK A;  3U8X A;  1NJX A;  3QEV A;  2UUB K;  4BRQ A;  2KQ2 A;  5FPN A;  3OYA A;  3VEN A;  3TU5 A;  4IBN A;  3PO5 A;  1T05 A;  3OYM A;  2UUC K;  3LDL A;  4BWJ A;  1TAU A;  4DTU A;  4FJ5 A;  1X9S A;  4JI3 K;  2HBJ A;  3LWL A;  2YKN A;  3WXM B;  2OTL N;  3LWM A;  2HHW A;  1DLO A;  3AY9 A;  1W2B M;  1L3S A;  2LSN A;  4FJJ A;  4FJH A;  4O0I A;  4OO1 J;  4DSI A;  3ZET B;  4AM7 A;  4N41 A;  2P9U A;  3CC2 N;  3AVL A;  2A3Z A;  4JI4 K;  2NUB A;  1XC3 A;  3U4L A;  4JI1 K;  3A5N C;  4DTM A;  4EFH A;  3DLG A;  3QIN A;  1NGF A;  2OPR A;  2Z1I A;  4CBU A;  1U45 A;  3NHG A;  5GAG P;  4M45 A;  2GUP A;  2AJQ A;  2XY7 A;  4AHR A;  2VGM A;  4IXC A;  3ITH A;  1NK5 A;  4LFA K;  2JLE A;  4K42 A;  4EZ9 A;  2ZM6 K;  2D0O A;  1BI4 B;  4BDP A;  4FJG A;  1QSS A;  4ELV A;  1U48 A;  1WAJ A;  4O5B A;  1NGG A;  1IBM K;  2FC0 A;  4PKH A;  1NNE A;  1JCF A;  3O80 A;  3SV3 A;  2X6N A;  4BG8 A;  3OYI A;  2VYP A;  4BGB A;  1KCF A;  3V6D A;  4FK0 A;  4CHO A;  3O4Q A;  4B1X B;  3HI0 A;  3OW2 M;  3QLH A;  1TKD A;  1JLG A;  1KAY A;  1TKZ A;  2ZWH A;  5JS2 A;  3O9U A;  1ESV A;  2Q0R A;  1CXQ A;  2P5G A;  4R5P A;  5E26 A;  3V9X A;  4JKG A;  3VTH A;  3QIO A;  3RMA A;  1ZBI A;  3GBT A;  1YJW N;  3ID6 A;  2OA8 A;  1U6Z A;  3VTI A;  2IVO A;  5HRS A;  1NJI O;  4CFA A;  5J2M A;  4DSJ A;  3OS0 A;  2ZGY A;  4WQ5 A;  1XHZ A;  5C42 A;  1NKB A;  4DR4 K;  1YXQ A;  2HST A;  3VF4 A;  3GE1 A;  4FJM A;  4FLW A;  1REV A;  3FFI A;  2WC9 A;  3BZC A;  3GG4 A;  4F2S A;  3CF5 L;  1WSI A;  3VEX A;  2G8K A;  4WQ4 A;  4DTJ A;  2CH6 A;  3I0R A;  2D0C A;  3OYL A;  2QWL A;  1Z25 A;  4BRO A;  4YOY A;  2GEM A;  2F7T A;  4IOC L;  3KK3 A;  3QB0 A;  3SUO A;  2YHA A;  2J4R A;  1YAG A;  3CC4 N;  4JI5 K;  1RT3 A;  3FR0 A;  3ULE A;  3S9H A;  3L2Q A;  3ZT0 A;  3NF9 A;  2ATQ A;  2ITM A;  2YNH A;  3W0L A;  1VQL N;  4PQU A;  2EHG A;  3VGK A;  1RT1 A;  1KXP A;  2KZM A;  3AVM A;  4IO9 L;  2HHS A;  1YTA A;  1RBT A;  4U67 L;  4FJ9 A;  4CZG A;  4JYA K;  3O8M A;  4PL8 A;  4JV5 K;  5C0Y A;  2QWQ A;  3A5O C;  1EET A;  5AZJ B;  1IBL K;  4FVM A;  1RDC A;  5AQY A;  4MFB A;  3JSM A;  1UOC A;  1CXU A;  1C0M A;  5C2D A;  4L8R B;  4CJS A;  3E66 A;  4H5N A;  1Y64 A;  1HNV A;  3WXI A;  2G8F A;  1WBB A;  4CI6 A;  4O8K A;  4PA1 A;  1EP4 A;  1BCO A;  4FWO A;  1T8E A;  3V1R A;  3LZJ A;  5AJ3 K;  4WFN L;  4R79 A;  4JD2 B;  4FK4 A;  4CJW A;  4M3W A;  2HBL A;  3LAL A;  1RGI A;  4DV0 K;  1F21 A;  5KPR A;  4ELT A;  5HLF A;  3WEE A;  4CER A;  3U3Y A;  5M1F A;  2VCP A;  1CZ9 A;  4IWV A;  1I3A A;  1N34 K;  3H46 O;  2HB5 A;  1VQM N;  4PUO A;  1LAW A;  4QS8 A;  3OYJ A;  1S9G A;  2E20 A;  2D0A A;  3E01 A;  4KB1 A;  3EE8 A;  2X74 A;  3H1V X;  1BCM A;  4JAX A;  5CYQ A;  2E5L K;  4GV9 A;  3HXM A;  3CD6 N;  1J53 A;  2FF6 A;  3TAP A;  3SLC A;  4DSF A;  4EP4 A;  4A61 A;  1VQN N;  2PYL A;  5HRO A;  3H1Q A;  4M41 A;  2D5R A;  1NMN A;  4CGJ A;  5AQP A;  5AQX A;  1MWK A;  1N6Q A;  1NMD A;  4YOV A;  5DM7 L;  4KI4 A;  3GOI A;  4DSL A;  5AQL A;  4DU1 A;  4W5T A;  4DLG A;  4M42 A;  3K57 A;  3DWL A;  2Q2R A;  4B3S K;  1ZXO A;  3O3F A;  1FXX A;  3AVF A;  1HYZ A;  4RW6 A;  1R59 O;  1GLL O;  2VQE K;  3PX0 A;  5EXW A;  1BA1 A;  5AQF A;  3KLE A;  4OX9 K;  1MU2 A;  2RHK A;  3KZB A;  3M1F A;  4CGI A;  4B08 A;  4CEF A;  5M1K A;  2NRR A;  3K5L A;  3UE5 A;  3TPQ A;  3CPW M;  1X9J A;  3K0S A;  3M8Q A;  4XH4 A;  4OLA A;  3CCV N;  5AQJ A;  4N5S A;  4B3M K;  3NBP A;  2G8W A;  3L3U A;  4Q5V A;  3F2K A;  1HRH A;  1KC8 O;  1VQO N;  1XNQ K;  2QWN A;  2UUA K;  3DAW A;  1UA1 A;  1TVR A;  2YCH A;  1ZBL A;  3U9D A;  2W41 A;  4CHP A;  4E7L A;  3CER A;  1RT2 A;  3UKU A;  1U04 A;  4H0Y B;  2ZJP L; 
#chains in the Genus database with same CATH homology
 4IEE A;  1KAZ A;  1QZ6 A;  1YVN A;  2ASM A;  2P9K A;  3CPE A;  3D2E A;  3I56 N;  1YIT N;  5GIP A;  3TSQ A;  2IVP A;  5AZI B;  4JK7 A;  3E1Y A;  1GLA G;  1RDW X;  1WUA A;  1GLB G;  3MWT A;  5F1X A;  1K9M O;  2D4W A;  3B8A X;  3CHW A;  2GEL A;  4IDH A;  4YOT A;  3CCS N;  4IEI A;  4FOE A;  3QFU A;  4M7Y A;  5JLF A;  3MX2 A;  4BVP A;  3C7N A;  2Q31 A;  3BF1 A;  1GLJ O;  3NVM A;  2E2Q A;  4KH5 A;  4BQL A;  1U2V B;  5EY4 A;  2A5X A;  3LM2 A;  5GAE P;  4BRA A;  3WT0 A;  1KAX A;  4WQ4 C;  1E4F T;  3FZL A;  1CZA N;  4O8U A;  3DLL L;  4ILH A;  3HBT A;  3UKR B;  5CR4 A;  3MN6 A;  1M90 O;  2E88 A;  3VEW A;  2ZJQ L;  1BU6 O;  2I7N A;  3M5R A;  3LDP A;  2NRW A;  3MDQ A;  1XQS C;  1BUP A;  4ISF A;  3WXJ A;  3CQY A;  5AQM A;  5EX5 A;  3CMA N;  4FVU A;  3N4Q A;  3O6W A;  4NB4 A;  4JK8 A;  4M7X A;  5M1N A;  4RWT A;  4WFA L;  1K8A O;  1OVY A;  3K9K A;  1T3V A;  2P9P B;  4FWS A;  3CJC A;  3Q7B A;  1NGB A;  5DM6 L;  4FO0 A;  5AQT A;  5JIC A;  1NGI A;  5TKW A;  5AQH A;  3P38 A;  4H5R A;  5KQD A;  2Q0U A;  3C0B A;  4IFE A;  4Z94 A;  3FE1 A;  5GAH P;  4A5A A;  3CJA A;  3HOT A;  1RDU A;  1K8K B;  1NGD A;  2HF4 A;  2V7Z A;  2NRZ A;  1ZBS A;  4A2B A;  3D7E O;  1N8R O;  4WFB L;  1E4G T;  2VGN A;  2YX6 A;  3O9R A;  3L0Q A;  2JWK A;  5BPL A;  4BR2 A;  2QWM A;  4BRP A;  1NGH A;  1VAZ A;  5LY3 A;  3TTD A;  1HLU A;  2Q97 A;  2P9S A;  3CET A;  5C2F A;  1ATN A;  3H6E A;  4YDU C;  2ZJR L;  1T6C A;  3T7Z A;  1S3X A;  3H45 C;  4K43 A;  2FLO A;  3G25 A;  3EN9 A;  3P4I A;  2P9L B;  4O5F A;  1Q86 O;  4GV6 A;  4FPA A;  1T6D A;  3ENB A;  1ZC6 A;  2YJF A;  1H1V A;  4K41 A;  3AAR A;  3QBX A;  3QFP A;  2I7P A;  1WOQ A;  2HBK A;  5AQN A;  1GLD G;  2P9N A;  4FWK A;  3C6H A;  5CHI A;  5AZJ A;  1IG8 A;  4IJA A;  1GLC G;  1HPM A;  3CCQ N;  4EAH D;  3P31 A;  3ZEU B;  3DXK A;  3VES A;  2DPN A;  3BEX A;  1YIJ N;  4FWQ A;  1YJ9 N;  1HJO A;  4FOI A;  2KLA A;  4BC3 A;  3DXM B;  3ZYY X;  4C1N K;  5BR9 A;  4G9Z A;  4RCH A;  3ATU A;  3ENO A;  4JN4 A;  3W3D A;  1HKB A;  5EVZ A;  3R8E A;  5JLH A;  1LOT B;  3CJ1 A;  4JHD B;  3R3L A;  4PHT X;  4H0V B;  1M1K O;  3QML A;  2ZF5 O;  2KKZ A;  4GNI A;  3J7Z O;  4ILJ A;  1BA0 A;  2QWP A;  3IKM A;  4A59 A;  4JHD A;  4WCE L;  2IIR A;  3A8Y A;  4JKF A;  1Q82 O;  2GWK A;  4CZI A;  1SAZ A;  3QDK A;  3RVC A;  5I9E B;  1NGJ A;  4BGA A;  3O9S A;  1NGC A;  2D1K A;  5ADX A;  5AQQ A;  5AQO A;  1QVG M;  3OBY A;  4BC2 A;  3U8X A;  4B1Y B;  5BN8 A;  4CZJ A;  4CZK A;  3MX5 A;  4BRQ A;  3FZH A;  5AQR A;  3T69 A;  4H5V A;  2GX9 A;  2QWO A;  5KPT A;  5FPN A;  4DCH A;  3VEN A;  3TU5 A;  4BG9 A;  2JWL A;  3MMV A;  4BRM A;  3TSU A;  3KVG A;  2NZT A;  3LDL A;  3SJH A;  3GL1 A;  3MWP A;  4A5B A;  1SS6 A;  3FFK B;  1V4S A;  4JNE A;  4I6M B;  3GDQ A;  1OKJ A;  2OAN A;  1P90 A;  4ILG B;  2QI2 A;  2NLX A;  2HBJ A;  4H5W A;  3CXC M;  3WXM B;  2OTL N;  1HUX A;  2E1Z A;  3BP8 A;  3AY9 A;  3BF3 A;  3CJB A;  1W2B M;  1X3M A;  3A5L C;  3NMU A;  3A5M C;  5BN9 A;  3AGK A;  4WYB A;  3VGM A;  3D6R A;  2YJE A;  2NRX A;  3MN5 A;  3PIO L;  4OO1 J;  2KHO A;  3LDQ A;  2QWR A;  4I6M A;  3ZET B;  4AM7 A;  2P9U A;  3CC2 N;  2A3Z A;  4RTF D;  4BRK A;  4WQ5 C;  3KWG A;  1BO5 O;  1XC3 A;  2HF3 A;  2A40 A;  3U4L A;  3A5N C;  4MO5 A;  4EFH A;  3EKU A;  3ZEU A;  3OHR A;  2HOE A;  1NGF A;  3TSP A;  1ILY A;  2P9U B;  1NWK A;  3I33 A;  3O9Q A;  2QXL A;  2V52 B;  3ULE B;  3O1B A;  4CBU A;  4H0T B;  3HSC A;  5GAG P;  2CGJ A;  2QEX N;  4M63 C;  1D4X A;  2GUP A;  3CCR N;  1IJJ A;  3HM8 A;  4LC9 B;  2HBM A;  2VGM A;  3K9J A;  4IXC A;  3VF2 A;  4K42 A;  3CC7 N;  2D0O A;  1VQ4 N;  1NGG A;  3EO3 A;  3U9Z A;  4PKH A;  1JCF A;  3O80 A;  5GIN A;  3O1W A;  5BRF A;  4BG8 A;  1U2V A;  3AAQ A;  3FGU A;  2VYP A;  2YHY A;  3EL2 A;  2GWJ A;  3F9M A;  1XUP O;  3H3N O;  4AF1 A;  4BGB A;  2FSN A;  4B1U B;  4B1X B;  4FL9 A;  1ATR A;  3HI0 A;  5AQK A;  4MO4 A;  3G71 N;  3OW2 M;  3MN9 A;  3HZ6 A;  1KAY A;  3MK6 A;  5BRH A;  2ZWH A;  3SAH A;  5JVH L;  2E8A A;  5BPM A;  3O9U A;  1ESV A;  4EHU A;  3LDO A;  1SQK A;  4OPA A;  2Q0R A;  4BVO A;  3TTC A;  1BG3 A;  2P9L A;  4KH6 A;  5E26 A;  2QTD A;  3WXK A;  5KPZ A;  3ID8 A;  1EQY A;  2P9P A;  4JKG A;  4JKA A;  3VTH A;  3GBT A;  4NLB A;  3ZX0 A;  1V4T A;  1YJW N;  3MN7 A;  3ID6 A;  5FPM A;  3PIP L;  2D0P A;  2AA4 A;  3WUH A;  3SAG A;  2WFB A;  4DB3 A;  3IUC A;  5M1Q A;  4WF9 L;  1U6Z A;  3CJ9 A;  2IVO A;  1YUW A;  4JKD A;  3VTI A;  4BR4 A;  4EHT A;  3JXU A;  3VOV A;  1NJI O;  1BWF O;  3DXM A;  4FPB A;  4JKG B;  4L3Q A;  1C0F A;  1X3N A;  5M1O A;  4CD1 A;  4C23 A;  2ZGY A;  4WQ5 A;  5C15 A;  4IZ9 A;  2GTD A;  3DJC A;  4J8F A;  4HWI A;  4IO8 A;  1YXQ A;  2FXU A;  2HST A;  3VF4 A;  4H03 B;  3GE1 A;  4H0P A;  2E2O A;  5HOO A;  3O9T A;  2FSJ A;  1GLE G;  4DKW A;  2WC9 A;  1GLF O;  2CH5 A;  1VQK N;  1ATS A;  5AQU A;  5ELZ A;  3GG4 A;  2UYT A;  4BC4 A;  4CBW A;  3VEX A;  5AQS A;  2P9N B;  5FPD A;  3CF5 L;  2CGK A;  4WQ4 A;  2YHX A;  2CH6 A;  3AAP A;  1S22 A;  1JJ2 M;  2QWL A;  4BRO A;  3L6Q A;  5HL7 L;  4MDB A;  5BRD A;  4CJ7 A;  4YOY A;  2GEM A;  3UKR A;  1VQ7 N;  4UY8 O;  4B9Q A;  3SMP A;  4BRE A;  2F7T A;  1O13 A;  3EKS A;  1LCU A;  3IMX A;  4XEI A;  4IOC L;  4YOR A;  3IFR A;  3QB0 A;  3TTF A;  2NNW A;  4CBX A;  4CZE A;  5CE3 A;  1Q7Y O;  5GAD P;  2J4R A;  2PAV A;  3L4I A;  4FWP A;  1YAG A;  3S41 A;  3CC4 N;  3FR0 A;  3CCE N;  3EE9 A;  3HTV A;  3ULE A;  4JKH A;  4U7B A;  3R6M A;  3CCM N;  1P8Z A;  4K25 A;  5AFU A;  4H0X B;  2ITM A;  1QZ5 A;  3FZF A;  3W0L A;  1DT9 A;  3D2F B;  1VQL N;  3MCA B;  2QW9 A;  3VGK A;  1MWM A;  4A62 A;  2WUS A;  1KXP A;  5E84 A;  4MLE A;  3WQT A;  4BR5 A;  4IO9 L;  4YOU A;  4PL7 A;  4CZF A;  4AM6 A;  2Q1N A;  1VQ9 N;  3ZET A;  1QQN A;  3FZK A;  3UKU B;  1BOT O;  3LDN A;  4YDU A;  5JMV A;  4IOA L;  1Z6R A;  4U67 L;  4CZG A;  5KQ8 A;  4E1J A;  3CME N;  4MDA A;  4BC5 A;  5GIO A;  4BQZ A;  3O8M A;  1NLV A;  2P9S B;  4FWL A;  3R9P A;  4PL8 A;  2A41 A;  2V51 B;  3I8B A;  3R1X A;  4B1W B;  5JVG L;  1VQ6 N;  5C0Y A;  3LM9 A;  2QWQ A;  3A5O C;  3QIC A;  5AZJ B;  3H3O B;  1TUU A;  5F0X A;  4B1Z A;  2YI1 A;  5AQY A;  1BDG A;  2W40 A;  1K73 O;  5FPE A;  1KD1 O;  4JK9 A;  3D2E B;  3VER A;  5ADX H;  5B8H A;  2P9K B;  3CJ7 A;  3KWI A;  5C2D A;  4CZH A;  3CIP A;  3E66 A;  1G99 A;  2BUP A;  2E2P A;  3WQU A;  4BRN A;  4H5N A;  4H5T A;  1MA9 B;  1Y64 A;  4GVE A;  3NVK A;  3WXI A;  1YF5 L;  4CI6 A;  4O8K A;  4BY9 C;  4FWO A;  3SBG A;  2E1Y A;  5AQW A;  4GV3 A;  1DKG D;  2NRV A;  3C65 A;  4R79 A;  2NRT A;  4JD2 B;  2A6A A;  1HKC A;  4WFN L;  1K8K A;  2Q36 A;  4DQ8 A;  3VPZ A;  2HBL A;  1RGI A;  4DHY A;  1Q18 A;  4XH5 A;  2PFU A;  5AR0 A;  5BPN A;  2FSK A;  3G6E N;  1MDU B;  2P9I B;  4QS9 A;  5KPR A;  3DXK B;  4QS7 A;  3VGL A;  4JEP A;  3CCL N;  3WEE A;  1QQO A;  2F9T A;  2RE2 A;  3VF6 A;  4C1N I;  5M1F A;  1JCE A;  2VCP A;  4BRI A;  3L4Q A;  4IWV A;  3ATV A;  4GY2 B;  1Q81 O;  1JCG A;  3H46 O;  2HMP A;  3I55 N;  1VQM N;  5AQG A;  4ISE A;  4QS8 A;  1J6Z A;  4JKC A;  3AGR A;  2E20 A;  4BRH A;  4JKE A;  1QHA A;  1TUY A;  3EE8 A;  3H1V X;  1YJN N;  3ENH A;  4BRC A;  4NLC A;  2CGL A;  4PKI A;  3VEV A;  3JS6 A;  5LJW A;  1NBW A;  4BR0 A;  2PBD A;  4BRF A;  4BRL A;  3FLC O;  4JAX A;  4YOX A;  1T44 A;  2WBN A;  3G4S N;  2EWS A;  2YHW A;  2NRH A;  4CZM A;  2QA4 N;  1VQ5 N;  2BH1 A;  4KH4 A;  5AQZ A;  4GV9 A;  1NGE A;  2H3G X;  5AZI A;  2ASO A;  1DGK N;  3HRG A;  3UB5 A;  3CD6 N;  2P9I A;  3SMS A;  1KQS M;  2FF6 A;  3SLC A;  4HTL A;  1TYQ A;  4A61 A;  1VQN N;  1QVF M;  1NGA A;  3H1Q A;  4FWR A;  1SZ2 A;  3M3Z A;  3RSE B;  5C12 A;  4CD3 A;  2A42 A;  3A0I X;  4F9O A;  5AQP A;  5AQX A;  3ZX3 A;  3SAF A;  1TYQ B;  3VEO A;  1MWK A;  1NMD A;  1VQP N;  4YOV A;  1HX1 A;  5DM7 L;  4Y0W A;  3VET A;  2V7Y A;  2AP1 A;  3D2F A;  3GOI A;  5F2R A;  3ZX2 A;  5AQL A;  2BTF A;  4JKB A;  1C0G A;  5H1S Q;  3BUZ B;  1DEJ A;  3KHY A;  4A2A A;  4BRG A;  3DWL A;  5BRE A;  4MLH A;  2Q2R A;  4A57 A;  4EIA A;  1S72 N;  3C7N B;  1ZXO A;  3EZW A;  3J8A A;  4IJN A;  3N4P A;  5AQI A;  5LJV A;  1R59 O;  4FWN A;  1GLL O;  3SK3 A;  1BA1 A;  1QQM A;  3FZM A;  5EXW A;  5AQF A;  3VMF B;  2E2N A;  3O4W A;  4B1V A;  4CZL A;  5C10 A;  5TKY A;  2RHK A;  2F9W A;  3E9L A;  3MCP A;  5EOY A;  1YI2 N;  3KZB A;  4XH1 A;  3OA9 A;  2QM1 A;  3SBT A;  3M1F A;  3E9O A;  5AQV A;  3WXL A;  5M1K A;  2NRR A;  3VEZ A;  3RSE A;  3UE5 A;  3TPQ A;  3CPW M;  1Z05 A;  3F5T A;  1X9J A;  2ZGZ A;  5MLC Q;  4XH4 A;  3OBW A;  4IOX A;  5AFU H;  1HKG A;  4BR7 A;  3O5B A;  3CCV N;  4PKG A;  4H0O A;  3O08 A;  5AQJ A;  3PLA A;  1EO1 A;  1NM1 A;  3CCJ N;  3CCU N;  4FWM A;  4BR9 A;  4OPH A;  2FF3 B;  1RFQ A;  3C6A A;  3F2K A;  3P39 A;  1KC8 O;  3WEE B;  3CI5 A;  3IDH A;  3Q7C A;  1VQO N;  3KK7 A;  2QWN A;  5M1P A;  4JD2 A;  3DAW A;  3M6G A;  2YCH A;  3U9D A;  2IVN A;  4FSV A;  1YHQ N;  4BRD A;  2W41 A;  4ISG A;  1VQ8 N;  1W97 L;  3CER A;  3LL3 A;  2ASP A;  2VWB A;  3UKU A;  3HOS A;  4H0Y B;  3CQX A;  3E9P A;  2ZJP L;  3QBW A;  2OTJ N;  3VEY A;  4NO7 A;  4KBO A;  4YOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...