4BRLA

Legionella pneumophila ntpdase1 crystal form iii (closed) in complex with transition state mimic guanosine 5'-phosphovanadate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 120
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brlA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brlA02
2YI1A 3O08A 3LDQA 2P9IA 1TYQA 3UKUB 3BEXA 2F9TA 3GL1A 3EL2A 2QWPA 1QZ5A 3W0LA 3L6QA 3IFRA 4FOIA 5ADXH 4A2BA 1P8ZA 4B1YB 1E4FT 3LM2A 1HKGA 4LC9B 4BROA 2NRHA 3GOIA 4HWIA 4NB4A 3CJ9A 4PKIA 3U9DA 4Y0WA 2QW9A 2P9LA 4FOEA 3WEEB 5KPTA 1T44A 3A5MC 3C0BA 2CGLA 3C7NA 3EKSA 4FWRA 3KZBA 1Z6RA 3QICA 1K8KB 3DAWA 3S41A 3DJCA 5AQGA 2Q0RA 5AQMA 1ZXOA 3ZETB 3U8XA 2VWBA 5AR0A 2EWSA 3TPQA 2YJFA 1NWKA 3QDKA 1KAZA 4BR5A 1QQOA 5BRHA 1GLJO 3JXUA 4JD2B 4H03B 4BRAA 3QBXA 3L4IA 3FE1A 4ISFA 1ATNA 1CZAN 1QQNA 2IVOA 3WEEA 4BC5A 1X9JA 4BRIA 1BG3A 1QQMA 2BUPA 1GLDG 2E1YA 2HOEA 2P9SA 2HF4A 1RFQA 2ZWHA 2FSKA 3O6WA 3JS6A 2P9NB 2Q0UA 1HKBA 2ASPA 5AQNA 2GUPA 4QS7A 1NGFA 5KQDA 2FF3B 4FWMA 1Z05A 1XQSC 5LY3A 2Q36A 2A42A 3AAQA 1QHAA 1NGEA 1X3MA 4FWNA 5E84A 1ATSA 3A5NC 4XH1A 3UE5A 2Q1NA 4BRGA 4H0VB 2AP1A 2A3ZA 2V7ZA 5BN8A 3A8YA 4FWSA 1X3NA 1BDGA 3O8MA 5AQYA 3FFKB 1MWKA 1YAGA 2IIRA 3BF1A 3I8BA 3R8EA 4BC4A 3WXJA 4FPBA 4A62A 4BRHA 4B1WB 2HF3A 4YDUA 3D7EO 5AQKA 1NMDA 5TKYA 4IZ9A 2J4RA 3EZWA 4EHTA 5F2RA 4BRQA 3D2FB 4CD3A 1V4SA 4CZIA 2FXUA 2E2QA 2P9PB 3LDPA 3O1BA 3MN7A 1NGJA 4BR4A 2FLOA 4DCHA 3M6GA 4CZGA 1U2VA 1GLEG 2KHOA 3R9PA 3QB0A 5AQXA 4CJ7A 3R6MA 4JHDA 3F9MA 4ISGA 4YDUC 4B1VA 1YVNA 3CJ1A 3VF4A 2YHWA 1WOQA 4L3QA 3ZX2A 2QWQA 4JAXA 4WQ4A 5AQSA 5AZIB 1HPMA 4AM6A 4H0TB 3QMLA 3SK3A 4K43A 4RWTA 3ZX0A 4EIAA 1TUUA 2CGJA 2W41A 4I6MB 4CZKA 1NGIA 3D2EB 1GLAG 4H5VA 5BRFA 3CJBA 3FZLA 2QXLA 4ISEA 1SQKA 4H0PA 5EXWA 4JN4A 3CIPA 1RGIA 1HX1A 3FR0A 3SMPA 4FWKA 1C0GA 4RCHA 1HJOA 4WQ4C 4BREA 2YJEA 1XC3A 3M3ZA 1MDUB 2ZF5O 2E2PA 2GWJA 3FZFA 5B8HA 4BR2A 1HUXA 1XUPO 4BRKA 5FPEA 1SAZA 2P9KA 5KPRA 1HLUA 3VERA 1ATRA 2ASMA 5AZJA 2BTFA 3GBTA 4O8KA 5BREA 4CI6A 3FGUA 2QWRA 3VEZA 2P9UA 4FSVA 3HI0A 4CZLA 5AQUA 3UKRB 4BG8A 2PBDA 5EOYA 3DXKA 3CJ7A 4CZHA 1ZBSA 4CZMA 3MCPA 3UKUA 4BRPA 3QBWA 1RDWX 3WT0A 1U6ZA 2DPNA 3FZMA 3HZ6A 4H5TA 4E1JA 5F1XA 3O5BA 3UB5A 5CE3A 2D0PA 3GDQA 2I7NA 2A40A 3VGKA 4B9QA 1T6DA 5EY4A 3BP8A 4KBOA 4XH4A 5KPZA 2D4WA 4FL9A 4PKHA 3DXMB 4BRDA 4PL8A 3LM9A 1QZ6A 3MK6A 3FZKA 3CQXA 3LDOA 3ENHA 3W3DA 1R59O 3WXIA 1BWFO 2A5XA 1K8KA 5AQZA 3U4LA 2YHXA 5AQWA 1H1VA 5I9EB 5JLFA 3ULEB 3RSEB 3J8AA 3HSCA 4H5WA 3ZETA 3KVGA 1Y64A 5FPDA 3IUCA 4K42A 1DGKN 2YCHA 3H3NO 1BA0A 1EQYA 3VEXA 4PL7A 2I7PA 3VEWA 2V7YA 2CGKA 4JD2A 1KXPA 1S22A 1D4XA 5AQVA 5EVZA 4JNEA 1DKGD 3CERA 4FWQA 3CHWA 1Q18A 4CZFA 3U9ZA 3VETA 5AQLA 5AQRA 4FO0A 3LDLA 4DHYA 5E26A 1NGGA 3KHYA 3OHRA 3WUHA 5BPNA 3VGMA 4IJAA 2QM1A 2P9NA 3SMSA 3ZEUB 4HTLA 1SZ2A 5BRDA 3RSEA 2A6AA 4CZJA 1NGDA 1HKCA 2Q2RA 4IO8A 2D0OA 2CH5A 4CZEA 2OANA 3FZHA 5AQFA 1GLCG 3CJAA 1OKJA 3QFUA 1NGBA 3H6EA 1NLVA 2NLXA 4BQLA 1WUAA 2V51B 4CD1A 2QWOA 2E2NA 2W40A 1C0FA 2IVPA 3VPZA 3ZX3A 5BPLA 4FWPA 3A5LC 1YXQA 2QWLA 2P9IB 1TYQB 3HM8A 1BOTO 4BGBA 3TU5A 3SJHA 4BC3A 3HBTA 3H45C 4H0XB 3D2FA 1G99A 4BRCA 4M63C 5AQPA 2A41A 2VCPA 2P9PA 3ID8A 3IMXA 3SLCA 2P9LB 2F9WA 3VEOA 1MA9B 1E4GT 4H0OA 4DQ8A 4PKGA 3C7NB 4BR9A 3O4WA 3O1WA 3BUZB 1JCGA 3EO3A 3MDQA 4M7XA 4H5RA 4F9OA 3MMVA 4H0YB 4B1UB 3M1FA 3VF2A 2E1ZA 3FLCO 3ATUA 1J6ZA 4Z94A 1KAYA 2ZGZA 4DB3A 1NGAA 3CQYA 2FSNA 4WQ5C 5FPMA 4XH5A 5AZIA 3ATVA 3I33A 3G25A 5BR9A 2GEMA 4BRMA 1BU6O 2HMPA 4QS9A 2GWKA 1GLBG 3A5OC 3QFPA 4I6MA 4J8FA 3D2EA 2WUSA 4IJNA 3H3OB 3IDHA 4BR0A 3GE1A 1YUWA 3VGLA 2QWNA 4BGAA 5FPNA 5LJVA 4BRFA 2QWMA 4CBXA 1NGHA 3EN9A 3AAPA 3VOVA 2P9SB 2E20A 1JCEA 2AA4A 3AY9A 2NZTA 4BVPA 1LOTB 2E8AA 1NM1A 2V52B 4BQZA 2ASOA 3VEVA 4B1XB 1BA1A 3ENOA 3WXLA 5LJWA 2E2OA 4BC2A 4GNIA 4K41A 2ZGYA 1ZC6A 5AQHA 5ELZA 1V4TA 4FPAA 3UKRA 4EAHD 3HTVA 3A0IX 4RTFD 1S3XA 4B1ZA 1GLFO 4MLHA 2YHYA 4FWOA 4O5FA 1ESVA 1IJJA 5BN9A 1JCFA 2H3GX 5AQJA 4FWLA 1GLLO 4BRLA 3AARA 3LDNA 3LL3A 4EFHA 1NBWA 1BO5O 4BRNA 2GTDA 3DXMA 1LCUA 2PAVA 3CJCA 5AQQA 5BPMA 1BUPA 1U2VB 2GELA 3VF6A 2CH6A 4H5NA 3WQUA 2D1KA 4MLEA 3CI5A 4IWVA 4CBWA 5F0XA 4JHDB 5AQOA 5AQTA 3ULEA 4AM7A 4CBUA 3VESA 4EHUA 3P4IA 2E88A 1DEJA 3MN5A 5AFUA 3MN6A 4IXCA 4BR7A 2FF6A 3GG4A 2ITMA 2Q97A 3VENA 3EKUA 5JICA 4BG9A 5KQ8A 4K25A 4BVOA 4M7YA 4WYBA 5JMVA 3VEYA 3MN9A 4A2AA 2UYTA 1T6CA 3O80A 4C23A 4WQ5A 5ADXA 3B8AX 3DWLA 5AQIA 4XEIA 2FSJA 2VYPA 3ZEUA 5JLHA 3CETA 1KAXA 1NGCA 1IG8A 2P9KB 5EX5A 4GY2B 5AFUH 3H1VX 5AZJB 3WXKA 2IVNA 4MO5A 4A61A 4QS8A 2P9UB 3BF3A 3H46O 2Q31A 4NO7A 1MWMA 1TUYA 3WQTA 3H1QA 3DXKB 4MO4A 3L0QA
chains in the Genus database with same CATH superfamily
3O08A 1RNHA 2F4VK 2D5RA 3OA9A 3LP2A 1C0MA 4GV9A 1E4FT 4RW8A 3LM2A 2G8VA 4LC9B 3GOIA 2YV0X 3U9DA 3SQ2A 1BQNA 2QW9A 2P9LA 1U49A 1T44A 3C0BA 3C7NA 2B4JA 3EKSA 3V9XA 4OGEA 4EZ6A 3DAWA 2KKZA 1LAVA 2Q0RA 1ZXOA 1IG9A 3WXMB 1TAQA 4KHWA 2QKKA 4KHUA 2IC3A 3TAFA 1HNXK 4O5BA 1JXBA 4CJ3A 3NGZA 1EXQA 3RMCA 4ISFA 1ATNA 3AVAA 2QA4N 1N33K 3M8SA 1L3SA 2ZM6K 1X9JA 1I3AA 1OH7A 2QXFA 2E1YA 4N76A 3CCSN 3SUQA 4JKFA 2FSKA 2F96A 4N41A 1D9DA 3D6RA 4QS7A 4BE2A 3LDSA 5GIOA 2P5OA 3LAMA 4XH1A 4CFBA 1VQ9N 3HP9A 4IOAL 3I8BA 3KK7A 2IIRA 2HVIA 1VQ7N 1YF5L 1TKZA 1JLGA 4JKAA 4FPBA 4YDUA 4O0JA 1VQMN 5TKYA 3QEPA 4IZ9A 3QIOA 1TK8A 2J4RA 4DSKA 3VQ7A 3QERA 3E9PA 3P38A 3ZSQA 4YHHK 3S3MA 1V4SA 3L3VA 2FXUA 3NH1A 4J2DA 3MN7A 4DCHA 1YJ9N 3I8DA 3QNOA 2HHTA 3K5MA 3QB0A 1WBDA 4H4MA 1WSJA 4B9LA 3TI0A 3R6MA 1C0UA 2HB5A 2AJQA 3HJFA 4YDUC 4YORA 4B1VA 3AVCA 2ZJPL 4CJUA 3TANA 2YHWA 4L3QA 2UXCK 4V19S 4DS5A 1ILYA 1HPMA 1KVBA 4RW4A 3KK1A 4DFMA 1VSHA 5I3UA 1KD1O 3B6OA 4EIAA 3ZT1A 2W41A 4O55A 1VQ5N 4FJLA 4DV7K 1GLAG 4H5VA 3NH0A 5BRFA 4DTOA 1QTMA 3CJBA 4J2AA 4MFBA 5EXWA 1RDUA 3SJJA 1U04A 2OCEA 3FR0A 4PQUA 4FWKA 4RCHA 2B5JA 5I42A 1T8EA 3M3ZA 1MDUB 3CCQN 4E19A 5HOOA 4M3XA 5B8HA 2VG5A 4JI5K 1SAZA 3MWPA 4E7LA 2P9KA 5KPRA 3VERA 3LWMA 1IBLK 4O8KA 4IDKA 4CI6A 3FGUA 3VEZA 4HCBA 2P9UA 2UUCK 5AQUA 4GW6A 2FBYA 3KK3A 2JWKA 1IBMK 4CZHA 3MXIA 1YIJN 4BRPA 3QBWA 5C24A 1RDWX 3QNNA 3R1XA 1U6ZA 5J2NA 3FZMA 1ZBFA 4H5TA 4JKGB 3OYNA 3UB5A 1OH5A 3AO1A 2A40A 3VGKA 4B9QA 5EY4A 3BP8A 4KBOA 2UUAK 3RTVA 3DRSA 4PKHA 2KFZA 5KGXA 4PL8A 4BE0A 1KFSA 4NCAA 3LM9A 4F2SA 4DQRA 4CJVA 1OH6A 1RBUA 3ENHA 1R59O 4ILGB 1OVYA 4K8XA 4F3TA 2P1JA 2YHXA 4Q5VA 4A5AA 3VQEA 5JLFA 3ULEB 2O8DB 3HSCA 4H5WA 1DT9A 5C0YA 2LSNA 1SS6A 2YCHA 1TGOA 2IS3A 3VEXA 3K9KA 3VEWA 1S22A 4IFVA 5AQVA 1VQPN 3HVRA 4YFUA 1CXUA 4KO0A 4PHTX 3ID6A 4HUFA 3CG7A 3B6PA 4E7KA 2QEXN 3LDLA 4QCLA 2WFBA 1J5EK 4CJTA 3KHYA 1RT2A 4NYNA 3WUHA 4FZZA 4DFJA 3VGMA 1A5VA 4PY5A 4W5TA 2P9NA 2A6AA 4B3SK 1NGDA 1HKCA 4IO8A 1ZBUA 5AQFA 1O1WA 1OKJA 3QFUA 3H6EA 3ZLJA 2YNFA 3NGIA 4IKFA 3VA0A 4GVEA 5HP1A 2GUIA 4FWPA 3A5LC 4N5SA 3ULDA 2P9IB 1TYQB 3HM8A 4QOZB 3M5RA 4BGBA 4M3YA 2VGNA 4I9QA 5IT9O 1WSFA 2HBJA 1IH7A 4CJLA 4R5PA 4H0XB 1Q9YA 3AGRA 2XY6A 1RTHA 2P9PA 3IMXA 5E41A 2VQFK 1D5AA 3HL8A 2DTUA 2IGIA 4H0OA 3QO9A 5C12A 4LFBK 3BUZB 4M7XA 4CEEA 4DLEA 4LF4K 3LPUA 3CFPA 3FLCO 1QS4A 3ATUA 4DKWA 1KAYA 4DR3K 1NGAA 5FPMA 5AZIA 4JLHA 3IKMA 2E6LA 5HBMA 2GWKA 1S6QA 4DV5K 3TARA 5D3GA 3QFPA 3SV4A 1VQ4N 3H3OB 4CEZA 4BR0A 3CCVN 1T03A 3THVA 2D0CA 4BGAA 4FJIA 5LJVA 4BRFA 5C2FA 3DOLA 3VOVA 1JCEA 4CJPA 4F4KA 3VQAA 1M90O 5CYMA 4B1XB 3V9SA 2X6NA 4KI4A 3WXLA 1WNSA 2E2OA 4BC2A 1RT1A 4GNIA 1KQSM 4K41A 4FM2A 5AQHA 3D0PA 1J53A 3UKRA 4EAHD 4RTFD 1S3XA 3SNNA 4MLHA 3AO5A 1RTIA 4LY7A 4AHUA 1VQNN 2HBMA 4O5FA 3CPWM 3T1HK 3PUFA 4M41A 1NKEA 3SBTA 5M1KA 4NCBA 3NF8A 3NF7A 4FWLA 3K9JA 1YVUA 3DLGA 1GLLO 4DS4A 4DSFA 3LL3A 3TSQA 1S1VA 4R79A 1BO5O 1VSMA 3ZSRA 1C1BA 5K14A 4GMJB 3DXMA 5H1SQ 1MU2A 2Z1IA 5AQQA 2GELA 4H5NA 4MLEA 1X1PA 2RHKA 4B9MA 4DMNA 1VSDA 5M1PA 4M3UA 2KZMA 1DEJA 4I2PA 3HYFA 4FVMA 4BR7A 4K8ZA 4FJNA 3EKUA 2X74A 4CK1A 1VQLN 4X62K 4M7YA 2PYLA 1BISA 4DSEA 2HHXA 3SAGA 3OYHA 3MN9A 3OYAA 5FRMA 3SPZA 4FCYA 3SPYA 4FW2A 4FLZA 4CHYA 5JVGL 4JI2K 4XEIA 1U45A 3KK2A 3ZEUA 3CETA 4U7BA 4CGDA 3OS1A 1NGCA 3ZT2A 1IG8A 3SQ1A 5AFUH 2UU9K 2IVNA 4O8UA 4KAZA 1L5UA 4A61A 3KLFA 3BF3A 3H46O 5GINA 2E5LK 3NHGA 3P83D 3VTIA 1MWMA 2GX9A 1HQUA 3Q7CA 3J81O 3H1QA 1J9AA 1GOBA 3THYB 1ASUA 3LDQA 4LF5K 3UKUB 3BEXA 4F8RA 2F9TA 3S3OA 2QWPA 3W0LA 3L6QA 4E7HA 4DTNA 5ADXH 3O3GA 1P8ZA 3IG1A 4PKIA 4NB4A 3BDPA 2YKMA 4CHPA 3AVKA 3WEEB 4CFCA 3LWLA 3RMBA 3A5MC 4FWRA 3PO5A 1NK9A 3NFAA 1SL0A 5AQGA 5AQMA 5GAEP 4DTUA 4B9SA 4FM0A 3ZETB 4KRFA 2EWSA 3TPQA 3RMDA 2YJFA 3K2PA 2NUBA 3MEEA 4Z4IA 3JXUA 4MDAA 1K8AO 3G4SN 4KH6A 3J7AP 4HHTA 3T1AA 3HXMA 4CJFA 4FJ7A 1YI2N 1QQNA 4DTRA 2JWLA 2G8WA 3WEEA 4BC5A 4C8MA 4BRIA 5HRRA 1BG3A 1GLDG 4CF2A 4IG0A 4CESA 4E1NA 3VQDA 3QEIA 5GADP 4AHSA 2ZWHA 1KVAA 2OTJN 2HNYA 4OPAA 2Q0UA 2ASPA 5AQNA 4KV8A 3ZSOA 2ZJQL 1Q82O 2GUPA 5KQDA 1Z05A 1R0AA 3AA5X 3AAQA 4B9VA 4ZHRA 1K6YA 4HTUA 4H0VB 2AP1A 2A3ZA 4X65K 1XMOK 3A8YA 4FWSA 1RDBA 1EKEA 1NK5A 1BDGA 3CCLN 2QTDA 1MWKA 3QINA 3R8EA 3MX5A 1NJWA 3WXJA 4KHPK 3O3HA 5AQKA 2BE2A 3AO2A 3EZWA 4EHTA 1O13A 2NRRA 5F2RA 2O8CA 4KREA 1UAXA 4CZIA 4YOTA 3LDPA 3O1BA 3PO4A 5CR4A 4J2EA 2FLOA 4WE1A 4DR1K 3CFOA 1U2VA 1GLEG 2KHOA 3OS0A 3SI6A 3CC2N 1RBTA 3F9MA 4ISGA 1YVNA 4BY9C 5DM6L 4FJMA 3E01A 4JAXA 3PIOL 3VN5A 4OVLA 4YOWA 4CGFA 1JLFA 1EO1A 4H0TB 4RW6A 2PYJA 2YHBA 3ZX0A 2HMIA 4CHQA 1IKXA 1BCOA 2O8BA 3NH2A 4I6MB 3S9HA 4DQIA 4KTQA 4A5BA 4B9NA 3FZLA 3QLHA 4JN4A 3THWB 2JLEA 4ELTA 1BHLA 1HJOA 4FVUA 1W97L 2XY7A 4DV0K 4GKJK 4BR2A 1HUXA 4JKHA 4BRKA 4FLWA 1DTQA 1HLUA 3V1QA 2WTUA 2ASMA 3DRRA 4AQYK 3HI0A 4B8AB 2G8IA 2PBDA 1N36K 2BGGA 1K73O 1ASWA 4DG1A 1YITN 4LF8K 3WT0A 3SBGA 1UA0A 2HHUA 4E1JA 3D45A 4CF9A 1TKTA 4C8NA 2HNZA 4FW1A 1KCFA 2I7NA 2G8UA 2D4WA 3O4NA 4AH9A 1D9FA 4B9TA 4LH5A 4KTWA 3F5TA 2BH1A 3MK6A 1HYVA 3I0RA 3FFIA 1F21A 3SYZA 3WXIA 2Z1HA 1BWFO 2A5XA 4E7JA 1JLEA 1H1VA 5I9EB 4FK4A 3DLEA 5CZ2A 3F9KA 1NJZA 3OYGA 3RVCA 3KVGA 1Y64A 3NAEA 3CCMN 2I7PA 2CGKA 2KLAA 3L2WA 1XNQK 3VQPA 4U67L 3OY9A 1VAZA 4FWQA 3CHWA 4JYAK 3O9SA 1Q18A 4PA1A 3VETA 3S3NA 2G8HA 4IBNA 4Z4CA 2I5JA 2G8KA 1NGGA 3EYZA 4IJAA 2F8SA 2W42A 2QM1A 3U6FA 1SZ2A 3V1OA 5BRDA 3OVNA 1XI1A 4KI6A 2CH5A 3FZHA 1QVFM 2RN2A 5J2PA 3CM5A 1NLVA 4BQLA 4DV3K 4DV4K 4CJSA 2QWOA 1LAWA 4LSLA 1L3UA 3EEQA 1C0FA 2IVPA 3VPZA 1VQON 1SL2A 4H4OA 4FJHA 2HHVA 2KZZA 2X6SA 3SUPA 1JL1A 1TKDA 4BC3A 4Z0UA 1A5WA 3THXB 3HO1A 1NK7A 1G99A 4M63C 4DTXA 5AQPA 3ID8A 1Z25A 1WSHA 3TAPA 3CCEN 4KB0A 3AA3A 1HQEA 1MA9B 4KTZA 2UXBK 4IEIA 5AJ3K 3ISNC 1JCGA 4W5OA 4I2QA 4CGGA 1RCHA 2HHHK 3M1FA 2E1ZA 3OYKA 4CCHA 4Z94A 3TAQA 3LP0A 3L4QA 3ATVA 3I33A 2HBKA 2XRIA 3G25A 5BR9A 4ILJA 3F73A 1N5YA 3PX6A 2O4IA 1GLBG 3L2RA 4I7FA 4LF9K 4J8FA 4JI3K 5GAGP 3WNFA 1X9SA 2G8FA 1YUWA 4WFNL 4EP4A 5FPNA 1UOCA 3ZYYX 2QWMA 3G6EN 1HYZA 2PFUA 4F2RA 3OYMA 3AAPA 2P9SB 3JAMO 3AY9A 2VG6A 2V52B 4BQZA 3V6DA 2HHWA 3ENOA 4FYDA 4LD0A 2ZGYA 1ZC6A 3OYBA 4CK2A 3TWHA 3RRHA 5M1FA 1HNIA 3OYEA 4DTSA 3A0IX 4B1ZA 4WFAL 1ZBHA 1ZBIA 4AHRA 2YHYA 4OPKA 1QE1A 3T1YK 3KLEA 2HSTA 4DV2K 3QEWA 4FJKA 5FDLA 3K5NA 1JCFA 2H3GX 3BGRA 4JKGA 2QI2A 1LWEA 1BIUA 4M45A 4EFHA 1NBWA 3OTOK 2IDOA 4FJJA 2NRZA 3UIQA 1LCUA 5HL7L 3AVBA 4M3RA 1BUPA 1U48A 2QK9A 3VF6A 2CH6A 3JYTA 3K5LA 4DFPA 3CI5A 4Z4EA 4IWVA 4CBWA 4CIEA 4JHDB 5AQOA 5F0XA 1JKHA 3MEGA 1RDCA 4CIFA 3ULEA 1L3TA 4GV3A 3VESA 2O8DA 4IOXA 1W7AA 3MN5A 5AFUA 3V4IA 3HOSA 1NOYA 2FF6A 4M3WA 2NRTA 3GG4A 5DK5A 1K9MO 5KRTA 5JICA 2GV9A 2OPPA 4BG9A 5KQ8A 4K25A 3V9WA 1B9FA 3VEYA 4AHCA 2ZD1A 2WOMA 4A2AA 4CGIA 4W5QA 3KLHA 1VSFA 5FLXO 3PIPL 4AF1A 3DM2A 5ADXA 3PX4A 3DWLA 3ENBA 1Q7YO 4IFEA 2FSJA 4IFYA 1FKPA 5EX5A 4LH4A 4GY2B 2X78A 4Z4GA 3C6UA 5AZJB 3AVMA 4MO5A 2XO7A 4UY8O 3DI6A 4JS5A 1RT4A 1W9HA 1NJXA 4RG8A 1TUYA 1D8YA 1LW0A 3DXKB 5LY3A 3HVTA 4O0IA 4FJGA 2YI1A 3SUOA 3O9TA 2P9IA 1TYQA 3P39A 3M8PA 4M42A 3SV3A 3EL2A 1IKVA 1QZ5A 1HMVA 3IFRA 5LMUK 4A2BA 1EWRA 4DR7K 1HKGA 4BROA 4HWIA 4Y0WA 3OYIA 3NMUA 1ZYQA 5KPTA 3TAGA 1NNEA 2O8FB 3HOTA 1JL2A 3TABA 2CGLA 1SL1A 3MAQA 1Z6RA 2FBVA 3RMAA 3QICA 1K8KB 3DJCA 4W5NA 2OPQA 4CJEA 3AVHA 5AR0A 3T7ZA 2BANA 1RT3A 5BRHA 1KAZA 3ZT0A 1QQOA 4BR5A 4JD2B 4CJWA 4H03B 5C15A 4BRAA 3QBXA 3PX0A 1S6PA 3DLLL 1CZAN 1YJNN 2IVOA 2HHQA 5LL6Z 1W2BM 1JLCA 4N56A 3K5OA 1QQMA 1X9WA 4H8KA 3TSUA 2HOEA 4HUGA 2HF4A 4G1QA 1JXEA 4FZYA 4OLAA 2FBXA 1HKBA 4DU3A 4DSLA 3SAHA 1NGFA 4CJQA 2FF3B 4DLGA 1LWFA 2A42A 1QHAA 1NGEA 3L2QA 1X3MA 4FWNA 1ATSA 2NNWA 3UE5A 4BRGA 3RWUA 4FLUA 3BZKA 1X3NA 1NJIO 3O8MA 3VQ6A 4BC4A 1YAGA 4B08A 3BF1A 3K0SA 3HK2A 5DM7L 4BRHA 4B1WB 1IO2A 2O8EB 1VQKN 3D2FB 4CD3A 2YNIA 3O9RA 3HP6A 2E2QA 3CQ8A 1N6QA 1NU0A 1NMNA 4FK0A 3M6GA 1EETA 3NF9A 1T05A 4CW7B 1EP4A 1RBSA 3R9PA 4PWDA 5AQXA 2OZMA 4RW9A 2RF2A 4CECA 4OPJA 4KHNA 3HPGA 3CC7N 2WONA 3CJ1A 3T69A 4MQ3A 3PSFA 1WOQA 4CHNA 2VQEK 2F7TA 4WQ4A 5AQSA 1QQCA 4AM6A 5M1NA 4K43A 4RWTA 2P5GA 4CZKA 3D2EB 2QXLA 4DTPA 4WF9L 4H0PA 2PY5A 1QVGM 4JK7A 3CIPA 1JLBA 3HPHA 3OBWA 1SKSA 4FZXC 3SMPA 5C42A 3SCXA 4WQ4C 4BREA 1XC3A 3K59A 1WSEA 2E2PA 2ZF5O 1C0TA 4YOXA 3FZFA 1WLJA 5FPEA 5HRPA 3V9ZA 4EZ9A 3ALYA 3KKRA 3GBTA 5BREA 3V81A 3QEXA 4CZLA 4BG8A 4CFAA 3LP3A 1FKOA 1HYSA 3CJ7A 3WNEA 2YX6A 4CJ4A 3THYA 3ZCMA 3UKUA 4OKEA 1RTJA 1NKCA 4Z4HA 1Q8IA 1TL1A 3O5BA 3MECA 1WB9A 4CGJA 4BACA 2HW3A 3ZSXA 3KD5E 4XH4A 2W6LA 4A57A 1N32K 3L3UA 4OJRA 4BRDA 3V1RA 3KKSA 3G0ZA 4XIUA 3LDOA 1EWQA 3W3DA 4ID1A 2UXDK 5AQZA 3TTFA 3U4LA 1N34K 3U3GA 3RSEB 3J8AA 4NLBA 4DU4A 1WAFA 5JVHL 3ZETA 1FW6A 3K57A 1DGKN 4JI6K 1BA0A 4NXMK 4FM1A 2V7YA 1NK8A 1FK9A 4JEPA 5EVZA 4DR2K 5JS1A 1DKGD 5HLFA 3VA3A 1VRUA 3U9ZA 2DFEA 5AQRA 4DV6K 4ELUA 3NCIA 3OHRA 4G9ZA 3VQ9A 4CEFA 3P1GA 1BI4B 3SMSA 4HTLA 3RSEA 4CZJA 2FBTA 4CZEA 2OANA 1VSIA 3AVJA 1GLCG 3CJAA 4KKOA 1NGBA 5GIPA 5CYQA 1DTTA 4GV6A 4CD1A 4B9UA 2W40A 5KGWA 5BPLA 2A1SA 4FJ5A 1YXQA 1VSJA 1QSLA 1BOTO 4B3MK 3CMEN 3MCAB 3TU5A 3SJHA 3ZSYA 4IO9L 3HBTA 3H45C 2HBLA 4BWMA 1ZBLA 1WBBA 3I55N 2P9LB 2F9WA 1YT3A 3VEOA 4HCCA 1E4GT 4DQ8A 4UQGA 2HNDA 5M1OA 1W0HA 3C7NB 4BR9A 4DUYK 1LWCA 3O1WA 2FC0A 4LSNA 4F9OA 3L2VA 4H0YB 3ZT3A 4B8CA 3VF2A 3SQ4A 1RBRA 3LALA 1J6ZA 1VHXA 2FSNA 4WQ5C 1CZ9A 1I39A 3E66A 2B6AA 1XHXA 4QS9A 3A5OC 4I6MA 2WUSA 2ETJA 1CLQA 3K58A 2KW4A 3GE1A 4CJRA 2D0AA 3VGLA 4FK2A 3THWA 1NGHA 3EN9A 4JRQA 4B3RK 2AA4A 4CF0A 3AVIA 2NZTA 1LOTB 2E8AA 5KTQA 1NM1A 1KTQA 2ASOA 3EE9A 4KFBA 3VEVA 2RKIA 1BA1A 1CXQA 4C1NI 1XNRK 3VQ8A 5LJWA 3PV8A 4DTJA 1VQ6N 1VQ8N 4B3OA 3OYDA 1V4TA 4FPAA 4CHZA 3EZ5A 3ZSVA 3CD6N 3HTVA 4BDYA 3P5JA 3IAYA 1S9EA 4KHQA 3LPTA 4FWOA 1A5XA 2O4GA 4JS4A 1IJJA 5BN9A 4JI4K 3R3LA 3E1YA 4DQQA 4ICLA 4L8RB 3OJUA 1BCMA 3MX2A 4BRLA 3AARA 3LDNA 4BRNA 1LW2A 2GTDA 4JI8K 2PAVA 3CJCA 5BPMA 3OYJA 2Z1JA 3WQUA 3VQCA 2BDPA 2PZSA 3OBYA 4CEDA 4DSJA 2Z1GA 4AM7A 1NK6A 4CF8A 3P4IA 1VSKA 3EY1A 5J1EA 4BE1A 4ZTJA 3E9LA 3G10A 1BIZA 3MEDA 3MN6A 1Z26A 1TKXA 3NBPA 1REVA 4IEEA 2Q97A 2WC9A 3VENA 3HPOA 1YTUA 1KLNA 5SZTA 1S72N 5FRNA 5JMVA 2UYTA 3VQBA 1T6CA 4YNQA 3O9QA 3O80A 4YOVA 3AV9A 4C23A 1IKYA 3V9UA 4E0DA 1XWLA 1TK0A 3CCJN 1ASVA 2VGMA 3DOKA 2XY5A 2OA8A 1G15A 4CJKA 2P9KB 4CEOA 4DV1K 2YNHA 3HRGA 3WXKA 4LF7K 5MLCQ 4QS8A 2P9UB 3DLRA 5KRSA 4NO7A 3KLGA 1UWBA 1VK0A 1GOAA 1U4BA 1WSIA 3M8RA 3LANA 3L0QA 1S9GA 1GOCA 3WNGA 3BY5A 2DFHA 1SV5A 2Y1IA 1JLQA 3A2FA 3GL1A 1QHTA 3O3FA 4IOCL 3TR8A 4KPYA 4JKBA 5HROA 3THXA 3PSIA 4FOIA 4ELVA 1HNWK 4LFCK 4B1YB 3WNHA 4DR5K 2NRHA 3CJ9A 3AVLA 1NG9A 4FOEA 4NLCA 2NRXA 3TTDA 3AVGA 2D0BA 3CPEA 3NGYA 3NDKA 2Y1JA 4FLVA 3KD1E 4FJ9A 1IKWA 4OX9K 3KZBA 1I94K 3S41A 2XY8A 3KJVA 3M8QA 1FXXA 1SKWA 1BGXT 2EHGA 5KI6A 3OYFA 4K0KK 3U8XA 3ZSWA 4W5RA 4Z4FA 4DTMA 2VWBA 4JI7K 1NWKA 3QDKA 3LZIA 4X64K 1GLJO 1NJYA 1S1TA 4JV5K 5IWAK 1UA1A 3L4IA 2YKNA 3FE1A 1Y97A 3ITHA 4AILC 1WAJA 4DSIA 4DR6K 4DU1A 1TL3A 1X9MA 2BUPA 1T7PA 2P9SA 4GVMA 1RFQA 3C6AA 3O6WA 3JS6A 2P9NB 4OKJA 1XHZA 1S1XA 3ZT4A 4FWMA 4IDHA 1XQSC 2Q36A 1WN7A 4JKCA 4DUZK 5E84A 3A5NC 2Q1NA 2V7ZA 2OPRA 5BN8A 3VQQA 4M3ZA 5AQYA 3AGKA 3FFKB 4HUEA 4B3TK 1NK0A 4A62A 1KC8O 1RT5A 2HF3A 2RE2A 4JK8A 5TKWA 5T7BA 3D7EO 1NMDA 3KWGA 2XHBA 4E89A 1HR0K 3H08A 3J7ZO 4BRQA 4DQSA 5CY4A 5J2QA 1EX4A 2P9PB 1U47A 4C8LA 4Q0BA 1NGJA 4BR4A 3T3FA 5CZ1A 4CZGA 4M3TA 4CJ7A 1C1AA 3TAEA 4JHDA 3VF4A 2NRWA 3ZX2A 2QWQA 1QSSA 1CZBA 3AO3A 4CEQA 4DWIA 4QAGA 4EP5A 5AZIB 1IV0A 4BDPA 3SAFA 2NRVA 5HRSA 3QMLA 4CK3A 3SK3A 3L2UA 2E6MA 4BDZA 3DLBA 3HSTB 1TUUA 2CGJA 4OO1J 1NGIA 1IBKK 3AA4A 4CGHA 1JJ2M 4ISEA 4CVNE 2HHSA 1SQKA 1RGIA 4O44A 1HX1A 3KIOA 5DMRA 4ZTFA 1C0GA 2DFFA 2YJEA 4JKEA 2GWJA 3OS2A 1XUPO 4E3SA 1ATRA 1QSYA 5AZJA 2BTFA 3VQ4A 4C8KA 3QEVA 4C8OA 4YY3K 2QWRA 2GBZA 4FSVA 1S1WA 3UKRB 5CHIA 2ATQA 5EOYA 4Y1DA 1YHQN 2IOCA 3DXKA 1TV6A 5M1QA 1ZBSA 4CZMA 3MCPA 2Q3SA 3PLAA 1KFDA 4NXNK 2DPNA 4KHSA 3RRGA 3HZ6A 1KRPA 5F1XA 2DY4A 2A1RA 1YJWN 3Q7BA 3CFRA 5CE3A 2D0PA 3I56N 3AA2A 3GDQA 1T6DA 4CEAA 4J2BA 4OPHA 5KPZA 4FL9A 4OGCA 3DXMB 4KB1A 2O8FA 4ILHA 1JLAA 1QZ6A 1TAUA 3FZKA 3CQXA 3MWTA 3DRPA 1K8KA 5AQWA 3ASMA 5SWMA 4CEBA 3L8BA 1B9DA 3JSMA 3NF6A 4MDBA 5FPDA 3IUCA 4K42A 4Y1CA 4CHOA 3C6HA 4X66K 3H3NO 1EQYA 4CF1A 4PL7A 1SKRA 5FROA 4DQPA 5C25A 4JD2A 1KXPA 2ZE2A 3CM6A 1D4XA 4RW7A 4FLYA 2VG7A 2EX3A 4JNEA 1S5JA 3C95A 3CERA 4NCGA 4IG3A 3N4QA 4KH4A 4CZFA 4TSXA 5C10A 1Q81O 5AQLA 3BZCA 4FO0A 1C6VA 4PUOA 5J2MA 4DHYA 4DFKA 5E26A 3OW2M 3HT3A 4CE9A 2KFNA 5BPNA 3J7YP 4JKDA 4JRPA 3ZEUB 3RR8A 4DF4A 2Q2RA 2D0OA 1ITGA 3LZJA 4FLXA 3OYCA 3P31A 3CMAN 1BL3A 3HM9A 2R7YA 2NLXA 1WUAA 2QKBA 2V51B 3SZ2A 2F8TA 2E2NA 2W6KA 3ZX3A 1RTDA 1J54A 1Q9XA 2QWLA 3E9OA 1RT6A 3CYMA 3TTCA 1RILA 2OZSA 4LFAK 1C1CA 4E1MA 1XC9A 1NOZA 1KSPA 2O8EA 3DMJA 3D2FA 4FJ8A 1HNZK 4BRCA 4N47A 3NVMA 1T3VA 2A41A 2VCPA 5JS2A 3SLCA 4AHTA 4FLTA 2ZJRL 3MXMA 3N4PA 3J80O 4NYFA 1L3VA 3QETA 2KTQA 1KVCA 4PKGA 3VQ5A 3LP1A 4CFDA 3O4WA 3O9UA 4A59A 3MDQA 2UUBK 3EO3A 3KTQA 1J5OA 4H5RA 3MMVA 3OJSA 1M1KO 3MXJA 1P90A 4CERA 4B1UB 3CCRN 4FJXA 1E3MA 2YHAA 3TAMA 2IAJA 1XMQK 3C6TA 2ZGZA 4DB3A 3CQYA 4XH5A 3RR7A 4OKKA 2GEMA 4BRMA 3SUNA 1BU6O 2HMPA 3SQ0A 4KHYA 3DLKA 3D2EA 4IJNA 1HPZA 3IDHA 2JGUA 3DLHA 4YOYA 2QWNA 4LF6K 2E4LA 2ZQBA 4CBXA 3IRXA 2E20A 4JK9A 3CF5L 1Q86O 4CIGA 3CC4N 4BVPA 4I9LA 3NE6A 4WFBL 4JI0K 3AO4A 4AHVA 4DR4K 3OYLA 3G71N 5ELZA 1VSEA 3C65A 4BWJA 5C2DA 4FXDA 5HRNA 5LMNK 3I0SA 1FJGK 1GLFO 1RDAA 2HVHA 3TSPA 2YNGA 1NKBA 3U3YA 4ID5A 3VMFB 3AVFA 1ESVA 1OVQA 3PY8A 3DYAA 5A2QO 2KQ2A 5AQJA 2O8CB 3QIPA 4C1NK 3QESA 3KLIA 1HJRA 1U2VB 2RPIA 4KH5A 2D1KA 1RT7A 1VSLA 2VWJA 3F2KA 5AQTA 3NVKA 4CBUA 1B92A 1OH8A 4EHUA 3IS9A 1LV5A 1YTAA 5BR8K 2E88A 2OPSA 2OTLN 1NK4A 2WBNA 3VTHA 3EE8A 1RBVA 4O4GA 4IXCA 1S1UA 2ITMA 4OLBA 4F3OA 4CJ5A 1KLMA 3T19A 2O8BB 3CXCM 4BVOA 4WYBA 2OYQA 1RDDA 1BQMA 3LAKA 1SUQA 1WSGA 2VWKA 3O4QA 3KWIA 2ITGA 4WQ5A 1VRTA 3CCUN 5GAHP 3B8AX 5AQIA 1BI4A 3ZSZA 1TK5A 5JLHA 2VYPA 1KAXA 4HVJA 1HNVA 4E7IA 4DF8A 4JI1K 3H1VX 1DLOA 4WCEL 1TVRA 3C94A 1HRHA 4GKKK 2Q31A 2P51A 5EU7A 4YOUA 3AVNA 1N8RO 3WQTA 4MO4A
chains in the Genus database with same CATH topology
2YI1A 3O08A 3LDQA 3O9TA 2P9IA 1TYQA 3UKUB 3BEXA 3P39A 2F9TA 3GL1A 3OA9A 4IOCL 3EL2A 2QWPA 4JKBA 1QZ5A 3W0LA 3L6QA 3IFRA 4FOIA 5ADXH 4A2BA 4GV9A 1P8ZA 4B1YB 1E4FT 3LM2A 1HKGA 4LC9B 4BROA 2NRHA 3GOIA 4HWIA 4NB4A 3CJ9A 4PKIA 3U9DA 4Y0WA 2QW9A 2P9LA 4FOEA 4NLCA 2NRXA 3WEEB 3TTDA 3NMUA 3CPEA 5KPTA 3HOTA 1T44A 3A5MC 3C0BA 2CGLA 3C7NA 3EKSA 4FWRA 3KZBA 1Z6RA 3QICA 1K8KB 3DAWA 3S41A 2KKZA 3DJCA 5AQGA 2Q0RA 5AQMA 5GAEP 1ZXOA 3ZETB 3U8XA 3WXMB 2VWBA 5AR0A 2EWSA 3TPQA 3T7ZA 2YJFA 1NWKA 3QDKA 1KAZA 4BR5A 1QQOA 5BRHA 1GLJO 3JXUA 4MDAA 1K8AO 4JD2B 3G4SN 4KH6A 4H03B 5C15A 4BRAA 3QBXA 3L4IA 3FE1A 4ISFA 3DLLL 1ATNA 1CZAN 1YI2N 2QA4N 1QQNA 2IVOA 1YJNN 1W2BM 2JWLA 3WEEA 4BC5A 1X9JA 4BRIA 1BG3A 1QQMA 2BUPA 1GLDG 3TSUA 2E1YA 2HOEA 3CCSN 2P9SA 2HF4A 1RFQA 4JKFA 5GADP 2ZWHA 2FSKA 3C6AA 2OTJN 3O6WA 3JS6A 4OPAA 2P9NB 2Q0UA 1HKBA 2ASPA 5AQNA 2ZJQL 1Q82O 2GUPA 3D6RA 3SAHA 4QS7A 1NGFA 5KQDA 2FF3B 4FWMA 1Z05A 4IDHA 1XQSC 5LY3A 2Q36A 2A42A 3AAQA 1QHAA 1NGEA 4JKCA 1X3MA 4FWNA 5GIOA 5E84A 1ATSA 3A5NC 4XH1A 2NNWA 3UE5A 2Q1NA 4BRGA 4H0VB 2AP1A 2A3ZA 2V7ZA 5BN8A 3A8YA 4FWSA 1X3NA 1NJIO 1BDGA 1VQ9N 3O8MA 3CCLN 5AQYA 3AGKA 2QTDA 3FFKB 1MWKA 1YAGA 2IIRA 3BF1A 3I8BA 3KK7A 3MX5A 1YF5L 3R8EA 1VQ7N 3WXJA 4JKAA 4FPBA 4A62A 5DM7L 4BRHA 1KC8O 4B1WB 2HF3A 2RE2A 4YDUA 4JK8A 5TKWA 3D7EO 5AQKA 1NMDA 1VQMN 5TKYA 3KWGA 4IZ9A 2J4RA 3EZWA 4EHTA 1O13A 2NRRA 5F2RA 3E9PA 3J7ZO 3P38A 1VQKN 4BRQA 3D2FB 4CD3A 1V4SA 4CZIA 3O9RA 2FXUA 2E2QA 4YOTA 2P9PB 3LDPA 3O1BA 3MN7A 5CR4A 1NGJA 4BR4A 2FLOA 4DCHA 1YJ9N 3M6GA 4CZGA 1U2VA 1GLEG 2KHOA 3R9PA 3QB0A 5AQXA 4CJ7A 3CC2N 3R6MA 4JHDA 3F9MA 4ISGA 4YDUC 4YORA 3CC7N 4B1VA 1YVNA 3CJ1A 3VF4A 2ZJPL 3T69A 4BY9C 2YHWA 5DM6L 1WOQA 2NRWA 4L3QA 3ZX2A 2QWQA 4JAXA 2F7TA 4WQ4A 3PIOL 5AQSA 5AZIB 1ILYA 3SAFA 1HPMA 2NRVA 4YOWA 1EO1A 4AM6A 4H0TB 5M1NA 3QMLA 3SK3A 4K43A 4RWTA 1KD1O 3ZX0A 4EIAA 1TUUA 2CGJA 2W41A 4OO1J 4I6MB 4CZKA 1NGIA 1VQ5N 3D2EB 1GLAG 4H5VA 4A5BA 5BRFA 3CJBA 3FZLA 2QXLA 1JJ2M 4ISEA 4WF9L 1SQKA 1RDUA 4H0PA 5EXWA 1QVGM 4JK7A 4JN4A 3CIPA 3OBWA 1RGIA 1HX1A 3FR0A 3SMPA 4FWKA 1C0GA 4RCHA 1HJOA 4WQ4C 4BREA 1W97L 2YJEA 1XC3A 3M3ZA 1MDUB 2ZF5O 2E2PA 2GWJA 4JKEA 5HOOA 4YOXA 3CCQN 3FZFA 5B8HA 4BR2A 1HUXA 1XUPO 4JKHA 4BRKA 1SAZA 3MWPA 5FPEA 2P9KA 5KPRA 1HLUA 3VERA 1ATRA 2ASMA 5AZJA 2BTFA 3GBTA 4O8KA 5BREA 4CI6A 3FGUA 2QWRA 3VEZA 2P9UA 4FSVA 3HI0A 4CZLA 5AQUA 3UKRB 4BG8A 5CHIA 2PBDA 1K73O 5EOYA 1YHQN 2JWKA 3DXKA 3CJ7A 4CZHA 2YX6A 1ZBSA 5M1QA 4CZMA 3MCPA 1YIJN 3PLAA 1YITN 3UKUA 4BRPA 3QBWA 1RDWX 3R1XA 3WT0A 1U6ZA 2DPNA 3SBGA 3FZMA 3HZ6A 4H5TA 4E1JA 4JKGB 5F1XA 3O5BA 1YJWN 3UB5A 3Q7BA 5CE3A 2D0PA 3I56N 3GDQA 2I7NA 2A40A 3VGKA 4B9QA 1T6DA 5EY4A 3BP8A 4KBOA 4XH4A 4OPHA 5KPZA 2D4WA 4A57A 4FL9A 4PKHA 3DXMB 4BRDA 4PL8A 4ILHA 3F5TA 2BH1A 1QZ6A 3LM9A 3MK6A 3FZKA 3CQXA 3LDOA 3MWTA 3ENHA 3W3DA 1R59O 4ILGB 1BWFO 1OVYA 2A5XA 1K8KA 3WXIA 5AQZA 3TTFA 3U4LA 2YHXA 4A5AA 5AQWA 1H1VA 5I9EB 5JLFA 3ULEB 3RSEB 3J8AA 4NLBA 3HSCA 5JVHL 4H5WA 4MDBA 3ZETA 3RVCA 3KVGA 1Y64A 1DT9A 5FPDA 3IUCA 4K42A 5C0YA 3C6HA 1SS6A 1DGKN 2YCHA 3H3NO 1BA0A 1EQYA 3CCMN 3VEXA 4PL7A 2I7PA 3K9KA 3VEWA 2V7YA 2CGKA 2KLAA 4JD2A 1KXPA 1S22A 4JEPA 1D4XA 5AQVA 5EVZA 4U67L 1VQPN 4JNEA 1DKGD 3CERA 1VAZA 4FWQA 4PHTX 3CHWA 3N4QA 3O9SA 1Q18A 4KH4A 4CZFA 3ID6A 3U9ZA 3VETA 5C10A 1Q81O 5AQLA 5AQRA 4FO0A 2QEXN 3LDLA 4DHYA 2WFBA 5E26A 3OW2M 1NGGA 3KHYA 3OHRA 4G9ZA 3WUHA 5BPNA 3VGMA 4IJAA 2QM1A 2P9NA 4JKDA 3SMSA 4HTLA 3ZEUB 1SZ2A 5BRDA 3RSEA 2A6AA 4CZJA 1NGDA 1HKCA 2Q2RA 4IO8A 2D0OA 2CH5A 4CZEA 2OANA 3FZHA 5AQFA 1QVFM 1GLCG 3CJAA 1OKJA 3P31A 3CMAN 3QFUA 1NGBA 3H6EA 1NLVA 2NLXA 4BQLA 5GIPA 1WUAA 4GV6A 2V51B 4CD1A 2QWOA 2E2NA 2W40A 1C0FA 2IVPA 4GVEA 3VPZA 3ZX3A 5BPLA 1VQON 4FWPA 3A5LC 1YXQA 2QWLA 3E9OA 2P9IB 1TYQB 3HM8A 1BOTO 3TTCA 3CMEN 3MCAB 3M5RA 4BGBA 3TU5A 3SJHA 2VGNA 4IO9L 4BC3A 3HBTA 2HBJA 3H45C 4H0XB 2HBLA 3D2FA 1G99A 3AGRA 4BRCA 4M63C 3NVMA 1T3VA 5AQPA 2A41A 2VCPA 2P9PA 3ID8A 3IMXA 3SLCA 2ZJRL 3I55N 2P9LB 3CCEN 3N4PA 2F9WA 3VEOA 1MA9B 1E4GT 4H0OA 4IEIA 4DQ8A 4PKGA 5C12A 5M1OA 3C7NB 4BR9A 3O4WA 3O9UA 3O1WA 3BUZB 1JCGA 3EO3A 3MDQA 4M7XA 4A59A 4H5RA 4F9OA 3MMVA 1M1KO 4H0YB 1P90A 4B1UB 3M1FA 3VF2A 3CCRN 2E1ZA 3FLCO 3ATUA 1J6ZA 4DKWA 4Z94A 1KAYA 2ZGZA 4DB3A 1NGAA 3CQYA 2FSNA 3L4QA 4WQ5C 5FPMA 4XH5A 5AZIA 3ATVA 3E66A 3I33A 2HBKA 3IKMA 3G25A 5BR9A 4ILJA 2GEMA 4BRMA 1BU6O 2HMPA 4QS9A 2GWKA 1GLBG 3A5OC 3QFPA 4I6MA 4J8FA 3D2EA 2WUSA 4IJNA 5GAGP 1VQ4N 3H3OB 3IDHA 4BR0A 3CCVN 3GE1A 1YUWA 4YOYA 3VGLA 4WFNL 2QWNA 4BGAA 5FPNA 3ZYYX 5LJVA 4BRFA 2QWMA 3G6EN 5C2FA 4CBXA 2PFUA 1NGHA 3EN9A 3AAPA 3VOVA 2P9SB 2E20A 4JK9A 4IOAL 3CF5L 1JCEA 2AA4A 1Q86O 3AY9A 2NZTA 3CC4N 4BVPA 1LOTB 2E8AA 4WFBL 1NM1A 2V52B 4BQZA 1M90O 2ASOA 3EE9A 3VEVA 4B1XB 1BA1A 4C1NI 3ENOA 3WXLA 5LJWA 2E2OA 4BC2A 1KQSM 4GNIA 4K41A 2ZGYA 1VQ6N 1ZC6A 5AQHA 3G71N 1VQ8N 5ELZA 1V4TA 4FPAA 3C65A 3UKRA 5C2DA 5M1FA 4EAHD 3CD6N 3HTVA 3A0IX 4RTFD 1S3XA 4B1ZA 4WFAL 1GLFO 4MLHA 2YHYA 4FWOA 3TSPA 1VQNN 2HBMA 4O5FA 3VMFB 1ESVA 3CPWM 1IJJA 5BN9A 2HSTA 3R3LA 3E1YA 3SBTA 5M1KA 1JCFA 2H3GX 4JKGA 2QI2A 5AQJA 4FWLA 3K9JA 4C1NK 1GLLO 3MX2A 4BRLA 3AARA 3LDNA 3LL3A 3TSQA 4EFHA 1NBWA 1BO5O 4BRNA 4R79A 2NRZA 2GTDA 3DXMA 1LCUA 2PAVA 5HL7L 3CJCA 5AQQA 5H1SQ 5BPMA 1BUPA 1U2VB 2GELA 3VF6A 2CH6A 4H5NA 4KH5A 3WQUA 2D1KA 4MLEA 3CI5A 4IWVA 3OBYA 2RHKA 4CBWA 5F0XA 3F2KA 4JHDB 5AQOA 5AQTA 4GV3A 3NVKA 3ULEA 4AM7A 4CBUA 5M1PA 3VESA 4EHUA 3P4IA 2E88A 2OTLN 1DEJA 4IOXA 2WBNA 3MN5A 5AFUA 3VTHA 3E9LA 3EE8A 3HOSA 3MN6A 4IXCA 4BR7A 2FF6A 2NRTA 3GG4A 2ITMA 4IEEA 2Q97A 2WC9A 3VENA 1K9MO 4FVUA 3EKUA 5JICA 4BG9A 5KQ8A 4K25A 1S72N 1VQLN 3CXCM 4BVOA 4M7YA 4WYBA 5JMVA 3VEYA 3SAGA 3MN9A 4A2AA 2UYTA 1T6CA 3PIPL 4AF1A 3O9QA 3O80A 4YOVA 4C23A 3KWIA 4WQ5A 5JVGL 5ADXA 3CCUN 5GAHP 3B8AX 4BC4A 3DWLA 3ENBA 5AQIA 3CCJN 1Q7YO 4XEIA 4IFEA 2FSJA 2VYPA 3ZEUA 2VGMA 3CETA 5JLHA 4U7BA 1KAXA 1NGCA 1IG8A 2P9KB 5EX5A 4GY2B 5AFUH 3H1VX 3HRGA 5AZJB 3WXKA 2IVNA 4MO5A 4O8UA 4WCEL 4A61A 5MLCQ 4QS8A 2P9UB 3BF3A 4UY8O 3H46O 5GINA 2Q31A 4NO7A 3VTIA 1MWMA 4YOUA 1N8RO 2GX9A 3Q7CA 1TUYA 3WQTA 3H1QA 3DXKB 4MO4A 3L0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI1 A;  3O08 A;  3LDQ A;  2P9I A;  1TYQ A;  3UKU B;  3BEX A;  2F9T A;  3GL1 A;  3EL2 A;  2QWP A;  1QZ5 A;  3W0L A;  3L6Q A;  3IFR A;  4FOI A;  5ADX H;  4A2B A;  1P8Z A;  4B1Y B;  1E4F T;  3LM2 A;  1HKG A;  4LC9 B;  4BRO A;  2NRH A;  3GOI A;  4HWI A;  4NB4 A;  3CJ9 A;  4PKI A;  3U9D A;  4Y0W A;  2QW9 A;  2P9L A;  4FOE A;  3WEE B;  5KPT A;  1T44 A;  3A5M C;  3C0B A;  2CGL A;  3C7N A;  3EKS A;  4FWR A;  3KZB A;  1Z6R A;  3QIC A;  1K8K B;  3DAW A;  3S41 A;  3DJC A;  5AQG A;  2Q0R A;  5AQM A;  1ZXO A;  3ZET B;  3U8X A;  2VWB A;  5AR0 A;  2EWS A;  3TPQ A;  2YJF A;  1NWK A;  3QDK A;  1KAZ A;  4BR5 A;  1QQO A;  5BRH A;  1GLJ O;  3JXU A;  4JD2 B;  4H03 B;  4BRA A;  3QBX A;  3L4I A;  3FE1 A;  4ISF A;  1ATN A;  1CZA N;  1QQN A;  2IVO A;  3WEE A;  4BC5 A;  1X9J A;  4BRI A;  1BG3 A;  1QQM A;  2BUP A;  1GLD G;  2E1Y A;  2HOE A;  2P9S A;  2HF4 A;  1RFQ A;  2ZWH A;  2FSK A;  3O6W A;  3JS6 A;  2P9N B;  2Q0U A;  1HKB A;  2ASP A;  5AQN A;  2GUP A;  4QS7 A;  1NGF A;  5KQD A;  2FF3 B;  4FWM A;  1Z05 A;  1XQS C;  5LY3 A;  2Q36 A;  2A42 A;  3AAQ A;  1QHA A;  1NGE A;  1X3M A;  4FWN A;  5E84 A;  1ATS A;  3A5N C;  4XH1 A;  3UE5 A;  2Q1N A;  4BRG A;  4H0V B;  2AP1 A;  2A3Z A;  2V7Z A;  5BN8 A;  3A8Y A;  4FWS A;  1X3N A;  1BDG A;  3O8M A;  5AQY A;  3FFK B;  1MWK A;  1YAG A;  2IIR A;  3BF1 A;  3I8B A;  3R8E A;  4BC4 A;  3WXJ A;  4FPB A;  4A62 A;  4BRH A;  4B1W B;  2HF3 A;  4YDU A;  3D7E O;  5AQK A;  1NMD A;  5TKY A;  4IZ9 A;  2J4R A;  3EZW A;  4EHT A;  5F2R A;  4BRQ A;  3D2F B;  4CD3 A;  1V4S A;  4CZI A;  2FXU A;  2E2Q A;  2P9P B;  3LDP A;  3O1B A;  3MN7 A;  1NGJ A;  4BR4 A;  2FLO A;  4DCH A;  3M6G A;  4CZG A;  1U2V A;  1GLE G;  2KHO A;  3R9P A;  3QB0 A;  5AQX A;  4CJ7 A;  3R6M A;  4JHD A;  3F9M A;  4ISG A;  4YDU C;  4B1V A;  1YVN A;  3CJ1 A;  3VF4 A;  2YHW A;  1WOQ A;  4L3Q A;  3ZX2 A;  2QWQ A;  4JAX A;  4WQ4 A;  5AQS A;  5AZI B;  1HPM A;  4AM6 A;  4H0T B;  3QML A;  3SK3 A;  4K43 A;  4RWT A;  3ZX0 A;  4EIA A;  1TUU A;  2CGJ A;  2W41 A;  4I6M B;  4CZK A;  1NGI A;  3D2E B;  1GLA G;  4H5V A;  5BRF A;  3CJB A;  3FZL A;  2QXL A;  4ISE A;  1SQK A;  4H0P A;  5EXW A;  4JN4 A;  3CIP A;  1RGI A;  1HX1 A;  3FR0 A;  3SMP A;  4FWK A;  1C0G A;  4RCH A;  1HJO A;  4WQ4 C;  4BRE A;  2YJE A;  1XC3 A;  3M3Z A;  1MDU B;  2ZF5 O;  2E2P A;  2GWJ A;  3FZF A;  5B8H A;  4BR2 A;  1HUX A;  1XUP O;  4BRK A;  5FPE A;  1SAZ A;  2P9K A;  5KPR A;  1HLU A;  3VER A;  1ATR A;  2ASM A;  5AZJ A;  2BTF A;  3GBT A;  4O8K A;  5BRE A;  4CI6 A;  3FGU A;  2QWR A;  3VEZ A;  2P9U A;  4FSV A;  3HI0 A;  4CZL A;  5AQU A;  3UKR B;  4BG8 A;  2PBD A;  5EOY A;  3DXK A;  3CJ7 A;  4CZH A;  1ZBS A;  4CZM A;  3MCP A;  3UKU A;  4BRP A;  3QBW A;  1RDW X;  3WT0 A;  1U6Z A;  2DPN A;  3FZM A;  3HZ6 A;  4H5T A;  4E1J A;  5F1X A;  3O5B A;  3UB5 A;  5CE3 A;  2D0P A;  3GDQ A;  2I7N A;  2A40 A;  3VGK A;  4B9Q A;  1T6D A;  5EY4 A;  3BP8 A;  4KBO A;  4XH4 A;  5KPZ A;  2D4W A;  4FL9 A;  4PKH A;  3DXM B;  4BRD A;  4PL8 A;  3LM9 A;  1QZ6 A;  3MK6 A;  3FZK A;  3CQX A;  3LDO A;  3ENH A;  3W3D A;  1R59 O;  3WXI A;  1BWF O;  2A5X A;  1K8K A;  5AQZ A;  3U4L A;  2YHX A;  5AQW A;  1H1V A;  5I9E B;  5JLF A;  3ULE B;  3RSE B;  3J8A A;  3HSC A;  4H5W A;  3ZET A;  3KVG A;  1Y64 A;  5FPD A;  3IUC A;  4K42 A;  1DGK N;  2YCH A;  3H3N O;  1BA0 A;  1EQY A;  3VEX A;  4PL7 A;  2I7P A;  3VEW A;  2V7Y A;  2CGK A;  4JD2 A;  1KXP A;  1S22 A;  1D4X A;  5AQV A;  5EVZ A;  4JNE A;  1DKG D;  3CER A;  4FWQ A;  3CHW A;  1Q18 A;  4CZF A;  3U9Z A;  3VET A;  5AQL A;  5AQR A;  4FO0 A;  3LDL A;  4DHY A;  5E26 A;  1NGG A;  3KHY A;  3OHR A;  3WUH A;  5BPN A;  3VGM A;  4IJA A;  2QM1 A;  2P9N A;  3SMS A;  3ZEU B;  4HTL A;  1SZ2 A;  5BRD A;  3RSE A;  2A6A A;  4CZJ A;  1NGD A;  1HKC A;  2Q2R A;  4IO8 A;  2D0O A;  2CH5 A;  4CZE A;  2OAN A;  3FZH A;  5AQF A;  1GLC G;  3CJA A;  1OKJ A;  3QFU A;  1NGB A;  3H6E A;  1NLV A;  2NLX A;  4BQL A;  1WUA A;  2V51 B;  4CD1 A;  2QWO A;  2E2N A;  2W40 A;  1C0F A;  2IVP A;  3VPZ A;  3ZX3 A;  5BPL A;  4FWP A;  3A5L C;  1YXQ A;  2QWL A;  2P9I B;  1TYQ B;  3HM8 A;  1BOT O;  4BGB A;  3TU5 A;  3SJH A;  4BC3 A;  3HBT A;  3H45 C;  4H0X B;  3D2F A;  1G99 A;  4BRC A;  4M63 C;  5AQP A;  2A41 A;  2VCP A;  2P9P A;  3ID8 A;  3IMX A;  3SLC A;  2P9L B;  2F9W A;  3VEO A;  1MA9 B;  1E4G T;  4H0O A;  4DQ8 A;  4PKG A;  3C7N B;  4BR9 A;  3O4W A;  3O1W A;  3BUZ B;  1JCG A;  3EO3 A;  3MDQ A;  4M7X A;  4H5R A;  4F9O A;  3MMV A;  4H0Y B;  4B1U B;  3M1F A;  3VF2 A;  2E1Z A;  3FLC O;  3ATU A;  1J6Z A;  4Z94 A;  1KAY A;  2ZGZ A;  4DB3 A;  1NGA A;  3CQY A;  2FSN A;  4WQ5 C;  5FPM A;  4XH5 A;  5AZI A;  3ATV A;  3I33 A;  3G25 A;  5BR9 A;  2GEM A;  4BRM A;  1BU6 O;  2HMP A;  4QS9 A;  2GWK A;  1GLB G;  3A5O C;  3QFP A;  4I6M A;  4J8F A;  3D2E A;  2WUS A;  4IJN A;  3H3O B;  3IDH A;  4BR0 A;  3GE1 A;  1YUW A;  3VGL A;  2QWN A;  4BGA A;  5FPN A;  5LJV A;  4BRF A;  2QWM A;  4CBX A;  1NGH A;  3EN9 A;  3AAP A;  3VOV A;  2P9S B;  2E20 A;  1JCE A;  2AA4 A;  3AY9 A;  2NZT A;  4BVP A;  1LOT B;  2E8A A;  1NM1 A;  2V52 B;  4BQZ A;  2ASO A;  3VEV A;  4B1X B;  1BA1 A;  3ENO A;  3WXL A;  5LJW A;  2E2O A;  4BC2 A;  4GNI A;  4K41 A;  2ZGY A;  1ZC6 A;  5AQH A;  5ELZ A;  1V4T A;  4FPA A;  3UKR A;  4EAH D;  3HTV A;  3A0I X;  4RTF D;  1S3X A;  4B1Z A;  1GLF O;  4MLH A;  2YHY A;  4FWO A;  4O5F A;  1ESV A;  1IJJ A;  5BN9 A;  1JCF A;  2H3G X;  5AQJ A;  4FWL A;  1GLL O;  4BRL A;  3AAR A;  3LDN A;  3LL3 A;  4EFH A;  1NBW A;  1BO5 O;  4BRN A;  2GTD A;  3DXM A;  1LCU A;  2PAV A;  3CJC A;  5AQQ A;  5BPM A;  1BUP A;  1U2V B;  2GEL A;  3VF6 A;  2CH6 A;  4H5N A;  3WQU A;  2D1K A;  4MLE A;  3CI5 A;  4IWV A;  4CBW A;  5F0X A;  4JHD B;  5AQO A;  5AQT A;  3ULE A;  4AM7 A;  4CBU A;  3VES A;  4EHU A;  3P4I A;  2E88 A;  1DEJ A;  3MN5 A;  5AFU A;  3MN6 A;  4IXC A;  4BR7 A;  2FF6 A;  3GG4 A;  2ITM A;  2Q97 A;  3VEN A;  3EKU A;  5JIC A;  4BG9 A;  5KQ8 A;  4K25 A;  4BVO A;  4M7Y A;  4WYB A;  5JMV A;  3VEY A;  3MN9 A;  4A2A A;  2UYT A;  1T6C A;  3O80 A;  4C23 A;  4WQ5 A;  5ADX A;  3B8A X;  3DWL A;  5AQI A;  4XEI A;  2FSJ A;  2VYP A;  3ZEU A;  5JLH A;  3CET A;  1KAX A;  1NGC A;  1IG8 A;  2P9K B;  5EX5 A;  4GY2 B;  5AFU H;  3H1V X;  5AZJ B;  3WXK A;  2IVN A;  4MO5 A;  4A61 A;  4QS8 A;  2P9U B;  3BF3 A;  3H46 O;  2Q31 A;  4NO7 A;  1MWM A;  1TUY A;  3WQT A;  3H1Q A;  3DXK B;  4MO4 A;  3L0Q A; 
#chains in the Genus database with same CATH topology
 3O08 A;  1RNH A;  2F4V K;  2D5R A;  3OA9 A;  3LP2 A;  1C0M A;  4GV9 A;  1E4F T;  4RW8 A;  3LM2 A;  2G8V A;  4LC9 B;  3GOI A;  2YV0 X;  3U9D A;  3SQ2 A;  1BQN A;  2QW9 A;  2P9L A;  1U49 A;  1T44 A;  3C0B A;  3C7N A;  2B4J A;  3EKS A;  3V9X A;  4OGE A;  4EZ6 A;  3DAW A;  2KKZ A;  1LAV A;  2Q0R A;  1ZXO A;  1IG9 A;  3WXM B;  1TAQ A;  4KHW A;  2QKK A;  4KHU A;  2IC3 A;  3TAF A;  1HNX K;  4O5B A;  1JXB A;  4CJ3 A;  3NGZ A;  1EXQ A;  3RMC A;  4ISF A;  1ATN A;  3AVA A;  2QA4 N;  1N33 K;  3M8S A;  1L3S A;  2ZM6 K;  1X9J A;  1I3A A;  1OH7 A;  2QXF A;  2E1Y A;  4N76 A;  3CCS N;  3SUQ A;  4JKF A;  2FSK A;  2F96 A;  4N41 A;  1D9D A;  3D6R A;  4QS7 A;  4BE2 A;  3LDS A;  5GIO A;  2P5O A;  3LAM A;  4XH1 A;  4CFB A;  1VQ9 N;  3HP9 A;  4IOA L;  3I8B A;  3KK7 A;  2IIR A;  2HVI A;  1VQ7 N;  1YF5 L;  1TKZ A;  1JLG A;  4JKA A;  4FPB A;  4YDU A;  4O0J A;  1VQM N;  5TKY A;  3QEP A;  4IZ9 A;  3QIO A;  1TK8 A;  2J4R A;  4DSK A;  3VQ7 A;  3QER A;  3E9P A;  3P38 A;  3ZSQ A;  4YHH K;  3S3M A;  1V4S A;  3L3V A;  2FXU A;  3NH1 A;  4J2D A;  3MN7 A;  4DCH A;  1YJ9 N;  3I8D A;  3QNO A;  2HHT A;  3K5M A;  3QB0 A;  1WBD A;  4H4M A;  1WSJ A;  4B9L A;  3TI0 A;  3R6M A;  1C0U A;  2HB5 A;  2AJQ A;  3HJF A;  4YDU C;  4YOR A;  4B1V A;  3AVC A;  2ZJP L;  4CJU A;  3TAN A;  2YHW A;  4L3Q A;  2UXC K;  4V19 S;  4DS5 A;  1ILY A;  1HPM A;  1KVB A;  4RW4 A;  3KK1 A;  4DFM A;  1VSH A;  5I3U A;  1KD1 O;  3B6O A;  4EIA A;  3ZT1 A;  2W41 A;  4O55 A;  1VQ5 N;  4FJL A;  4DV7 K;  1GLA G;  4H5V A;  3NH0 A;  5BRF A;  4DTO A;  1QTM A;  3CJB A;  4J2A A;  4MFB A;  5EXW A;  1RDU A;  3SJJ A;  1U04 A;  2OCE A;  3FR0 A;  4PQU A;  4FWK A;  4RCH A;  2B5J A;  5I42 A;  1T8E A;  3M3Z A;  1MDU B;  3CCQ N;  4E19 A;  5HOO A;  4M3X A;  5B8H A;  2VG5 A;  4JI5 K;  1SAZ A;  3MWP A;  4E7L A;  2P9K A;  5KPR A;  3VER A;  3LWM A;  1IBL K;  4O8K A;  4IDK A;  4CI6 A;  3FGU A;  3VEZ A;  4HCB A;  2P9U A;  2UUC K;  5AQU A;  4GW6 A;  2FBY A;  3KK3 A;  2JWK A;  1IBM K;  4CZH A;  3MXI A;  1YIJ N;  4BRP A;  3QBW A;  5C24 A;  1RDW X;  3QNN A;  3R1X A;  1U6Z A;  5J2N A;  3FZM A;  1ZBF A;  4H5T A;  4JKG B;  3OYN A;  3UB5 A;  1OH5 A;  3AO1 A;  2A40 A;  3VGK A;  4B9Q A;  5EY4 A;  3BP8 A;  4KBO A;  2UUA K;  3RTV A;  3DRS A;  4PKH A;  2KFZ A;  5KGX A;  4PL8 A;  4BE0 A;  1KFS A;  4NCA A;  3LM9 A;  4F2S A;  4DQR A;  4CJV A;  1OH6 A;  1RBU A;  3ENH A;  1R59 O;  4ILG B;  1OVY A;  4K8X A;  4F3T A;  2P1J A;  2YHX A;  4Q5V A;  4A5A A;  3VQE A;  5JLF A;  3ULE B;  2O8D B;  3HSC A;  4H5W A;  1DT9 A;  5C0Y A;  2LSN A;  1SS6 A;  2YCH A;  1TGO A;  2IS3 A;  3VEX A;  3K9K A;  3VEW A;  1S22 A;  4IFV A;  5AQV A;  1VQP N;  3HVR A;  4YFU A;  1CXU A;  4KO0 A;  4PHT X;  3ID6 A;  4HUF A;  3CG7 A;  3B6P A;  4E7K A;  2QEX N;  3LDL A;  4QCL A;  2WFB A;  1J5E K;  4CJT A;  3KHY A;  1RT2 A;  4NYN A;  3WUH A;  4FZZ A;  4DFJ A;  3VGM A;  1A5V A;  4PY5 A;  4W5T A;  2P9N A;  2A6A A;  4B3S K;  1NGD A;  1HKC A;  4IO8 A;  1ZBU A;  5AQF A;  1O1W A;  1OKJ A;  3QFU A;  3H6E A;  3ZLJ A;  2YNF A;  3NGI A;  4IKF A;  3VA0 A;  4GVE A;  5HP1 A;  2GUI A;  4FWP A;  3A5L C;  4N5S A;  3ULD A;  2P9I B;  1TYQ B;  3HM8 A;  4QOZ B;  3M5R A;  4BGB A;  4M3Y A;  2VGN A;  4I9Q A;  5IT9 O;  1WSF A;  2HBJ A;  1IH7 A;  4CJL A;  4R5P A;  4H0X B;  1Q9Y A;  3AGR A;  2XY6 A;  1RTH A;  2P9P A;  3IMX A;  5E41 A;  2VQF K;  1D5A A;  3HL8 A;  2DTU A;  2IGI A;  4H0O A;  3QO9 A;  5C12 A;  4LFB K;  3BUZ B;  4M7X A;  4CEE A;  4DLE A;  4LF4 K;  3LPU A;  3CFP A;  3FLC O;  1QS4 A;  3ATU A;  4DKW A;  1KAY A;  4DR3 K;  1NGA A;  5FPM A;  5AZI A;  4JLH A;  3IKM A;  2E6L A;  5HBM A;  2GWK A;  1S6Q A;  4DV5 K;  3TAR A;  5D3G A;  3QFP A;  3SV4 A;  1VQ4 N;  3H3O B;  4CEZ A;  4BR0 A;  3CCV N;  1T03 A;  3THV A;  2D0C A;  4BGA A;  4FJI A;  5LJV A;  4BRF A;  5C2F A;  3DOL A;  3VOV A;  1JCE A;  4CJP A;  4F4K A;  3VQA A;  1M90 O;  5CYM A;  4B1X B;  3V9S A;  2X6N A;  4KI4 A;  3WXL A;  1WNS A;  2E2O A;  4BC2 A;  1RT1 A;  4GNI A;  1KQS M;  4K41 A;  4FM2 A;  5AQH A;  3D0P A;  1J53 A;  3UKR A;  4EAH D;  4RTF D;  1S3X A;  3SNN A;  4MLH A;  3AO5 A;  1RTI A;  4LY7 A;  4AHU A;  1VQN N;  2HBM A;  4O5F A;  3CPW M;  3T1H K;  3PUF A;  4M41 A;  1NKE A;  3SBT A;  5M1K A;  4NCB A;  3NF8 A;  3NF7 A;  4FWL A;  3K9J A;  1YVU A;  3DLG A;  1GLL O;  4DS4 A;  4DSF A;  3LL3 A;  3TSQ A;  1S1V A;  4R79 A;  1BO5 O;  1VSM A;  3ZSR A;  1C1B A;  5K14 A;  4GMJ B;  3DXM A;  5H1S Q;  1MU2 A;  2Z1I A;  5AQQ A;  2GEL A;  4H5N A;  4MLE A;  1X1P A;  2RHK A;  4B9M A;  4DMN A;  1VSD A;  5M1P A;  4M3U A;  2KZM A;  1DEJ A;  4I2P A;  3HYF A;  4FVM A;  4BR7 A;  4K8Z A;  4FJN A;  3EKU A;  2X74 A;  4CK1 A;  1VQL N;  4X62 K;  4M7Y A;  2PYL A;  1BIS A;  4DSE A;  2HHX A;  3SAG A;  3OYH A;  3MN9 A;  3OYA A;  5FRM A;  3SPZ A;  4FCY A;  3SPY A;  4FW2 A;  4FLZ A;  4CHY A;  5JVG L;  4JI2 K;  4XEI A;  1U45 A;  3KK2 A;  3ZEU A;  3CET A;  4U7B A;  4CGD A;  3OS1 A;  1NGC A;  3ZT2 A;  1IG8 A;  3SQ1 A;  5AFU H;  2UU9 K;  2IVN A;  4O8U A;  4KAZ A;  1L5U A;  4A61 A;  3KLF A;  3BF3 A;  3H46 O;  5GIN A;  2E5L K;  3NHG A;  3P83 D;  3VTI A;  1MWM A;  2GX9 A;  1HQU A;  3Q7C A;  3J81 O;  3H1Q A;  1J9A A;  1GOB A;  3THY B;  1ASU A;  3LDQ A;  4LF5 K;  3UKU B;  3BEX A;  4F8R A;  2F9T A;  3S3O A;  2QWP A;  3W0L A;  3L6Q A;  4E7H A;  4DTN A;  5ADX H;  3O3G A;  1P8Z A;  3IG1 A;  4PKI A;  4NB4 A;  3BDP A;  2YKM A;  4CHP A;  3AVK A;  3WEE B;  4CFC A;  3LWL A;  3RMB A;  3A5M C;  4FWR A;  3PO5 A;  1NK9 A;  3NFA A;  1SL0 A;  5AQG A;  5AQM A;  5GAE P;  4DTU A;  4B9S A;  4FM0 A;  3ZET B;  4KRF A;  2EWS A;  3TPQ A;  3RMD A;  2YJF A;  3K2P A;  2NUB A;  3MEE A;  4Z4I A;  3JXU A;  4MDA A;  1K8A O;  3G4S N;  4KH6 A;  3J7A P;  4HHT A;  3T1A A;  3HXM A;  4CJF A;  4FJ7 A;  1YI2 N;  1QQN A;  4DTR A;  2JWL A;  2G8W A;  3WEE A;  4BC5 A;  4C8M A;  4BRI A;  5HRR A;  1BG3 A;  1GLD G;  4CF2 A;  4IG0 A;  4CES A;  4E1N A;  3VQD A;  3QEI A;  5GAD P;  4AHS A;  2ZWH A;  1KVA A;  2OTJ N;  2HNY A;  4OPA A;  2Q0U A;  2ASP A;  5AQN A;  4KV8 A;  3ZSO A;  2ZJQ L;  1Q82 O;  2GUP A;  5KQD A;  1Z05 A;  1R0A A;  3AA5 X;  3AAQ A;  4B9V A;  4ZHR A;  1K6Y A;  4HTU A;  4H0V B;  2AP1 A;  2A3Z A;  4X65 K;  1XMO K;  3A8Y A;  4FWS A;  1RDB A;  1EKE A;  1NK5 A;  1BDG A;  3CCL N;  2QTD A;  1MWK A;  3QIN A;  3R8E A;  3MX5 A;  1NJW A;  3WXJ A;  4KHP K;  3O3H A;  5AQK A;  2BE2 A;  3AO2 A;  3EZW A;  4EHT A;  1O13 A;  2NRR A;  5F2R A;  2O8C A;  4KRE A;  1UAX A;  4CZI A;  4YOT A;  3LDP A;  3O1B A;  3PO4 A;  5CR4 A;  4J2E A;  2FLO A;  4WE1 A;  4DR1 K;  3CFO A;  1U2V A;  1GLE G;  2KHO A;  3OS0 A;  3SI6 A;  3CC2 N;  1RBT A;  3F9M A;  4ISG A;  1YVN A;  4BY9 C;  5DM6 L;  4FJM A;  3E01 A;  4JAX A;  3PIO L;  3VN5 A;  4OVL A;  4YOW A;  4CGF A;  1JLF A;  1EO1 A;  4H0T B;  4RW6 A;  2PYJ A;  2YHB A;  3ZX0 A;  2HMI A;  4CHQ A;  1IKX A;  1BCO A;  2O8B A;  3NH2 A;  4I6M B;  3S9H A;  4DQI A;  4KTQ A;  4A5B A;  4B9N A;  3FZL A;  3QLH A;  4JN4 A;  3THW B;  2JLE A;  4ELT A;  1BHL A;  1HJO A;  4FVU A;  1W97 L;  2XY7 A;  4DV0 K;  4GKJ K;  4BR2 A;  1HUX A;  4JKH A;  4BRK A;  4FLW A;  1DTQ A;  1HLU A;  3V1Q A;  2WTU A;  2ASM A;  3DRR A;  4AQY K;  3HI0 A;  4B8A B;  2G8I A;  2PBD A;  1N36 K;  2BGG A;  1K73 O;  1ASW A;  4DG1 A;  1YIT N;  4LF8 K;  3WT0 A;  3SBG A;  1UA0 A;  2HHU A;  4E1J A;  3D45 A;  4CF9 A;  1TKT A;  4C8N A;  2HNZ A;  4FW1 A;  1KCF A;  2I7N A;  2G8U A;  2D4W A;  3O4N A;  4AH9 A;  1D9F A;  4B9T A;  4LH5 A;  4KTW A;  3F5T A;  2BH1 A;  3MK6 A;  1HYV A;  3I0R A;  3FFI A;  1F21 A;  3SYZ A;  3WXI A;  2Z1H A;  1BWF O;  2A5X A;  4E7J A;  1JLE A;  1H1V A;  5I9E B;  4FK4 A;  3DLE A;  5CZ2 A;  3F9K A;  1NJZ A;  3OYG A;  3RVC A;  3KVG A;  1Y64 A;  3NAE A;  3CCM N;  2I7P A;  2CGK A;  2KLA A;  3L2W A;  1XNQ K;  3VQP A;  4U67 L;  3OY9 A;  1VAZ A;  4FWQ A;  3CHW A;  4JYA K;  3O9S A;  1Q18 A;  4PA1 A;  3VET A;  3S3N A;  2G8H A;  4IBN A;  4Z4C A;  2I5J A;  2G8K A;  1NGG A;  3EYZ A;  4IJA A;  2F8S A;  2W42 A;  2QM1 A;  3U6F A;  1SZ2 A;  3V1O A;  5BRD A;  3OVN A;  1XI1 A;  4KI6 A;  2CH5 A;  3FZH A;  1QVF M;  2RN2 A;  5J2P A;  3CM5 A;  1NLV A;  4BQL A;  4DV3 K;  4DV4 K;  4CJS A;  2QWO A;  1LAW A;  4LSL A;  1L3U A;  3EEQ A;  1C0F A;  2IVP A;  3VPZ A;  1VQO N;  1SL2 A;  4H4O A;  4FJH A;  2HHV A;  2KZZ A;  2X6S A;  3SUP A;  1JL1 A;  1TKD A;  4BC3 A;  4Z0U A;  1A5W A;  3THX B;  3HO1 A;  1NK7 A;  1G99 A;  4M63 C;  4DTX A;  5AQP A;  3ID8 A;  1Z25 A;  1WSH A;  3TAP A;  3CCE N;  4KB0 A;  3AA3 A;  1HQE A;  1MA9 B;  4KTZ A;  2UXB K;  4IEI A;  5AJ3 K;  3ISN C;  1JCG A;  4W5O A;  4I2Q A;  4CGG A;  1RCH A;  2HHH K;  3M1F A;  2E1Z A;  3OYK A;  4CCH A;  4Z94 A;  3TAQ A;  3LP0 A;  3L4Q A;  3ATV A;  3I33 A;  2HBK A;  2XRI A;  3G25 A;  5BR9 A;  4ILJ A;  3F73 A;  1N5Y A;  3PX6 A;  2O4I A;  1GLB G;  3L2R A;  4I7F A;  4LF9 K;  4J8F A;  4JI3 K;  5GAG P;  3WNF A;  1X9S A;  2G8F A;  1YUW A;  4WFN L;  4EP4 A;  5FPN A;  1UOC A;  3ZYY X;  2QWM A;  3G6E N;  1HYZ A;  2PFU A;  4F2R A;  3OYM A;  3AAP A;  2P9S B;  3JAM O;  3AY9 A;  2VG6 A;  2V52 B;  4BQZ A;  3V6D A;  2HHW A;  3ENO A;  4FYD A;  4LD0 A;  2ZGY A;  1ZC6 A;  3OYB A;  4CK2 A;  3TWH A;  3RRH A;  5M1F A;  1HNI A;  3OYE A;  4DTS A;  3A0I X;  4B1Z A;  4WFA L;  1ZBH A;  1ZBI A;  4AHR A;  2YHY A;  4OPK A;  1QE1 A;  3T1Y K;  3KLE A;  2HST A;  4DV2 K;  3QEW A;  4FJK A;  5FDL A;  3K5N A;  1JCF A;  2H3G X;  3BGR A;  4JKG A;  2QI2 A;  1LWE A;  1BIU A;  4M45 A;  4EFH A;  1NBW A;  3OTO K;  2IDO A;  4FJJ A;  2NRZ A;  3UIQ A;  1LCU A;  5HL7 L;  3AVB A;  4M3R A;  1BUP A;  1U48 A;  2QK9 A;  3VF6 A;  2CH6 A;  3JYT A;  3K5L A;  4DFP A;  3CI5 A;  4Z4E A;  4IWV A;  4CBW A;  4CIE A;  4JHD B;  5AQO A;  5F0X A;  1JKH A;  3MEG A;  1RDC A;  4CIF A;  3ULE A;  1L3T A;  4GV3 A;  3VES A;  2O8D A;  4IOX A;  1W7A A;  3MN5 A;  5AFU A;  3V4I A;  3HOS A;  1NOY A;  2FF6 A;  4M3W A;  2NRT A;  3GG4 A;  5DK5 A;  1K9M O;  5KRT A;  5JIC A;  2GV9 A;  2OPP A;  4BG9 A;  5KQ8 A;  4K25 A;  3V9W A;  1B9F A;  3VEY A;  4AHC A;  2ZD1 A;  2WOM A;  4A2A A;  4CGI A;  4W5Q A;  3KLH A;  1VSF A;  5FLX O;  3PIP L;  4AF1 A;  3DM2 A;  5ADX A;  3PX4 A;  3DWL A;  3ENB A;  1Q7Y O;  4IFE A;  2FSJ A;  4IFY A;  1FKP A;  5EX5 A;  4LH4 A;  4GY2 B;  2X78 A;  4Z4G A;  3C6U A;  5AZJ B;  3AVM A;  4MO5 A;  2XO7 A;  4UY8 O;  3DI6 A;  4JS5 A;  1RT4 A;  1W9H A;  1NJX A;  4RG8 A;  1TUY A;  1D8Y A;  1LW0 A;  3DXK B;  5LY3 A;  3HVT A;  4O0I A;  4FJG A;  2YI1 A;  3SUO A;  3O9T A;  2P9I A;  1TYQ A;  3P39 A;  3M8P A;  4M42 A;  3SV3 A;  3EL2 A;  1IKV A;  1QZ5 A;  1HMV A;  3IFR A;  5LMU K;  4A2B A;  1EWR A;  4DR7 K;  1HKG A;  4BRO A;  4HWI A;  4Y0W A;  3OYI A;  3NMU A;  1ZYQ A;  5KPT A;  3TAG A;  1NNE A;  2O8F B;  3HOT A;  1JL2 A;  3TAB A;  2CGL A;  1SL1 A;  3MAQ A;  1Z6R A;  2FBV A;  3RMA A;  3QIC A;  1K8K B;  3DJC A;  4W5N A;  2OPQ A;  4CJE A;  3AVH A;  5AR0 A;  3T7Z A;  2BAN A;  1RT3 A;  5BRH A;  1KAZ A;  3ZT0 A;  1QQO A;  4BR5 A;  4JD2 B;  4CJW A;  4H03 B;  5C15 A;  4BRA A;  3QBX A;  3PX0 A;  1S6P A;  3DLL L;  1CZA N;  1YJN N;  2IVO A;  2HHQ A;  5LL6 Z;  1W2B M;  1JLC A;  4N56 A;  3K5O A;  1QQM A;  1X9W A;  4H8K A;  3TSU A;  2HOE A;  4HUG A;  2HF4 A;  4G1Q A;  1JXE A;  4FZY A;  4OLA A;  2FBX A;  1HKB A;  4DU3 A;  4DSL A;  3SAH A;  1NGF A;  4CJQ A;  2FF3 B;  4DLG A;  1LWF A;  2A42 A;  1QHA A;  1NGE A;  3L2Q A;  1X3M A;  4FWN A;  1ATS A;  2NNW A;  3UE5 A;  4BRG A;  3RWU A;  4FLU A;  3BZK A;  1X3N A;  1NJI O;  3O8M A;  3VQ6 A;  4BC4 A;  1YAG A;  4B08 A;  3BF1 A;  3K0S A;  3HK2 A;  5DM7 L;  4BRH A;  4B1W B;  1IO2 A;  2O8E B;  1VQK N;  3D2F B;  4CD3 A;  2YNI A;  3O9R A;  3HP6 A;  2E2Q A;  3CQ8 A;  1N6Q A;  1NU0 A;  1NMN A;  4FK0 A;  3M6G A;  1EET A;  3NF9 A;  1T05 A;  4CW7 B;  1EP4 A;  1RBS A;  3R9P A;  4PWD A;  5AQX A;  2OZM A;  4RW9 A;  2RF2 A;  4CEC A;  4OPJ A;  4KHN A;  3HPG A;  3CC7 N;  2WON A;  3CJ1 A;  3T69 A;  4MQ3 A;  3PSF A;  1WOQ A;  4CHN A;  2VQE K;  2F7T A;  4WQ4 A;  5AQS A;  1QQC A;  4AM6 A;  5M1N A;  4K43 A;  4RWT A;  2P5G A;  4CZK A;  3D2E B;  2QXL A;  4DTP A;  4WF9 L;  4H0P A;  2PY5 A;  1QVG M;  4JK7 A;  3CIP A;  1JLB A;  3HPH A;  3OBW A;  1SKS A;  4FZX C;  3SMP A;  5C42 A;  3SCX A;  4WQ4 C;  4BRE A;  1XC3 A;  3K59 A;  1WSE A;  2E2P A;  2ZF5 O;  1C0T A;  4YOX A;  3FZF A;  1WLJ A;  5FPE A;  5HRP A;  3V9Z A;  4EZ9 A;  3ALY A;  3KKR A;  3GBT A;  5BRE A;  3V81 A;  3QEX A;  4CZL A;  4BG8 A;  4CFA A;  3LP3 A;  1FKO A;  1HYS A;  3CJ7 A;  3WNE A;  2YX6 A;  4CJ4 A;  3THY A;  3ZCM A;  3UKU A;  4OKE A;  1RTJ A;  1NKC A;  4Z4H A;  1Q8I A;  1TL1 A;  3O5B A;  3MEC A;  1WB9 A;  4CGJ A;  4BAC A;  2HW3 A;  3ZSX A;  3KD5 E;  4XH4 A;  2W6L A;  4A57 A;  1N32 K;  3L3U A;  4OJR A;  4BRD A;  3V1R A;  3KKS A;  3G0Z A;  4XIU A;  3LDO A;  1EWQ A;  3W3D A;  4ID1 A;  2UXD K;  5AQZ A;  3TTF A;  3U4L A;  1N34 K;  3U3G A;  3RSE B;  3J8A A;  4NLB A;  4DU4 A;  1WAF A;  5JVH L;  3ZET A;  1FW6 A;  3K57 A;  1DGK N;  4JI6 K;  1BA0 A;  4NXM K;  4FM1 A;  2V7Y A;  1NK8 A;  1FK9 A;  4JEP A;  5EVZ A;  4DR2 K;  5JS1 A;  1DKG D;  5HLF A;  3VA3 A;  1VRU A;  3U9Z A;  2DFE A;  5AQR A;  4DV6 K;  4ELU A;  3NCI A;  3OHR A;  4G9Z A;  3VQ9 A;  4CEF A;  3P1G A;  1BI4 B;  3SMS A;  4HTL A;  3RSE A;  4CZJ A;  2FBT A;  4CZE A;  2OAN A;  1VSI A;  3AVJ A;  1GLC G;  3CJA A;  4KKO A;  1NGB A;  5GIP A;  5CYQ A;  1DTT A;  4GV6 A;  4CD1 A;  4B9U A;  2W40 A;  5KGW A;  5BPL A;  2A1S A;  4FJ5 A;  1YXQ A;  1VSJ A;  1QSL A;  1BOT O;  4B3M K;  3CME N;  3MCA B;  3TU5 A;  3SJH A;  3ZSY A;  4IO9 L;  3HBT A;  3H45 C;  2HBL A;  4BWM A;  1ZBL A;  1WBB A;  3I55 N;  2P9L B;  2F9W A;  1YT3 A;  3VEO A;  4HCC A;  1E4G T;  4DQ8 A;  4UQG A;  2HND A;  5M1O A;  1W0H A;  3C7N B;  4BR9 A;  4DUY K;  1LWC A;  3O1W A;  2FC0 A;  4LSN A;  4F9O A;  3L2V A;  4H0Y B;  3ZT3 A;  4B8C A;  3VF2 A;  3SQ4 A;  1RBR A;  3LAL A;  1J6Z A;  1VHX A;  2FSN A;  4WQ5 C;  1CZ9 A;  1I39 A;  3E66 A;  2B6A A;  1XHX A;  4QS9 A;  3A5O C;  4I6M A;  2WUS A;  2ETJ A;  1CLQ A;  3K58 A;  2KW4 A;  3GE1 A;  4CJR A;  2D0A A;  3VGL A;  4FK2 A;  3THW A;  1NGH A;  3EN9 A;  4JRQ A;  4B3R K;  2AA4 A;  4CF0 A;  3AVI A;  2NZT A;  1LOT B;  2E8A A;  5KTQ A;  1NM1 A;  1KTQ A;  2ASO A;  3EE9 A;  4KFB A;  3VEV A;  2RKI A;  1BA1 A;  1CXQ A;  4C1N I;  1XNR K;  3VQ8 A;  5LJW A;  3PV8 A;  4DTJ A;  1VQ6 N;  1VQ8 N;  4B3O A;  3OYD A;  1V4T A;  4FPA A;  4CHZ A;  3EZ5 A;  3ZSV A;  3CD6 N;  3HTV A;  4BDY A;  3P5J A;  3IAY A;  1S9E A;  4KHQ A;  3LPT A;  4FWO A;  1A5X A;  2O4G A;  4JS4 A;  1IJJ A;  5BN9 A;  4JI4 K;  3R3L A;  3E1Y A;  4DQQ A;  4ICL A;  4L8R B;  3OJU A;  1BCM A;  3MX2 A;  4BRL A;  3AAR A;  3LDN A;  4BRN A;  1LW2 A;  2GTD A;  4JI8 K;  2PAV A;  3CJC A;  5BPM A;  3OYJ A;  2Z1J A;  3WQU A;  3VQC A;  2BDP A;  2PZS A;  3OBY A;  4CED A;  4DSJ A;  2Z1G A;  4AM7 A;  1NK6 A;  4CF8 A;  3P4I A;  1VSK A;  3EY1 A;  5J1E A;  4BE1 A;  4ZTJ A;  3E9L A;  3G10 A;  1BIZ A;  3MED A;  3MN6 A;  1Z26 A;  1TKX A;  3NBP A;  1REV A;  4IEE A;  2Q97 A;  2WC9 A;  3VEN A;  3HPO A;  1YTU A;  1KLN A;  5SZT A;  1S72 N;  5FRN A;  5JMV A;  2UYT A;  3VQB A;  1T6C A;  4YNQ A;  3O9Q A;  3O80 A;  4YOV A;  3AV9 A;  4C23 A;  1IKY A;  3V9U A;  4E0D A;  1XWL A;  1TK0 A;  3CCJ N;  1ASV A;  2VGM A;  3DOK A;  2XY5 A;  2OA8 A;  1G15 A;  4CJK A;  2P9K B;  4CEO A;  4DV1 K;  2YNH A;  3HRG A;  3WXK A;  4LF7 K;  5MLC Q;  4QS8 A;  2P9U B;  3DLR A;  5KRS A;  4NO7 A;  3KLG A;  1UWB A;  1VK0 A;  1GOA A;  1U4B A;  1WSI A;  3M8R A;  3LAN A;  3L0Q A;  1S9G A;  1GOC A;  3WNG A;  3BY5 A;  2DFH A;  1SV5 A;  2Y1I A;  1JLQ A;  3A2F A;  3GL1 A;  1QHT A;  3O3F A;  4IOC L;  3TR8 A;  4KPY A;  4JKB A;  5HRO A;  3THX A;  3PSI A;  4FOI A;  4ELV A;  1HNW K;  4LFC K;  4B1Y B;  3WNH A;  4DR5 K;  2NRH A;  3CJ9 A;  3AVL A;  1NG9 A;  4FOE A;  4NLC A;  2NRX A;  3TTD A;  3AVG A;  2D0B A;  3CPE A;  3NGY A;  3NDK A;  2Y1J A;  4FLV A;  3KD1 E;  4FJ9 A;  1IKW A;  4OX9 K;  3KZB A;  1I94 K;  3S41 A;  2XY8 A;  3KJV A;  3M8Q A;  1FXX A;  1SKW A;  1BGX T;  2EHG A;  5KI6 A;  3OYF A;  4K0K K;  3U8X A;  3ZSW A;  4W5R A;  4Z4F A;  4DTM A;  2VWB A;  4JI7 K;  1NWK A;  3QDK A;  3LZI A;  4X64 K;  1GLJ O;  1NJY A;  1S1T A;  4JV5 K;  5IWA K;  1UA1 A;  3L4I A;  2YKN A;  3FE1 A;  1Y97 A;  3ITH A;  4AIL C;  1WAJ A;  4DSI A;  4DR6 K;  4DU1 A;  1TL3 A;  1X9M A;  2BUP A;  1T7P A;  2P9S A;  4GVM A;  1RFQ A;  3C6A A;  3O6W A;  3JS6 A;  2P9N B;  4OKJ A;  1XHZ A;  1S1X A;  3ZT4 A;  4FWM A;  4IDH A;  1XQS C;  2Q36 A;  1WN7 A;  4JKC A;  4DUZ K;  5E84 A;  3A5N C;  2Q1N A;  2V7Z A;  2OPR A;  5BN8 A;  3VQQ A;  4M3Z A;  5AQY A;  3AGK A;  3FFK B;  4HUE A;  4B3T K;  1NK0 A;  4A62 A;  1KC8 O;  1RT5 A;  2HF3 A;  2RE2 A;  4JK8 A;  5TKW A;  5T7B A;  3D7E O;  1NMD A;  3KWG A;  2XHB A;  4E89 A;  1HR0 K;  3H08 A;  3J7Z O;  4BRQ A;  4DQS A;  5CY4 A;  5J2Q A;  1EX4 A;  2P9P B;  1U47 A;  4C8L A;  4Q0B A;  1NGJ A;  4BR4 A;  3T3F A;  5CZ1 A;  4CZG A;  4M3T A;  4CJ7 A;  1C1A A;  3TAE A;  4JHD A;  3VF4 A;  2NRW A;  3ZX2 A;  2QWQ A;  1QSS A;  1CZB A;  3AO3 A;  4CEQ A;  4DWI A;  4QAG A;  4EP5 A;  5AZI B;  1IV0 A;  4BDP A;  3SAF A;  2NRV A;  5HRS A;  3QML A;  4CK3 A;  3SK3 A;  3L2U A;  2E6M A;  4BDZ A;  3DLB A;  3HST B;  1TUU A;  2CGJ A;  4OO1 J;  1NGI A;  1IBK K;  3AA4 A;  4CGH A;  1JJ2 M;  4ISE A;  4CVN E;  2HHS A;  1SQK A;  1RGI A;  4O44 A;  1HX1 A;  3KIO A;  5DMR A;  4ZTF A;  1C0G A;  2DFF A;  2YJE A;  4JKE A;  2GWJ A;  3OS2 A;  1XUP O;  4E3S A;  1ATR A;  1QSY A;  5AZJ A;  2BTF A;  3VQ4 A;  4C8K A;  3QEV A;  4C8O A;  4YY3 K;  2QWR A;  2GBZ A;  4FSV A;  1S1W A;  3UKR B;  5CHI A;  2ATQ A;  5EOY A;  4Y1D A;  1YHQ N;  2IOC A;  3DXK A;  1TV6 A;  5M1Q A;  1ZBS A;  4CZM A;  3MCP A;  2Q3S A;  3PLA A;  1KFD A;  4NXN K;  2DPN A;  4KHS A;  3RRG A;  3HZ6 A;  1KRP A;  5F1X A;  2DY4 A;  2A1R A;  1YJW N;  3Q7B A;  3CFR A;  5CE3 A;  2D0P A;  3I56 N;  3AA2 A;  3GDQ A;  1T6D A;  4CEA A;  4J2B A;  4OPH A;  5KPZ A;  4FL9 A;  4OGC A;  3DXM B;  4KB1 A;  2O8F A;  4ILH A;  1JLA A;  1QZ6 A;  1TAU A;  3FZK A;  3CQX A;  3MWT A;  3DRP A;  1K8K A;  5AQW A;  3ASM A;  5SWM A;  4CEB A;  3L8B A;  1B9D A;  3JSM A;  3NF6 A;  4MDB A;  5FPD A;  3IUC A;  4K42 A;  4Y1C A;  4CHO A;  3C6H A;  4X66 K;  3H3N O;  1EQY A;  4CF1 A;  4PL7 A;  1SKR A;  5FRO A;  4DQP A;  5C25 A;  4JD2 A;  1KXP A;  2ZE2 A;  3CM6 A;  1D4X A;  4RW7 A;  4FLY A;  2VG7 A;  2EX3 A;  4JNE A;  1S5J A;  3C95 A;  3CER A;  4NCG A;  4IG3 A;  3N4Q A;  4KH4 A;  4CZF A;  4TSX A;  5C10 A;  1Q81 O;  5AQL A;  3BZC A;  4FO0 A;  1C6V A;  4PUO A;  5J2M A;  4DHY A;  4DFK A;  5E26 A;  3OW2 M;  3HT3 A;  4CE9 A;  2KFN A;  5BPN A;  3J7Y P;  4JKD A;  4JRP A;  3ZEU B;  3RR8 A;  4DF4 A;  2Q2R A;  2D0O A;  1ITG A;  3LZJ A;  4FLX A;  3OYC A;  3P31 A;  3CMA N;  1BL3 A;  3HM9 A;  2R7Y A;  2NLX A;  1WUA A;  2QKB A;  2V51 B;  3SZ2 A;  2F8T A;  2E2N A;  2W6K A;  3ZX3 A;  1RTD A;  1J54 A;  1Q9X A;  2QWL A;  3E9O A;  1RT6 A;  3CYM A;  3TTC A;  1RIL A;  2OZS A;  4LFA K;  1C1C A;  4E1M A;  1XC9 A;  1NOZ A;  1KSP A;  2O8E A;  3DMJ A;  3D2F A;  4FJ8 A;  1HNZ K;  4BRC A;  4N47 A;  3NVM A;  1T3V A;  2A41 A;  2VCP A;  5JS2 A;  3SLC A;  4AHT A;  4FLT A;  2ZJR L;  3MXM A;  3N4P A;  3J80 O;  4NYF A;  1L3V A;  3QET A;  2KTQ A;  1KVC A;  4PKG A;  3VQ5 A;  3LP1 A;  4CFD A;  3O4W A;  3O9U A;  4A59 A;  3MDQ A;  2UUB K;  3EO3 A;  3KTQ A;  1J5O A;  4H5R A;  3MMV A;  3OJS A;  1M1K O;  3MXJ A;  1P90 A;  4CER A;  4B1U B;  3CCR N;  4FJX A;  1E3M A;  2YHA A;  3TAM A;  2IAJ A;  1XMQ K;  3C6T A;  2ZGZ A;  4DB3 A;  3CQY A;  4XH5 A;  3RR7 A;  4OKK A;  2GEM A;  4BRM A;  3SUN A;  1BU6 O;  2HMP A;  3SQ0 A;  4KHY A;  3DLK A;  3D2E A;  4IJN A;  1HPZ A;  3IDH A;  2JGU A;  3DLH A;  4YOY A;  2QWN A;  4LF6 K;  2E4L A;  2ZQB A;  4CBX A;  3IRX A;  2E20 A;  4JK9 A;  3CF5 L;  1Q86 O;  4CIG A;  3CC4 N;  4BVP A;  4I9L A;  3NE6 A;  4WFB L;  4JI0 K;  3AO4 A;  4AHV A;  4DR4 K;  3OYL A;  3G71 N;  5ELZ A;  1VSE A;  3C65 A;  4BWJ A;  5C2D A;  4FXD A;  5HRN A;  5LMN K;  3I0S A;  1FJG K;  1GLF O;  1RDA A;  2HVH A;  3TSP A;  2YNG A;  1NKB A;  3U3Y A;  4ID5 A;  3VMF B;  3AVF A;  1ESV A;  1OVQ A;  3PY8 A;  3DYA A;  5A2Q O;  2KQ2 A;  5AQJ A;  2O8C B;  3QIP A;  4C1N K;  3QES A;  3KLI A;  1HJR A;  1U2V B;  2RPI A;  4KH5 A;  2D1K A;  1RT7 A;  1VSL A;  2VWJ A;  3F2K A;  5AQT A;  3NVK A;  4CBU A;  1B92 A;  1OH8 A;  4EHU A;  3IS9 A;  1LV5 A;  1YTA A;  5BR8 K;  2E88 A;  2OPS A;  2OTL N;  1NK4 A;  2WBN A;  3VTH A;  3EE8 A;  1RBV A;  4O4G A;  4IXC A;  1S1U A;  2ITM A;  4OLB A;  4F3O A;  4CJ5 A;  1KLM A;  3T19 A;  2O8B B;  3CXC M;  4BVO A;  4WYB A;  2OYQ A;  1RDD A;  1BQM A;  3LAK A;  1SUQ A;  1WSG A;  2VWK A;  3O4Q A;  3KWI A;  2ITG A;  4WQ5 A;  1VRT A;  3CCU N;  5GAH P;  3B8A X;  5AQI A;  1BI4 A;  3ZSZ A;  1TK5 A;  5JLH A;  2VYP A;  1KAX A;  4HVJ A;  1HNV A;  4E7I A;  4DF8 A;  4JI1 K;  3H1V X;  1DLO A;  4WCE L;  1TVR A;  3C94 A;  1HRH A;  4GKK K;  2Q31 A;  2P51 A;  5EU7 A;  4YOU A;  3AVN A;  1N8R O;  3WQT A;  4MO4 A; 
#chains in the Genus database with same CATH homology
 2YI1 A;  3O08 A;  3LDQ A;  3O9T A;  2P9I A;  1TYQ A;  3UKU B;  3BEX A;  3P39 A;  2F9T A;  3GL1 A;  3OA9 A;  4IOC L;  3EL2 A;  2QWP A;  4JKB A;  1QZ5 A;  3W0L A;  3L6Q A;  3IFR A;  4FOI A;  5ADX H;  4A2B A;  4GV9 A;  1P8Z A;  4B1Y B;  1E4F T;  3LM2 A;  1HKG A;  4LC9 B;  4BRO A;  2NRH A;  3GOI A;  4HWI A;  4NB4 A;  3CJ9 A;  4PKI A;  3U9D A;  4Y0W A;  2QW9 A;  2P9L A;  4FOE A;  4NLC A;  2NRX A;  3WEE B;  3TTD A;  3NMU A;  3CPE A;  5KPT A;  3HOT A;  1T44 A;  3A5M C;  3C0B A;  2CGL A;  3C7N A;  3EKS A;  4FWR A;  3KZB A;  1Z6R A;  3QIC A;  1K8K B;  3DAW A;  3S41 A;  2KKZ A;  3DJC A;  5AQG A;  2Q0R A;  5AQM A;  5GAE P;  1ZXO A;  3ZET B;  3U8X A;  3WXM B;  2VWB A;  5AR0 A;  2EWS A;  3TPQ A;  3T7Z A;  2YJF A;  1NWK A;  3QDK A;  1KAZ A;  4BR5 A;  1QQO A;  5BRH A;  1GLJ O;  3JXU A;  4MDA A;  1K8A O;  4JD2 B;  3G4S N;  4KH6 A;  4H03 B;  5C15 A;  4BRA A;  3QBX A;  3L4I A;  3FE1 A;  4ISF A;  3DLL L;  1ATN A;  1CZA N;  1YI2 N;  2QA4 N;  1QQN A;  2IVO A;  1YJN N;  1W2B M;  2JWL A;  3WEE A;  4BC5 A;  1X9J A;  4BRI A;  1BG3 A;  1QQM A;  2BUP A;  1GLD G;  3TSU A;  2E1Y A;  2HOE A;  3CCS N;  2P9S A;  2HF4 A;  1RFQ A;  4JKF A;  5GAD P;  2ZWH A;  2FSK A;  3C6A A;  2OTJ N;  3O6W A;  3JS6 A;  4OPA A;  2P9N B;  2Q0U A;  1HKB A;  2ASP A;  5AQN A;  2ZJQ L;  1Q82 O;  2GUP A;  3D6R A;  3SAH A;  4QS7 A;  1NGF A;  5KQD A;  2FF3 B;  4FWM A;  1Z05 A;  4IDH A;  1XQS C;  5LY3 A;  2Q36 A;  2A42 A;  3AAQ A;  1QHA A;  1NGE A;  4JKC A;  1X3M A;  4FWN A;  5GIO A;  5E84 A;  1ATS A;  3A5N C;  4XH1 A;  2NNW A;  3UE5 A;  2Q1N A;  4BRG A;  4H0V B;  2AP1 A;  2A3Z A;  2V7Z A;  5BN8 A;  3A8Y A;  4FWS A;  1X3N A;  1NJI O;  1BDG A;  1VQ9 N;  3O8M A;  3CCL N;  5AQY A;  3AGK A;  2QTD A;  3FFK B;  1MWK A;  1YAG A;  2IIR A;  3BF1 A;  3I8B A;  3KK7 A;  3MX5 A;  1YF5 L;  3R8E A;  1VQ7 N;  3WXJ A;  4JKA A;  4FPB A;  4A62 A;  5DM7 L;  4BRH A;  1KC8 O;  4B1W B;  2HF3 A;  2RE2 A;  4YDU A;  4JK8 A;  5TKW A;  3D7E O;  5AQK A;  1NMD A;  1VQM N;  5TKY A;  3KWG A;  4IZ9 A;  2J4R A;  3EZW A;  4EHT A;  1O13 A;  2NRR A;  5F2R A;  3E9P A;  3J7Z O;  3P38 A;  1VQK N;  4BRQ A;  3D2F B;  4CD3 A;  1V4S A;  4CZI A;  3O9R A;  2FXU A;  2E2Q A;  4YOT A;  2P9P B;  3LDP A;  3O1B A;  3MN7 A;  5CR4 A;  1NGJ A;  4BR4 A;  2FLO A;  4DCH A;  1YJ9 N;  3M6G A;  4CZG A;  1U2V A;  1GLE G;  2KHO A;  3R9P A;  3QB0 A;  5AQX A;  4CJ7 A;  3CC2 N;  3R6M A;  4JHD A;  3F9M A;  4ISG A;  4YDU C;  4YOR A;  3CC7 N;  4B1V A;  1YVN A;  3CJ1 A;  3VF4 A;  2ZJP L;  3T69 A;  4BY9 C;  2YHW A;  5DM6 L;  1WOQ A;  2NRW A;  4L3Q A;  3ZX2 A;  2QWQ A;  4JAX A;  2F7T A;  4WQ4 A;  3PIO L;  5AQS A;  5AZI B;  1ILY A;  3SAF A;  1HPM A;  2NRV A;  4YOW A;  1EO1 A;  4AM6 A;  4H0T B;  5M1N A;  3QML A;  3SK3 A;  4K43 A;  4RWT A;  1KD1 O;  3ZX0 A;  4EIA A;  1TUU A;  2CGJ A;  2W41 A;  4OO1 J;  4I6M B;  4CZK A;  1NGI A;  1VQ5 N;  3D2E B;  1GLA G;  4H5V A;  4A5B A;  5BRF A;  3CJB A;  3FZL A;  2QXL A;  1JJ2 M;  4ISE A;  4WF9 L;  1SQK A;  1RDU A;  4H0P A;  5EXW A;  1QVG M;  4JK7 A;  4JN4 A;  3CIP A;  3OBW A;  1RGI A;  1HX1 A;  3FR0 A;  3SMP A;  4FWK A;  1C0G A;  4RCH A;  1HJO A;  4WQ4 C;  4BRE A;  1W97 L;  2YJE A;  1XC3 A;  3M3Z A;  1MDU B;  2ZF5 O;  2E2P A;  2GWJ A;  4JKE A;  5HOO A;  4YOX A;  3CCQ N;  3FZF A;  5B8H A;  4BR2 A;  1HUX A;  1XUP O;  4JKH A;  4BRK A;  1SAZ A;  3MWP A;  5FPE A;  2P9K A;  5KPR A;  1HLU A;  3VER A;  1ATR A;  2ASM A;  5AZJ A;  2BTF A;  3GBT A;  4O8K A;  5BRE A;  4CI6 A;  3FGU A;  2QWR A;  3VEZ A;  2P9U A;  4FSV A;  3HI0 A;  4CZL A;  5AQU A;  3UKR B;  4BG8 A;  5CHI A;  2PBD A;  1K73 O;  5EOY A;  1YHQ N;  2JWK A;  3DXK A;  3CJ7 A;  4CZH A;  2YX6 A;  1ZBS A;  5M1Q A;  4CZM A;  3MCP A;  1YIJ N;  3PLA A;  1YIT N;  3UKU A;  4BRP A;  3QBW A;  1RDW X;  3R1X A;  3WT0 A;  1U6Z A;  2DPN A;  3SBG A;  3FZM A;  3HZ6 A;  4H5T A;  4E1J A;  4JKG B;  5F1X A;  3O5B A;  1YJW N;  3UB5 A;  3Q7B A;  5CE3 A;  2D0P A;  3I56 N;  3GDQ A;  2I7N A;  2A40 A;  3VGK A;  4B9Q A;  1T6D A;  5EY4 A;  3BP8 A;  4KBO A;  4XH4 A;  4OPH A;  5KPZ A;  2D4W A;  4A57 A;  4FL9 A;  4PKH A;  3DXM B;  4BRD A;  4PL8 A;  4ILH A;  3F5T A;  2BH1 A;  1QZ6 A;  3LM9 A;  3MK6 A;  3FZK A;  3CQX A;  3LDO A;  3MWT A;  3ENH A;  3W3D A;  1R59 O;  4ILG B;  1BWF O;  1OVY A;  2A5X A;  1K8K A;  3WXI A;  5AQZ A;  3TTF A;  3U4L A;  2YHX A;  4A5A A;  5AQW A;  1H1V A;  5I9E B;  5JLF A;  3ULE B;  3RSE B;  3J8A A;  4NLB A;  3HSC A;  5JVH L;  4H5W A;  4MDB A;  3ZET A;  3RVC A;  3KVG A;  1Y64 A;  1DT9 A;  5FPD A;  3IUC A;  4K42 A;  5C0Y A;  3C6H A;  1SS6 A;  1DGK N;  2YCH A;  3H3N O;  1BA0 A;  1EQY A;  3CCM N;  3VEX A;  4PL7 A;  2I7P A;  3K9K A;  3VEW A;  2V7Y A;  2CGK A;  2KLA A;  4JD2 A;  1KXP A;  1S22 A;  4JEP A;  1D4X A;  5AQV A;  5EVZ A;  4U67 L;  1VQP N;  4JNE A;  1DKG D;  3CER A;  1VAZ A;  4FWQ A;  4PHT X;  3CHW A;  3N4Q A;  3O9S A;  1Q18 A;  4KH4 A;  4CZF A;  3ID6 A;  3U9Z A;  3VET A;  5C10 A;  1Q81 O;  5AQL A;  5AQR A;  4FO0 A;  2QEX N;  3LDL A;  4DHY A;  2WFB A;  5E26 A;  3OW2 M;  1NGG A;  3KHY A;  3OHR A;  4G9Z A;  3WUH A;  5BPN A;  3VGM A;  4IJA A;  2QM1 A;  2P9N A;  4JKD A;  3SMS A;  4HTL A;  3ZEU B;  1SZ2 A;  5BRD A;  3RSE A;  2A6A A;  4CZJ A;  1NGD A;  1HKC A;  2Q2R A;  4IO8 A;  2D0O A;  2CH5 A;  4CZE A;  2OAN A;  3FZH A;  5AQF A;  1QVF M;  1GLC G;  3CJA A;  1OKJ A;  3P31 A;  3CMA N;  3QFU A;  1NGB A;  3H6E A;  1NLV A;  2NLX A;  4BQL A;  5GIP A;  1WUA A;  4GV6 A;  2V51 B;  4CD1 A;  2QWO A;  2E2N A;  2W40 A;  1C0F A;  2IVP A;  4GVE A;  3VPZ A;  3ZX3 A;  5BPL A;  1VQO N;  4FWP A;  3A5L C;  1YXQ A;  2QWL A;  3E9O A;  2P9I B;  1TYQ B;  3HM8 A;  1BOT O;  3TTC A;  3CME N;  3MCA B;  3M5R A;  4BGB A;  3TU5 A;  3SJH A;  2VGN A;  4IO9 L;  4BC3 A;  3HBT A;  2HBJ A;  3H45 C;  4H0X B;  2HBL A;  3D2F A;  1G99 A;  3AGR A;  4BRC A;  4M63 C;  3NVM A;  1T3V A;  5AQP A;  2A41 A;  2VCP A;  2P9P A;  3ID8 A;  3IMX A;  3SLC A;  2ZJR L;  3I55 N;  2P9L B;  3CCE N;  3N4P A;  2F9W A;  3VEO A;  1MA9 B;  1E4G T;  4H0O A;  4IEI A;  4DQ8 A;  4PKG A;  5C12 A;  5M1O A;  3C7N B;  4BR9 A;  3O4W A;  3O9U A;  3O1W A;  3BUZ B;  1JCG A;  3EO3 A;  3MDQ A;  4M7X A;  4A59 A;  4H5R A;  4F9O A;  3MMV A;  1M1K O;  4H0Y B;  1P90 A;  4B1U B;  3M1F A;  3VF2 A;  3CCR N;  2E1Z A;  3FLC O;  3ATU A;  1J6Z A;  4DKW A;  4Z94 A;  1KAY A;  2ZGZ A;  4DB3 A;  1NGA A;  3CQY A;  2FSN A;  3L4Q A;  4WQ5 C;  5FPM A;  4XH5 A;  5AZI A;  3ATV A;  3E66 A;  3I33 A;  2HBK A;  3IKM A;  3G25 A;  5BR9 A;  4ILJ A;  2GEM A;  4BRM A;  1BU6 O;  2HMP A;  4QS9 A;  2GWK A;  1GLB G;  3A5O C;  3QFP A;  4I6M A;  4J8F A;  3D2E A;  2WUS A;  4IJN A;  5GAG P;  1VQ4 N;  3H3O B;  3IDH A;  4BR0 A;  3CCV N;  3GE1 A;  1YUW A;  4YOY A;  3VGL A;  4WFN L;  2QWN A;  4BGA A;  5FPN A;  3ZYY X;  5LJV A;  4BRF A;  2QWM A;  3G6E N;  5C2F A;  4CBX A;  2PFU A;  1NGH A;  3EN9 A;  3AAP A;  3VOV A;  2P9S B;  2E20 A;  4JK9 A;  4IOA L;  3CF5 L;  1JCE A;  2AA4 A;  1Q86 O;  3AY9 A;  2NZT A;  3CC4 N;  4BVP A;  1LOT B;  2E8A A;  4WFB L;  1NM1 A;  2V52 B;  4BQZ A;  1M90 O;  2ASO A;  3EE9 A;  3VEV A;  4B1X B;  1BA1 A;  4C1N I;  3ENO A;  3WXL A;  5LJW A;  2E2O A;  4BC2 A;  1KQS M;  4GNI A;  4K41 A;  2ZGY A;  1VQ6 N;  1ZC6 A;  5AQH A;  3G71 N;  1VQ8 N;  5ELZ A;  1V4T A;  4FPA A;  3C65 A;  3UKR A;  5C2D A;  5M1F A;  4EAH D;  3CD6 N;  3HTV A;  3A0I X;  4RTF D;  1S3X A;  4B1Z A;  4WFA L;  1GLF O;  4MLH A;  2YHY A;  4FWO A;  3TSP A;  1VQN N;  2HBM A;  4O5F A;  3VMF B;  1ESV A;  3CPW M;  1IJJ A;  5BN9 A;  2HST A;  3R3L A;  3E1Y A;  3SBT A;  5M1K A;  1JCF A;  2H3G X;  4JKG A;  2QI2 A;  5AQJ A;  4FWL A;  3K9J A;  4C1N K;  1GLL O;  3MX2 A;  4BRL A;  3AAR A;  3LDN A;  3LL3 A;  3TSQ A;  4EFH A;  1NBW A;  1BO5 O;  4BRN A;  4R79 A;  2NRZ A;  2GTD A;  3DXM A;  1LCU A;  2PAV A;  5HL7 L;  3CJC A;  5AQQ A;  5H1S Q;  5BPM A;  1BUP A;  1U2V B;  2GEL A;  3VF6 A;  2CH6 A;  4H5N A;  4KH5 A;  3WQU A;  2D1K A;  4MLE A;  3CI5 A;  4IWV A;  3OBY A;  2RHK A;  4CBW A;  5F0X A;  3F2K A;  4JHD B;  5AQO A;  5AQT A;  4GV3 A;  3NVK A;  3ULE A;  4AM7 A;  4CBU A;  5M1P A;  3VES A;  4EHU A;  3P4I A;  2E88 A;  2OTL N;  1DEJ A;  4IOX A;  2WBN A;  3MN5 A;  5AFU A;  3VTH A;  3E9L A;  3EE8 A;  3HOS A;  3MN6 A;  4IXC A;  4BR7 A;  2FF6 A;  2NRT A;  3GG4 A;  2ITM A;  4IEE A;  2Q97 A;  2WC9 A;  3VEN A;  1K9M O;  4FVU A;  3EKU A;  5JIC A;  4BG9 A;  5KQ8 A;  4K25 A;  1S72 N;  1VQL N;  3CXC M;  4BVO A;  4M7Y A;  4WYB A;  5JMV A;  3VEY A;  3SAG A;  3MN9 A;  4A2A A;  2UYT A;  1T6C A;  3PIP L;  4AF1 A;  3O9Q A;  3O80 A;  4YOV A;  4C23 A;  3KWI A;  4WQ5 A;  5JVG L;  5ADX A;  3CCU N;  5GAH P;  3B8A X;  4BC4 A;  3DWL A;  3ENB A;  5AQI A;  3CCJ N;  1Q7Y O;  4XEI A;  4IFE A;  2FSJ A;  2VYP A;  3ZEU A;  2VGM A;  3CET A;  5JLH A;  4U7B A;  1KAX A;  1NGC A;  1IG8 A;  2P9K B;  5EX5 A;  4GY2 B;  5AFU H;  3H1V X;  3HRG A;  5AZJ B;  3WXK A;  2IVN A;  4MO5 A;  4O8U A;  4WCE L;  4A61 A;  5MLC Q;  4QS8 A;  2P9U B;  3BF3 A;  4UY8 O;  3H46 O;  5GIN A;  2Q31 A;  4NO7 A;  3VTI A;  1MWM A;  4YOU A;  1N8R O;  2GX9 A;  3Q7C A;  1TUY A;  3WQT A;  3H1Q A;  3DXK B;  4MO4 A;  3L0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...