4BRLA

Legionella pneumophila ntpdase1 crystal form iii (closed) in complex with transition state mimic guanosine 5'-phosphovanadate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
b'TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
molecule tags Hydrolase
source organism Legionella pneumophila
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
total genus 120
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brlA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brlA02
1YAGA 3MN5A 4H5TA 3VF4A 1NGCA 1NGBA 2CGLA 4ISGA 3AARA 3IMXA 4F9OA 3HM8A 5AQPA 4FOIA 4DQ8A 2IVOA 2E2QA 4B1ZA 4M7YA 2DPNA 1BO5O 4BRNA 3H45C 3FE1A 3WXIA 2P9SB 3GG4A 3H6EA 3QICA 1NGEA 4H0OA 1MWMA 4BC3A 1GLFO 2PBDA 3OHRA 2YHYA 3O80A 4CZIA 3O08A 4FWPA 5EY4A 2ZGZA 2P9NA 1NGAA 2P9UB 5AZIA 2OANA 3BP8A 2A40A 5AQRA 1HKGA 1HKBA 4DCHA 3ZEUB 4BRGA 2D0PA 1HPMA 1DGKN 1QQNA 4QS7A 3QFPA 2VWBA 1HJOA 1BA1A 4IO8A 5AQWA 4FPAA 5AQVA 1Y64A 2VYPA 3BEXA 5E84A 2V52B 4XH1A 4H0YB 1QQMA 1XQSC 3ZX2A 1NMDA 2GTDA 3ENOA 4AM6A 5AFUH 1CZAN 2PAVA 3A5OC 3DXMB 3M6GA 1E4GT 4QS8A 3JS6A 3KZBA 3AY9A 5KQDA 2A3ZA 2CH5A 3ATVA 3ZX3A 5KPTA 3UKUA 3UKRA 1C0GA 2E8AA 1GLEG 2E2NA 3U4LA 2QWOA 4WQ5C 4JHDA 4CBWA 3MCPA 4H5WA 1NGHA 2E1ZA 5E26A 3FZFA 3EN9A 2P9LB 5AQYA 4BVOA 2D1KA 4WYBA 3UKRB 1ZXOA 2ITMA 3U9DA 3WUHA 1K8KA 4H0PA 4J8FA 5FPDA 3L6QA 4FWQA 5LJVA 2IVNA 1QZ5A 4WQ4C 4BR0A 1ATNA 3H46O 3TPQA 2A6AA 3MN7A 4NO7A 5AQHA 2CGKA 3FR0A 3VEVA 3D2FB 5LJWA 4H0VB 2IIRA 5AQGA 2HF3A 1BUPA 4BQLA 1NLVA 1SZ2A 2QM1A 4MO5A 4BRKA 4CJ7A 5AQMA 1G99A 4B1YB 3VGMA 5I9EB 5AFUA 5BN8A 3EZWA 1GLLO 3HI0A 1SAZA 3CHWA 1NWKA 2GELA 3KHYA 1WUAA 4H0TB 4BRMA 3SK3A 1GLJO 3HTVA 1TYQB 3ZX0A 1MA9B 3VEXA 4BRFA 1XUPO 3DJCA 3DWLA 4BRHA 4JHDB 3I8BA 4BG8A 1Q18A 2QWLA 4BGBA 3D2EA 1NM1A 2A42A 2QWMA 3A5MC 4DB3A 4FWMA 1RGIA 3VESA 2GWKA 4B1UB 5BRDA 2QWNA 4RWTA 1D4XA 2D0OA 3FZKA 2P9IB 2YCHA 3CJBA 2P9SA 3MDQA 1KAXA 1HKCA 4BR9A 5BPLA 1TUUA 3R9PA 1BA0A 4PL8A 3FLCO 5FPEA 3TU5A 2E2OA 2Q97A 5CE3A 4BR4A 1KXPA 4ISEA 1X3MA 3D7EO 4GNIA 3VEWA 2IVPA 2I7NA 4CBUA 2QWRA 5AQQA 5AQIA 2QWPA 4XH5A 2P9KA 3ID8A 2J4RA 5JICA 3WXLA 3L0QA 5KPZA 4BR5A 3IDHA 2ZGYA 3L4IA 1XC3A 3EKSA 3HZ6A 3I33A 4CZFA 3LDLA 5AQNA 1KAYA 2UYTA 4BVPA 4B9QA 1YVNA 3U9ZA 5AZJB 5BREA 2E1YA 1GLAG 1V4TA 3O6WA 3VGLA 4BC4A 2GEMA 1S22A 4C23A 1J6ZA 3CERA 4H5RA 4K43A 4H0XB 5EXWA 3BF1A 4RTFD 3QBXA 4MO4A 4B1XB 2ASPA 3O1BA 2YJEA 1IJJA 5KPRA 2NLXA 3MMVA 2FXUA 3QDKA 4B1WB 3GOIA 4IXCA 3EO3A 4BC5A 1ATSA 1HLUA 1U6ZA 2A5XA 2W40A 3VF6A 4BGAA 1GLCG 4FWKA 4LC9B 3VEYA 3FGUA 4AM7A 3SMSA 4CBXA 2KHOA 2V51B 1V4SA 4XH4A 2FF6A 4KBOA 4K25A 3CQYA 4IZ9A 4CZEA 1KAZA 1NGJA 3BUZB 4WQ5A 4XEIA 4MLHA 4FL9A 4ISFA 3LM9A 4EAHD 2Q36A 1JCGA 3VEOA 2P9KB 3A5NC 4PKGA 3QB0A 4JD2A 3S41A 4HTLA 5F2RA 5AQJA 3WXKA 1MDUB 3CIPA 3GL1A 4E1JA 2Q31A 4FWLA 3ULEB 3W3DA 3ZETB 1IG8A 4MLEA 3LDPA 5ADXA 1T6DA 5FPNA 3HSCA 2VCPA 2WUSA 1QQOA 3ATUA 2F9TA 3A0IX 5AQSA 4BC2A 5ADXH 2YHWA 3GDQA 4YDUC 4A2BA 4CD3A 2GUPA 2CGJA 4FO0A 1ZBSA 4CZJA 3LL3A 1GLDG 3DAWA 5AQLA 2E20A 4FWOA 4BQZA 3G25A 2W41A 2P9PB 2NRHA 2QWQA 4I6MA 5BPNA 3VPZA 1MWKA 3VEZA 3CJ1A 3H3OB 2NZTA 1BWFO 4BRDA 4CZMA 5BN9A 1H1VA 3CI5A 2Q2RA 3M1FA 4RCHA 4DHYA 4JN4A 1K8KB 4EFHA 4Z94A 1TUYA 2GWJA 3RSEA 4I6MB 3CETA 2P9PA 3O8MA 3J8AA 2A41A 2P9LA 3LM2A 5AQUA 1C0FA 3WQTA 3A5LC 5AQFA 3R8EA 1BU6O 3WEEA 1X9JA 4M63C 5AZIB 1NBWA 3CQXA 1NGDA 3DXKA 5EX5A 2YJFA 2FSNA 3LDNA 3VOVA 3EKUA 4O5FA 3VENA 1U2VB 5AR0A 4BRQA 2HMPA 1JCEA 2FF3B 5AQTA 2E2PA 2QW9A 5B8HA 3MK6A 3SJHA 4BRIA 4CZGA 3WT0A 1NGIA 5BRFA 3FZMA 2BTFA 2V7YA 2YI1A 3DXKB 5F1XA 3MN9A 4IWVA 1BOTO 1P8ZA 4PKIA 2QXLA 2F9WA 1QHAA 3UB5A 1WOQA 1BDGA 3GE1A 2FLOA 2BUPA 3UE5A 1Z6RA 5TKYA 3CJ9A 4YDUA 4CZKA 2D4WA 5JMVA 2I7PA 1HX1A 1ESVA 5BRHA 3QFUA 3SMPA 5BPMA 3HBTA 1HUXA 3B8AX 5EOYA 1E4FT 4FWNA 4JAXA 4B1VA 3GBTA 3P4IA 4PKHA 4WQ4A 5AQOA 4FPBA 4FOEA 3WXJA 3H1QA 3ZEUA 1RFQA 3QMLA 4CI6A 1T6CA 2H3GX 3CJCA 3WEEB 3O1WA 1QZ6A 5ELZA 1JCFA 2P9IA 2ZF5O 1TYQA 1YXQA 2HOEA 2P9UA 5AQZA 3U8XA 4Y0WA 1ZC6A 5BR9A 2Q0UA 4BRAA 5LY3A 3ZETA 1NGFA 3IUCA 2AA4A 1OKJA 3ULEA 3VGKA 3D2EB 1LOTB 5AQXA 2CH6A 5F0XA 3EL2A 3VETA 4EHTA 1YUWA 5AZJA 4O8KA 4JD2B 4JNEA 4BR2A 4IJAA 1U2VA 3MN6A 1SQKA 2V7ZA 5JLHA 3C7NA 3VERA 4IJNA 3AAPA 3BF3A 3FZHA 1LCUA 4L3QA 3CJAA 4HWIA 2YHXA 3ENHA 4CZHA 4EIAA 4CZLA 4EHUA 5AQKA 4BRPA 3VF2A 4BROA 2EWSA 3D2FA 3O4WA 2E88A 2ASOA 3C7NB 4FWSA 1X3NA 3F9MA 4GY2B 3A8YA 1NGGA 4BRCA 4PL7A 4BG9A 4M7XA 1GLBG 3H3NO 1DKGD 2P9NB 4H03B 4A61A 1S3XA 3O5BA 4NB4A 4BRLA 2FSKA 5JLFA 3FZLA 4A2AA 2ASMA 3CJ7A 5EVZA 4FWRA 1DEJA 3AAQA 4FSVA 3FFKB 1ATRA 3R6MA 3SLCA 3M3ZA 1EQYA 3KVGA 3WQUA 2AP1A 5KQ8A 1BG3A 1R59O 4K41A 4H5NA 4QS9A 3UKUB 3C0BA 3RSEB 2Q1NA 4BR7A 4K42A 2HF4A 4CD1A 3W0LA 5FPMA 2Q0RA 3H1VX 3IFRA 3LDQA 2ZWHA 3QBWA 1RDWX 4H5VA 4BREA 3LDOA 1T44A 1Z05A 4A62A 3DXMA 2FSJA 3JXUA
chains in the Genus database with same CATH superfamily
4NXMK 3VF4A 2EX3A 4WFBL 3VQ8A 1RTHA 3OJSA 4DUZK 1JLAA 2WFBA 3MEEA 3TTCA 4LF9K 2IAJA 1C6VA 1NOYA 3HM8A 4C8NA 3K5OA 5HLFA 2IVOA 3SUQA 1SL0A 1VSKA 2UXBK 4B1ZA 4KHNA 4KFBA 3IG1A 3WXIA 4DU4A 2P9SB 3GG4A 3K9JA 1E3MA 3VQ4A 3VA0A 5GIOA 1NGEA 4H0OA 4FJ9A 4BC3A 4DR6K 1IKVA 1SL1A 1BISA 2YHYA 1Y97A 4DR3K 3NH1A 3DRSA 3LANA 4FWPA 2ZGZA 1Z25A 1S72N 3EEQA 2P9UB 2O8FB 1IBMK 4J2EA 2A40A 5E41A 4N56A 1HKGA 1QS4A 4PUOA 1S1WA 1XHZA 3ZEUB 3CFRA 3G0ZA 1QQNA 1XNRK 3LP3A 4BWMA 4QS7A 3QFPA 1HJOA 4IO8A 4ILGB 5AQWA 3E66A 4JKFA 1CLQA 4DV5K 3SCXA 5E84A 1RDBA 3OYDA 1M1KO 4ICLA 1OH6A 3ZX2A 3P5JA 1NMDA 3QERA 1M90O 3ENOA 3THYB 4CJKA 3AY9A 3AO4A 5KQDA 2A3ZA 3NGZA 3G6EN 1WN7A 1BGXT 3ZX3A 3UKRA 1GLEG 5HBMA 4WQ5C 1L3SA 4JHDA 4TSXA 4B9MA 4H5WA 3NVMA 3HSTB 3OYNA 2LSNA 3EN9A 2HBLA 4DKWA 3J7YP 2P9LB 3SBGA 5C10A 2OTJN 1JLCA 1RBVA 4KV8A 4Y1CA 3L8BA 2Y1JA 1BI4B 3QESA 2HHUA 1XMOK 2ZM6K 2QXFA 4H0PA 4E7JA 1QZ5A 2F8TA 1TAQA 3CCEN 4RW7A 3P39A 3MN7A 2UUAK 3TTDA 1MU2A 1B9FA 1BUPA 4E7IA 4MO5A 1G99A 3C95A 5BN8A 4CHYA 4FJIA 3CHWA 4JKCA 1T05A 1NWKA 3CFPA 1SKRA 3L2VA 3AVCA 1TYQB 4BE1A 1D9FA 4LF6K 4FCYA 5KRSA 5H1SQ 4JHDB 3I8BA 4CJWA 1VQON 2FBYA 3S3NA 1NK5A 2QWMA 4DB3A 4FWMA 5HRSA 1RGIA 4B1UB 4CECA 3FZKA 2P9IB 2HBJA 1Q7YO 1TKDA 3WNEA 1IKXA 1BIZA 1KVCA 3OYJA 1KVBA 3MX5A 4JI7K 4DV1K 4PL8A 4CERA 4CEAA 4KRFA 2ETJA 4OPJA 1UOCA 2HNZA 2G8FA 1K6YA 3RRHA 1K8AO 5AQIA 4JEPA 2P9KA 1ZBHA 1NG9A 2KZMA 3L0QA 4GVEA 5KPZA 4BR5A 4HTUA 3M8SA 3RMDA 2Z1GA 4OVLA 1C0TA 4CZFA 1EXQA 5SWMA 4KI6A 1WSGA 4BVPA 5BREA 4BC4A 3V6DA 3MEDA 4KH5A 2GEMA 4H5RA 4K43A 1KRPA 2ATQA 3CF5L 4DTOA 2ASPA 4CGIA 1EP4A 3KK1A 3DLKA 4FJMA 5KPRA 3JYTA 4CF0A 4A57A 2NLXA 3MMVA 4CJUA 3EE8A 3GOIA 4GW6A 4GKKK 3EO3A 4EZ6A 4M3XA 3KWGA 2A5XA 4KTQA 3VEYA 1NKEA 4R5PA 4DTPA 3SMSA 4CBXA 3I55N 1OH5A 2KHOA 1QQCA 3CD6N 2HHVA 1UA0A 5AJ3K 5J1EA 3CCJN 4OPKA 4KBOA 4K25A 4XEIA 1XWLA 5FRNA 4EAHD 2Q36A 3ZCMA 2F4VK 2P9KB 3S41A 1HQEA 1W9HA 4HTLA 1EWRA 3WXKA 3GL1A 3CIPA 3L2WA 1VQMN 2OPSA 1J53A 1N6QA 3W3DA 3L4QA 3N4QA 3PIOL 2HNDA 3TR8A 1KCFA 4BY9C 3ZSXA 3A0IX 5A2QO 1YTAA 3V9UA 2BH1A 4A2BA 4HVJA 5GINA 5JVHL 4JYAK 1I94K 3T69A 4KB0A 4FJNA 1X1PA 4IEEA 2NRHA 4JRPA 1VQ9N 4I6MA 1Q9YA 3VPZA 1MWKA 2HBKA 4WCEL 4O5BA 2OCEA 4BRDA 4CZMA 3QEXA 4DHYA 3NH0A 2A1RA 4LF8K 1K8KB 3KLHA 4DSKA 4EFHA 4I9QA 1U45A 4GV9A 4DTXA 4I6MB 3CETA 3O8MA 2JWKA 1N5YA 4CJEA 5D3GA 2A41A 2P9LA 3OYHA 4FLUA 4E89A 4NLBA 3HVRA 3R8EA 5BR8K 1NBWA 3CQXA 3Q7CA 1NGDA 1VSMA 2YJFA 3VOVA 1NOZA 1HYVA 3VENA 4BRQA 1JCEA 4W5NA 1WSHA 4XIUA 4BRIA 4F2RA 5BRFA 2V7YA 1RNHA 2O8EB 2RHKA 4IWVA 2YKNA 3MECA 4CEFA 1BOTO 5LMUK 2F9WA 1QHAA 3UB5A 4FYDA 1WSIA 3ZT4A 3K5NA 3ZT3A 3UE5A 5TKYA 5DM7L 5CR4A 3OYMA 4AHCA 4CZKA 1YI2N 1N8RO 1ASVA 3VN5A 3ENBA 1HUXA 2IOCA 5DK5A 1E4FT 1NK7A 4JAXA 4B1VA 4O4GA 5AQOA 5CYQA 1S6PA 1NK0A 4NCAA 5M1NA 4AH9A 3ZEUA 3KJVA 4CJVA 3CXCM 3QMLA 4CI6A 3CJCA 3WEEB 4LSNA 3SQ0A 3DLBA 5AQZA 1NMNA 3N4PA 3LP0A 1S9EA 4M3YA 1OKJA 3VGKA 3VQAA 2R7YA 5J2QA 4M3ZA 4IFVA 3VETA 4M42A 3V9ZA 3PO4A 3EZ5A 4O8KA 4IJAA 3IAYA 1O13A 3VQEA 1JLEA 2OA8A 1RCHA 1YF5L 1RDUA 2O4IA 1N36K 2E6LA 4KHYA 4CK1A 5SZTA 3KK2A 2O8FA 1XNQK 4JI0K 3ENHA 4CZLA 3CMEN 4K8ZA 3AA3A 4BRPA 2E4LA 2EWSA 1J9AA 3D2FA 3O4WA 3SJJA 2KFNA 4FWSA 3DM2A 1X3NA 3BZCA 4E7LA 5T7BA 1T8EA 1VQNN 4CEEA 1JJ2M 2P9NB 2YNGA 1SS6A 1BCOA 4A61A 4OO1J 1UWBA 2UU9K 4FZYA 1I39A 1DLOA 1YVUA 1U49A 2FSKA 1HNVA 5JLFA 2E5LK 3HT3A 5EVZA 3QIOA 1Z26A 5HOOA 3SLCA 1KD1O 1Q81O 2AP1A 1R59O 2X6NA 1YTUA 2BGGA 3HP6A 4DTJA 3MAQA 1VSLA 4MDAA 3W0LA 1BCMA 1RDWX 3LDOA 1Z05A 1VSJA 2W42A 3ALYA 1TKTA 3LPUA 3OYLA 1NKBA 3AVMA 1FKOA 1YAGA 3MN5A 3C94A 4O55A 1VSDA 2IS3A 1SV5A 5KGXA 3RMCA 2CGLA 3TI0A 2HVHA 5GAEP 1YT3A 4H4OA 3ZSOA 4ZHRA 1S9GA 5C0YA 4OPHA 3HO1A 4B9VA 4YFUA 3QICA 1CZ9A 3SPZA 3MXJA 1ILYA 2VQFK 2VWKA 1RBUA 3K5MA 4KREA 3O08A 1IO2A 3RR7A 5EY4A 4KAZA 2NRVA 4LSLA 3BP8A 1FW6A 3OS0A 3PY8A 3MXMA 4DCHA 4ZTJA 4BRGA 5HRRA 4WFNL 3AA2A 4I2PA 4CF8A 3KIOA 4CFDA 1D5AA 5AQVA 4G9ZA 1SKSA 2VYPA 4CJQA 3SBTA 4N47A 1QQMA 4B3OA 2HHQA 2YNIA 5AFUH 2PAVA 2KTQA 3DXMB 3S3OA 1E4GT 4QS8A 3JAMO 1NU0A 1Q86O 2P5GA 4E0DA 2HHSA 4IFEA 4DSFA 3ATVA 3TAPA 2Q3SA 1C0GA 3SV4A 3U4LA 1QSYA 4YOUA 1RT7A 1WNSA 3NFAA 5FDLA 1BIUA 3CCSN 1LWEA 2E1ZA 5E26A 1S1TA 4DQPA 4CFBA 4IG3A 2ITMA 4FJKA 3U9DA 3WUHA 3ZT0A 1VSFA 5FPDA 3RTVA 4FWQA 5LJVA 4BR0A 4KHSA 3BZKA 3H46O 1VAZA 1TAUA 3AVFA 4PY5A 4DTUA 2F7TA 2A6AA 4NO7A 3LP1A 1NKCA 3D2FB 1W7AA 2IIRA 3PV8A 2HF3A 1ZYQA 3C6TA 1NLVA 1LW2A 4BRKA 2OYQA 4GKJK 3AA4A 4B1YB 1Q9XA 3VGMA 3AO2A 4Z4EA 3EZWA 3VTIA 1RDDA 2GELA 3ZSQA 3LPTA 5M1QA 4BRFA 4BRHA 1UA1A 4JI2K 3QINA 2XY8A 1Q18A 2DTUA 4JI4K 4BGBA 4CJPA 2A1SA 4FJ5A 4IEIA 2QWNA 3HL8A 4J2DA 4C8OA 4F8RA 4CF9A 2DFFA 3MXIA 2P9SA 2IDOA 1KAXA 4L8RB 4ILHA 4CHZA 5BPLA 1TUUA 1RT4A 3AVBA 3R9PA 2WOMA 3FLCO 4A5AA 2E2OA 1CXQA 1I3AA 1OVYA 3AGRA 3RR8A 3RRGA 4QAGA 4LF4K 4BR4A 4MDBA 4OKKA 5JS2A 4ISEA 1X3MA 4LD0A 4GNIA 3D0PA 5AQQA 1GOCA 4KHWA 2QWPA 2I5JA 4JV5K 3AVGA 3V1RA 5CZ1A 4AHTA 5JICA 2ZGYA 4DV3K 3L4IA 1XC3A 4K8XA 3HZ6A 5GIPA 1TK8A 3NF8A 3LDLA 4CK2A 1LWCA 1RT2A 3QEPA 5AZJB 3VGLA 1V4TA 4C23A 4X62K 3CERA 5EXWA 4RTFD 3QBXA 4MO4A 4E7HA 2FBVA 3O1BA 4A59A 1IJJA 3I8DA 4JI8K 1S1XA 1YJWN 4M3WA 2UUCK 1RTDA 3KTQA 4BC5A 5JMVA 1GLCG 4YOVA 3TAMA 3IKMA 3PX4A 1REVA 3ITHA 1NK9A 3OYFA 4XH4A 2FF6A 1P90A 4IZ9A 4DV2K 4ISFA 3I0SA 3SUOA 2O8BA 4DR4K 1JCGA 3SI6A 4JD2A 4Z4IA 5I42A 1RDCA 3L2QA 2Q31A 3IRXA 3CPWM 4MLEA 3KLFA 3LDPA 1A5XA 5FPNA 4CVNE 4EZ9A 3ID6A 1VSEA 4ELTA 3NVKA 2YX6A 4BC2A 5ADXH 3TAGA 4YDUC 4Z4CA 4F3OA 3OYGA 4PQUA 3LL3A 1GLDG 3OS1A 3V9SA 3VQCA 3O3GA 4NLCA 2XY5A 2P9PB 2QWQA 4CEQA 2XY6A 3QIPA 1BWFO 4N41A 4U7BA 3K5LA 3WNFA 3O4NA 4DTSA 1ZBLA 1H1VA 3PX0A 1HJRA 4RCHA 4W5TA 2QK9A 4JN4A 3HPGA 4JK7A 4IG0A 1TUYA 2GWJA 1VQKN 3RSEA 5MLCQ 2P9PA 3LALA 2O4GA 2BANA 3PSFA 4JI5K 2KZZA 3WQTA 2XHBA 4FK2A 5FROA 4QCLA 3DMJA 2FSNA 3WNGA 3NGIA 3EKUA 1OVQA 3NGYA 1QSSA 1U2VB 5AR0A 4NYFA 2QW9A 4A5BA 3MK6A 3M8PA 4CZGA 1LV5A 1JLQA 3FZMA 5M1KA 5F1XA 4FVMA 1N34K 3VQDA 1HPZA 3MN9A 2ZE2A 4O8UA 4PKIA 2PFUA 1D9DA 3GE1A 1WBBA 2FBXA 3LAMA 3CJ9A 5FRMA 4YDUA 3SUNA 1OH7A 1C1AA 4DQQA 1QE1A 2D4WA 3KD5E 4DTRA 2DY4A 1ESVA 5BPMA 1T3VA 3HBTA 4DF8A 1O1WA 4FLWA 4PKHA 4B9SA 1LWFA 1W2BM 5DMRA 4NYNA 4Z4FA 4FPBA 4FM1A 4M3UA 3HPOA 2JLEA 1T6CA 1C0MA 2H3GX 1TL3A 1QZ6A 3O1WA 5ELZA 3O9SA 4X66K 2P9IA 1TYQA 2HOEA 4Z0UA 3KK3A 3TSQA 1KC8O 1JL1A 3SPYA 1RBRA 1RT1A 3IUCA 1L3UA 3VQ6A 3EL2A 5AZJA 1VK0A 3ZSVA 4JD2B 3DLLL 4JNEA 4JKBA 5TKWA 3E1YA 1YIJN 3CMAN 2VG5A 3C7NA 1U48A 2P1JA 4IJNA 3AAPA 3WXMB 3L2UA 1VQ6N 4HUEA 1LW0A 1A5VA 3CJAA 3ZSYA 4EHUA 1N33K 4BROA 4EP5A 1DTQA 4BE0A 1G15A 2YKMA 1NK4A 2E88A 5M1FA 4CGDA 3C7NB 3F5TA 5HRPA 4K0KK 3RMBA 4B9UA 2IGIA 1IH7A 4CF1A 4BRCA 1NGGA 3V4IA 4M7XA 1GLBG 1DKGD 4H03B 1HQUA 4OLBA 2GV9A 1S3XA 3O5BA 3QLHA 3MCAB 3QEIA 4LFBK 4A2AA 3TAFA 1RT5A 1NJZA 4FWRA 1DEJA 3AAQA 3NF6A 4FLTA 4B9NA 3FFKB 3R6MA 4FW1A 1IV0A 3T7ZA 1BG3A 3LZJA 2HBMA 3UKUB 4CHQA 3HJFA 3OBWA 4BR7A 4G1QA 4K42A 4CD1A 4RG8A 3IFRA 3H1VX 3QBWA 2ZWHA 1Q8IA 4CEBA 5J2MA 1YHQN 3LDSA 2UXDK 3WNHA 3THYA 1BQMA 2HVIA 1R0AA 3NH2A 4WFAL 4H5TA 4WF9L 2ZQBA 1NGBA 5IT9O 3AARA 5AQPA 4YOXA 3ASMA 2E2QA 3SQ4A 3V9XA 1C1CA 4M7YA 2DPNA 1BO5O 3LWMA 3OYEA 3H45C 3FE1A 4FJJA 1EO1A 1RBTA 4FLXA 2NUBA 1MWMA 1GLFO 2PBDA 1NJYA 1NJIO 4KB1A 3O80A 2DFEA 4AILC 4BACA 3THWB 2P9NA 3OTOK 4DS4A 2X78A 2RF2A 4DG1A 2WTUA 4DF4A 5AQRA 3B6PA 1WSEA 4JKAA 1HKBA 4Z4GA 2D0PA 1WLJA 4B8CA 1DGKN 2W6KA 1FJGK 4C8LA 3OBYA 4CJ4A 3K58A 3E9LA 4WE1A 1Y64A 4F4KA 4BDYA 3A2FA 3AVKA 4JLHA 4XH1A 3M8RA 4CHNA 3K59A 4F3TA 2D0CA 1XQSC 4ELVA 4JS5A 2GTDA 3DOKA 4AM6A 3C6HA 3ZT2A 3M6GA 4B9LA 3JS6A 5CYMA 3KZBA 1U47A 4Q5VA 4C8MA 2CH5A 1RTJA 4FVUA 3CC4N 3CC7N 1BI4A 5KPTA 3UKUA 5KRTA 2E8AA 4FZZA 2E2NA 2QWOA 4O0JA 2B4JA 3MCPA 3J80O 3ZSWA 4DSJA 4JI1K 1KTQA 4BVOA 1VQ4N 2NRRA 1HYZA 2D1KA 4CHPA 4DSLA 2NRTA 1K8KA 4MFBA 3EYZA 4DFMA 3L6QA 5KTQA 2IVNA 4WQ4C 4HHTA 4IFYA 3TPQA 1SUQA 5AQHA 4RW6A 2CGKA 1L3TA 3VEVA 1TK5A 4H0VB 4OGEA 5AQGA 3TAEA 1X9MA 2QM1A 1SZ2A 3NMUA 4E7KA 3NE6A 4HCCA 5I9EB 5AFUA 1GLLO 3CCLN 1KLMA 1WUAA 4BRMA 1T03A 2WBNA 2QKBA 1HRHA 1MA9B 3HP9A 3NDKA 5HP1A 2YV0X 4C1NI 5GAGP 4BG8A 3VQ5A 3D2EA 3A5MC 2ZJQL 3VESA 5BRDA 1KVAA 3VQQA 4RW9A 4YOYA 4CGJA 3CJBA 1JLGA 2GX9A 2F8SA 3MDQA 4CW7B 1HKCA 3D6RA 4AF1A 4KHPK 3KLEA 3THVA 4DS5A 3TU5A 2Q97A 2YHBA 4DFKA 2ZJRL 3SAFA 3THXB 2X6SA 2IVPA 2I7NA 4CBUA 2QWRA 1S5JA 4XH5A 3AGKA 1FXXA 3ID8A 2QA4N 2G8IA 2J4RA 4IOCL 3HYFA 1VSIA 4H8KA 3IDHA 1TKZA 4W5RA 3G10A 3P38A 3I33A 3O3FA 2UYTA 4B9QA 1D8YA 1YVNA 1RILA 3Q7BA 1GLAG 3O6WA 3RVCA 2KKZA 4M41A 1J6ZA 1YITN 4HCBA 1VRUA 1J54A 4B1XB 3K0SA 4PHTX 4Y1DA 2HB5A 4CEDA 2HNYA 3LAKA 3NF7A 4FJXA 3L2RA 4OJRA 4B8AB 3KLGA 3AO3A 3U3YA 1JXBA 2FXUA 2EHGA 3QDKA 3NAEA 3TANA 1HNXK 3ISNC 3V9WA 2WC9A 4DR5K 1WSFA 3EE9A 1ATSA 1HLUA 4H4MA 2W40A 4BGAA 4HUGA 3FGUA 1XC9A 2BDPA 2V51B 3T19A 4DU1A 3KWIA 1K73O 2VG6A 3CQYA 1U04A 1FKPA 1KAZA 1HYSA 4OKJA 4FL9A 4AHVA 4FK4A 3V81A 2O8CA 2HHWA 2Z1JA 3VTHA 3QB0A 1K9MO 4CE9A 5AQJA 4AQYK 1MDUB 3DLRA 3PO5A 3SZ2A 3OYKA 4J2BA 3ZETB 3I0RA 1IG8A 5ADXA 1T6DA 4JKEA 3HSCA 2VCPA 2WUSA 2OZMA 2O8BB 4OLAA 1RT6A 1QQOA 3ATUA 2F9TA 4GV3A 5AQSA 4JK9A 3KD1E 1QVFM 2YHWA 3GDQA 2FC0A 4CD3A 2GUPA 3T1YK 1VQ8N 2CGJA 4FO0A 4DSIA 2G8WA 4R79A 3L3VA 4CESA 2W41A 1ZBIA 5BPNA 3CJ1A 1EX4A 3P31A 1GOBA 5BN9A 5C15A 2GUIA 1S6QA 3AVAA 4Z94A 3SQ2A 2RKIA 1TKXA 3NCIA 1RT3A 3J8AA 1NJWA 3LM2A 3G4SN 3G71N 3PUFA 3V1OA 1ITGA 4M63C 5AZIB 4E19A 3MWTA 5EX5A 2X74A 5M1OA 5AQTA 2HHTA 5B8HA 2QKKA 3R1XA 1B92A 3WT0A 2YHAA 3U6FA 3SV3A 1S1VA 4DSEA 1LAWA 1DT9A 3C6UA 1ASUA 1HMVA 3KLIA 5JVGL 2O8CB 2YNFA 3JSMA 1WAJA 2NNWA 4F2SA 1VQPN 2VGMA 4B3TK 1Z6RA 4KPYA 2P51A 3CCUN 1WBDA 1JL2A 4LH4A 2KFZA 3PLAA 2I7PA 4JI6K 1HX1A 5BRHA 3QFUA 3SMPA 3VQ9A 1IKYA 3F2KA 4FWNA 3TABA 1KSPA 2D0AA 4DUYK 3GBTA 3P4IA 4JK8A 4AHSA 2Y1IA 3NHGA 3WXJA 4QOZB 4CJLA 3CPEA 2HMIA 1YJ9N 4ZTFA 2HHXA 4E1NA 2ZF5O 3CC2N 1YXQA 2P9UA 1ZC6A 2Q0UA 1TK0A 2AA4A 2B6AA 3CQ8A 3HPHA 1LOTB 5HL7L 2CH6A 4EHTA 4CJSA 3TTFA 4BR2A 3NF9A 1U2VA 3AV9A 2O8DB 3TSUA 3ULDA 3VERA 3HXMA 3BF3A 4OPAA 4DR7K 3B6OA 3OYBA 3FZHA 1NK8A 4L3QA 2YHXA 4CZHA 4EIAA 1RBSA 5IWAK 3VF2A 4DV4K 3O9RA 2KQ2A 3MX2A 3E01A 1T7PA 2ASOA 4GMJB 4DTNA 3O9QA 3F9MA 4GY2B 4M3TA 3A8YA 4PL7A 3AVJA 3H3NO 4IOAL 4YORA 4JRQA 4C8KA 2G8KA 4FLZA 4O44A 1TV6A 3FZLA 1JKHA 3F9KA 4U67L 2ASMA 3CJ7A 4I9LA 4PWDA 4DMNA 1L3VA 4IKFA 3R3LA 4YOTA 3AO1A 1UAXA 1EQYA 3I56N 3KVGA 3WQUA 5KQ8A 4K41A 4FM0A 4DLEA 1QSLA 3FFIA 3CFOA 2Z1IA 4QS9A 3QNNA 3C0BA 2Q1NA 3MWPA 2HF4A 4YOWA 5FPMA 4CEZA 3LDQA 2AJQA 2F96A 2VWJA 4IDHA 3DXMA 2FSJA 3E9OA 3K2PA 4IOXA 1XMQK 1NGCA 2HSTA 3DLEA 2ZJPL 4ISGA 4DQRA 3IMXA 3SQ1A 4F9OA 3HVTA 4FOIA 4DQ8A 3F73A 3C6AA 4DV6K 4BRNA 2OTLN 1RDAA 3VQBA 3H6EA 4FW2A 4DR1K 4YHHK 3OHRA 1X9SA 5M1PA 4C1NK 4CZIA 3AVIA 4HUFA 4LFAK 5KGWA 1NGAA 3H08A 5AZIA 2OANA 3RMAA 2PZSA 1EKEA 3CM5A 3CCVN 4ILJA 3LWLA 4GVMA 5LL6Z 1J5OA 1VQ5N 1HPMA 3OYAA 3DLHA 2VWBA 1BA1A 4FPAA 1W0HA 4NXNK 3BEXA 2V52B 1KLNA 4H0YB 1JLFA 3VQPA 4B3MK 4ELUA 1CZAN 3A5OC 3C65A 5GADP 1TGOA 4DR2K 3K9KA 4YY3K 1L5UA 4B08A 1OH8A 1NJXA 4CBWA 4CIGA 1NGHA 3IS9A 1IKWA 5FLXO 3FZFA 2P5OA 1WAFA 2W6LA 5AQYA 2OPRA 3THWA 4X64K 3SYZA 4WYBA 3UKRB 1ZXOA 1CXUA 4DTMA 5K14A 2OPPA 5GAHP 4KTZA 4KKOA 3AVNA 4J8FA 4JKDA 2PY5A 3LZIA 1ATNA 2G8UA 3HRGA 3U3GA 4OX9K 4N76A 3AA5X 4JKGB 3AVHA 3FR0A 5HRNA 4E3SA 5LJWA 4DV0K 5I3UA 3TWHA 4UY8O 3S9HA 5C2DA 4BQLA 2GBZA 4CJ7A 2UUBK 5AQMA 1U4BA 4NCBA 1VSHA 3HI0A 1SAZA 3KKRA 1EWQA 3O3HA 3THXA 3KHYA 4H0TB 3ZYYX 3SK3A 1GLJO 3HTVA 5LMNK 3ZX0A 4FK0A 2HW3A 3VEXA 1XUPO 3DJCA 4DFJA 1VHXA 3DWLA 3E9PA 1NNEA 2QWLA 4DLGA 1NM1A 2A42A 3PX6A 3TSPA 2GWKA 2O8DA 4RWTA 1D4XA 2D0OA 4I7FA 4RW4A 2WONA 2YCHA 5J2NA 4CGHA 2BE2A 1F21A 4Z4HA 2PYLA 4BR9A 4CGGA 3VQ7A 3AVLA 4OGCA 2OZSA 1BA0A 3J7ZO 5FPEA 2G8HA 1YJNN 2PYJA 3SNNA 3ZT1A 2NRZA 3DRPA 4RW8A 1VQLN 5CE3A 1KXPA 2VGNA 3D7EO 3VEWA 3OJUA 4LFCK 4E1MA 3DI6A 3T3FA 4FJLA 4DFPA 3WXLA 2ZD1A 4FJGA 5JS1A 4CHOA 3ZSZA 4YNQA 1VRTA 3EKSA 1C1BA 5AQNA 1BQNA 1KAYA 4CEOA 3U9ZA 2B5JA 4JS4A 2RE2A 2E1YA 5DM6L 4X65K 1XI1A 1S22A 4IDKA 3J7AP 4H0XB 3BF1A 3OY9A 1KFSA 4KI4A 4KTWA 3ZLJA 4CJ5A 1J5EK 2QEXN 4CGFA 2YJEA 4OKEA 4LF5K 3CG7A 4I2QA 1WB9A 4KHUA 4B1WB 4IXCA 1GOAA 2G8VA 1U6ZA 3VF6A 4JKHA 4FWKA 4LC9B 4AM7A 1SL2A 2XRIA 1EETA 4CCHA 1HNIA 3HOSA 3CM6A 1V4SA 1XHXA 3M5RA 3O9UA 3OA9A 5HROA 2JWLA 1IG9A 1B9DA 4DU3A 2RPIA 4CZEA 1NGJA 3BUZB 4WQ5A 4MLHA 1KFDA 4CK3A 3OS2A 3LM9A 3OW2M 5C12A 4V19S 3VEOA 5CZ2A 3A5NC 3QO9A 4PKGA 5F2RA 2D0BA 2HHHK 4E1JA 4FWLA 3V1QA 3OVNA 3ULEB 2ITGA 5EU7A 4LF7K 3T1AA 2IC3A 4W5OA 3QETA 4LH5A 3SAHA 3QEWA 1ZBSA 2VQEK 1HNWK 3PIPL 4UQGA 3HK2A 4JI3K 4CZJA 3HM9A 1KQSM 3BGRA 3DAWA 5AQLA 4FXDA 2E20A 1JLBA 4FWOA 4BQZA 3G25A 4DWIA 1IBLK 3VEZA 1VQ7N 3H3OB 2NZTA 3EY1A 3BY5A 5CY4A 4CJTA 3DRRA 3CI5A 2Q2RA 3M1FA 4CIFA 1S1UA 4CJRA 1TVRA 2XO7A 5AQUA 1C0FA 3D45A 4FJHA 3A5LC 5AQFA 1BU6O 3WEEA 1X9JA 2FBTA 3J81O 3DXKA 3LDNA 3OYCA 1BHLA 1TL1A 4BWJA 4CIEA 4O5FA 2HMPA 2FF3B 3LP2A 2NRXA 2E2PA 3QEVA 3L3UA 3AO5A 4BDZA 3SJHA 1Q82O 1W97L 1NGIA 2BTFA 2YI1A 3DXKB 2E6MA 2KLAA 1DTTA 4CJ3A 1P8ZA 4B3RK 3CCMN 4CFCA 2XY7A 2QXLA 1WOQA 1BDGA 4FJ8A 2DFHA 2FLOA 2BUPA 4KHQA 1A5WA 4M45A 4AHRA 3DOLA 1C0UA 4DV7K 4FLYA 3SAGA 4FM2A 3O9TA 3K57A 4DQSA 4JKGA 1WSJA 2OPQA 5CHIA 4BE2A 4ID1A 4GV6A 3VMFB 3B8AX 2JGUA 3P1GA 5EOYA 4B3SK 4ID5A 1RTIA 4WQ4A 4BDPA 1HNZK 4CFAA 1LAVA 3ZSRA 3DLGA 2YNHA 3KKSA 4FOEA 3HOTA 3H1QA 1RFQA 1IBKK 3TARA 3O4QA 1JCFA 3BDPA 5BR9A 3U8XA 4Y0WA 4BRAA 5C42A 5LY3A 2O8EA 3ZETA 4MQ3A 1NGFA 2Z1HA 1JXEA 4PA1A 3ULEA 3D2EB 3SUPA 5AQXA 3OYIA 5F0XA 1YUWA 3CCQN 1NK6A 4B9TA 3MEGA 3MN6A 5KI6A 4KO0A 1SQKA 2V7ZA 3KK7A 5JLHA 4W5QA 4FLVA 1LCUA 4HWIA 2QTDA 2RN2A 5C24A 4FZXC 4EP4A 1ZBUA 5AQKA 4J2AA 5C2FA 1X9WA 3VA3A 4N5SA 4DQIA 1BL3A 1QVGM 1QTMA 4IO9L 4KH4A 4Q0BA 4BG9A 3QNOA 1HR0K 2NRWA 1SKWA 4O0IA 4AHUA 4FJ7A 2D5RA 5J2PA 3P83D 4NB4A 3DYAA 4BRLA 4IBNA 2UXCK 3UIQA 3NBPA 3PSIA 4FSVA 3CCRN 4CF2A 4NCGA 3S3MA 1ATRA 3TAQA 3RWUA 3CYMA 3M3ZA 1CZBA 4CJFA 1N32K 2QI2A 4H5NA 5C25A 1FK9A 4M3RA 3RSEB 3M8QA 2VG7A 2KW4A 4KH6A 2Q0RA 4LY7A 4H5VA 4BREA 3T1HK 1T44A 4A62A 1ZBFA 1QHTA 3JXUA 1ASWA
chains in the Genus database with same CATH topology
1YAGA 3MN5A 4WFAL 4H5TA 3VF4A 4WF9L 1NGCA 4WFBL 2HSTA 2ZJPL 1NGBA 2CGLA 2WFBA 4ISGA 3AARA 3TTCA 3IMXA 4F9OA 3HM8A 5AQPA 5GAEP 4FOIA 4YOXA 4DQ8A 2IVOA 2E2QA 4B1ZA 3C6AA 2DPNA 1BO5O 4M7YA 4BRNA 2OTLN 3H45C 3FE1A 3WXIA 5C0YA 2P9SB 3GG4A 4OPHA 1EO1A 3K9JA 3H6EA 3QICA 5GIOA 1NGEA 4H0OA 1MWMA 4BC3A 1GLFO 2PBDA 3OHRA 1NJIO 1ILYA 2YHYA 3O80A 5M1PA 4C1NK 4CZIA 3O08A 4FWPA 5EY4A 2ZGZA 2P9NA 1S72N 2NRVA 1NGAA 2P9UB 5AZIA 2OANA 3BP8A 2A40A 5AQRA 1HKGA 4JKAA 1HKBA 4DCHA 4ILJA 3CCVN 3ZEUB 1VQ5N 4BRGA 2D0PA 1HPMA 1DGKN 4WFNL 1QQNA 4QS7A 3QFPA 2VWBA 1HJOA 1BA1A 4IO8A 4ILGB 3OBYA 4FPAA 5AQVA 5AQWA 3E66A 3E9LA 4JKFA 1Y64A 4G9ZA 2VYPA 3BEXA 3SBTA 5E84A 2V52B 4XH1A 1M1KO 4H0YB 1QQMA 1XQSC 3ZX2A 1NMDA 1M90O 2GTDA 3ENOA 4AM6A 5AFUH 1CZAN 2PAVA 3C6HA 3A5OC 3DXMB 3M6GA 3C65A 5GADP 1E4GT 4QS8A 3JS6A 3K9KA 3KZBA 3AY9A 5KQDA 1Q86O 2A3ZA 2CH5A 3G6EN 4FVUA 3CC4N 4IFEA 3CC7N 3ATVA 3ZX3A 5KPTA 3UKUA 3UKRA 1C0GA 2E8AA 1GLEG 2E2NA 4YOUA 3U4LA 2QWOA 4WQ5C 4JHDA 4CBWA 3MCPA 4H5WA 1NGHA 3CCSN 3NVMA 2E1ZA 5E26A 3FZFA 3EN9A 2HBLA 4DKWA 2P9LB 5AQYA 3SBGA 4BVOA 5C10A 2OTJN 1VQ4N 2NRRA 2D1KA 4WYBA 3UKRB 1ZXOA 5GAHP 2ITMA 3U9DA 3WUHA 2NRTA 1K8KA 4H0PA 4J8FA 5FPDA 3L6QA 4FWQA 5LJVA 2IVNA 1QZ5A 4JKDA 4WQ4C 4BR0A 1ATNA 3HRGA 3H46O 3TPQA 1VAZA 3CCEN 3P39A 2F7TA 2A6AA 3MN7A 4NO7A 5AQHA 4JKGB 2CGKA 3FR0A 3VEVA 3D2FB 5LJWA 4H0VB 2IIRA 5AQGA 3TTDA 4UY8O 2HF3A 5C2DA 1BUPA 4BQLA 1NLVA 1SZ2A 2QM1A 3NMUA 4MO5A 4BRKA 4CJ7A 5AQMA 1G99A 4B1YB 3VGMA 5I9EB 5AFUA 5BN8A 3EZWA 1GLLO 3VTIA 3HI0A 1SAZA 3CHWA 4JKCA 1NWKA 3CCLN 2GELA 3KHYA 1WUAA 4H0TB 3ZYYX 3SK3A 4BRMA 1GLJO 3HTVA 1TYQB 2WBNA 3ZX0A 1MA9B 5M1QA 3VEXA 4BRFA 1XUPO 3DJCA 5H1SQ 3DWLA 3E9PA 4BRHA 4JHDB 3I8BA 4C1NI 4BG8A 5GAGP 1VQON 1Q18A 2QWLA 4BGBA 3D2EA 1NM1A 2A42A 2QWMA 3A5MC 4DB3A 4IEIA 2ZJQL 4FWMA 3TSPA 1RGIA 3VESA 2GWKA 4B1UB 5BRDA 2QWNA 4RWTA 1D4XA 2D0OA 3FZKA 2P9IB 4YOYA 2HBJA 2YCHA 1Q7YO 3CJBA 2GX9A 2P9SA 3MDQA 1KAXA 4ILHA 1HKCA 4BR9A 5BPLA 1TUUA 3D6RA 4AF1A 3MX5A 3R9PA 1BA0A 4PL8A 3FLCO 3J7ZO 4A5AA 5FPEA 3TU5A 2E2OA 2Q97A 3AGRA 1OVYA 2ZJRL 1YJNN 2NRZA 1VQLN 5CE3A 3SAFA 4BR4A 1KXPA 4MDBA 2VGNA 1X3MA 3D7EO 4GNIA 4ISEA 3VEWA 2IVPA 2I7NA 4CBUA 2QWRA 5AQQA 1K8AO 5AQIA 4JEPA 2QWPA 4XH5A 3AGKA 2P9KA 3ID8A 2QA4N 2J4RA 4IOCL 5JICA 3WXLA 3L0QA 4GVEA 5KPZA 4BR5A 3IDHA 2ZGYA 3L4IA 1XC3A 3EKSA 3HZ6A 3P38A 5GIPA 3I33A 4CZFA 3LDLA 5AQNA 1KAYA 2UYTA 4BVPA 4B9QA 1YVNA 3U9ZA 5AZJB 2RE2A 2E1YA 5BREA 5DM6L 3Q7BA 1GLAG 1V4TA 3O6WA 3VGLA 3RVCA 4KH5A 2KKZA 4BC4A 2GEMA 1S22A 4C23A 1J6ZA 3CERA 1YITN 4H5RA 4K43A 4H0XB 5EXWA 3BF1A 3CF5L 4RTFD 3QBXA 4MO4A 4B1XB 2QEXN 2ASPA 3O1BA 2YJEA 4PHTX 4A59A 1IJJA 5KPRA 4A57A 1YJWN 2NLXA 3MMVA 2FXUA 3EE8A 3QDKA 4B1WB 3GOIA 4IXCA 2WC9A 3EO3A 3KWGA 3EE9A 4BC5A 1ATSA 1HLUA 1U6ZA 2W40A 2A5XA 4JKHA 3VF6A 1GLCG 4FWKA 4LC9B 4BGAA 4YOVA 3VEYA 3FGUA 3IKMA 4AM7A 3SMSA 4CBXA 3I55N 3HOSA 2KHOA 2V51B 3CD6N 1V4SA 3O9UA 3M5RA 3OA9A 4XH4A 3CCJN 2JWLA 2FF6A 4KBOA 1P90A 3KWIA 4K25A 1K73O 3CQYA 4IZ9A 4CZEA 1KAZA 1NGJA 3BUZB 4WQ5A 4XEIA 4MLHA 4FL9A 4ISFA 3LM9A 3OW2M 5C12A 4EAHD 2Q36A 1JCGA 3VEOA 5BR9A 2P9KB 3A5NC 4PKGA 3QB0A 4JD2A 3S41A 4HTLA 5F2RA 5AQJA 3VTHA 1K9MO 3WXKA 1MDUB 3CIPA 3GL1A 1VQMN 4E1JA 2Q31A 4FWLA 3ULEB 3W3DA 3L4QA 3ZETB 3N4QA 3CPWM 1IG8A 4MLEA 3LDPA 5ADXA 3PIOL 1T6DA 4JKEA 5FPNA 3HSCA 2VCPA 2WUSA 3ID6A 1QQOA 3ATUA 2F9TA 4BY9C 3A0IX 4GV3A 3NVKA 2YX6A 5AQSA 4JK9A 4BC2A 5ADXH 1QVFM 2YHWA 3GDQA 2BH1A 4YDUC 4A2BA 2GUPA 4CD3A 5GINA 5JVHL 2CGJA 4FO0A 3SAHA 1ZBSA 1VQ8N 3PIPL 4CZJA 1KQSM 3LL3A 1GLDG 3DAWA 5AQLA 2E20A 4R79A 3T69A 4FWOA 4BQZA 3G25A 2W41A 4IEEA 2P9PB 2NRHA 2QWQA 4NLCA 1VQ9N 4I6MA 5BPNA 3VPZA 1MWKA 3VEZA 2HBKA 3CJ1A 1VQ7N 3H3OB 4WCEL 2NZTA 1BWFO 3P31A 4BRDA 4U7BA 4CZMA 5BN9A 1H1VA 3CI5A 2Q2RA 3M1FA 4RCHA 4DHYA 5C15A 4JN4A 1K8KB 4JK7A 4EFHA 4Z94A 1TUYA 2GWJA 1VQKN 3RSEA 4GV9A 5MLCQ 4I6MB 3CETA 2P9PA 2JWKA 3O8MA 3J8AA 2A41A 2P9LA 3LM2A 5AQUA 1C0FA 3G4SN 3WQTA 4NLBA 3A5LC 3G71N 5AQFA 3R8EA 1BU6O 3WEEA 1X9JA 4M63C 5AZIB 3MWTA 1NBWA 3CQXA 3Q7CA 1NGDA 3DXKA 5EX5A 2YJFA 2FSNA 3LDNA 3VOVA 3EKUA 4O5FA 5M1OA 3VENA 1U2VB 5AR0A 4BRQA 2HMPA 1JCEA 2FF3B 2NRXA 5AQTA 2E2PA 2QW9A 4A5BA 5B8HA 1Q82O 3MK6A 3SJHA 4BRIA 4CZGA 3R1XA 1W97L 3WT0A 1NGIA 5BRFA 3FZMA 2BTFA 2V7YA 2YI1A 3DXKB 5M1KA 5F1XA 1DT9A 2RHKA 2KLAA 5JVGL 3MN9A 4IWVA 4O8UA 1BOTO 1P8ZA 3CCMN 4PKIA 2QXLA 2F9WA 2NNWA 1QHAA 3UB5A 2PFUA 1WOQA 1BDGA 3GE1A 2FLOA 1VQPN 2BUPA 2VGMA 3UE5A 1Z6RA 5TKYA 3CJ9A 5DM7L 4YDUA 5CR4A 3CCUN 4CZKA 1YI2N 2D4WA 3PLAA 3SAGA 1N8RO 3O9TA 5JMVA 2I7PA 1HX1A 1ESVA 4JKGA 5BRHA 3QFUA 3SMPA 5CHIA 3ENBA 1T3VA 5BPMA 3HBTA 1HUXA 4GV6A 3VMFB 3B8AX 3F2KA 5EOYA 1E4FT 4FWNA 4JAXA 4B1VA 3GBTA 3P4IA 4PKHA 4WQ4A 5AQOA 1W2BM 4JK8A 4FPBA 4FOEA 3WXJA 5M1NA 3HOTA 3H1QA 3ZEUA 3CPEA 3CXCM 1RFQA 3QMLA 4CI6A 1T6CA 2H3GX 3CJCA 3WEEB 1YJ9N 3O1WA 1QZ6A 5ELZA 1JCFA 3O9SA 2P9IA 2ZF5O 1TYQA 1YXQA 2HOEA 2P9UA 5AQZA 3U8XA 4Y0WA 1ZC6A 3TSQA 2Q0UA 4BRAA 3N4PA 5LY3A 3ZETA 1KC8O 1NGFA 3IUCA 2AA4A 1OKJA 3ULEA 3VGKA 3D2EB 1LOTB 5AQXA 5HL7L 2CH6A 5F0XA 3EL2A 3VETA 4EHTA 1YUWA 5AZJA 3TTFA 3CCQN 4O8KA 4JD2B 3DLLL 4JNEA 4BR2A 4IJAA 4JKBA 5TKWA 1U2VA 3E1YA 3MN6A 1YIJN 1O13A 3CMAN 3TSUA 1SQKA 2V7ZA 3KK7A 5JLHA 3C7NA 3VERA 4IJNA 1YF5L 1RDUA 3AAPA 3BF3A 4OPAA 3WXMB 1VQ6N 3FZHA 1LCUA 4L3QA 3CJAA 2QTDA 2YHXA 3ENHA 4HWIA 4CZHA 4EIAA 4CZLA 4EHUA 3CMEN 5AQKA 4BRPA 3CC2N 3VF2A 4BROA 5C2FA 2EWSA 3O9RA 3D2FA 3O4WA 2E88A 3MX2A 5M1FA 2ASOA 3C7NB 3F5TA 4FWSA 1QVGM 1X3NA 3O9QA 3F9MA 4IO9L 4GY2B 4KH4A 3A8YA 1NGGA 4BRCA 4PL7A 1VQNN 4BG9A 4M7XA 1GLBG 3H3NO 4IOAL 1DKGD 2NRWA 1JJ2M 2P9NB 1SS6A 4H03B 4YORA 4A61A 4OO1J 1S3XA 3O5BA 4NB4A 3MCAB 2FSKA 4BRLA 5JLFA 3FZLA 4A2AA 4U67L 2ASMA 3CJ7A 5EVZA 4FWRA 1DEJA 3AAQA 4FSVA 3CCRN 3R3LA 5HOOA 4YOTA 3FFKB 1ATRA 3R6MA 3SLCA 3M3ZA 3T7ZA 1KD1O 1EQYA 3I56N 3KVGA 3WQUA 1Q81O 2AP1A 5KQ8A 1BG3A 1R59O 4K41A 2QI2A 2HBMA 4H5NA 4QS9A 3UKUB 4MDAA 3C0BA 3RSEB 2Q1NA 3OBWA 3MWPA 2HF4A 4K42A 3W0LA 4BR7A 4CD1A 5FPMA 4YOWA 4KH6A 2Q0RA 3H1VX 3IFRA 3LDQA 2ZWHA 3QBWA 1RDWX 4H5VA 4BREA 1YHQN 3LDOA 4IDHA 1T44A 1Z05A 4A62A 3DXMA 2FSJA 3JXUA 3E9OA 4IOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAG A;  3MN5 A;  4H5T A;  3VF4 A;  1NGC A;  1NGB A;  2CGL A;  4ISG A;  3AAR A;  3IMX A;  4F9O A;  3HM8 A;  5AQP A;  4FOI A;  4DQ8 A;  2IVO A;  2E2Q A;  4B1Z A;  4M7Y A;  2DPN A;  1BO5 O;  4BRN A;  3H45 C;  3FE1 A;  3WXI A;  2P9S B;  3GG4 A;  3H6E A;  3QIC A;  1NGE A;  4H0O A;  1MWM A;  4BC3 A;  1GLF O;  2PBD A;  3OHR A;  2YHY A;  3O80 A;  4CZI A;  3O08 A;  4FWP A;  5EY4 A;  2ZGZ A;  2P9N A;  1NGA A;  2P9U B;  5AZI A;  2OAN A;  3BP8 A;  2A40 A;  5AQR A;  1HKG A;  1HKB A;  4DCH A;  3ZEU B;  4BRG A;  2D0P A;  1HPM A;  1DGK N;  1QQN A;  4QS7 A;  3QFP A;  2VWB A;  1HJO A;  1BA1 A;  4IO8 A;  5AQW A;  4FPA A;  5AQV A;  1Y64 A;  2VYP A;  3BEX A;  5E84 A;  2V52 B;  4XH1 A;  4H0Y B;  1QQM A;  1XQS C;  3ZX2 A;  1NMD A;  2GTD A;  3ENO A;  4AM6 A;  5AFU H;  1CZA N;  2PAV A;  3A5O C;  3DXM B;  3M6G A;  1E4G T;  4QS8 A;  3JS6 A;  3KZB A;  3AY9 A;  5KQD A;  2A3Z A;  2CH5 A;  3ATV A;  3ZX3 A;  5KPT A;  3UKU A;  3UKR A;  1C0G A;  2E8A A;  1GLE G;  2E2N A;  3U4L A;  2QWO A;  4WQ5 C;  4JHD A;  4CBW A;  3MCP A;  4H5W A;  1NGH A;  2E1Z A;  5E26 A;  3FZF A;  3EN9 A;  2P9L B;  5AQY A;  4BVO A;  2D1K A;  4WYB A;  3UKR B;  1ZXO A;  2ITM A;  3U9D A;  3WUH A;  1K8K A;  4H0P A;  4J8F A;  5FPD A;  3L6Q A;  4FWQ A;  5LJV A;  2IVN A;  1QZ5 A;  4WQ4 C;  4BR0 A;  1ATN A;  3H46 O;  3TPQ A;  2A6A A;  3MN7 A;  4NO7 A;  5AQH A;  2CGK A;  3FR0 A;  3VEV A;  3D2F B;  5LJW A;  4H0V B;  2IIR A;  5AQG A;  2HF3 A;  1BUP A;  4BQL A;  1NLV A;  1SZ2 A;  2QM1 A;  4MO5 A;  4BRK A;  4CJ7 A;  5AQM A;  1G99 A;  4B1Y B;  3VGM A;  5I9E B;  5AFU A;  5BN8 A;  3EZW A;  1GLL O;  3HI0 A;  1SAZ A;  3CHW A;  1NWK A;  2GEL A;  3KHY A;  1WUA A;  4H0T B;  4BRM A;  3SK3 A;  1GLJ O;  3HTV A;  1TYQ B;  3ZX0 A;  1MA9 B;  3VEX A;  4BRF A;  1XUP O;  3DJC A;  3DWL A;  4BRH A;  4JHD B;  3I8B A;  4BG8 A;  1Q18 A;  2QWL A;  4BGB A;  3D2E A;  1NM1 A;  2A42 A;  2QWM A;  3A5M C;  4DB3 A;  4FWM A;  1RGI A;  3VES A;  2GWK A;  4B1U B;  5BRD A;  2QWN A;  4RWT A;  1D4X A;  2D0O A;  3FZK A;  2P9I B;  2YCH A;  3CJB A;  2P9S A;  3MDQ A;  1KAX A;  1HKC A;  4BR9 A;  5BPL A;  1TUU A;  3R9P A;  1BA0 A;  4PL8 A;  3FLC O;  5FPE A;  3TU5 A;  2E2O A;  2Q97 A;  5CE3 A;  4BR4 A;  1KXP A;  4ISE A;  1X3M A;  3D7E O;  4GNI A;  3VEW A;  2IVP A;  2I7N A;  4CBU A;  2QWR A;  5AQQ A;  5AQI A;  2QWP A;  4XH5 A;  2P9K A;  3ID8 A;  2J4R A;  5JIC A;  3WXL A;  3L0Q A;  5KPZ A;  4BR5 A;  3IDH A;  2ZGY A;  3L4I A;  1XC3 A;  3EKS A;  3HZ6 A;  3I33 A;  4CZF A;  3LDL A;  5AQN A;  1KAY A;  2UYT A;  4BVP A;  4B9Q A;  1YVN A;  3U9Z A;  5AZJ B;  5BRE A;  2E1Y A;  1GLA G;  1V4T A;  3O6W A;  3VGL A;  4BC4 A;  2GEM A;  1S22 A;  4C23 A;  1J6Z A;  3CER A;  4H5R A;  4K43 A;  4H0X B;  5EXW A;  3BF1 A;  4RTF D;  3QBX A;  4MO4 A;  4B1X B;  2ASP A;  3O1B A;  2YJE A;  1IJJ A;  5KPR A;  2NLX A;  3MMV A;  2FXU A;  3QDK A;  4B1W B;  3GOI A;  4IXC A;  3EO3 A;  4BC5 A;  1ATS A;  1HLU A;  1U6Z A;  2A5X A;  2W40 A;  3VF6 A;  4BGA A;  1GLC G;  4FWK A;  4LC9 B;  3VEY A;  3FGU A;  4AM7 A;  3SMS A;  4CBX A;  2KHO A;  2V51 B;  1V4S A;  4XH4 A;  2FF6 A;  4KBO A;  4K25 A;  3CQY A;  4IZ9 A;  4CZE A;  1KAZ A;  1NGJ A;  3BUZ B;  4WQ5 A;  4XEI A;  4MLH A;  4FL9 A;  4ISF A;  3LM9 A;  4EAH D;  2Q36 A;  1JCG A;  3VEO A;  2P9K B;  3A5N C;  4PKG A;  3QB0 A;  4JD2 A;  3S41 A;  4HTL A;  5F2R A;  5AQJ A;  3WXK A;  1MDU B;  3CIP A;  3GL1 A;  4E1J A;  2Q31 A;  4FWL A;  3ULE B;  3W3D A;  3ZET B;  1IG8 A;  4MLE A;  3LDP A;  5ADX A;  1T6D A;  5FPN A;  3HSC A;  2VCP A;  2WUS A;  1QQO A;  3ATU A;  2F9T A;  3A0I X;  5AQS A;  4BC2 A;  5ADX H;  2YHW A;  3GDQ A;  4YDU C;  4A2B A;  4CD3 A;  2GUP A;  2CGJ A;  4FO0 A;  1ZBS A;  4CZJ A;  3LL3 A;  1GLD G;  3DAW A;  5AQL A;  2E20 A;  4FWO A;  4BQZ A;  3G25 A;  2W41 A;  2P9P B;  2NRH A;  2QWQ A;  4I6M A;  5BPN A;  3VPZ A;  1MWK A;  3VEZ A;  3CJ1 A;  3H3O B;  2NZT A;  1BWF O;  4BRD A;  4CZM A;  5BN9 A;  1H1V A;  3CI5 A;  2Q2R A;  3M1F A;  4RCH A;  4DHY A;  4JN4 A;  1K8K B;  4EFH A;  4Z94 A;  1TUY A;  2GWJ A;  3RSE A;  4I6M B;  3CET A;  2P9P A;  3O8M A;  3J8A A;  2A41 A;  2P9L A;  3LM2 A;  5AQU A;  1C0F A;  3WQT A;  3A5L C;  5AQF A;  3R8E A;  1BU6 O;  3WEE A;  1X9J A;  4M63 C;  5AZI B;  1NBW A;  3CQX A;  1NGD A;  3DXK A;  5EX5 A;  2YJF A;  2FSN A;  3LDN A;  3VOV A;  3EKU A;  4O5F A;  3VEN A;  1U2V B;  5AR0 A;  4BRQ A;  2HMP A;  1JCE A;  2FF3 B;  5AQT A;  2E2P A;  2QW9 A;  5B8H A;  3MK6 A;  3SJH A;  4BRI A;  4CZG A;  3WT0 A;  1NGI A;  5BRF A;  3FZM A;  2BTF A;  2V7Y A;  2YI1 A;  3DXK B;  5F1X A;  3MN9 A;  4IWV A;  1BOT O;  1P8Z A;  4PKI A;  2QXL A;  2F9W A;  1QHA A;  3UB5 A;  1WOQ A;  1BDG A;  3GE1 A;  2FLO A;  2BUP A;  3UE5 A;  1Z6R A;  5TKY A;  3CJ9 A;  4YDU A;  4CZK A;  2D4W A;  5JMV A;  2I7P A;  1HX1 A;  1ESV A;  5BRH A;  3QFU A;  3SMP A;  5BPM A;  3HBT A;  1HUX A;  3B8A X;  5EOY A;  1E4F T;  4FWN A;  4JAX A;  4B1V A;  3GBT A;  3P4I A;  4PKH A;  4WQ4 A;  5AQO A;  4FPB A;  4FOE A;  3WXJ A;  3H1Q A;  3ZEU A;  1RFQ A;  3QML A;  4CI6 A;  1T6C A;  2H3G X;  3CJC A;  3WEE B;  3O1W A;  1QZ6 A;  5ELZ A;  1JCF A;  2P9I A;  2ZF5 O;  1TYQ A;  1YXQ A;  2HOE A;  2P9U A;  5AQZ A;  3U8X A;  4Y0W A;  1ZC6 A;  5BR9 A;  2Q0U A;  4BRA A;  5LY3 A;  3ZET A;  1NGF A;  3IUC A;  2AA4 A;  1OKJ A;  3ULE A;  3VGK A;  3D2E B;  1LOT B;  5AQX A;  2CH6 A;  5F0X A;  3EL2 A;  3VET A;  4EHT A;  1YUW A;  5AZJ A;  4O8K A;  4JD2 B;  4JNE A;  4BR2 A;  4IJA A;  1U2V A;  3MN6 A;  1SQK A;  2V7Z A;  5JLH A;  3C7N A;  3VER A;  4IJN A;  3AAP A;  3BF3 A;  3FZH A;  1LCU A;  4L3Q A;  3CJA A;  4HWI A;  2YHX A;  3ENH A;  4CZH A;  4EIA A;  4CZL A;  4EHU A;  5AQK A;  4BRP A;  3VF2 A;  4BRO A;  2EWS A;  3D2F A;  3O4W A;  2E88 A;  2ASO A;  3C7N B;  4FWS A;  1X3N A;  3F9M A;  4GY2 B;  3A8Y A;  1NGG A;  4BRC A;  4PL7 A;  4BG9 A;  4M7X A;  1GLB G;  3H3N O;  1DKG D;  2P9N B;  4H03 B;  4A61 A;  1S3X A;  3O5B A;  4NB4 A;  4BRL A;  2FSK A;  5JLF A;  3FZL A;  4A2A A;  2ASM A;  3CJ7 A;  5EVZ A;  4FWR A;  1DEJ A;  3AAQ A;  4FSV A;  3FFK B;  1ATR A;  3R6M A;  3SLC A;  3M3Z A;  1EQY A;  3KVG A;  3WQU A;  2AP1 A;  5KQ8 A;  1BG3 A;  1R59 O;  4K41 A;  4H5N A;  4QS9 A;  3UKU B;  3C0B A;  3RSE B;  2Q1N A;  4BR7 A;  4K42 A;  2HF4 A;  4CD1 A;  3W0L A;  5FPM A;  2Q0R A;  3H1V X;  3IFR A;  3LDQ A;  2ZWH A;  3QBW A;  1RDW X;  4H5V A;  4BRE A;  3LDO A;  1T44 A;  1Z05 A;  4A62 A;  3DXM A;  2FSJ A;  3JXU A; 
#chains in the Genus database with same CATH topology
 4NXM K;  3VF4 A;  2EX3 A;  4WFB L;  3VQ8 A;  1RTH A;  3OJS A;  4DUZ K;  1JLA A;  2WFB A;  3MEE A;  3TTC A;  4LF9 K;  2IAJ A;  1C6V A;  1NOY A;  3HM8 A;  4C8N A;  3K5O A;  5HLF A;  2IVO A;  3SUQ A;  1SL0 A;  1VSK A;  2UXB K;  4B1Z A;  4KHN A;  4KFB A;  3IG1 A;  3WXI A;  4DU4 A;  2P9S B;  3GG4 A;  3K9J A;  1E3M A;  3VQ4 A;  3VA0 A;  5GIO A;  1NGE A;  4H0O A;  4FJ9 A;  4BC3 A;  4DR6 K;  1IKV A;  1SL1 A;  1BIS A;  2YHY A;  1Y97 A;  4DR3 K;  3NH1 A;  3DRS A;  3LAN A;  4FWP A;  2ZGZ A;  1Z25 A;  1S72 N;  3EEQ A;  2P9U B;  2O8F B;  1IBM K;  4J2E A;  2A40 A;  5E41 A;  4N56 A;  1HKG A;  1QS4 A;  4PUO A;  1S1W A;  1XHZ A;  3ZEU B;  3CFR A;  3G0Z A;  1QQN A;  1XNR K;  3LP3 A;  4BWM A;  4QS7 A;  3QFP A;  1HJO A;  4IO8 A;  4ILG B;  5AQW A;  3E66 A;  4JKF A;  1CLQ A;  4DV5 K;  3SCX A;  5E84 A;  1RDB A;  3OYD A;  1M1K O;  4ICL A;  1OH6 A;  3ZX2 A;  3P5J A;  1NMD A;  3QER A;  1M90 O;  3ENO A;  3THY B;  4CJK A;  3AY9 A;  3AO4 A;  5KQD A;  2A3Z A;  3NGZ A;  3G6E N;  1WN7 A;  1BGX T;  3ZX3 A;  3UKR A;  1GLE G;  5HBM A;  4WQ5 C;  1L3S A;  4JHD A;  4TSX A;  4B9M A;  4H5W A;  3NVM A;  3HST B;  3OYN A;  2LSN A;  3EN9 A;  2HBL A;  4DKW A;  3J7Y P;  2P9L B;  3SBG A;  5C10 A;  2OTJ N;  1JLC A;  1RBV A;  4KV8 A;  4Y1C A;  3L8B A;  2Y1J A;  1BI4 B;  3QES A;  2HHU A;  1XMO K;  2ZM6 K;  2QXF A;  4H0P A;  4E7J A;  1QZ5 A;  2F8T A;  1TAQ A;  3CCE N;  4RW7 A;  3P39 A;  3MN7 A;  2UUA K;  3TTD A;  1MU2 A;  1B9F A;  1BUP A;  4E7I A;  4MO5 A;  1G99 A;  3C95 A;  5BN8 A;  4CHY A;  4FJI A;  3CHW A;  4JKC A;  1T05 A;  1NWK A;  3CFP A;  1SKR A;  3L2V A;  3AVC A;  1TYQ B;  4BE1 A;  1D9F A;  4LF6 K;  4FCY A;  5KRS A;  5H1S Q;  4JHD B;  3I8B A;  4CJW A;  1VQO N;  2FBY A;  3S3N A;  1NK5 A;  2QWM A;  4DB3 A;  4FWM A;  5HRS A;  1RGI A;  4B1U B;  4CEC A;  3FZK A;  2P9I B;  2HBJ A;  1Q7Y O;  1TKD A;  3WNE A;  1IKX A;  1BIZ A;  1KVC A;  3OYJ A;  1KVB A;  3MX5 A;  4JI7 K;  4DV1 K;  4PL8 A;  4CER A;  4CEA A;  4KRF A;  2ETJ A;  4OPJ A;  1UOC A;  2HNZ A;  2G8F A;  1K6Y A;  3RRH A;  1K8A O;  5AQI A;  4JEP A;  2P9K A;  1ZBH A;  1NG9 A;  2KZM A;  3L0Q A;  4GVE A;  5KPZ A;  4BR5 A;  4HTU A;  3M8S A;  3RMD A;  2Z1G A;  4OVL A;  1C0T A;  4CZF A;  1EXQ A;  5SWM A;  4KI6 A;  1WSG A;  4BVP A;  5BRE A;  4BC4 A;  3V6D A;  3MED A;  4KH5 A;  2GEM A;  4H5R A;  4K43 A;  1KRP A;  2ATQ A;  3CF5 L;  4DTO A;  2ASP A;  4CGI A;  1EP4 A;  3KK1 A;  3DLK A;  4FJM A;  5KPR A;  3JYT A;  4CF0 A;  4A57 A;  2NLX A;  3MMV A;  4CJU A;  3EE8 A;  3GOI A;  4GW6 A;  4GKK K;  3EO3 A;  4EZ6 A;  4M3X A;  3KWG A;  2A5X A;  4KTQ A;  3VEY A;  1NKE A;  4R5P A;  4DTP A;  3SMS A;  4CBX A;  3I55 N;  1OH5 A;  2KHO A;  1QQC A;  3CD6 N;  2HHV A;  1UA0 A;  5AJ3 K;  5J1E A;  3CCJ N;  4OPK A;  4KBO A;  4K25 A;  4XEI A;  1XWL A;  5FRN A;  4EAH D;  2Q36 A;  3ZCM A;  2F4V K;  2P9K B;  3S41 A;  1HQE A;  1W9H A;  4HTL A;  1EWR A;  3WXK A;  3GL1 A;  3CIP A;  3L2W A;  1VQM N;  2OPS A;  1J53 A;  1N6Q A;  3W3D A;  3L4Q A;  3N4Q A;  3PIO L;  2HND A;  3TR8 A;  1KCF A;  4BY9 C;  3ZSX A;  3A0I X;  5A2Q O;  1YTA A;  3V9U A;  2BH1 A;  4A2B A;  4HVJ A;  5GIN A;  5JVH L;  4JYA K;  1I94 K;  3T69 A;  4KB0 A;  4FJN A;  1X1P A;  4IEE A;  2NRH A;  4JRP A;  1VQ9 N;  4I6M A;  1Q9Y A;  3VPZ A;  1MWK A;  2HBK A;  4WCE L;  4O5B A;  2OCE A;  4BRD A;  4CZM A;  3QEX A;  4DHY A;  3NH0 A;  2A1R A;  4LF8 K;  1K8K B;  3KLH A;  4DSK A;  4EFH A;  4I9Q A;  1U45 A;  4GV9 A;  4DTX A;  4I6M B;  3CET A;  3O8M A;  2JWK A;  1N5Y A;  4CJE A;  5D3G A;  2A41 A;  2P9L A;  3OYH A;  4FLU A;  4E89 A;  4NLB A;  3HVR A;  3R8E A;  5BR8 K;  1NBW A;  3CQX A;  3Q7C A;  1NGD A;  1VSM A;  2YJF A;  3VOV A;  1NOZ A;  1HYV A;  3VEN A;  4BRQ A;  1JCE A;  4W5N A;  1WSH A;  4XIU A;  4BRI A;  4F2R A;  5BRF A;  2V7Y A;  1RNH A;  2O8E B;  2RHK A;  4IWV A;  2YKN A;  3MEC A;  4CEF A;  1BOT O;  5LMU K;  2F9W A;  1QHA A;  3UB5 A;  4FYD A;  1WSI A;  3ZT4 A;  3K5N A;  3ZT3 A;  3UE5 A;  5TKY A;  5DM7 L;  5CR4 A;  3OYM A;  4AHC A;  4CZK A;  1YI2 N;  1N8R O;  1ASV A;  3VN5 A;  3ENB A;  1HUX A;  2IOC A;  5DK5 A;  1E4F T;  1NK7 A;  4JAX A;  4B1V A;  4O4G A;  5AQO A;  5CYQ A;  1S6P A;  1NK0 A;  4NCA A;  5M1N A;  4AH9 A;  3ZEU A;  3KJV A;  4CJV A;  3CXC M;  3QML A;  4CI6 A;  3CJC A;  3WEE B;  4LSN A;  3SQ0 A;  3DLB A;  5AQZ A;  1NMN A;  3N4P A;  3LP0 A;  1S9E A;  4M3Y A;  1OKJ A;  3VGK A;  3VQA A;  2R7Y A;  5J2Q A;  4M3Z A;  4IFV A;  3VET A;  4M42 A;  3V9Z A;  3PO4 A;  3EZ5 A;  4O8K A;  4IJA A;  3IAY A;  1O13 A;  3VQE A;  1JLE A;  2OA8 A;  1RCH A;  1YF5 L;  1RDU A;  2O4I A;  1N36 K;  2E6L A;  4KHY A;  4CK1 A;  5SZT A;  3KK2 A;  2O8F A;  1XNQ K;  4JI0 K;  3ENH A;  4CZL A;  3CME N;  4K8Z A;  3AA3 A;  4BRP A;  2E4L A;  2EWS A;  1J9A A;  3D2F A;  3O4W A;  3SJJ A;  2KFN A;  4FWS A;  3DM2 A;  1X3N A;  3BZC A;  4E7L A;  5T7B A;  1T8E A;  1VQN N;  4CEE A;  1JJ2 M;  2P9N B;  2YNG A;  1SS6 A;  1BCO A;  4A61 A;  4OO1 J;  1UWB A;  2UU9 K;  4FZY A;  1I39 A;  1DLO A;  1YVU A;  1U49 A;  2FSK A;  1HNV A;  5JLF A;  2E5L K;  3HT3 A;  5EVZ A;  3QIO A;  1Z26 A;  5HOO A;  3SLC A;  1KD1 O;  1Q81 O;  2AP1 A;  1R59 O;  2X6N A;  1YTU A;  2BGG A;  3HP6 A;  4DTJ A;  3MAQ A;  1VSL A;  4MDA A;  3W0L A;  1BCM A;  1RDW X;  3LDO A;  1Z05 A;  1VSJ A;  2W42 A;  3ALY A;  1TKT A;  3LPU A;  3OYL A;  1NKB A;  3AVM A;  1FKO A;  1YAG A;  3MN5 A;  3C94 A;  4O55 A;  1VSD A;  2IS3 A;  1SV5 A;  5KGX A;  3RMC A;  2CGL A;  3TI0 A;  2HVH A;  5GAE P;  1YT3 A;  4H4O A;  3ZSO A;  4ZHR A;  1S9G A;  5C0Y A;  4OPH A;  3HO1 A;  4B9V A;  4YFU A;  3QIC A;  1CZ9 A;  3SPZ A;  3MXJ A;  1ILY A;  2VQF K;  2VWK A;  1RBU A;  3K5M A;  4KRE A;  3O08 A;  1IO2 A;  3RR7 A;  5EY4 A;  4KAZ A;  2NRV A;  4LSL A;  3BP8 A;  1FW6 A;  3OS0 A;  3PY8 A;  3MXM A;  4DCH A;  4ZTJ A;  4BRG A;  5HRR A;  4WFN L;  3AA2 A;  4I2P A;  4CF8 A;  3KIO A;  4CFD A;  1D5A A;  5AQV A;  4G9Z A;  1SKS A;  2VYP A;  4CJQ A;  3SBT A;  4N47 A;  1QQM A;  4B3O A;  2HHQ A;  2YNI A;  5AFU H;  2PAV A;  2KTQ A;  3DXM B;  3S3O A;  1E4G T;  4QS8 A;  3JAM O;  1NU0 A;  1Q86 O;  2P5G A;  4E0D A;  2HHS A;  4IFE A;  4DSF A;  3ATV A;  3TAP A;  2Q3S A;  1C0G A;  3SV4 A;  3U4L A;  1QSY A;  4YOU A;  1RT7 A;  1WNS A;  3NFA A;  5FDL A;  1BIU A;  3CCS N;  1LWE A;  2E1Z A;  5E26 A;  1S1T A;  4DQP A;  4CFB A;  4IG3 A;  2ITM A;  4FJK A;  3U9D A;  3WUH A;  3ZT0 A;  1VSF A;  5FPD A;  3RTV A;  4FWQ A;  5LJV A;  4BR0 A;  4KHS A;  3BZK A;  3H46 O;  1VAZ A;  1TAU A;  3AVF A;  4PY5 A;  4DTU A;  2F7T A;  2A6A A;  4NO7 A;  3LP1 A;  1NKC A;  3D2F B;  1W7A A;  2IIR A;  3PV8 A;  2HF3 A;  1ZYQ A;  3C6T A;  1NLV A;  1LW2 A;  4BRK A;  2OYQ A;  4GKJ K;  3AA4 A;  4B1Y B;  1Q9X A;  3VGM A;  3AO2 A;  4Z4E A;  3EZW A;  3VTI A;  1RDD A;  2GEL A;  3ZSQ A;  3LPT A;  5M1Q A;  4BRF A;  4BRH A;  1UA1 A;  4JI2 K;  3QIN A;  2XY8 A;  1Q18 A;  2DTU A;  4JI4 K;  4BGB A;  4CJP A;  2A1S A;  4FJ5 A;  4IEI A;  2QWN A;  3HL8 A;  4J2D A;  4C8O A;  4F8R A;  4CF9 A;  2DFF A;  3MXI A;  2P9S A;  2IDO A;  1KAX A;  4L8R B;  4ILH A;  4CHZ A;  5BPL A;  1TUU A;  1RT4 A;  3AVB A;  3R9P A;  2WOM A;  3FLC O;  4A5A A;  2E2O A;  1CXQ A;  1I3A A;  1OVY A;  3AGR A;  3RR8 A;  3RRG A;  4QAG A;  4LF4 K;  4BR4 A;  4MDB A;  4OKK A;  5JS2 A;  4ISE A;  1X3M A;  4LD0 A;  4GNI A;  3D0P A;  5AQQ A;  1GOC A;  4KHW A;  2QWP A;  2I5J A;  4JV5 K;  3AVG A;  3V1R A;  5CZ1 A;  4AHT A;  5JIC A;  2ZGY A;  4DV3 K;  3L4I A;  1XC3 A;  4K8X A;  3HZ6 A;  5GIP A;  1TK8 A;  3NF8 A;  3LDL A;  4CK2 A;  1LWC A;  1RT2 A;  3QEP A;  5AZJ B;  3VGL A;  1V4T A;  4C23 A;  4X62 K;  3CER A;  5EXW A;  4RTF D;  3QBX A;  4MO4 A;  4E7H A;  2FBV A;  3O1B A;  4A59 A;  1IJJ A;  3I8D A;  4JI8 K;  1S1X A;  1YJW N;  4M3W A;  2UUC K;  1RTD A;  3KTQ A;  4BC5 A;  5JMV A;  1GLC G;  4YOV A;  3TAM A;  3IKM A;  3PX4 A;  1REV A;  3ITH A;  1NK9 A;  3OYF A;  4XH4 A;  2FF6 A;  1P90 A;  4IZ9 A;  4DV2 K;  4ISF A;  3I0S A;  3SUO A;  2O8B A;  4DR4 K;  1JCG A;  3SI6 A;  4JD2 A;  4Z4I A;  5I42 A;  1RDC A;  3L2Q A;  2Q31 A;  3IRX A;  3CPW M;  4MLE A;  3KLF A;  3LDP A;  1A5X A;  5FPN A;  4CVN E;  4EZ9 A;  3ID6 A;  1VSE A;  4ELT A;  3NVK A;  2YX6 A;  4BC2 A;  5ADX H;  3TAG A;  4YDU C;  4Z4C A;  4F3O A;  3OYG A;  4PQU A;  3LL3 A;  1GLD G;  3OS1 A;  3V9S A;  3VQC A;  3O3G A;  4NLC A;  2XY5 A;  2P9P B;  2QWQ A;  4CEQ A;  2XY6 A;  3QIP A;  1BWF O;  4N41 A;  4U7B A;  3K5L A;  3WNF A;  3O4N A;  4DTS A;  1ZBL A;  1H1V A;  3PX0 A;  1HJR A;  4RCH A;  4W5T A;  2QK9 A;  4JN4 A;  3HPG A;  4JK7 A;  4IG0 A;  1TUY A;  2GWJ A;  1VQK N;  3RSE A;  5MLC Q;  2P9P A;  3LAL A;  2O4G A;  2BAN A;  3PSF A;  4JI5 K;  2KZZ A;  3WQT A;  2XHB A;  4FK2 A;  5FRO A;  4QCL A;  3DMJ A;  2FSN A;  3WNG A;  3NGI A;  3EKU A;  1OVQ A;  3NGY A;  1QSS A;  1U2V B;  5AR0 A;  4NYF A;  2QW9 A;  4A5B A;  3MK6 A;  3M8P A;  4CZG A;  1LV5 A;  1JLQ A;  3FZM A;  5M1K A;  5F1X A;  4FVM A;  1N34 K;  3VQD A;  1HPZ A;  3MN9 A;  2ZE2 A;  4O8U A;  4PKI A;  2PFU A;  1D9D A;  3GE1 A;  1WBB A;  2FBX A;  3LAM A;  3CJ9 A;  5FRM A;  4YDU A;  3SUN A;  1OH7 A;  1C1A A;  4DQQ A;  1QE1 A;  2D4W A;  3KD5 E;  4DTR A;  2DY4 A;  1ESV A;  5BPM A;  1T3V A;  3HBT A;  4DF8 A;  1O1W A;  4FLW A;  4PKH A;  4B9S A;  1LWF A;  1W2B M;  5DMR A;  4NYN A;  4Z4F A;  4FPB A;  4FM1 A;  4M3U A;  3HPO A;  2JLE A;  1T6C A;  1C0M A;  2H3G X;  1TL3 A;  1QZ6 A;  3O1W A;  5ELZ A;  3O9S A;  4X66 K;  2P9I A;  1TYQ A;  2HOE A;  4Z0U A;  3KK3 A;  3TSQ A;  1KC8 O;  1JL1 A;  3SPY A;  1RBR A;  1RT1 A;  3IUC A;  1L3U A;  3VQ6 A;  3EL2 A;  5AZJ A;  1VK0 A;  3ZSV A;  4JD2 B;  3DLL L;  4JNE A;  4JKB A;  5TKW A;  3E1Y A;  1YIJ N;  3CMA N;  2VG5 A;  3C7N A;  1U48 A;  2P1J A;  4IJN A;  3AAP A;  3WXM B;  3L2U A;  1VQ6 N;  4HUE A;  1LW0 A;  1A5V A;  3CJA A;  3ZSY A;  4EHU A;  1N33 K;  4BRO A;  4EP5 A;  1DTQ A;  4BE0 A;  1G15 A;  2YKM A;  1NK4 A;  2E88 A;  5M1F A;  4CGD A;  3C7N B;  3F5T A;  5HRP A;  4K0K K;  3RMB A;  4B9U A;  2IGI A;  1IH7 A;  4CF1 A;  4BRC A;  1NGG A;  3V4I A;  4M7X A;  1GLB G;  1DKG D;  4H03 B;  1HQU A;  4OLB A;  2GV9 A;  1S3X A;  3O5B A;  3QLH A;  3MCA B;  3QEI A;  4LFB K;  4A2A A;  3TAF A;  1RT5 A;  1NJZ A;  4FWR A;  1DEJ A;  3AAQ A;  3NF6 A;  4FLT A;  4B9N A;  3FFK B;  3R6M A;  4FW1 A;  1IV0 A;  3T7Z A;  1BG3 A;  3LZJ A;  2HBM A;  3UKU B;  4CHQ A;  3HJF A;  3OBW A;  4BR7 A;  4G1Q A;  4K42 A;  4CD1 A;  4RG8 A;  3IFR A;  3H1V X;  3QBW A;  2ZWH A;  1Q8I A;  4CEB A;  5J2M A;  1YHQ N;  3LDS A;  2UXD K;  3WNH A;  3THY A;  1BQM A;  2HVI A;  1R0A A;  3NH2 A;  4WFA L;  4H5T A;  4WF9 L;  2ZQB A;  1NGB A;  5IT9 O;  3AAR A;  5AQP A;  4YOX A;  3ASM A;  2E2Q A;  3SQ4 A;  3V9X A;  1C1C A;  4M7Y A;  2DPN A;  1BO5 O;  3LWM A;  3OYE A;  3H45 C;  3FE1 A;  4FJJ A;  1EO1 A;  1RBT A;  4FLX A;  2NUB A;  1MWM A;  1GLF O;  2PBD A;  1NJY A;  1NJI O;  4KB1 A;  3O80 A;  2DFE A;  4AIL C;  4BAC A;  3THW B;  2P9N A;  3OTO K;  4DS4 A;  2X78 A;  2RF2 A;  4DG1 A;  2WTU A;  4DF4 A;  5AQR A;  3B6P A;  1WSE A;  4JKA A;  1HKB A;  4Z4G A;  2D0P A;  1WLJ A;  4B8C A;  1DGK N;  2W6K A;  1FJG K;  4C8L A;  3OBY A;  4CJ4 A;  3K58 A;  3E9L A;  4WE1 A;  1Y64 A;  4F4K A;  4BDY A;  3A2F A;  3AVK A;  4JLH A;  4XH1 A;  3M8R A;  4CHN A;  3K59 A;  4F3T A;  2D0C A;  1XQS C;  4ELV A;  4JS5 A;  2GTD A;  3DOK A;  4AM6 A;  3C6H A;  3ZT2 A;  3M6G A;  4B9L A;  3JS6 A;  5CYM A;  3KZB A;  1U47 A;  4Q5V A;  4C8M A;  2CH5 A;  1RTJ A;  4FVU A;  3CC4 N;  3CC7 N;  1BI4 A;  5KPT A;  3UKU A;  5KRT A;  2E8A A;  4FZZ A;  2E2N A;  2QWO A;  4O0J A;  2B4J A;  3MCP A;  3J80 O;  3ZSW A;  4DSJ A;  4JI1 K;  1KTQ A;  4BVO A;  1VQ4 N;  2NRR A;  1HYZ A;  2D1K A;  4CHP A;  4DSL A;  2NRT A;  1K8K A;  4MFB A;  3EYZ A;  4DFM A;  3L6Q A;  5KTQ A;  2IVN A;  4WQ4 C;  4HHT A;  4IFY A;  3TPQ A;  1SUQ A;  5AQH A;  4RW6 A;  2CGK A;  1L3T A;  3VEV A;  1TK5 A;  4H0V B;  4OGE A;  5AQG A;  3TAE A;  1X9M A;  2QM1 A;  1SZ2 A;  3NMU A;  4E7K A;  3NE6 A;  4HCC A;  5I9E B;  5AFU A;  1GLL O;  3CCL N;  1KLM A;  1WUA A;  4BRM A;  1T03 A;  2WBN A;  2QKB A;  1HRH A;  1MA9 B;  3HP9 A;  3NDK A;  5HP1 A;  2YV0 X;  4C1N I;  5GAG P;  4BG8 A;  3VQ5 A;  3D2E A;  3A5M C;  2ZJQ L;  3VES A;  5BRD A;  1KVA A;  3VQQ A;  4RW9 A;  4YOY A;  4CGJ A;  3CJB A;  1JLG A;  2GX9 A;  2F8S A;  3MDQ A;  4CW7 B;  1HKC A;  3D6R A;  4AF1 A;  4KHP K;  3KLE A;  3THV A;  4DS5 A;  3TU5 A;  2Q97 A;  2YHB A;  4DFK A;  2ZJR L;  3SAF A;  3THX B;  2X6S A;  2IVP A;  2I7N A;  4CBU A;  2QWR A;  1S5J A;  4XH5 A;  3AGK A;  1FXX A;  3ID8 A;  2QA4 N;  2G8I A;  2J4R A;  4IOC L;  3HYF A;  1VSI A;  4H8K A;  3IDH A;  1TKZ A;  4W5R A;  3G10 A;  3P38 A;  3I33 A;  3O3F A;  2UYT A;  4B9Q A;  1D8Y A;  1YVN A;  1RIL A;  3Q7B A;  1GLA G;  3O6W A;  3RVC A;  2KKZ A;  4M41 A;  1J6Z A;  1YIT N;  4HCB A;  1VRU A;  1J54 A;  4B1X B;  3K0S A;  4PHT X;  4Y1D A;  2HB5 A;  4CED A;  2HNY A;  3LAK A;  3NF7 A;  4FJX A;  3L2R A;  4OJR A;  4B8A B;  3KLG A;  3AO3 A;  3U3Y A;  1JXB A;  2FXU A;  2EHG A;  3QDK A;  3NAE A;  3TAN A;  1HNX K;  3ISN C;  3V9W A;  2WC9 A;  4DR5 K;  1WSF A;  3EE9 A;  1ATS A;  1HLU A;  4H4M A;  2W40 A;  4BGA A;  4HUG A;  3FGU A;  1XC9 A;  2BDP A;  2V51 B;  3T19 A;  4DU1 A;  3KWI A;  1K73 O;  2VG6 A;  3CQY A;  1U04 A;  1FKP A;  1KAZ A;  1HYS A;  4OKJ A;  4FL9 A;  4AHV A;  4FK4 A;  3V81 A;  2O8C A;  2HHW A;  2Z1J A;  3VTH A;  3QB0 A;  1K9M O;  4CE9 A;  5AQJ A;  4AQY K;  1MDU B;  3DLR A;  3PO5 A;  3SZ2 A;  3OYK A;  4J2B A;  3ZET B;  3I0R A;  1IG8 A;  5ADX A;  1T6D A;  4JKE A;  3HSC A;  2VCP A;  2WUS A;  2OZM A;  2O8B B;  4OLA A;  1RT6 A;  1QQO A;  3ATU A;  2F9T A;  4GV3 A;  5AQS A;  4JK9 A;  3KD1 E;  1QVF M;  2YHW A;  3GDQ A;  2FC0 A;  4CD3 A;  2GUP A;  3T1Y K;  1VQ8 N;  2CGJ A;  4FO0 A;  4DSI A;  2G8W A;  4R79 A;  3L3V A;  4CES A;  2W41 A;  1ZBI A;  5BPN A;  3CJ1 A;  1EX4 A;  3P31 A;  1GOB A;  5BN9 A;  5C15 A;  2GUI A;  1S6Q A;  3AVA A;  4Z94 A;  3SQ2 A;  2RKI A;  1TKX A;  3NCI A;  1RT3 A;  3J8A A;  1NJW A;  3LM2 A;  3G4S N;  3G71 N;  3PUF A;  3V1O A;  1ITG A;  4M63 C;  5AZI B;  4E19 A;  3MWT A;  5EX5 A;  2X74 A;  5M1O A;  5AQT A;  2HHT A;  5B8H A;  2QKK A;  3R1X A;  1B92 A;  3WT0 A;  2YHA A;  3U6F A;  3SV3 A;  1S1V A;  4DSE A;  1LAW A;  1DT9 A;  3C6U A;  1ASU A;  1HMV A;  3KLI A;  5JVG L;  2O8C B;  2YNF A;  3JSM A;  1WAJ A;  2NNW A;  4F2S A;  1VQP N;  2VGM A;  4B3T K;  1Z6R A;  4KPY A;  2P51 A;  3CCU N;  1WBD A;  1JL2 A;  4LH4 A;  2KFZ A;  3PLA A;  2I7P A;  4JI6 K;  1HX1 A;  5BRH A;  3QFU A;  3SMP A;  3VQ9 A;  1IKY A;  3F2K A;  4FWN A;  3TAB A;  1KSP A;  2D0A A;  4DUY K;  3GBT A;  3P4I A;  4JK8 A;  4AHS A;  2Y1I A;  3NHG A;  3WXJ A;  4QOZ B;  4CJL A;  3CPE A;  2HMI A;  1YJ9 N;  4ZTF A;  2HHX A;  4E1N A;  2ZF5 O;  3CC2 N;  1YXQ A;  2P9U A;  1ZC6 A;  2Q0U A;  1TK0 A;  2AA4 A;  2B6A A;  3CQ8 A;  3HPH A;  1LOT B;  5HL7 L;  2CH6 A;  4EHT A;  4CJS A;  3TTF A;  4BR2 A;  3NF9 A;  1U2V A;  3AV9 A;  2O8D B;  3TSU A;  3ULD A;  3VER A;  3HXM A;  3BF3 A;  4OPA A;  4DR7 K;  3B6O A;  3OYB A;  3FZH A;  1NK8 A;  4L3Q A;  2YHX A;  4CZH A;  4EIA A;  1RBS A;  5IWA K;  3VF2 A;  4DV4 K;  3O9R A;  2KQ2 A;  3MX2 A;  3E01 A;  1T7P A;  2ASO A;  4GMJ B;  4DTN A;  3O9Q A;  3F9M A;  4GY2 B;  4M3T A;  3A8Y A;  4PL7 A;  3AVJ A;  3H3N O;  4IOA L;  4YOR A;  4JRQ A;  4C8K A;  2G8K A;  4FLZ A;  4O44 A;  1TV6 A;  3FZL A;  1JKH A;  3F9K A;  4U67 L;  2ASM A;  3CJ7 A;  4I9L A;  4PWD A;  4DMN A;  1L3V A;  4IKF A;  3R3L A;  4YOT A;  3AO1 A;  1UAX A;  1EQY A;  3I56 N;  3KVG A;  3WQU A;  5KQ8 A;  4K41 A;  4FM0 A;  4DLE A;  1QSL A;  3FFI A;  3CFO A;  2Z1I A;  4QS9 A;  3QNN A;  3C0B A;  2Q1N A;  3MWP A;  2HF4 A;  4YOW A;  5FPM A;  4CEZ A;  3LDQ A;  2AJQ A;  2F96 A;  2VWJ A;  4IDH A;  3DXM A;  2FSJ A;  3E9O A;  3K2P A;  4IOX A;  1XMQ K;  1NGC A;  2HST A;  3DLE A;  2ZJP L;  4ISG A;  4DQR A;  3IMX A;  3SQ1 A;  4F9O A;  3HVT A;  4FOI A;  4DQ8 A;  3F73 A;  3C6A A;  4DV6 K;  4BRN A;  2OTL N;  1RDA A;  3VQB A;  3H6E A;  4FW2 A;  4DR1 K;  4YHH K;  3OHR A;  1X9S A;  5M1P A;  4C1N K;  4CZI A;  3AVI A;  4HUF A;  4LFA K;  5KGW A;  1NGA A;  3H08 A;  5AZI A;  2OAN A;  3RMA A;  2PZS A;  1EKE A;  3CM5 A;  3CCV N;  4ILJ A;  3LWL A;  4GVM A;  5LL6 Z;  1J5O A;  1VQ5 N;  1HPM A;  3OYA A;  3DLH A;  2VWB A;  1BA1 A;  4FPA A;  1W0H A;  4NXN K;  3BEX A;  2V52 B;  1KLN A;  4H0Y B;  1JLF A;  3VQP A;  4B3M K;  4ELU A;  1CZA N;  3A5O C;  3C65 A;  5GAD P;  1TGO A;  4DR2 K;  3K9K A;  4YY3 K;  1L5U A;  4B08 A;  1OH8 A;  1NJX A;  4CBW A;  4CIG A;  1NGH A;  3IS9 A;  1IKW A;  5FLX O;  3FZF A;  2P5O A;  1WAF A;  2W6L A;  5AQY A;  2OPR A;  3THW A;  4X64 K;  3SYZ A;  4WYB A;  3UKR B;  1ZXO A;  1CXU A;  4DTM A;  5K14 A;  2OPP A;  5GAH P;  4KTZ A;  4KKO A;  3AVN A;  4J8F A;  4JKD A;  2PY5 A;  3LZI A;  1ATN A;  2G8U A;  3HRG A;  3U3G A;  4OX9 K;  4N76 A;  3AA5 X;  4JKG B;  3AVH A;  3FR0 A;  5HRN A;  4E3S A;  5LJW A;  4DV0 K;  5I3U A;  3TWH A;  4UY8 O;  3S9H A;  5C2D A;  4BQL A;  2GBZ A;  4CJ7 A;  2UUB K;  5AQM A;  1U4B A;  4NCB A;  1VSH A;  3HI0 A;  1SAZ A;  3KKR A;  1EWQ A;  3O3H A;  3THX A;  3KHY A;  4H0T B;  3ZYY X;  3SK3 A;  1GLJ O;  3HTV A;  5LMN K;  3ZX0 A;  4FK0 A;  2HW3 A;  3VEX A;  1XUP O;  3DJC A;  4DFJ A;  1VHX A;  3DWL A;  3E9P A;  1NNE A;  2QWL A;  4DLG A;  1NM1 A;  2A42 A;  3PX6 A;  3TSP A;  2GWK A;  2O8D A;  4RWT A;  1D4X A;  2D0O A;  4I7F A;  4RW4 A;  2WON A;  2YCH A;  5J2N A;  4CGH A;  2BE2 A;  1F21 A;  4Z4H A;  2PYL A;  4BR9 A;  4CGG A;  3VQ7 A;  3AVL A;  4OGC A;  2OZS A;  1BA0 A;  3J7Z O;  5FPE A;  2G8H A;  1YJN N;  2PYJ A;  3SNN A;  3ZT1 A;  2NRZ A;  3DRP A;  4RW8 A;  1VQL N;  5CE3 A;  1KXP A;  2VGN A;  3D7E O;  3VEW A;  3OJU A;  4LFC K;  4E1M A;  3DI6 A;  3T3F A;  4FJL A;  4DFP A;  3WXL A;  2ZD1 A;  4FJG A;  5JS1 A;  4CHO A;  3ZSZ A;  4YNQ A;  1VRT A;  3EKS A;  1C1B A;  5AQN A;  1BQN A;  1KAY A;  4CEO A;  3U9Z A;  2B5J A;  4JS4 A;  2RE2 A;  2E1Y A;  5DM6 L;  4X65 K;  1XI1 A;  1S22 A;  4IDK A;  3J7A P;  4H0X B;  3BF1 A;  3OY9 A;  1KFS A;  4KI4 A;  4KTW A;  3ZLJ A;  4CJ5 A;  1J5E K;  2QEX N;  4CGF A;  2YJE A;  4OKE A;  4LF5 K;  3CG7 A;  4I2Q A;  1WB9 A;  4KHU A;  4B1W B;  4IXC A;  1GOA A;  2G8V A;  1U6Z A;  3VF6 A;  4JKH A;  4FWK A;  4LC9 B;  4AM7 A;  1SL2 A;  2XRI A;  1EET A;  4CCH A;  1HNI A;  3HOS A;  3CM6 A;  1V4S A;  1XHX A;  3M5R A;  3O9U A;  3OA9 A;  5HRO A;  2JWL A;  1IG9 A;  1B9D A;  4DU3 A;  2RPI A;  4CZE A;  1NGJ A;  3BUZ B;  4WQ5 A;  4MLH A;  1KFD A;  4CK3 A;  3OS2 A;  3LM9 A;  3OW2 M;  5C12 A;  4V19 S;  3VEO A;  5CZ2 A;  3A5N C;  3QO9 A;  4PKG A;  5F2R A;  2D0B A;  2HHH K;  4E1J A;  4FWL A;  3V1Q A;  3OVN A;  3ULE B;  2ITG A;  5EU7 A;  4LF7 K;  3T1A A;  2IC3 A;  4W5O A;  3QET A;  4LH5 A;  3SAH A;  3QEW A;  1ZBS A;  2VQE K;  1HNW K;  3PIP L;  4UQG A;  3HK2 A;  4JI3 K;  4CZJ A;  3HM9 A;  1KQS M;  3BGR A;  3DAW A;  5AQL A;  4FXD A;  2E20 A;  1JLB A;  4FWO A;  4BQZ A;  3G25 A;  4DWI A;  1IBL K;  3VEZ A;  1VQ7 N;  3H3O B;  2NZT A;  3EY1 A;  3BY5 A;  5CY4 A;  4CJT A;  3DRR A;  3CI5 A;  2Q2R A;  3M1F A;  4CIF A;  1S1U A;  4CJR A;  1TVR A;  2XO7 A;  5AQU A;  1C0F A;  3D45 A;  4FJH A;  3A5L C;  5AQF A;  1BU6 O;  3WEE A;  1X9J A;  2FBT A;  3J81 O;  3DXK A;  3LDN A;  3OYC A;  1BHL A;  1TL1 A;  4BWJ A;  4CIE A;  4O5F A;  2HMP A;  2FF3 B;  3LP2 A;  2NRX A;  2E2P A;  3QEV A;  3L3U A;  3AO5 A;  4BDZ A;  3SJH A;  1Q82 O;  1W97 L;  1NGI A;  2BTF A;  2YI1 A;  3DXK B;  2E6M A;  2KLA A;  1DTT A;  4CJ3 A;  1P8Z A;  4B3R K;  3CCM N;  4CFC A;  2XY7 A;  2QXL A;  1WOQ A;  1BDG A;  4FJ8 A;  2DFH A;  2FLO A;  2BUP A;  4KHQ A;  1A5W A;  4M45 A;  4AHR A;  3DOL A;  1C0U A;  4DV7 K;  4FLY A;  3SAG A;  4FM2 A;  3O9T A;  3K57 A;  4DQS A;  4JKG A;  1WSJ A;  2OPQ A;  5CHI A;  4BE2 A;  4ID1 A;  4GV6 A;  3VMF B;  3B8A X;  2JGU A;  3P1G A;  5EOY A;  4B3S K;  4ID5 A;  1RTI A;  4WQ4 A;  4BDP A;  1HNZ K;  4CFA A;  1LAV A;  3ZSR A;  3DLG A;  2YNH A;  3KKS A;  4FOE A;  3HOT A;  3H1Q A;  1RFQ A;  1IBK K;  3TAR A;  3O4Q A;  1JCF A;  3BDP A;  5BR9 A;  3U8X A;  4Y0W A;  4BRA A;  5C42 A;  5LY3 A;  2O8E A;  3ZET A;  4MQ3 A;  1NGF A;  2Z1H A;  1JXE A;  4PA1 A;  3ULE A;  3D2E B;  3SUP A;  5AQX A;  3OYI A;  5F0X A;  1YUW A;  3CCQ N;  1NK6 A;  4B9T A;  3MEG A;  3MN6 A;  5KI6 A;  4KO0 A;  1SQK A;  2V7Z A;  3KK7 A;  5JLH A;  4W5Q A;  4FLV A;  1LCU A;  4HWI A;  2QTD A;  2RN2 A;  5C24 A;  4FZX C;  4EP4 A;  1ZBU A;  5AQK A;  4J2A A;  5C2F A;  1X9W A;  3VA3 A;  4N5S A;  4DQI A;  1BL3 A;  1QVG M;  1QTM A;  4IO9 L;  4KH4 A;  4Q0B A;  4BG9 A;  3QNO A;  1HR0 K;  2NRW A;  1SKW A;  4O0I A;  4AHU A;  4FJ7 A;  2D5R A;  5J2P A;  3P83 D;  4NB4 A;  3DYA A;  4BRL A;  4IBN A;  2UXC K;  3UIQ A;  3NBP A;  3PSI A;  4FSV A;  3CCR N;  4CF2 A;  4NCG A;  3S3M A;  1ATR A;  3TAQ A;  3RWU A;  3CYM A;  3M3Z A;  1CZB A;  4CJF A;  1N32 K;  2QI2 A;  4H5N A;  5C25 A;  1FK9 A;  4M3R A;  3RSE B;  3M8Q A;  2VG7 A;  2KW4 A;  4KH6 A;  2Q0R A;  4LY7 A;  4H5V A;  4BRE A;  3T1H K;  1T44 A;  4A62 A;  1ZBF A;  1QHT A;  3JXU A;  1ASW A; 
#chains in the Genus database with same CATH homology
 1YAG A;  3MN5 A;  4WFA L;  4H5T A;  3VF4 A;  4WF9 L;  1NGC A;  4WFB L;  2HST A;  2ZJP L;  1NGB A;  2CGL A;  2WFB A;  4ISG A;  3AAR A;  3TTC A;  3IMX A;  4F9O A;  3HM8 A;  5AQP A;  5GAE P;  4FOI A;  4YOX A;  4DQ8 A;  2IVO A;  2E2Q A;  4B1Z A;  3C6A A;  2DPN A;  1BO5 O;  4M7Y A;  4BRN A;  2OTL N;  3H45 C;  3FE1 A;  3WXI A;  5C0Y A;  2P9S B;  3GG4 A;  4OPH A;  1EO1 A;  3K9J A;  3H6E A;  3QIC A;  5GIO A;  1NGE A;  4H0O A;  1MWM A;  4BC3 A;  1GLF O;  2PBD A;  3OHR A;  1NJI O;  1ILY A;  2YHY A;  3O80 A;  5M1P A;  4C1N K;  4CZI A;  3O08 A;  4FWP A;  5EY4 A;  2ZGZ A;  2P9N A;  1S72 N;  2NRV A;  1NGA A;  2P9U B;  5AZI A;  2OAN A;  3BP8 A;  2A40 A;  5AQR A;  1HKG A;  4JKA A;  1HKB A;  4DCH A;  4ILJ A;  3CCV N;  3ZEU B;  1VQ5 N;  4BRG A;  2D0P A;  1HPM A;  1DGK N;  4WFN L;  1QQN A;  4QS7 A;  3QFP A;  2VWB A;  1HJO A;  1BA1 A;  4IO8 A;  4ILG B;  3OBY A;  4FPA A;  5AQV A;  5AQW A;  3E66 A;  3E9L A;  4JKF A;  1Y64 A;  4G9Z A;  2VYP A;  3BEX A;  3SBT A;  5E84 A;  2V52 B;  4XH1 A;  1M1K O;  4H0Y B;  1QQM A;  1XQS C;  3ZX2 A;  1NMD A;  1M90 O;  2GTD A;  3ENO A;  4AM6 A;  5AFU H;  1CZA N;  2PAV A;  3C6H A;  3A5O C;  3DXM B;  3M6G A;  3C65 A;  5GAD P;  1E4G T;  4QS8 A;  3JS6 A;  3K9K A;  3KZB A;  3AY9 A;  5KQD A;  1Q86 O;  2A3Z A;  2CH5 A;  3G6E N;  4FVU A;  3CC4 N;  4IFE A;  3CC7 N;  3ATV A;  3ZX3 A;  5KPT A;  3UKU A;  3UKR A;  1C0G A;  2E8A A;  1GLE G;  2E2N A;  4YOU A;  3U4L A;  2QWO A;  4WQ5 C;  4JHD A;  4CBW A;  3MCP A;  4H5W A;  1NGH A;  3CCS N;  3NVM A;  2E1Z A;  5E26 A;  3FZF A;  3EN9 A;  2HBL A;  4DKW A;  2P9L B;  5AQY A;  3SBG A;  4BVO A;  5C10 A;  2OTJ N;  1VQ4 N;  2NRR A;  2D1K A;  4WYB A;  3UKR B;  1ZXO A;  5GAH P;  2ITM A;  3U9D A;  3WUH A;  2NRT A;  1K8K A;  4H0P A;  4J8F A;  5FPD A;  3L6Q A;  4FWQ A;  5LJV A;  2IVN A;  1QZ5 A;  4JKD A;  4WQ4 C;  4BR0 A;  1ATN A;  3HRG A;  3H46 O;  3TPQ A;  1VAZ A;  3CCE N;  3P39 A;  2F7T A;  2A6A A;  3MN7 A;  4NO7 A;  5AQH A;  4JKG B;  2CGK A;  3FR0 A;  3VEV A;  3D2F B;  5LJW A;  4H0V B;  2IIR A;  5AQG A;  3TTD A;  4UY8 O;  2HF3 A;  5C2D A;  1BUP A;  4BQL A;  1NLV A;  1SZ2 A;  2QM1 A;  3NMU A;  4MO5 A;  4BRK A;  4CJ7 A;  5AQM A;  1G99 A;  4B1Y B;  3VGM A;  5I9E B;  5AFU A;  5BN8 A;  3EZW A;  1GLL O;  3VTI A;  3HI0 A;  1SAZ A;  3CHW A;  4JKC A;  1NWK A;  3CCL N;  2GEL A;  3KHY A;  1WUA A;  4H0T B;  3ZYY X;  3SK3 A;  4BRM A;  1GLJ O;  3HTV A;  1TYQ B;  2WBN A;  3ZX0 A;  1MA9 B;  5M1Q A;  3VEX A;  4BRF A;  1XUP O;  3DJC A;  5H1S Q;  3DWL A;  3E9P A;  4BRH A;  4JHD B;  3I8B A;  4C1N I;  4BG8 A;  5GAG P;  1VQO N;  1Q18 A;  2QWL A;  4BGB A;  3D2E A;  1NM1 A;  2A42 A;  2QWM A;  3A5M C;  4DB3 A;  4IEI A;  2ZJQ L;  4FWM A;  3TSP A;  1RGI A;  3VES A;  2GWK A;  4B1U B;  5BRD A;  2QWN A;  4RWT A;  1D4X A;  2D0O A;  3FZK A;  2P9I B;  4YOY A;  2HBJ A;  2YCH A;  1Q7Y O;  3CJB A;  2GX9 A;  2P9S A;  3MDQ A;  1KAX A;  4ILH A;  1HKC A;  4BR9 A;  5BPL A;  1TUU A;  3D6R A;  4AF1 A;  3MX5 A;  3R9P A;  1BA0 A;  4PL8 A;  3FLC O;  3J7Z O;  4A5A A;  5FPE A;  3TU5 A;  2E2O A;  2Q97 A;  3AGR A;  1OVY A;  2ZJR L;  1YJN N;  2NRZ A;  1VQL N;  5CE3 A;  3SAF A;  4BR4 A;  1KXP A;  4MDB A;  2VGN A;  1X3M A;  3D7E O;  4GNI A;  4ISE A;  3VEW A;  2IVP A;  2I7N A;  4CBU A;  2QWR A;  5AQQ A;  1K8A O;  5AQI A;  4JEP A;  2QWP A;  4XH5 A;  3AGK A;  2P9K A;  3ID8 A;  2QA4 N;  2J4R A;  4IOC L;  5JIC A;  3WXL A;  3L0Q A;  4GVE A;  5KPZ A;  4BR5 A;  3IDH A;  2ZGY A;  3L4I A;  1XC3 A;  3EKS A;  3HZ6 A;  3P38 A;  5GIP A;  3I33 A;  4CZF A;  3LDL A;  5AQN A;  1KAY A;  2UYT A;  4BVP A;  4B9Q A;  1YVN A;  3U9Z A;  5AZJ B;  2RE2 A;  2E1Y A;  5BRE A;  5DM6 L;  3Q7B A;  1GLA G;  1V4T A;  3O6W A;  3VGL A;  3RVC A;  4KH5 A;  2KKZ A;  4BC4 A;  2GEM A;  1S22 A;  4C23 A;  1J6Z A;  3CER A;  1YIT N;  4H5R A;  4K43 A;  4H0X B;  5EXW A;  3BF1 A;  3CF5 L;  4RTF D;  3QBX A;  4MO4 A;  4B1X B;  2QEX N;  2ASP A;  3O1B A;  2YJE A;  4PHT X;  4A59 A;  1IJJ A;  5KPR A;  4A57 A;  1YJW N;  2NLX A;  3MMV A;  2FXU A;  3EE8 A;  3QDK A;  4B1W B;  3GOI A;  4IXC A;  2WC9 A;  3EO3 A;  3KWG A;  3EE9 A;  4BC5 A;  1ATS A;  1HLU A;  1U6Z A;  2W40 A;  2A5X A;  4JKH A;  3VF6 A;  1GLC G;  4FWK A;  4LC9 B;  4BGA A;  4YOV A;  3VEY A;  3FGU A;  3IKM A;  4AM7 A;  3SMS A;  4CBX A;  3I55 N;  3HOS A;  2KHO A;  2V51 B;  3CD6 N;  1V4S A;  3O9U A;  3M5R A;  3OA9 A;  4XH4 A;  3CCJ N;  2JWL A;  2FF6 A;  4KBO A;  1P90 A;  3KWI A;  4K25 A;  1K73 O;  3CQY A;  4IZ9 A;  4CZE A;  1KAZ A;  1NGJ A;  3BUZ B;  4WQ5 A;  4XEI A;  4MLH A;  4FL9 A;  4ISF A;  3LM9 A;  3OW2 M;  5C12 A;  4EAH D;  2Q36 A;  1JCG A;  3VEO A;  5BR9 A;  2P9K B;  3A5N C;  4PKG A;  3QB0 A;  4JD2 A;  3S41 A;  4HTL A;  5F2R A;  5AQJ A;  3VTH A;  1K9M O;  3WXK A;  1MDU B;  3CIP A;  3GL1 A;  1VQM N;  4E1J A;  2Q31 A;  4FWL A;  3ULE B;  3W3D A;  3L4Q A;  3ZET B;  3N4Q A;  3CPW M;  1IG8 A;  4MLE A;  3LDP A;  5ADX A;  3PIO L;  1T6D A;  4JKE A;  5FPN A;  3HSC A;  2VCP A;  2WUS A;  3ID6 A;  1QQO A;  3ATU A;  2F9T A;  4BY9 C;  3A0I X;  4GV3 A;  3NVK A;  2YX6 A;  5AQS A;  4JK9 A;  4BC2 A;  5ADX H;  1QVF M;  2YHW A;  3GDQ A;  2BH1 A;  4YDU C;  4A2B A;  2GUP A;  4CD3 A;  5GIN A;  5JVH L;  2CGJ A;  4FO0 A;  3SAH A;  1ZBS A;  1VQ8 N;  3PIP L;  4CZJ A;  1KQS M;  3LL3 A;  1GLD G;  3DAW A;  5AQL A;  2E20 A;  4R79 A;  3T69 A;  4FWO A;  4BQZ A;  3G25 A;  2W41 A;  4IEE A;  2P9P B;  2NRH A;  2QWQ A;  4NLC A;  1VQ9 N;  4I6M A;  5BPN A;  3VPZ A;  1MWK A;  3VEZ A;  2HBK A;  3CJ1 A;  1VQ7 N;  3H3O B;  4WCE L;  2NZT A;  1BWF O;  3P31 A;  4BRD A;  4U7B A;  4CZM A;  5BN9 A;  1H1V A;  3CI5 A;  2Q2R A;  3M1F A;  4RCH A;  4DHY A;  5C15 A;  4JN4 A;  1K8K B;  4JK7 A;  4EFH A;  4Z94 A;  1TUY A;  2GWJ A;  1VQK N;  3RSE A;  4GV9 A;  5MLC Q;  4I6M B;  3CET A;  2P9P A;  2JWK A;  3O8M A;  3J8A A;  2A41 A;  2P9L A;  3LM2 A;  5AQU A;  1C0F A;  3G4S N;  3WQT A;  4NLB A;  3A5L C;  3G71 N;  5AQF A;  3R8E A;  1BU6 O;  3WEE A;  1X9J A;  4M63 C;  5AZI B;  3MWT A;  1NBW A;  3CQX A;  3Q7C A;  1NGD A;  3DXK A;  5EX5 A;  2YJF A;  2FSN A;  3LDN A;  3VOV A;  3EKU A;  4O5F A;  5M1O A;  3VEN A;  1U2V B;  5AR0 A;  4BRQ A;  2HMP A;  1JCE A;  2FF3 B;  2NRX A;  5AQT A;  2E2P A;  2QW9 A;  4A5B A;  5B8H A;  1Q82 O;  3MK6 A;  3SJH A;  4BRI A;  4CZG A;  3R1X A;  1W97 L;  3WT0 A;  1NGI A;  5BRF A;  3FZM A;  2BTF A;  2V7Y A;  2YI1 A;  3DXK B;  5M1K A;  5F1X A;  1DT9 A;  2RHK A;  2KLA A;  5JVG L;  3MN9 A;  4IWV A;  4O8U A;  1BOT O;  1P8Z A;  3CCM N;  4PKI A;  2QXL A;  2F9W A;  2NNW A;  1QHA A;  3UB5 A;  2PFU A;  1WOQ A;  1BDG A;  3GE1 A;  2FLO A;  1VQP N;  2BUP A;  2VGM A;  3UE5 A;  1Z6R A;  5TKY A;  3CJ9 A;  5DM7 L;  4YDU A;  5CR4 A;  3CCU N;  4CZK A;  1YI2 N;  2D4W A;  3PLA A;  3SAG A;  1N8R O;  3O9T A;  5JMV A;  2I7P A;  1HX1 A;  1ESV A;  4JKG A;  5BRH A;  3QFU A;  3SMP A;  5CHI A;  3ENB A;  1T3V A;  5BPM A;  3HBT A;  1HUX A;  4GV6 A;  3VMF B;  3B8A X;  3F2K A;  5EOY A;  1E4F T;  4FWN A;  4JAX A;  4B1V A;  3GBT A;  3P4I A;  4PKH A;  4WQ4 A;  5AQO A;  1W2B M;  4JK8 A;  4FPB A;  4FOE A;  3WXJ A;  5M1N A;  3HOT A;  3H1Q A;  3ZEU A;  3CPE A;  3CXC M;  1RFQ A;  3QML A;  4CI6 A;  1T6C A;  2H3G X;  3CJC A;  3WEE B;  1YJ9 N;  3O1W A;  1QZ6 A;  5ELZ A;  1JCF A;  3O9S A;  2P9I A;  2ZF5 O;  1TYQ A;  1YXQ A;  2HOE A;  2P9U A;  5AQZ A;  3U8X A;  4Y0W A;  1ZC6 A;  3TSQ A;  2Q0U A;  4BRA A;  3N4P A;  5LY3 A;  3ZET A;  1KC8 O;  1NGF A;  3IUC A;  2AA4 A;  1OKJ A;  3ULE A;  3VGK A;  3D2E B;  1LOT B;  5AQX A;  5HL7 L;  2CH6 A;  5F0X A;  3EL2 A;  3VET A;  4EHT A;  1YUW A;  5AZJ A;  3TTF A;  3CCQ N;  4O8K A;  4JD2 B;  3DLL L;  4JNE A;  4BR2 A;  4IJA A;  4JKB A;  5TKW A;  1U2V A;  3E1Y A;  3MN6 A;  1YIJ N;  1O13 A;  3CMA N;  3TSU A;  1SQK A;  2V7Z A;  3KK7 A;  5JLH A;  3C7N A;  3VER A;  4IJN A;  1YF5 L;  1RDU A;  3AAP A;  3BF3 A;  4OPA A;  3WXM B;  1VQ6 N;  3FZH A;  1LCU A;  4L3Q A;  3CJA A;  2QTD A;  2YHX A;  3ENH A;  4HWI A;  4CZH A;  4EIA A;  4CZL A;  4EHU A;  3CME N;  5AQK A;  4BRP A;  3CC2 N;  3VF2 A;  4BRO A;  5C2F A;  2EWS A;  3O9R A;  3D2F A;  3O4W A;  2E88 A;  3MX2 A;  5M1F A;  2ASO A;  3C7N B;  3F5T A;  4FWS A;  1QVG M;  1X3N A;  3O9Q A;  3F9M A;  4IO9 L;  4GY2 B;  4KH4 A;  3A8Y A;  1NGG A;  4BRC A;  4PL7 A;  1VQN N;  4BG9 A;  4M7X A;  1GLB G;  3H3N O;  4IOA L;  1DKG D;  2NRW A;  1JJ2 M;  2P9N B;  1SS6 A;  4H03 B;  4YOR A;  4A61 A;  4OO1 J;  1S3X A;  3O5B A;  4NB4 A;  3MCA B;  2FSK A;  4BRL A;  5JLF A;  3FZL A;  4A2A A;  4U67 L;  2ASM A;  3CJ7 A;  5EVZ A;  4FWR A;  1DEJ A;  3AAQ A;  4FSV A;  3CCR N;  3R3L A;  5HOO A;  4YOT A;  3FFK B;  1ATR A;  3R6M A;  3SLC A;  3M3Z A;  3T7Z A;  1KD1 O;  1EQY A;  3I56 N;  3KVG A;  3WQU A;  1Q81 O;  2AP1 A;  5KQ8 A;  1BG3 A;  1R59 O;  4K41 A;  2QI2 A;  2HBM A;  4H5N A;  4QS9 A;  3UKU B;  4MDA A;  3C0B A;  3RSE B;  2Q1N A;  3OBW A;  3MWP A;  2HF4 A;  4K42 A;  3W0L A;  4BR7 A;  4CD1 A;  5FPM A;  4YOW A;  4KH6 A;  2Q0R A;  3H1V X;  3IFR A;  3LDQ A;  2ZWH A;  3QBW A;  1RDW X;  4H5V A;  4BRE A;  1YHQ N;  3LDO A;  4IDH A;  1T44 A;  1Z05 A;  4A62 A;  3DXM A;  2FSJ A;  3JXU A;  3E9O A;  4IOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...