4BRLA

Legionella pneumophila ntpdase1 crystal form iii (closed) in complex with transition state mimic guanosine 5'-phosphovanadate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
b'TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 120
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brlA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brlA02
1NBWA 3BF3A 3CJ7A 3VERA 5LY3A 4BR4A 3CQYA 5BRFA 2BUPA 3SMSA 4HWIA 4EIAA 5KPTA 2V51B 3BF1A 1OKJA 1P8ZA 1XUPO 4BC5A 4FWRA 2GELA 3IUCA 5AQSA 4BVPA 3WT0A 4DCHA 3IMXA 3I33A 5AQQA 2GWKA 1U2VB 3UKRB 3DJCA 3H6EA 5AQGA 3VETA 2ASOA 3ATVA 3D2EA 3O08A 2ZGZA 4FWKA 1MDUB 2P9UA 2D0PA 2HOEA 3A5OC 1ZXOA 3H1VX 2QWMA 2VCPA 3GBTA 3HTVA 4PKHA 2F9WA 1NGCA 3HSCA 3O80A 4BR2A 2E2OA 4FWLA 4WQ4A 3VPZA 2GEMA 3O4WA 5TKYA 4CZLA 3WUHA 4BRKA 4IO8A 3QICA 2Q1NA 3FGUA 3QMLA 2E1YA 1X3NA 4QS9A 2J4RA 4YDUA 4IXCA 4B1VA 1NLVA 4BQLA 2HF3A 3HM8A 3QB0A 5F2RA 5AQMA 3ZETA 4WQ5A 3FZHA 4L3QA 3BUZB 5AZJA 5AQVA 2V7YA 2WUSA 3HBTA 1D4XA 4Y0WA 1U6ZA 2A40A 4B1YB 2I7NA 4FWPA 1EQYA 5AZIB 2ZGYA 5BPLA 1NGIA 2F9TA 3M1FA 2P9IB 4IJNA 1QQOA 1RDWX 1K8KB 5JICA 4IZ9A 2IVNA 3D7EO 1GLBG 4JN4A 3O6WA 2BTFA 1NWKA 3HZ6A 2Q2RA 4HTLA 3IDHA 4BVOA 1BO5O 4BROA 1TUYA 3FE1A 3JS6A 5AQRA 3QFUA 5E84A 3C7NA 4H5RA 1GLLO 1E4FT 1BDGA 2EWSA 3AAQA 2CGJA 3WEEA 1C0GA 2QM1A 2AA4A 3VOVA 1NGGA 4BRIA 3DXKA 4H0XB 3WQUA 1T44A 4JAXA 4CZJA 4CBXA 2P9SA 5CE3A 1BU6O 4K42A 3MN7A 3H3OB 3MN6A 3DAWA 4CZGA 2CH5A 3ENHA 1BA0A 5JLFA 5BRHA 4JNEA 3D2FB 4Z94A 5JLHA 2P9LB 2P9PB 5ADXH 1X9JA 1KAXA 3CJAA 4C23A 5F0XA 1HKBA 3ZEUA 5AQHA 3WXJA 3QBXA 4B1UB 5BPMA 4CBWA 3H45C 4B1ZA 1GLCG 2QW9A 3DXMB 5AQPA 4FPAA 3MMVA 5FPNA 4PKIA 1BUPA 1ZC6A 3GG4A 4BRHA 1E4GT 4H0VB 2YHYA 4BRMA 1RFQA 1JCEA 3EN9A 5AQJA 3CJ1A 3LL3A 3LDQA 5AQKA 2A3ZA 4BC2A 3FR0A 4BQZA 1BG3A 1MWKA 4XEIA 4H5NA 1SAZA 1ATRA 2AP1A 4BRCA 3VENA 3H3NO 3U8XA 5JMVA 3FZLA 2P9KB 4BG8A 4BRPA 1Y64A 5AQLA 3W0LA 4AM6A 1DGKN 1R59O 3WXKA 2QXLA 5BR9A 4BGAA 1YXQA 2YCHA 4PL8A 1LCUA 2Q36A 4JD2A 1S22A 4FL9A 3CJCA 3CJ9A 1NGBA 1NGFA 4H0YB 4FWMA 2W41A 4XH5A 3MN9A 4DHYA 4M7XA 3B8AX 2Q0UA 3UB5A 3FZKA 5EVZA 2NLXA 4BR5A 4AM7A 3MDQA 2D0OA 3LM2A 1XC3A 1HJOA 3RSEB 4BG9A 3EO3A 3VEZA 1K8KA 1JCFA 3FZFA 5EX5A 3VF2A 2QWOA 3R8EA 2ASPA 1XQSC 1IJJA 2A6AA 1KXPA 4RWTA 3VGKA 4RCHA 5EXWA 5I9EB 3A8YA 3KHYA 1KAYA 4JHDB 3WXLA 3S41A 3QBWA 1SZ2A 2A5XA 3ZX2A 3UKUB 2P9NA 3SLCA 3VEXA 5AQOA 2QWLA 4K43A 3U4LA 5AQNA 4M63C 4K25A 3R6MA 1KAZA 5KPZA 4IJAA 1GLJO 4FSVA 1NGDA 4EHUA 3LDNA 3EL2A 3CETA 4A2AA 2I7PA 4BRQA 4PL7A 4WQ4C 5AQYA 1ATSA 3JXUA 4CD1A 3EZWA 1HKGA 3D2FA 3ZX3A 3BEXA 3D2EB 4CJ7A 5FPEA 5KQ8A 3M6GA 3VGMA 4H5TA 3O5BA 3ULEB 3VF4A 4CBUA 2P9UB 4BRFA 4FWSA 1HKCA 2YI1A 4BC3A 1JCGA 2V52B 4A2BA 4CZHA 5AQWA 4FOIA 5AQFA 1X3MA 3VEVA 5BPNA 1Z05A 2QWQA 4EFHA 3ENOA 1CZAN 4QS8A 5E26A 1TUUA 2E20A 3C0BA 4H0TB 4LC9B 4BR0A 2CGKA 4B1WB 5LJVA 3KZBA 2ZF5O 1GLFO 3L4IA 3CI5A 2E2PA 4H0OA 3SMPA 1TYQB 4MO4A 2FXUA 2A41A 3CIPA 3IFRA 3GDQA 3WXIA 3ZETB 5F1XA 3CQXA 4BC4A 5AZJB 5BN8A 1NMDA 5BREA 1T6CA 1H1VA 2QWPA 5AFUH 2E2QA 1NGHA 4ISEA 3FZMA 3HI0A 1HLUA 1GLAG 4RTFD 4B9QA 3AARA 2ITMA 3MK6A 1U2VA 3UKRA 3J8AA 5FPMA 2YHXA 4A62A 3EKSA 4B1XB 4BGBA 4O5FA 4BRGA 1NGAA 2YHWA 4KBOA 4FWQA 4GY2B 3QDKA 4QS7A 3C7NB 1Q18A 4ISFA 3W3DA 1DEJA 1NM1A 4MO5A 2Q31A 2YJFA 4M7YA 1T6DA 3ZX0A 3TPQA 4FWNA 4FOEA 2NRHA 3WEEB 3KVGA 1DKGD 3CJBA 3VESA 3DXKB 4BRDA 4F9OA 2V7ZA 4IWVA 3ID8A 5FPDA 1NGJA 1SQKA 2E88A 5ADXA 1QQMA 2YJEA 3VEWA 5AFUA 4I6MB 2D4WA 2ASMA 1V4SA 5B8HA 2FLOA 2QWNA 5KQDA 5AQTA 3UE5A 3G25A 3ZEUB 4CZMA 1GLEG 1GLDG 5ELZA 2HF4A 2FF6A 3I8BA 5AZIA 3FFKB 5EY4A 1QZ5A 4MLHA 3GOIA 2P9IA 2FF3B 5LJWA 2QWRA 3A0IX 4WYBA 3AY9A 4NB4A 1ATNA 3A5LC 3WQTA 2IVOA 4XH4A 4K41A 4H0PA 3ULEA 2A42A 3A5NC 3VEOA 2IVPA 4PKGA 5KPRA 1QQNA 3O8MA 2VWBA 5AQZA 3EKUA 1J6ZA 5EOYA 3BP8A 4H5VA 3VF6A 2PBDA 4O8KA 4BR7A 3AAPA 2NZTA 4NO7A 4GNIA 4BR9A 1TYQA 4JD2B 3A5MC 3P4IA 5AQIA 3O1BA 3LDOA 4ISGA 2D1KA 2P9LA 2KHOA 4YDUC 1YAGA 2P9PA 5AQXA 2GWJA 3MN5A 3R9PA 4WQ5C 3GE1A 3DXMA 3FLCO 4CZIA 4CZKA 3H1QA 5AR0A 2PAVA 1IG8A 3U9ZA 4E1JA 4EHTA 1QHAA 3VEYA 4BRAA 2IIRA 1C0FA 3DWLA 4CD3A 1RGIA 4FO0A 4H03B 3M3ZA 3CERA 1G99A 2P9NB 2GUPA 1MA9B 3VGLA 2P9KA 1HX1A 1QZ6A 3F9MA 4BRLA 3H46O 1MWMA 5AQUA 2VYPA 4DQ8A 3MCPA 4FWOA 2ZWHA 2HMPA 2FSJA 4XH1A 2UYTA 3TU5A 1YUWA 2OANA 3ATUA 2H3GX 4J8FA 3L6QA 4FPBA 3LDLA 4I6MA 4MLEA 4BRNA 2FSNA 1NGEA 2DPNA 1LOTB 1BA1A 1V4TA 3OHRA 3QFPA 1ZBSA 2GTDA 2E2NA 2CGLA 4CZEA 2W40A 3RSEA 4H5WA 4CI6A 3O1WA 2E8AA 3SK3A 4CZFA 3SJHA 3GL1A 4EAHD 2Q0RA 2E1ZA 4BREA 1BWFO 1YVNA 1WUAA 5BRDA 1HUXA 3L0QA 1HPMA 1ESVA 1S3XA 4DB3A 1WOQA 2P9SB 4JHDA 4A61A 1Z6RA 1BOTO 2CH6A 3LDPA 2FSKA 3LM9A 3CHWA 3UKUA 3U9DA 2Q97A 5BN9A
chains in the Genus database with same CATH superfamily
1ILYA 3FFIA 3BF3A 4DFMA 3CJ7A 1RTIA 3K59A 1NK9A 2NUBA 1FJGK 5LY3A 3ZT3A 1O13A 2VQEK 4FYDA 5KPTA 1HNWK 4FWRA 3WT0A 1TL1A 1J9AA 1IKWA 1WSJA 4FJ8A 3MX2A 4KI4A 5CYMA 3UKRB 2ITGA 2B6AA 4LF9K 2WBNA 2HOEA 1ZXOA 2OPQA 3GBTA 3HSCA 1NK8A 4BR2A 2O8BB 3VPZA 4M3UA 3M8PA 3ENBA 2D0AA 2RPIA 1X1PA 5C15A 3HL8A 1S9GA 1KC8O 4QS9A 1OH5A 1Q82O 3WNFA 4B1VA 4I9QA 3J7AP 1NLVA 2G8HA 3HM8A 3QNNA 5HLFA 4LF8K 2Z1JA 4CF9A 3ZLJA 3HSTB 4WQ5A 3FZHA 4L3QA 1HQUA 2VGMA 2BGGA 4GV9A 3HBTA 3ULDA 4Y0WA 3KD1E 1U6ZA 4B1YB 3OJUA 5AZIB 4FK4A 4LF6K 3M1FA 2P9IB 1RDWX 3AO2A 5JICA 4FLYA 1VQPN 2RN2A 1GLBG 2O8EA 1Z26A 3HZ6A 1W2BM 3DLEA 4K8XA 4BROA 3FE1A 3PSIA 4IEEA 5AQRA 3QFUA 3C7NA 3AVAA 3KIOA 3L3UA 2EWSA 3WEEA 5GAHP 4CHPA 1TK8A 1K9MO 1NGGA 3AVGA 4ILJA 4BY9C 3HP6A 3WQUA 1RT2A 4JI3K 1BU6O 4OPHA 3H3OB 2O8CB 3QETA 1FW6A 4DR6K 4OLAA 1NJZA 5ADXH 4W5OA 1X9JA 1KAXA 3CF5L 4CJFA 4DWIA 3NMUA 3WNHA 1LAVA 4BWJA 1JLCA 1RDAA 1T3VA 5FPNA 3CQ8A 1ZC6A 3GG4A 4OPJA 1RT5A 4BRHA 1KLMA 4G1QA 3AVLA 3EN9A 1K6YA 1LWFA 1QE1A 3LDQA 3LZIA 5AQKA 4CGFA 2A3ZA 1TL3A 3FR0A 4BQZA 1BI4A 3TI0A 1BG3A 3T19A 1MWKA 4B9MA 5C2FA 1N33K 4LY7A 4GMJB 4BRCA 3VENA 3H3NO 1NK7A 1X9WA 2O8DA 4B9TA 4GVMA 4OPAA 1YVUA 4CCHA 4Y1DA 5AQLA 4DV5K 3SV3A 4CGGA 2HHWA 3WXKA 4CGDA 4OLBA 5BR9A 1YXQA 2YCHA 3CCEN 3MAQA 1LCUA 2JWKA 1YI2N 3CJ9A 1NGBA 4DUYK 1NGFA 4FWMA 2W41A 4DQSA 1L3TA 3LP3A 3VTHA 4M7XA 3UB5A 3VQEA 1HNVA 3TR8A 1HNZK 1XC3A 4LH5A 3ALYA 4DTNA 1RCHA 3QINA 2QWOA 2ASPA 4RWTA 4LFBK 1IBMK 3KLFA 4PY5A 4RCHA 5I9EB 3A8YA 3DLRA 3KHYA 3R3LA 4JHDB 2BDPA 2A5XA 3CXCM 1M1KO 3NF8A 2QWLA 4K43A 3ZSVA 4ZTJA 5J2PA 1ZBUA 1BQNA 3V4IA 4FK2A 1G15A 5GAEP 4ZHRA 3CCMN 4K25A 3QEPA 4DFPA 5FROA 2E5LK 5KPZA 3VQ7A 3EL2A 4DU4A 1Y97A 4MQ3A 3G4SN 4CFBA 2G8IA 3CPWM 4CD1A 3C65A 3P1GA 4IO9L 3V9SA 4CJ7A 3L8BA 1TAQA 2P9UB 4XIUA 1WLJA 4CECA 1SL2A 3OBYA 4BRFA 4FWSA 2YI1A 4DF4A 3OYHA 3CC2N 4A2BA 3TTFA 4O0JA 2IOCA 2G8KA 4U7BA 1CZAN 1JLAA 4BR0A 4LC9B 5LJVA 5IWAK 3VQAA 1GLFO 3L4IA 3SMPA 1SL1A 3WXIA 3ZETB 2Y1IA 4KV8A 3U6FA 5F1XA 3RR8A 4FXDA 2YNHA 1RDCA 1NMDA 1T6CA 5AFUH 4UQGA 2E2QA 1NGHA 4Z4FA 1RBRA 1HLUA 2Z1GA 1VQON 5H1SQ 3C6UA 4LD0A 4B9QA 3MK6A 4RW8A 5FPMA 4BE0A 4RW6A 4KTQA 4KBOA 1U49A 4JI8K 3KD5E 1S9EA 1Q18A 1JLBA 4DSEA 1B9DA 4F8RA 1VSLA 4CJ3A 3CCJN 2QK9A 1RT7A 4PA1A 4LF5K 1QS4A 3OYNA 4FWNA 4M45A 3KVGA 4DTUA 2D0CA 4UY8O 4CGHA 4YOVA 2V7ZA 2OZSA 5FPDA 3NBPA 2YJEA 3VEWA 4FZXC 2ASMA 1DLOA 5KQDA 3ZEUB 4CZMA 5ELZA 3FFKB 5EY4A 1QZ5A 3B6OA 2W6LA 4CEOA 1ITGA 1B9FA 3QEWA 1YHQN 2ZJQL 4FJJA 4DV4K 4DR5K 3CCRN 1WSGA 3A0IX 3V9XA 4WYBA 3AY9A 3HT3A 3VQDA 5M1FA 2F8TA 4PUOA 3RVCA 3T1HK 4K41A 4C1NI 3RMDA 2DFFA 3C6HA 4JI5K 4HUFA 3VQ4A 4B9NA 1I39A 2F8SA 3CCQN 1QQNA 3VQQA 1VQ6N 2YKMA 1LW0A 3OYJA 1SKWA 4H5VA 1VQKN 2QKKA 2PYLA 4AHVA 4BR9A 1WSFA 4GNIA 4I2PA 1TYQA 4MFBA 4Z4CA 1A5XA 2XY7A 1NOYA 3A5MC 5AQIA 1VQ7N 2D1KA 4YDUC 2KHOA 3Q7CA 3TTDA 4YOXA 3ZSRA 3K57A 2PZSA 4CZKA 3KTQA 3J7YP 5AR0A 3DLBA 1IG8A 1S1TA 3QIOA 4B8CA 3U9ZA 4AF1A 2OZMA 4RW7A 4HCBA 3P38A 4M3TA 3T69A 3OYFA 4Z4IA 4OPKA 3AVIA 3J7ZO 2JGUA 4H03B 4JI6K 4DV0K 4DU1A 3HM9A 4LSLA 3NGYA 4JKGA 1HX1A 3F9MA 3H46O 1A5WA 1D8YA 1P90A 5AQUA 3O3GA 1Q9XA 5JS1A 1J54A 4J2AA 2IC3A 2VYPA 4DQ8A 2GX9A 5M1PA 3OYCA 2FSJA 3VTIA 2BANA 4I2QA 1YUWA 3ATUA 4J8FA 3L6QA 5HOOA 3SQ1A 4I6MA 4BRNA 3C94A 3EZ5A 1NGEA 1LOTB 1BA1A 3KJVA 1NK6A 3CG7A 4M3WA 3RSEA 3PLAA 4DTJA 4B8AB 4H5WA 4CI6A 2W6KA 2QEXN 5SWMA 3SJHA 4EAHD 1BWFO 3AVFA 1XC9A 5AJ3K 1HUXA 4N5SA 1WOQA 2P9SB 3NH1A 4A61A 3LM9A 4Z4GA 4AHSA 3I56N 1NNEA 4DTRA 1HPZA 4C8OA 3HRGA 3V1RA 4CHZA 5JVGL 1J5EK 1WBBA 5DM6L 3CQYA 3MEDA 5BRFA 3HO1A 2E6MA 4HWIA 4OO1J 1P8ZA 1XUPO 4BVPA 2HBMA 2GELA 5AQSA 4DCHA 3IMXA 5CZ2A 2HBJA 4N76A 5AQQA 3AA3A 2WONA 2FBVA 3AGRA 3H6EA 3VETA 3P83D 1YITN 2ASOA 4FWKA 3D2EA 4EP4A 1FKOA 1Q81O 3A5OC 3H1VX 4O4GA 2QWMA 2O8FA 4DSLA 3RWUA 1XNRK 1CXQA 3O80A 4JKEA 4DQRA 3L3VA 3HPOA 3BZKA 4BRKA 4IO8A 3QICA 2Q1NA 2E1YA 3CM6A 4A5BA 4IXCA 4FM0A 4E7LA 3ZSXA 3MECA 4O44A 4OKJA 4DR3K 1EXQA 4KH4A 2HBKA 4CHYA 4B9LA 4B3MK 2V7YA 3CPEA 5KTQA 2WUSA 2QI2A 3AVCA 5T7BA 3SUNA 4FWPA 1EQYA 3LWLA 4WF9L 4FLXA 2F9TA 5D3GA 1QQOA 1K8KB 1KFDA 3O6WA 2BTFA 1NWKA 2Q2RA 5C0YA 3IDHA 1VQMN 4BDYA 5M1NA 1BO5O 2BE2A 3JS6A 4CFDA 2XO7A 4CK2A 5E84A 1RBSA 4H5RA 3OS1A 2HBLA 4E7IA 1BDGA 1LWCA 3PV8A 4DQPA 2CGJA 2KFNA 1C0GA 2QM1A 1NKCA 4JAXA 4NYFA 4ID5A 2NRWA 1TVRA 2ZM6K 4DQIA 1I94K 3MN6A 3SQ2A 1RT4A 3DAWA 1BA0A 5J2QA 1UOCA 5BRHA 4JNEA 3D2FB 4Z94A 5JLHA 2P9LB 3M8SA 4F4KA 3T7ZA 4YOYA 3HOSA 5F0XA 1QTMA 4Z0UA 3S3OA 3QBXA 4B1UB 2G8WA 1CXUA 4CBWA 3G0ZA 4L8RB 4B1ZA 4DR1K 3AVBA 5AQPA 4FPAA 1MU2A 1BUPA 4N47A 2BH1A 2P1JA 4NCGA 2X78A 4BRMA 1JCEA 1BCOA 3DLLL 3KKRA 1BCMA 4BC2A 1SKRA 2WOMA 1QVGM 3BGRA 1L3VA 2XY5A 4PQUA 1KD1O 4DV7K 3KLIA 4B3OA 4CJQA 2AP1A 1N8RO 2JLEA 3U8XA 2OCEA 4E7HA 3TANA 1RILA 4BRPA 3QO9A 1YTUA 4AM6A 1DGKN 1R59O 4BACA 4AQYK 1XNQK 4M3ZA 4JYAK 3L2WA 5KRSA 4ID1A 1KQSM 3AVKA 4O5BA 2HSTA 4XH5A 4E7JA 2EHGA 3K5LA 4B9VA 4DHYA 3SBGA 1S72N 1QVFM 2NLXA 4BR5A 4AM7A 3MDQA 4ILHA 2IS3A 3EE8A 2A1SA 1RDUA 3Q7BA 1JCFA 5EX5A 4JI2K 1N6QA 3R8EA 3OTOK 5GIPA 3U3YA 2A6AA 3VQCA 3DRPA 4JK8A 2D5RA 3A2FA 1YF5L 3S41A 3WNGA 3UKUB 2P9NA 1LAWA 3SLCA 5AQOA 3VEXA 3L2QA 4DQQA 4FW1A 3RR7A 1L3SA 4FJ7A 4M63C 3R6MA 1KAZA 4YY3K 2HVIA 4EHUA 4FK0A 3O9SA 3NH2A 3V9ZA 1CZBA 2PYJA 2O8CA 3JXUA 3NF7A 3EZWA 4YHHK 1OH7A 3ZX3A 5J2MA 2GV9A 5FPEA 3SAFA 4HHTA 3M6GA 3VGMA 4YFUA 1U48A 3ULEB 3VF4A 4CBUA 2NNWA 3HVTA 4J2DA 1JCGA 1RBUA 1IBKK 2HHTA 4FOIA 5AQFA 3G6EN 4JK7A 3SAGA 3H08A 5BPNA 1Z05A 1DTQA 2UXDK 1TUUA 4KKOA 2CGKA 3ZSWA 4CEEA 2ZF5O 3LPTA 5GADP 4MO4A 2FXUA 3G71N 2A41A 3PIPL 3IFRA 3PIOL 3GDQA 4CIFA 3TSPA 1H1VA 2QWPA 5GAGP 4BWMA 4FJNA 3TABA 4J2BA 4ISEA 4TSXA 4KTZA 1GLAG 3AVHA 4GV3A 2UUAK 4CESA 1U2VA 3J8AA 2O8EB 2YHXA 3NGZA 4BRGA 1NGAA 2YHWA 3SUQA 1S1XA 1RT1A 3C7NB 2E4LA 4ISFA 1DEJA 5IT9O 3K9JA 5FLXO 3VMFB 3ZX0A 3I55N 3LAMA 2YNIA 3O4NA 1JLFA 2HNYA 3WEEB 4U67L 4OGCA 1REVA 3CJBA 4FM2A 4F9OA 3KKSA 1WNSA 1T7PA 5LMNK 4GW6A 3L4QA 3DLHA 3ID8A 2E88A 4OX9K 1W0HA 5DK5A 5HRPA 3MXMA 3ZT0A 4FZZA 1JL1A 2FLOA 3U3GA 1GLEG 4F3TA 1UAXA 2HMIA 4B3TK 3ZSOA 3OY9A 3THVA 2VQFK 1C1BA 4FJLA 1YTAA 4O8UA 3I0RA 1C0UA 3E9LA 5LJWA 2Y1JA 2QWRA 3LP1A 5HBMA 4FVMA 2WC9A 1TAUA 4NB4A 1BI4B 2FBTA 2YKNA 4XH4A 4H0PA 3THWB 4K8ZA 2A42A 1GOBA 4E89A 3A5NC 2YNFA 3AA5X 1T05A 2YHAA 5C25A 5LL6Z 4KTWA 4JEPA 4WCEL 4BE2A 2OPRA 3BP8A 2PBDA 4E1NA 3HPGA 4WFBL 3C6AA 2VG5A 1TKXA 3LDOA 4ISGA 1YAGA 2P9PA 5J1EA 3K2PA 4M3YA 4KH5A 3SPYA 3R9PA 4WQ5C 2OPSA 3DXMA 1JKHA 4CZIA 3IRXA 3K9KA 3I8DA 3MCAB 3T1YK 4WFNL 2PAVA 1IKYA 2RHKA 1IBLK 4JKDA 3IS9A 1FXXA 4EHTA 3J81O 4BRAA 4DS5A 3SQ4A 3ZSZA 4O0IA 1EX4A 3EYZA 1M90O 1J5OA 1L5UA 1RGIA 4DU3A 3M3ZA 1S1WA 2GUPA 1BIUA 2P9KA 1QZ6A 1TGOA 3LALA 1EETA 3MCPA 1C0MA 1WSEA 4FWOA 2ZWHA 2NRVA 1HQEA 2HMPA 1OH8A 2D0BA 3MWTA 2YX6A 3THXA 2NRRA 1L3UA 4KRFA 3LDLA 3PUFA 4MLEA 3LWMA 3NCIA 4F3OA 1ZBFA 3AA2A 1NK5A 1NJYA 5DMRA 1V4TA 3AV9A 3NFAA 2E2NA 4CZEA 1D5AA 3OYKA 2RE2A 5KGXA 2E8AA 3SK3A 4CIGA 4JRQA 1RTJA 3NAEA 1HYZA 2E1ZA 3TTCA 1WUAA 1U4BA 5BRDA 1HPMA 1S3XA 3K5NA 4FJHA 1B92A 3QEXA 3OYIA 3CHWA 4DMNA 4KHQA 1DT9A 3U9DA 2Q97A 3LZJA 3OS2A 4I9LA 3SQ0A 1W9HA 4DV3K 4V19S 3C6TA 2ETJA 1GOAA 2RKIA 3OYEA 4DR4K 4OJRA 5CR4A 3SMSA 4EIAA 3BF1A 1OKJA 4BC5A 3IUCA 1SL0A 1D9FA 3D6RA 3PSFA 1WAJA 1HRHA 4OGEA 3DJCA 3MXIA 4DSJA 3ATVA 2ZGZA 4JI1K 4PWDA 3TARA 3V6DA 2D0PA 1OVQA 4F2SA 2VCPA 4IFYA 3HTVA 3RRHA 4PKHA 2F9WA 2LSNA 4DSKA 3TSUA 4FWLA 4WQ4A 4RG8A 5LMUK 2GEMA 3O4WA 5TKYA 2R7YA 3OW2M 4CZLA 3AO4A 3OYMA 1BL3A 2HF3A 4CHQA 3SI6A 3QB0A 3MEEA 2VWKA 2ZQBA 1JL2A 3N4PA 5M1OA 4IOAL 5AZJA 4KAZA 5GIOA 4JKCA 4CF1A 4KB0A 2X6NA 2I7NA 2VG7A 3OBWA 1HNIA 3KK2A 3SUPA 3AO3A 2ZGYA 1UWBA 1NGIA 3CMEN 3VQBA 4IJNA 3ZCMA 3PO5A 3SUOA 3D7EO 4JN4A 4DUZK 4FJKA 3VQ8A 3E9PA 2HHVA 1KCFA 4BVOA 1TUYA 1YJNN 3JSMA 2KZZA 4CF2A 4YNQA 3LDSA 3DMJA 1E4FT 4W5TA 4IFEA 5HRRA 4DTOA 3HK2A 4CJLA 2AA4A 2DFEA 3VOVA 3DXKA 2UUBK 1T44A 2P9SA 5CE3A 3DLKA 3F5TA 3KWGA 5DM7L 3ENHA 3E01A 2OTJN 5JLFA 4DR7K 4Q5VA 2VG6A 1S6PA 4C23A 1NOZA 4WFAL 4N41A 3LP2A 2ATQA 1GLCG 1OVYA 1SKSA 1VQ4N 3MMVA 3KK7A 1E4GT 4FW2A 2YHYA 5AQJA 2UXBK 4WE1A 4JI0K 3LL3A 1JXBA 2ZD1A 3NH0A 1QSSA 4XEIA 4KFBA 4H5NA 4QCLA 4O55A 3SPZA 4JKGB 3FZLA 1X9MA 1WN7A 1VQ5N 1HYVA 3K5OA 5KRTA 3L2UA 4FCYA 2QXLA 4IDHA 2YHBA 4W5NA 2Q36A 4DFKA 4ELTA 5GINA 1F21A 4JD2A 1S22A 4FL9A 1QHTA 3CJCA 2YV0X 3N4QA 3BDPA 3PY8A 4Q0BA 1ASVA 4X66K 1LW2A 4H0YB 3HXMA 5KGWA 3MN9A 4FLTA 3B8AX 3JYTA 2Q0UA 4JKFA 4CEZA 1ASWA 2D0OA 2OA8A 3LM2A 2DTUA 4C8MA 3RSEB 1KTQA 5C24A 4KHWA 3SYZA 3VEZA 1K8KA 1NU0A 3VF2A 1KXPA 5EXWA 3ZT2A 3THYB 3WXLA 5KI6A 2HNDA 3VQ9A 4FLUA 4M42A 2XHBA 2OYQA 4KREA 1EWRA 4CJRA 2IGIA 1I3AA 2NRXA 3HP9A 4IJAA 5HL7L 3VA0A 3NVMA 3CETA 4BRQA 2I7PA 4PL7A 4BDZA 3V9WA 2VGNA 4WQ4C 2UUCK 1UA1A 1E3MA 4E19A 4JRPA 1HKGA 3D2FA 5EU7A 1HNXK 3D2EB 4BC3A 1JLQA 3ZSYA 3K0SA 2HHXA 3MX5A 1A5VA 5AQWA 3DLGA 2DY4A 1X3MA 3VEVA 3TAFA 5I42A 2QWQA 3ENOA 4B3RK 4QS8A 5E26A 3QNOA 1YJ9N 2E20A 4GVEA 4H0TB 2ZJPL 4IDKA 3JAMO 2E2PA 2W42A 4CJ4A 4HUEA 1IKXA 5MLCQ 1NJIO 4GKJK 4MDAA 4CEAA 3MWPA 5BN8A 5BREA 4CHOA 2X6SA 5E41A 3QLHA 1C1AA 3FZMA 3HI0A 4OKKA 4FJIA 3SV4A 1NK4A 3PX4A 4B08A 2HHSA 3UKRA 2HHQA 1NG9A 3EKSA 4B1XB 4O5FA 3D0PA 3ISNC 4GY2B 5JS2A 4DTMA 3S3MA 3G10A 4LFCK 4MO5A 1RT6A 2YJFA 4M7YA 1T6DA 1UA0A 1QSLA 2O8BA 3TPQA 3V1QA 2F7TA 4FOEA 3LP0A 3CD6N 1DKGD 1XWLA 1X9SA 1T03A 4IWVA 3TSQA 1SQKA 1QQMA 4CEDA 5AFUA 4CJ5A 1TKZA 3NDKA 3I0SA 1V4SA 5B8HA 1VRTA 5C10A 2QWNA 5HROA 4ELVA 3UE5A 4NXNK 3G25A 4FLWA 1VHXA 2HF4A 2FF6A 3I8BA 3CFOA 5AZIA 3TAMA 3ITHA 1O1WA 4IG3A 1VSKA 5HRSA 4MLHA 1BHLA 4NLCA 1KVCA 2P9IA 4IFVA 3TAEA 3ZT1A 4IEIA 4DFJA 3A5LC 3DRRA 3WQTA 4KH6A 2Q3SA 3ULEA 5C42A 4JI4K 2ZE2A 4DR2K 2KQ2A 1VQ9N 2IVPA 4PKGA 5KPRA 3CFRA 3O8MA 4FJXA 2UXCK 2VWBA 1ZBLA 5AQZA 5CYQA 3EKUA 1J6ZA 5EOYA 3VQ6A 1XI1A 3V81A 4IBNA 4O8KA 3AVJA 4BR7A 4CE9A 4CJSA 3B6PA 1Z25A 2NZTA 4NO7A 4EP5A 4AILC 4N56A 3P4IA 1K73O 1TK5A 1KLNA 1NKEA 1NJXA 3TAPA 1JXEA 3F2KA 3MN5A 4A57A 3CYMA 3PO4A 4JS5A 1EO1A 3H1QA 2QKBA 5I3UA 4E1JA 1N32K 4CJUA 3VEYA 5M1KA 4Z4HA 2O4GA 4KHSA 4DLGA 3S9HA 4IKFA 4QAGA 3O3FA 3CERA 2P9NB 3LANA 1MA9B 1U45A 3VGLA 1Q86O 1TK0A 4BRLA 2G8UA 4AHTA 1MWMA 3C95A 1TKDA 2HB5A 1VSJA 3TU5A 1HJRA 2UYTA 4LF4K 2OANA 2H3GX 1GOCA 4B9UA 5M1QA 4C8KA 3BY5A 3RMBA 1JJ2M 4M41A 3O3HA 3T1AA 2QXFA 2DPNA 4NXMK 4CHNA 1EWQA 3OHRA 3QFPA 4GV6A 2CGLA 2W40A 4R79A 2F96A 4BDPA 3O1WA 3WNEA 3AVMA 3CM5A 4AHRA 1QQCA 2Q0RA 1C1CA 1BIZA 4BREA 3OYAA 1YVNA 2P5GA 3L0QA 2PFUA 4JI7K 4DB3A 3AVNA 4OKEA 2XY6A 4JHDA 4CFCA 1Z6RA 1BOTO 3LDPA 2FSKA 4LSNA 3THWA 2E6LA 5BN9A 4A5AA 5A2QO 1IO2A 1NBWA 4CEBA 1BGXT 3VERA 4JKAA 4AH9A 1KRPA 4JS4A 3ZSQA 4BR4A 1XHXA 4R5PA 2BUPA 4ILGB 2VWJA 2HVHA 2V51B 1VQNN 4IG0A 3LAKA 1LV5A 2WFBA 3I33A 3OYBA 2GWKA 1U2VB 4KPYA 3WXMB 5JVHL 3R1XA 5AQGA 3NHGA 4Z4EA 1EKEA 1JLEA 1S5JA 3EEQA 3O08A 4DV6K 2IAJA 2FBXA 5CY4A 2B4JA 2FBYA 1MDUB 2P9UA 2P5OA 3CFPA 4RW4A 2Z1HA 4CVNE 2O8DB 3O9QA 1NGCA 2E2OA 2A1RA 3HVRA 1NKBA 3WUHA 2QA4N 3E1YA 3AO5A 3FGUA 3QMLA 3HYFA 1X3NA 4YDUA 2J4RA 1VSMA 5CZ1A 3L2VA 4BQLA 4DLEA 5F2RA 2GUIA 4FLVA 5AQMA 3RRGA 5TKWA 3ZETA 1WBDA 3NVKA 1LWEA 3BUZB 5AQVA 3K58A 1D4XA 1VSFA 3QEVA 2PY5A 4GKKK 2A40A 1U47A 5HP1A 5BPLA 3CC7N 2IDOA 1VAZA 4DF8A 3F73A 1N5YA 3OA9A 4IZ9A 2IVNA 4DSFA 4CIEA 2I5JA 2AJQA 2DFHA 3L2RA 4HTLA 3KLGA 3QIPA 3TWHA 2RF2A 4BE1A 4DS4A 1T8EA 1XMQK 1IG9A 4X64K 3T3FA 2O4IA 1D9DA 1GLLO 3AAQA 5FRMA 4NCBA 2JWLA 2HNZA 3TAGA 4BRIA 4H0XB 1IV0A 4CZJA 4CBXA 3M8QA 4DTSA 4CJPA 1W7AA 4K42A 3MN7A 3KK3A 4CZGA 2CH5A 1KSPA 1WB9A 2G8FA 2P9PB 3CJAA 1HKBA 3ZEUA 1VQ8N 5AQHA 4E3SA 4J2EA 3IKMA 3WXJA 5BPMA 3UIQA 3H45C 1VRUA 2QW9A 4M3RA 1YT3A 3DXMB 3CCLN 3EE9A 4PKIA 4IOCL 3NF6A 4H0VB 1DTTA 1RFQA 2XY8A 3CJ1A 4EZ6A 1C6VA 4ZTFA 4KHUA 1SAZA 1ATRA 3K5MA 1SV5A 2X74A 5JMVA 3M5RA 2P9KB 1S6QA 1JLGA 4BG8A 1Y64A 4DG1A 4Y1CA 4LH4A 3W0LA 4MDBA 4H4MA 1VK0A 4BGAA 3CCUN 4PL8A 4FJ5A 2HHUA 1Q9YA 4CJWA 3SAHA 3OJSA 3THXB 4KB1A 3O9UA 4CF8A 3J80O 4HTUA 4M3XA 3LPUA 4DV2K 3FZKA 5EVZA 4JKBA 1NJWA 1HJOA 4BG9A 3EO3A 3FZFA 1XQSC 1IJJA 1R0AA 3VGKA 4KHYA 4CEFA 3HPHA 1KAYA 4DV1K 3P31A 1RBVA 3ZX2A 3QBWA 1SZ2A 1XMOK 4KI6A 3DRSA 1ZYQA 3U4LA 4B3SK 4CFAA 4YOTA 5AQNA 3V9UA 4CF0A 3O9RA 5J2NA 4DSIA 4KO0A 1GLJO 3IG1A 4FSVA 1NGDA 1VSIA 3RTVA 4E0DA 3F9KA 3LDNA 2OTLN 4PHTX 4A2AA 3E66A 5AQYA 1ATSA 4NYNA 4OVLA 3DI6A 1C0TA 4DKWA 4NCAA 1RTDA 3BEXA 3RMCA 5KQ8A 4H5TA 3O5BA 3RMAA 1S1VA 1VSEA 4JLHA 2KLAA 1HKCA 4CK1A 2V52B 3HJFA 3DM2A 3P5JA 4CZHA 4FVUA 4C1NK 4NLBA 4AHUA 3VQPA 4EFHA 3AGKA 3C0BA 4ICLA 3IAYA 4B1WB 3KZBA 3VN5A 3DYAA 3CI5A 4H0OA 1TYQB 2EX3A 3CIPA 3OS0A 1RDBA 3CQXA 4BC4A 5AZJB 2QTDA 3AO1A 4FJGA 4W5RA 3SBTA 3O9TA 5C12A 4FZYA 4E7KA 4HUGA 4G9ZA 2G8VA 4KHPK 3SNNA 5FRNA 2KFZA 1KVAA 4B9SA 3TAQA 4RTFD 1W97L 3AARA 2ITMA 4CGJA 2P51A 4YOUA 2KZMA 4A62A 1BISA 3E9OA 4BGBA 3SCXA 2FC0A 4FWQA 1VQLN 4CW7B 1K8AO 3QDKA 4QOZB 4QS7A 3S3NA 5FDLA 3W3DA 4HVJA 1NM1A 2Q31A 1BQMA 2OPPA 4YORA 3CMAN 1KVBA 1FK9A 4AHCA 4FLZA 2NRHA 3VA3A 2KTQA 3KLEA 3VQ5A 5BR8K 4X62K 1KFSA 3VESA 3DXKB 4BRDA 3THYA 4X65K 1NGJA 4DTPA 5ADXA 3P39A 5HRNA 4I6MB 1HYSA 3M8RA 2D4WA 4I7FA 1RDDA 2Z1IA 5AQTA 3NGIA 2B5JA 1FKPA 1GLDG 1TV6A 2HW3A 2YNGA 3HOTA 1WSHA 1RNHA 4CK3A 3GOIA 1NK0A 2FF3B 4KHNA 3NF9A 4DTXA 1ZBIA 4JV5K 4CJTA 1TKTA 2KKZA 3CCVN 1ATNA 3KLHA 2IVOA 3MXJA 2XRIA 3SJJA 1N36K 1RBTA 3VEOA 4C8NA 3BZCA 3AA4A 3OYGA 4FJMA 1Q7YO 4LF7K 3VF6A 3DOLA 4RW9A 2F4VK 1WAFA 3V1OA 3AAPA 1WSIA 3CCSN 4JD2B 3KWIA 4E1MA 4H8KA 3O1BA 4IOXA 1SUQA 2P9LA 5AQXA 4CJEA 2GWJA 1N34K 1SS6A 3GE1A 2NRTA 3FLCO 1J53A 2O8FB 4F2RA 3PX6A 5SZTA 1RTHA 1U04A 3QERA 1YIJN 3D45A 1VSDA 3MEGA 1QHAA 1Q8IA 3ZYYX 3OYDA 4H4OA 2IIRA 1C0FA 4LFAK 3ID6A 3DWLA 4CD3A 1QSYA 4W5QA 1HMVA 1ASUA 4FO0A 4ELUA 1G99A 2ZJRL 4JKHA 1HR0K 4FM1A 1IKVA 3O4QA 1NMNA 3DOKA 3OYLA 4K0KK 2HHHK 4A59A 4XH1A 1VSHA 4FPBA 3CC4N 3ZT4A 3KK1A 2FSNA 2NRZA 3QESA 1XHZA 1CLQA 1CZ9A 1RT3A 1ZBSA 2GTDA 3NE6A 3QEIA 1ZBHA 4CEQA 4CGIA 4CZFA 2WTUA 4HCCA 1EP4A 5C2DA 3PX0A 1YJWN 3GL1A 4JK9A 4EZ9A 4CERA 2UU9K 5CHIA 2GBZA 1ESVA 4CJVA 5K14A 4YOWA 3ASMA 1IH7A 3OVNA 2CH6A 3SZ2A 1S1UA 3UKUA 4CJKA 4C8LA 4FJ9A 2KW4A 3EY1A 1OH6A
chains in the Genus database with same CATH topology
1ILYA 1NBWA 3BF3A 3CJ7A 3HRGA 4JKAA 3VERA 5JVGL 5DM6L 5LY3A 4BR4A 3CQYA 5BRFA 2BUPA 5CR4A 4ILGB 3SMSA 1O13A 4HWIA 4OO1J 4EIAA 5KPTA 2V51B 1VQNN 3BF1A 1OKJA 1P8ZA 1XUPO 4BC5A 2HBMA 2GELA 3IUCA 4FWRA 5AQSA 3WT0A 4BVPA 3IMXA 4DCHA 2HBJA 2WFBA 3I33A 3D6RA 5AQQA 3MX2A 2GWKA 1U2VB 3UKRB 3WXMB 3AGRA 5JVHL 3DJCA 3H6EA 3R1XA 5AQGA 3VETA 1YITN 2ASOA 3ATVA 3D2EA 3O08A 2ZGZA 4FWKA 1MDUB 2P9UA 2WBNA 2D0PA 1Q81O 2HOEA 3A5OC 1ZXOA 3H1VX 2QWMA 2VCPA 3GBTA 3HTVA 3O9QA 4PKHA 2F9WA 1NGCA 3HSCA 3O80A 4JKEA 4BR2A 3TSUA 2E2OA 4FWLA 4WQ4A 3VPZA 2GEMA 3O4WA 5TKYA 3ENBA 3OW2M 4CZLA 3WUHA 4BRKA 4IO8A 3QICA 3E1YA 2QA4N 2Q1NA 3FGUA 3QMLA 2E1YA 5C15A 1X3NA 4QS9A 2J4RA 4YDUA 4A5BA 1Q82O 1KC8O 4IXCA 4B1VA 1NLVA 4BQLA 2HF3A 3HM8A 3QB0A 5F2RA 5AQMA 5TKWA 3ZETA 4WQ5A 3NVKA 3FZHA 3N4PA 5M1OA 4KH4A 2HBKA 3BUZB 4L3QA 5AZJA 4IOAL 5AQVA 2V7YA 2VGMA 3CPEA 2WUSA 5GIOA 4GV9A 4JKCA 2QI2A 3HBTA 1D4XA 4Y0WA 1U6ZA 2A40A 4B1YB 2I7NA 4FWPA 1EQYA 3OBWA 5AZIB 2ZGYA 5BPLA 3CC7N 4WF9L 1NGIA 1VAZA 3CMEN 2F9TA 3M1FA 2P9IB 4IJNA 1QQOA 1RDWX 1K8KB 3OA9A 4IZ9A 5JICA 2IVNA 1VQPN 3D7EO 1GLBG 4JN4A 3O6WA 2BTFA 1NWKA 3HZ6A 2Q2RA 1W2BM 3E9PA 4HTLA 5C0YA 3IDHA 4BVOA 1VQMN 5M1NA 1BO5O 4BROA 1TUYA 3FE1A 1YJNN 3JS6A 4IEEA 5AQRA 3QFUA 5E84A 3C7NA 4H5RA 1GLLO 2HBLA 1E4FT 1BDGA 2EWSA 3AAQA 4IFEA 2CGJA 3WEEA 5GAHP 1C0GA 2JWLA 2QM1A 2AA4A 3VOVA 1K9MO 1NGGA 4BRIA 4ILJA 3DXKA 4H0XB 4BY9C 3WQUA 1T44A 4JAXA 4CZJA 4CBXA 2P9SA 5CE3A 1BU6O 4OPHA 4K42A 3MN7A 3F5TA 2NRWA 3KWGA 3H3OB 3MN6A 3DAWA 4CZGA 5DM7L 2CH5A 3ENHA 1BA0A 2OTJN 5JLFA 5BRHA 4JNEA 3D2FB 4Z94A 5JLHA 2P9LB 2P9PB 5ADXH 3T7ZA 1X9JA 1KAXA 3CJAA 4C23A 4YOYA 5F0XA 1HKBA 3ZEUA 4WFAL 5AQHA 3HOSA 3CF5L 1VQ8N 3NMUA 3IKMA 3QBXA 3WXJA 4B1UB 5BPMA 4CBWA 3H45C 4B1ZA 1GLCG 1OVYA 1T3VA 2QW9A 3DXMB 3CCLN 3EE9A 5AQPA 4FPAA 3MMVA 5FPNA 1VQ4N 4PKIA 4IOCL 1BUPA 3KK7A 1ZC6A 3GG4A 2BH1A 1E4GT 4BRHA 4H0VB 2YHYA 4BRMA 1RFQA 1JCEA 3EN9A 5AQJA 3CJ1A 3LL3A 3DLLL 3LDQA 5AQKA 2A3ZA 4BC2A 3FR0A 4BQZA 1QVGM 1BG3A 1MWKA 5C2FA 1KD1O 4XEIA 4H5NA 1SAZA 1ATRA 2AP1A 4BRCA 3VENA 3H3NO 1N8RO 3U8XA 4JKGB 3FZLA 3M5RA 5JMVA 2P9KB 1VQ5N 4OPAA 4BG8A 4BRPA 1Y64A 5AQLA 3W0LA 4AM6A 1DGKN 1R59O 3WXKA 4MDBA 2QXLA 5BR9A 4BGAA 1YXQA 2YCHA 4IDHA 3CCUN 3CCEN 4PL8A 1LCUA 2JWKA 2Q36A 5GINA 1YI2N 1KQSM 4JD2A 3SAHA 1S22A 4FL9A 3CJCA 3N4QA 3O9UA 3CJ9A 1NGBA 1NGFA 2HSTA 4H0YB 4FWMA 2W41A 4XH5A 3MN9A 3VTHA 4M7XA 3SBGA 4DHYA 1S72N 3B8AX 2Q0UA 4JKFA 3UB5A 1QVFM 3FZKA 5EVZA 2NLXA 4BR5A 4AM7A 3MDQA 4ILHA 2D0OA 4JKBA 3EE8A 1XC3A 3LM2A 1HJOA 3RSEB 4BG9A 1RDUA 3EO3A 3Q7BA 3VEZA 1K8KA 1JCFA 3FZFA 5EX5A 3VF2A 2QWOA 3R8EA 5GIPA 2ASPA 1XQSC 1IJJA 2A6AA 1KXPA 4RWTA 3VGKA 4JK8A 4RCHA 5EXWA 5I9EB 3A8YA 3KHYA 1KAYA 3R3LA 3P31A 4JHDB 3WXLA 1YF5L 3QBWA 1SZ2A 2A5XA 3S41A 3ZX2A 3CXCM 1M1KO 3UKUB 2P9NA 3SLCA 3VEXA 5AQOA 2QWLA 4K43A 3U4LA 4YOTA 5AQNA 5GAEP 4M63C 3CCMN 3O9RA 4K25A 3R6MA 1KAZA 5KPZA 2NRXA 4IJAA 1GLJO 4FSVA 1NGDA 4EHUA 5HL7L 3LDNA 3EL2A 3NVMA 3O9SA 2OTLN 4PHTX 3CETA 4A2AA 2I7PA 4BRQA 4PL7A 2VGNA 4WQ4C 3G4SN 3E66A 5AQYA 1ATSA 3JXUA 3CPWM 4CD1A 3EZWA 3C65A 1HKGA 3D2FA 4IO9L 4DKWA 3ZX3A 3BEXA 3D2EB 4CJ7A 5FPEA 5KQ8A 3SAFA 3M6GA 3VGMA 4H5TA 3O5BA 3ULEB 3VF4A 4CBUA 2P9UB 2NNWA 3OBYA 2KLAA 4BRFA 4FWSA 1HKCA 2YI1A 4BC3A 1JCGA 2V52B 3CC2N 4A2BA 3TTFA 4CZHA 3MX5A 4FVUA 5AQWA 4FOIA 4U7BA 4C1NK 5AQFA 3G6EN 1X3MA 4JK7A 3VEVA 3SAGA 5BPNA 4NLBA 1Z05A 2QWQA 4EFHA 3ENOA 1CZAN 4QS8A 5E26A 1TUUA 1YJ9N 3AGKA 2E20A 3C0BA 4GVEA 4H0TB 4LC9B 2CGKA 4B1WB 4BR0A 5LJVA 2ZJPL 3KZBA 2ZF5O 1GLFO 3L4IA 3CI5A 2E2PA 4H0OA 3SMPA 1TYQB 5GADP 4MO4A 2FXUA 3G71N 2A41A 3CIPA 3IFRA 5MLCQ 3PIPL 3GDQA 3WXIA 3ZETB 3PIOL 4MDAA 5F1XA 1NJIO 3MWPA 3CQXA 4BC4A 5AZJB 5BN8A 2QTDA 1NMDA 5BREA 1T6CA 1H1VA 2QWPA 3O9TA 5AFUH 3SBTA 3TSPA 5GAGP 5C12A 2E2QA 1NGHA 4ISEA 3FZMA 3HI0A 4G9ZA 1HLUA 1VQON 5H1SQ 1GLAG 4RTFD 1W97L 4B9QA 3AARA 2ITMA 4GV3A 3MK6A 1U2VA 3UKRA 3J8AA 4YOUA 5FPMA 2YHXA 4A62A 3E9OA 3EKSA 4B1XB 4BGBA 4O5FA 4BRGA 1NGAA 2YHWA 4KBOA 4FWQA 4GY2B 1VQLN 1K8AO 3QDKA 4QS7A 3C7NB 1Q18A 4ISFA 3W3DA 1DEJA 1NM1A 3K9JA 4MO5A 2Q31A 2YJFA 4M7YA 1T6DA 4YORA 3VMFB 3ZX0A 3I55N 3CMAN 3CCJN 3TPQA 2F7TA 4FWNA 4FOEA 2NRHA 3WEEB 4U67L 3KVGA 3CD6N 1DKGD 4UY8O 3CJBA 3VESA 3DXKB 4BRDA 4F9OA 4YOVA 2V7ZA 3L4QA 4IWVA 3TSQA 3ID8A 5FPDA 1NGJA 1SQKA 2E88A 5ADXA 1QQMA 2YJEA 3P39A 3VEWA 5AFUA 4I6MB 2D4WA 2ASMA 1V4SA 5B8HA 5C10A 2FLOA 2QWNA 5KQDA 5AQTA 3UE5A 3G25A 3ZEUB 4CZMA 1GLEG 1GLDG 5ELZA 2HF4A 2FF6A 3I8BA 5AZIA 3FFKB 5EY4A 1QZ5A 3HOTA 4MLHA 3GOIA 4NLCA 2P9IA 2FF3B 4O8UA 3E9LA 5LJWA 1YHQN 2ZJQL 2QWRA 4IEIA 3CCRN 2KKZA 3A0IX 2WC9A 3CCVN 4WYBA 3AY9A 4NB4A 5M1FA 1ATNA 3A5LC 3WQTA 2IVOA 4KH6A 3RVCA 4XH4A 4K41A 4C1NI 4H0PA 3ULEA 2A42A 3C6HA 3A5NC 3VEOA 1VQ9N 2IVPA 4PKGA 3CCQN 5KPRA 1QQNA 1VQ6N 3O8MA 2VWBA 4JEPA 4WCEL 5AQZA 3EKUA 1J6ZA 5EOYA 1Q7YO 3BP8A 4H5VA 3VF6A 2PBDA 1VQKN 4O8KA 4BR7A 3AAPA 2NZTA 4NO7A 4GNIA 4BR9A 4WFBL 3CCSN 1TYQA 3KWIA 4JD2B 3C6AA 3A5MC 3P4IA 5AQIA 3O1BA 3LDOA 4IOXA 1K73O 4ISGA 1VQ7N 2D1KA 2P9LA 2KHOA 4YDUC 1YAGA 2P9PA 5AQXA 3Q7CA 3TTDA 4YOXA 2GWJA 3F2KA 4A57A 3MN5A 4KH5A 3R9PA 1SS6A 3GE1A 2NRTA 3DXMA 3FLCO 4WQ5C 4CZIA 3K9KA 4CZKA 3MCAB 3H1QA 1EO1A 5AR0A 4WFNL 2PAVA 1IG8A 2RHKA 4JKDA 1YIJN 3U9ZA 4AF1A 4E1JA 4EHTA 3P38A 1QHAA 3VEYA 3ZYYX 3T69A 4BRAA 5M1KA 2IIRA 1C0FA 3J7ZO 3ID6A 1M90O 3DWLA 4CD3A 1RGIA 4FO0A 4H03B 3M3ZA 3CERA 1G99A 2P9NB 2ZJRL 2GUPA 1MA9B 3VGLA 1Q86O 4JKGA 4JKHA 2P9KA 1HX1A 1QZ6A 3F9MA 4BRLA 3H46O 1MWMA 1P90A 5AQUA 2VYPA 4DQ8A 2GX9A 3MCPA 4FWOA 5M1PA 2ZWHA 2NRVA 2HMPA 4A59A 2FSJA 4XH1A 3MWTA 2UYTA 3TU5A 3VTIA 1YUWA 2OANA 3ATUA 2H3GX 5M1QA 2YX6A 4J8FA 3L6QA 2NRRA 5HOOA 4FPBA 3CC4N 1JJ2M 3LDLA 4I6MA 4MLEA 4BRNA 2FSNA 2NRZA 1NGEA 2DPNA 1LOTB 1BA1A 1V4TA 3OHRA 3QFPA 1ZBSA 2GTDA 4GV6A 2E2NA 2CGLA 4CZEA 2W40A 3RSEA 4R79A 3PLAA 4H5WA 4CI6A 3O1WA 2RE2A 2QEXN 2E8AA 3SK3A 4CZFA 3SJHA 5C2DA 1YJWN 3GL1A 4JK9A 4EAHD 2Q0RA 2E1ZA 3TTCA 4BREA 1BWFO 5CHIA 1YVNA 1WUAA 5BRDA 1HUXA 3L0QA 2PFUA 1HPMA 1ESVA 1S3XA 4DB3A 4YOWA 1WOQA 2P9SB 4JHDA 4A61A 1Z6RA 1BOTO 2CH6A 3LDPA 2FSKA 3LM9A 3CHWA 3UKUA 1DT9A 3U9DA 2Q97A 5BN9A 3I56N 4A5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBW A;  3BF3 A;  3CJ7 A;  3VER A;  5LY3 A;  4BR4 A;  3CQY A;  5BRF A;  2BUP A;  3SMS A;  4HWI A;  4EIA A;  5KPT A;  2V51 B;  3BF1 A;  1OKJ A;  1P8Z A;  1XUP O;  4BC5 A;  4FWR A;  2GEL A;  3IUC A;  5AQS A;  4BVP A;  3WT0 A;  4DCH A;  3IMX A;  3I33 A;  5AQQ A;  2GWK A;  1U2V B;  3UKR B;  3DJC A;  3H6E A;  5AQG A;  3VET A;  2ASO A;  3ATV A;  3D2E A;  3O08 A;  2ZGZ A;  4FWK A;  1MDU B;  2P9U A;  2D0P A;  2HOE A;  3A5O C;  1ZXO A;  3H1V X;  2QWM A;  2VCP A;  3GBT A;  3HTV A;  4PKH A;  2F9W A;  1NGC A;  3HSC A;  3O80 A;  4BR2 A;  2E2O A;  4FWL A;  4WQ4 A;  3VPZ A;  2GEM A;  3O4W A;  5TKY A;  4CZL A;  3WUH A;  4BRK A;  4IO8 A;  3QIC A;  2Q1N A;  3FGU A;  3QML A;  2E1Y A;  1X3N A;  4QS9 A;  2J4R A;  4YDU A;  4IXC A;  4B1V A;  1NLV A;  4BQL A;  2HF3 A;  3HM8 A;  3QB0 A;  5F2R A;  5AQM A;  3ZET A;  4WQ5 A;  3FZH A;  4L3Q A;  3BUZ B;  5AZJ A;  5AQV A;  2V7Y A;  2WUS A;  3HBT A;  1D4X A;  4Y0W A;  1U6Z A;  2A40 A;  4B1Y B;  2I7N A;  4FWP A;  1EQY A;  5AZI B;  2ZGY A;  5BPL A;  1NGI A;  2F9T A;  3M1F A;  2P9I B;  4IJN A;  1QQO A;  1RDW X;  1K8K B;  5JIC A;  4IZ9 A;  2IVN A;  3D7E O;  1GLB G;  4JN4 A;  3O6W A;  2BTF A;  1NWK A;  3HZ6 A;  2Q2R A;  4HTL A;  3IDH A;  4BVO A;  1BO5 O;  4BRO A;  1TUY A;  3FE1 A;  3JS6 A;  5AQR A;  3QFU A;  5E84 A;  3C7N A;  4H5R A;  1GLL O;  1E4F T;  1BDG A;  2EWS A;  3AAQ A;  2CGJ A;  3WEE A;  1C0G A;  2QM1 A;  2AA4 A;  3VOV A;  1NGG A;  4BRI A;  3DXK A;  4H0X B;  3WQU A;  1T44 A;  4JAX A;  4CZJ A;  4CBX A;  2P9S A;  5CE3 A;  1BU6 O;  4K42 A;  3MN7 A;  3H3O B;  3MN6 A;  3DAW A;  4CZG A;  2CH5 A;  3ENH A;  1BA0 A;  5JLF A;  5BRH A;  4JNE A;  3D2F B;  4Z94 A;  5JLH A;  2P9L B;  2P9P B;  5ADX H;  1X9J A;  1KAX A;  3CJA A;  4C23 A;  5F0X A;  1HKB A;  3ZEU A;  5AQH A;  3WXJ A;  3QBX A;  4B1U B;  5BPM A;  4CBW A;  3H45 C;  4B1Z A;  1GLC G;  2QW9 A;  3DXM B;  5AQP A;  4FPA A;  3MMV A;  5FPN A;  4PKI A;  1BUP A;  1ZC6 A;  3GG4 A;  4BRH A;  1E4G T;  4H0V B;  2YHY A;  4BRM A;  1RFQ A;  1JCE A;  3EN9 A;  5AQJ A;  3CJ1 A;  3LL3 A;  3LDQ A;  5AQK A;  2A3Z A;  4BC2 A;  3FR0 A;  4BQZ A;  1BG3 A;  1MWK A;  4XEI A;  4H5N A;  1SAZ A;  1ATR A;  2AP1 A;  4BRC A;  3VEN A;  3H3N O;  3U8X A;  5JMV A;  3FZL A;  2P9K B;  4BG8 A;  4BRP A;  1Y64 A;  5AQL A;  3W0L A;  4AM6 A;  1DGK N;  1R59 O;  3WXK A;  2QXL A;  5BR9 A;  4BGA A;  1YXQ A;  2YCH A;  4PL8 A;  1LCU A;  2Q36 A;  4JD2 A;  1S22 A;  4FL9 A;  3CJC A;  3CJ9 A;  1NGB A;  1NGF A;  4H0Y B;  4FWM A;  2W41 A;  4XH5 A;  3MN9 A;  4DHY A;  4M7X A;  3B8A X;  2Q0U A;  3UB5 A;  3FZK A;  5EVZ A;  2NLX A;  4BR5 A;  4AM7 A;  3MDQ A;  2D0O A;  3LM2 A;  1XC3 A;  1HJO A;  3RSE B;  4BG9 A;  3EO3 A;  3VEZ A;  1K8K A;  1JCF A;  3FZF A;  5EX5 A;  3VF2 A;  2QWO A;  3R8E A;  2ASP A;  1XQS C;  1IJJ A;  2A6A A;  1KXP A;  4RWT A;  3VGK A;  4RCH A;  5EXW A;  5I9E B;  3A8Y A;  3KHY A;  1KAY A;  4JHD B;  3WXL A;  3S41 A;  3QBW A;  1SZ2 A;  2A5X A;  3ZX2 A;  3UKU B;  2P9N A;  3SLC A;  3VEX A;  5AQO A;  2QWL A;  4K43 A;  3U4L A;  5AQN A;  4M63 C;  4K25 A;  3R6M A;  1KAZ A;  5KPZ A;  4IJA A;  1GLJ O;  4FSV A;  1NGD A;  4EHU A;  3LDN A;  3EL2 A;  3CET A;  4A2A A;  2I7P A;  4BRQ A;  4PL7 A;  4WQ4 C;  5AQY A;  1ATS A;  3JXU A;  4CD1 A;  3EZW A;  1HKG A;  3D2F A;  3ZX3 A;  3BEX A;  3D2E B;  4CJ7 A;  5FPE A;  5KQ8 A;  3M6G A;  3VGM A;  4H5T A;  3O5B A;  3ULE B;  3VF4 A;  4CBU A;  2P9U B;  4BRF A;  4FWS A;  1HKC A;  2YI1 A;  4BC3 A;  1JCG A;  2V52 B;  4A2B A;  4CZH A;  5AQW A;  4FOI A;  5AQF A;  1X3M A;  3VEV A;  5BPN A;  1Z05 A;  2QWQ A;  4EFH A;  3ENO A;  1CZA N;  4QS8 A;  5E26 A;  1TUU A;  2E20 A;  3C0B A;  4H0T B;  4LC9 B;  4BR0 A;  2CGK A;  4B1W B;  5LJV A;  3KZB A;  2ZF5 O;  1GLF O;  3L4I A;  3CI5 A;  2E2P A;  4H0O A;  3SMP A;  1TYQ B;  4MO4 A;  2FXU A;  2A41 A;  3CIP A;  3IFR A;  3GDQ A;  3WXI A;  3ZET B;  5F1X A;  3CQX A;  4BC4 A;  5AZJ B;  5BN8 A;  1NMD A;  5BRE A;  1T6C A;  1H1V A;  2QWP A;  5AFU H;  2E2Q A;  1NGH A;  4ISE A;  3FZM A;  3HI0 A;  1HLU A;  1GLA G;  4RTF D;  4B9Q A;  3AAR A;  2ITM A;  3MK6 A;  1U2V A;  3UKR A;  3J8A A;  5FPM A;  2YHX A;  4A62 A;  3EKS A;  4B1X B;  4BGB A;  4O5F A;  4BRG A;  1NGA A;  2YHW A;  4KBO A;  4FWQ A;  4GY2 B;  3QDK A;  4QS7 A;  3C7N B;  1Q18 A;  4ISF A;  3W3D A;  1DEJ A;  1NM1 A;  4MO5 A;  2Q31 A;  2YJF A;  4M7Y A;  1T6D A;  3ZX0 A;  3TPQ A;  4FWN A;  4FOE A;  2NRH A;  3WEE B;  3KVG A;  1DKG D;  3CJB A;  3VES A;  3DXK B;  4BRD A;  4F9O A;  2V7Z A;  4IWV A;  3ID8 A;  5FPD A;  1NGJ A;  1SQK A;  2E88 A;  5ADX A;  1QQM A;  2YJE A;  3VEW A;  5AFU A;  4I6M B;  2D4W A;  2ASM A;  1V4S A;  5B8H A;  2FLO A;  2QWN A;  5KQD A;  5AQT A;  3UE5 A;  3G25 A;  3ZEU B;  4CZM A;  1GLE G;  1GLD G;  5ELZ A;  2HF4 A;  2FF6 A;  3I8B A;  5AZI A;  3FFK B;  5EY4 A;  1QZ5 A;  4MLH A;  3GOI A;  2P9I A;  2FF3 B;  5LJW A;  2QWR A;  3A0I X;  4WYB A;  3AY9 A;  4NB4 A;  1ATN A;  3A5L C;  3WQT A;  2IVO A;  4XH4 A;  4K41 A;  4H0P A;  3ULE A;  2A42 A;  3A5N C;  3VEO A;  2IVP A;  4PKG A;  5KPR A;  1QQN A;  3O8M A;  2VWB A;  5AQZ A;  3EKU A;  1J6Z A;  5EOY A;  3BP8 A;  4H5V A;  3VF6 A;  2PBD A;  4O8K A;  4BR7 A;  3AAP A;  2NZT A;  4NO7 A;  4GNI A;  4BR9 A;  1TYQ A;  4JD2 B;  3A5M C;  3P4I A;  5AQI A;  3O1B A;  3LDO A;  4ISG A;  2D1K A;  2P9L A;  2KHO A;  4YDU C;  1YAG A;  2P9P A;  5AQX A;  2GWJ A;  3MN5 A;  3R9P A;  4WQ5 C;  3GE1 A;  3DXM A;  3FLC O;  4CZI A;  4CZK A;  3H1Q A;  5AR0 A;  2PAV A;  1IG8 A;  3U9Z A;  4E1J A;  4EHT A;  1QHA A;  3VEY A;  4BRA A;  2IIR A;  1C0F A;  3DWL A;  4CD3 A;  1RGI A;  4FO0 A;  4H03 B;  3M3Z A;  3CER A;  1G99 A;  2P9N B;  2GUP A;  1MA9 B;  3VGL A;  2P9K A;  1HX1 A;  1QZ6 A;  3F9M A;  4BRL A;  3H46 O;  1MWM A;  5AQU A;  2VYP A;  4DQ8 A;  3MCP A;  4FWO A;  2ZWH A;  2HMP A;  2FSJ A;  4XH1 A;  2UYT A;  3TU5 A;  1YUW A;  2OAN A;  3ATU A;  2H3G X;  4J8F A;  3L6Q A;  4FPB A;  3LDL A;  4I6M A;  4MLE A;  4BRN A;  2FSN A;  1NGE A;  2DPN A;  1LOT B;  1BA1 A;  1V4T A;  3OHR A;  3QFP A;  1ZBS A;  2GTD A;  2E2N A;  2CGL A;  4CZE A;  2W40 A;  3RSE A;  4H5W A;  4CI6 A;  3O1W A;  2E8A A;  3SK3 A;  4CZF A;  3SJH A;  3GL1 A;  4EAH D;  2Q0R A;  2E1Z A;  4BRE A;  1BWF O;  1YVN A;  1WUA A;  5BRD A;  1HUX A;  3L0Q A;  1HPM A;  1ESV A;  1S3X A;  4DB3 A;  1WOQ A;  2P9S B;  4JHD A;  4A61 A;  1Z6R A;  1BOT O;  2CH6 A;  3LDP A;  2FSK A;  3LM9 A;  3CHW A;  3UKU A;  3U9D A;  2Q97 A;  5BN9 A; 
#chains in the Genus database with same CATH topology
 1ILY A;  3FFI A;  3BF3 A;  4DFM A;  3CJ7 A;  1RTI A;  3K59 A;  1NK9 A;  2NUB A;  1FJG K;  5LY3 A;  3ZT3 A;  1O13 A;  2VQE K;  4FYD A;  5KPT A;  1HNW K;  4FWR A;  3WT0 A;  1TL1 A;  1J9A A;  1IKW A;  1WSJ A;  4FJ8 A;  3MX2 A;  4KI4 A;  5CYM A;  3UKR B;  2ITG A;  2B6A A;  4LF9 K;  2WBN A;  2HOE A;  1ZXO A;  2OPQ A;  3GBT A;  3HSC A;  1NK8 A;  4BR2 A;  2O8B B;  3VPZ A;  4M3U A;  3M8P A;  3ENB A;  2D0A A;  2RPI A;  1X1P A;  5C15 A;  3HL8 A;  1S9G A;  1KC8 O;  4QS9 A;  1OH5 A;  1Q82 O;  3WNF A;  4B1V A;  4I9Q A;  3J7A P;  1NLV A;  2G8H A;  3HM8 A;  3QNN A;  5HLF A;  4LF8 K;  2Z1J A;  4CF9 A;  3ZLJ A;  3HST B;  4WQ5 A;  3FZH A;  4L3Q A;  1HQU A;  2VGM A;  2BGG A;  4GV9 A;  3HBT A;  3ULD A;  4Y0W A;  3KD1 E;  1U6Z A;  4B1Y B;  3OJU A;  5AZI B;  4FK4 A;  4LF6 K;  3M1F A;  2P9I B;  1RDW X;  3AO2 A;  5JIC A;  4FLY A;  1VQP N;  2RN2 A;  1GLB G;  2O8E A;  1Z26 A;  3HZ6 A;  1W2B M;  3DLE A;  4K8X A;  4BRO A;  3FE1 A;  3PSI A;  4IEE A;  5AQR A;  3QFU A;  3C7N A;  3AVA A;  3KIO A;  3L3U A;  2EWS A;  3WEE A;  5GAH P;  4CHP A;  1TK8 A;  1K9M O;  1NGG A;  3AVG A;  4ILJ A;  4BY9 C;  3HP6 A;  3WQU A;  1RT2 A;  4JI3 K;  1BU6 O;  4OPH A;  3H3O B;  2O8C B;  3QET A;  1FW6 A;  4DR6 K;  4OLA A;  1NJZ A;  5ADX H;  4W5O A;  1X9J A;  1KAX A;  3CF5 L;  4CJF A;  4DWI A;  3NMU A;  3WNH A;  1LAV A;  4BWJ A;  1JLC A;  1RDA A;  1T3V A;  5FPN A;  3CQ8 A;  1ZC6 A;  3GG4 A;  4OPJ A;  1RT5 A;  4BRH A;  1KLM A;  4G1Q A;  3AVL A;  3EN9 A;  1K6Y A;  1LWF A;  1QE1 A;  3LDQ A;  3LZI A;  5AQK A;  4CGF A;  2A3Z A;  1TL3 A;  3FR0 A;  4BQZ A;  1BI4 A;  3TI0 A;  1BG3 A;  3T19 A;  1MWK A;  4B9M A;  5C2F A;  1N33 K;  4LY7 A;  4GMJ B;  4BRC A;  3VEN A;  3H3N O;  1NK7 A;  1X9W A;  2O8D A;  4B9T A;  4GVM A;  4OPA A;  1YVU A;  4CCH A;  4Y1D A;  5AQL A;  4DV5 K;  3SV3 A;  4CGG A;  2HHW A;  3WXK A;  4CGD A;  4OLB A;  5BR9 A;  1YXQ A;  2YCH A;  3CCE N;  3MAQ A;  1LCU A;  2JWK A;  1YI2 N;  3CJ9 A;  1NGB A;  4DUY K;  1NGF A;  4FWM A;  2W41 A;  4DQS A;  1L3T A;  3LP3 A;  3VTH A;  4M7X A;  3UB5 A;  3VQE A;  1HNV A;  3TR8 A;  1HNZ K;  1XC3 A;  4LH5 A;  3ALY A;  4DTN A;  1RCH A;  3QIN A;  2QWO A;  2ASP A;  4RWT A;  4LFB K;  1IBM K;  3KLF A;  4PY5 A;  4RCH A;  5I9E B;  3A8Y A;  3DLR A;  3KHY A;  3R3L A;  4JHD B;  2BDP A;  2A5X A;  3CXC M;  1M1K O;  3NF8 A;  2QWL A;  4K43 A;  3ZSV A;  4ZTJ A;  5J2P A;  1ZBU A;  1BQN A;  3V4I A;  4FK2 A;  1G15 A;  5GAE P;  4ZHR A;  3CCM N;  4K25 A;  3QEP A;  4DFP A;  5FRO A;  2E5L K;  5KPZ A;  3VQ7 A;  3EL2 A;  4DU4 A;  1Y97 A;  4MQ3 A;  3G4S N;  4CFB A;  2G8I A;  3CPW M;  4CD1 A;  3C65 A;  3P1G A;  4IO9 L;  3V9S A;  4CJ7 A;  3L8B A;  1TAQ A;  2P9U B;  4XIU A;  1WLJ A;  4CEC A;  1SL2 A;  3OBY A;  4BRF A;  4FWS A;  2YI1 A;  4DF4 A;  3OYH A;  3CC2 N;  4A2B A;  3TTF A;  4O0J A;  2IOC A;  2G8K A;  4U7B A;  1CZA N;  1JLA A;  4BR0 A;  4LC9 B;  5LJV A;  5IWA K;  3VQA A;  1GLF O;  3L4I A;  3SMP A;  1SL1 A;  3WXI A;  3ZET B;  2Y1I A;  4KV8 A;  3U6F A;  5F1X A;  3RR8 A;  4FXD A;  2YNH A;  1RDC A;  1NMD A;  1T6C A;  5AFU H;  4UQG A;  2E2Q A;  1NGH A;  4Z4F A;  1RBR A;  1HLU A;  2Z1G A;  1VQO N;  5H1S Q;  3C6U A;  4LD0 A;  4B9Q A;  3MK6 A;  4RW8 A;  5FPM A;  4BE0 A;  4RW6 A;  4KTQ A;  4KBO A;  1U49 A;  4JI8 K;  3KD5 E;  1S9E A;  1Q18 A;  1JLB A;  4DSE A;  1B9D A;  4F8R A;  1VSL A;  4CJ3 A;  3CCJ N;  2QK9 A;  1RT7 A;  4PA1 A;  4LF5 K;  1QS4 A;  3OYN A;  4FWN A;  4M45 A;  3KVG A;  4DTU A;  2D0C A;  4UY8 O;  4CGH A;  4YOV A;  2V7Z A;  2OZS A;  5FPD A;  3NBP A;  2YJE A;  3VEW A;  4FZX C;  2ASM A;  1DLO A;  5KQD A;  3ZEU B;  4CZM A;  5ELZ A;  3FFK B;  5EY4 A;  1QZ5 A;  3B6O A;  2W6L A;  4CEO A;  1ITG A;  1B9F A;  3QEW A;  1YHQ N;  2ZJQ L;  4FJJ A;  4DV4 K;  4DR5 K;  3CCR N;  1WSG A;  3A0I X;  3V9X A;  4WYB A;  3AY9 A;  3HT3 A;  3VQD A;  5M1F A;  2F8T A;  4PUO A;  3RVC A;  3T1H K;  4K41 A;  4C1N I;  3RMD A;  2DFF A;  3C6H A;  4JI5 K;  4HUF A;  3VQ4 A;  4B9N A;  1I39 A;  2F8S A;  3CCQ N;  1QQN A;  3VQQ A;  1VQ6 N;  2YKM A;  1LW0 A;  3OYJ A;  1SKW A;  4H5V A;  1VQK N;  2QKK A;  2PYL A;  4AHV A;  4BR9 A;  1WSF A;  4GNI A;  4I2P A;  1TYQ A;  4MFB A;  4Z4C A;  1A5X A;  2XY7 A;  1NOY A;  3A5M C;  5AQI A;  1VQ7 N;  2D1K A;  4YDU C;  2KHO A;  3Q7C A;  3TTD A;  4YOX A;  3ZSR A;  3K57 A;  2PZS A;  4CZK A;  3KTQ A;  3J7Y P;  5AR0 A;  3DLB A;  1IG8 A;  1S1T A;  3QIO A;  4B8C A;  3U9Z A;  4AF1 A;  2OZM A;  4RW7 A;  4HCB A;  3P38 A;  4M3T A;  3T69 A;  3OYF A;  4Z4I A;  4OPK A;  3AVI A;  3J7Z O;  2JGU A;  4H03 B;  4JI6 K;  4DV0 K;  4DU1 A;  3HM9 A;  4LSL A;  3NGY A;  4JKG A;  1HX1 A;  3F9M A;  3H46 O;  1A5W A;  1D8Y A;  1P90 A;  5AQU A;  3O3G A;  1Q9X A;  5JS1 A;  1J54 A;  4J2A A;  2IC3 A;  2VYP A;  4DQ8 A;  2GX9 A;  5M1P A;  3OYC A;  2FSJ A;  3VTI A;  2BAN A;  4I2Q A;  1YUW A;  3ATU A;  4J8F A;  3L6Q A;  5HOO A;  3SQ1 A;  4I6M A;  4BRN A;  3C94 A;  3EZ5 A;  1NGE A;  1LOT B;  1BA1 A;  3KJV A;  1NK6 A;  3CG7 A;  4M3W A;  3RSE A;  3PLA A;  4DTJ A;  4B8A B;  4H5W A;  4CI6 A;  2W6K A;  2QEX N;  5SWM A;  3SJH A;  4EAH D;  1BWF O;  3AVF A;  1XC9 A;  5AJ3 K;  1HUX A;  4N5S A;  1WOQ A;  2P9S B;  3NH1 A;  4A61 A;  3LM9 A;  4Z4G A;  4AHS A;  3I56 N;  1NNE A;  4DTR A;  1HPZ A;  4C8O A;  3HRG A;  3V1R A;  4CHZ A;  5JVG L;  1J5E K;  1WBB A;  5DM6 L;  3CQY A;  3MED A;  5BRF A;  3HO1 A;  2E6M A;  4HWI A;  4OO1 J;  1P8Z A;  1XUP O;  4BVP A;  2HBM A;  2GEL A;  5AQS A;  4DCH A;  3IMX A;  5CZ2 A;  2HBJ A;  4N76 A;  5AQQ A;  3AA3 A;  2WON A;  2FBV A;  3AGR A;  3H6E A;  3VET A;  3P83 D;  1YIT N;  2ASO A;  4FWK A;  3D2E A;  4EP4 A;  1FKO A;  1Q81 O;  3A5O C;  3H1V X;  4O4G A;  2QWM A;  2O8F A;  4DSL A;  3RWU A;  1XNR K;  1CXQ A;  3O80 A;  4JKE A;  4DQR A;  3L3V A;  3HPO A;  3BZK A;  4BRK A;  4IO8 A;  3QIC A;  2Q1N A;  2E1Y A;  3CM6 A;  4A5B A;  4IXC A;  4FM0 A;  4E7L A;  3ZSX A;  3MEC A;  4O44 A;  4OKJ A;  4DR3 K;  1EXQ A;  4KH4 A;  2HBK A;  4CHY A;  4B9L A;  4B3M K;  2V7Y A;  3CPE A;  5KTQ A;  2WUS A;  2QI2 A;  3AVC A;  5T7B A;  3SUN A;  4FWP A;  1EQY A;  3LWL A;  4WF9 L;  4FLX A;  2F9T A;  5D3G A;  1QQO A;  1K8K B;  1KFD A;  3O6W A;  2BTF A;  1NWK A;  2Q2R A;  5C0Y A;  3IDH A;  1VQM N;  4BDY A;  5M1N A;  1BO5 O;  2BE2 A;  3JS6 A;  4CFD A;  2XO7 A;  4CK2 A;  5E84 A;  1RBS A;  4H5R A;  3OS1 A;  2HBL A;  4E7I A;  1BDG A;  1LWC A;  3PV8 A;  4DQP A;  2CGJ A;  2KFN A;  1C0G A;  2QM1 A;  1NKC A;  4JAX A;  4NYF A;  4ID5 A;  2NRW A;  1TVR A;  2ZM6 K;  4DQI A;  1I94 K;  3MN6 A;  3SQ2 A;  1RT4 A;  3DAW A;  1BA0 A;  5J2Q A;  1UOC A;  5BRH A;  4JNE A;  3D2F B;  4Z94 A;  5JLH A;  2P9L B;  3M8S A;  4F4K A;  3T7Z A;  4YOY A;  3HOS A;  5F0X A;  1QTM A;  4Z0U A;  3S3O A;  3QBX A;  4B1U B;  2G8W A;  1CXU A;  4CBW A;  3G0Z A;  4L8R B;  4B1Z A;  4DR1 K;  3AVB A;  5AQP A;  4FPA A;  1MU2 A;  1BUP A;  4N47 A;  2BH1 A;  2P1J A;  4NCG A;  2X78 A;  4BRM A;  1JCE A;  1BCO A;  3DLL L;  3KKR A;  1BCM A;  4BC2 A;  1SKR A;  2WOM A;  1QVG M;  3BGR A;  1L3V A;  2XY5 A;  4PQU A;  1KD1 O;  4DV7 K;  3KLI A;  4B3O A;  4CJQ A;  2AP1 A;  1N8R O;  2JLE A;  3U8X A;  2OCE A;  4E7H A;  3TAN A;  1RIL A;  4BRP A;  3QO9 A;  1YTU A;  4AM6 A;  1DGK N;  1R59 O;  4BAC A;  4AQY K;  1XNQ K;  4M3Z A;  4JYA K;  3L2W A;  5KRS A;  4ID1 A;  1KQS M;  3AVK A;  4O5B A;  2HST A;  4XH5 A;  4E7J A;  2EHG A;  3K5L A;  4B9V A;  4DHY A;  3SBG A;  1S72 N;  1QVF M;  2NLX A;  4BR5 A;  4AM7 A;  3MDQ A;  4ILH A;  2IS3 A;  3EE8 A;  2A1S A;  1RDU A;  3Q7B A;  1JCF A;  5EX5 A;  4JI2 K;  1N6Q A;  3R8E A;  3OTO K;  5GIP A;  3U3Y A;  2A6A A;  3VQC A;  3DRP A;  4JK8 A;  2D5R A;  3A2F A;  1YF5 L;  3S41 A;  3WNG A;  3UKU B;  2P9N A;  1LAW A;  3SLC A;  5AQO A;  3VEX A;  3L2Q A;  4DQQ A;  4FW1 A;  3RR7 A;  1L3S A;  4FJ7 A;  4M63 C;  3R6M A;  1KAZ A;  4YY3 K;  2HVI A;  4EHU A;  4FK0 A;  3O9S A;  3NH2 A;  3V9Z A;  1CZB A;  2PYJ A;  2O8C A;  3JXU A;  3NF7 A;  3EZW A;  4YHH K;  1OH7 A;  3ZX3 A;  5J2M A;  2GV9 A;  5FPE A;  3SAF A;  4HHT A;  3M6G A;  3VGM A;  4YFU A;  1U48 A;  3ULE B;  3VF4 A;  4CBU A;  2NNW A;  3HVT A;  4J2D A;  1JCG A;  1RBU A;  1IBK K;  2HHT A;  4FOI A;  5AQF A;  3G6E N;  4JK7 A;  3SAG A;  3H08 A;  5BPN A;  1Z05 A;  1DTQ A;  2UXD K;  1TUU A;  4KKO A;  2CGK A;  3ZSW A;  4CEE A;  2ZF5 O;  3LPT A;  5GAD P;  4MO4 A;  2FXU A;  3G71 N;  2A41 A;  3PIP L;  3IFR A;  3PIO L;  3GDQ A;  4CIF A;  3TSP A;  1H1V A;  2QWP A;  5GAG P;  4BWM A;  4FJN A;  3TAB A;  4J2B A;  4ISE A;  4TSX A;  4KTZ A;  1GLA G;  3AVH A;  4GV3 A;  2UUA K;  4CES A;  1U2V A;  3J8A A;  2O8E B;  2YHX A;  3NGZ A;  4BRG A;  1NGA A;  2YHW A;  3SUQ A;  1S1X A;  1RT1 A;  3C7N B;  2E4L A;  4ISF A;  1DEJ A;  5IT9 O;  3K9J A;  5FLX O;  3VMF B;  3ZX0 A;  3I55 N;  3LAM A;  2YNI A;  3O4N A;  1JLF A;  2HNY A;  3WEE B;  4U67 L;  4OGC A;  1REV A;  3CJB A;  4FM2 A;  4F9O A;  3KKS A;  1WNS A;  1T7P A;  5LMN K;  4GW6 A;  3L4Q A;  3DLH A;  3ID8 A;  2E88 A;  4OX9 K;  1W0H A;  5DK5 A;  5HRP A;  3MXM A;  3ZT0 A;  4FZZ A;  1JL1 A;  2FLO A;  3U3G A;  1GLE G;  4F3T A;  1UAX A;  2HMI A;  4B3T K;  3ZSO A;  3OY9 A;  3THV A;  2VQF K;  1C1B A;  4FJL A;  1YTA A;  4O8U A;  3I0R A;  1C0U A;  3E9L A;  5LJW A;  2Y1J A;  2QWR A;  3LP1 A;  5HBM A;  4FVM A;  2WC9 A;  1TAU A;  4NB4 A;  1BI4 B;  2FBT A;  2YKN A;  4XH4 A;  4H0P A;  3THW B;  4K8Z A;  2A42 A;  1GOB A;  4E89 A;  3A5N C;  2YNF A;  3AA5 X;  1T05 A;  2YHA A;  5C25 A;  5LL6 Z;  4KTW A;  4JEP A;  4WCE L;  4BE2 A;  2OPR A;  3BP8 A;  2PBD A;  4E1N A;  3HPG A;  4WFB L;  3C6A A;  2VG5 A;  1TKX A;  3LDO A;  4ISG A;  1YAG A;  2P9P A;  5J1E A;  3K2P A;  4M3Y A;  4KH5 A;  3SPY A;  3R9P A;  4WQ5 C;  2OPS A;  3DXM A;  1JKH A;  4CZI A;  3IRX A;  3K9K A;  3I8D A;  3MCA B;  3T1Y K;  4WFN L;  2PAV A;  1IKY A;  2RHK A;  1IBL K;  4JKD A;  3IS9 A;  1FXX A;  4EHT A;  3J81 O;  4BRA A;  4DS5 A;  3SQ4 A;  3ZSZ A;  4O0I A;  1EX4 A;  3EYZ A;  1M90 O;  1J5O A;  1L5U A;  1RGI A;  4DU3 A;  3M3Z A;  1S1W A;  2GUP A;  1BIU A;  2P9K A;  1QZ6 A;  1TGO A;  3LAL A;  1EET A;  3MCP A;  1C0M A;  1WSE A;  4FWO A;  2ZWH A;  2NRV A;  1HQE A;  2HMP A;  1OH8 A;  2D0B A;  3MWT A;  2YX6 A;  3THX A;  2NRR A;  1L3U A;  4KRF A;  3LDL A;  3PUF A;  4MLE A;  3LWM A;  3NCI A;  4F3O A;  1ZBF A;  3AA2 A;  1NK5 A;  1NJY A;  5DMR A;  1V4T A;  3AV9 A;  3NFA A;  2E2N A;  4CZE A;  1D5A A;  3OYK A;  2RE2 A;  5KGX A;  2E8A A;  3SK3 A;  4CIG A;  4JRQ A;  1RTJ A;  3NAE A;  1HYZ A;  2E1Z A;  3TTC A;  1WUA A;  1U4B A;  5BRD A;  1HPM A;  1S3X A;  3K5N A;  4FJH A;  1B92 A;  3QEX A;  3OYI A;  3CHW A;  4DMN A;  4KHQ A;  1DT9 A;  3U9D A;  2Q97 A;  3LZJ A;  3OS2 A;  4I9L A;  3SQ0 A;  1W9H A;  4DV3 K;  4V19 S;  3C6T A;  2ETJ A;  1GOA A;  2RKI A;  3OYE A;  4DR4 K;  4OJR A;  5CR4 A;  3SMS A;  4EIA A;  3BF1 A;  1OKJ A;  4BC5 A;  3IUC A;  1SL0 A;  1D9F A;  3D6R A;  3PSF A;  1WAJ A;  1HRH A;  4OGE A;  3DJC A;  3MXI A;  4DSJ A;  3ATV A;  2ZGZ A;  4JI1 K;  4PWD A;  3TAR A;  3V6D A;  2D0P A;  1OVQ A;  4F2S A;  2VCP A;  4IFY A;  3HTV A;  3RRH A;  4PKH A;  2F9W A;  2LSN A;  4DSK A;  3TSU A;  4FWL A;  4WQ4 A;  4RG8 A;  5LMU K;  2GEM A;  3O4W A;  5TKY A;  2R7Y A;  3OW2 M;  4CZL A;  3AO4 A;  3OYM A;  1BL3 A;  2HF3 A;  4CHQ A;  3SI6 A;  3QB0 A;  3MEE A;  2VWK A;  2ZQB A;  1JL2 A;  3N4P A;  5M1O A;  4IOA L;  5AZJ A;  4KAZ A;  5GIO A;  4JKC A;  4CF1 A;  4KB0 A;  2X6N A;  2I7N A;  2VG7 A;  3OBW A;  1HNI A;  3KK2 A;  3SUP A;  3AO3 A;  2ZGY A;  1UWB A;  1NGI A;  3CME N;  3VQB A;  4IJN A;  3ZCM A;  3PO5 A;  3SUO A;  3D7E O;  4JN4 A;  4DUZ K;  4FJK A;  3VQ8 A;  3E9P A;  2HHV A;  1KCF A;  4BVO A;  1TUY A;  1YJN N;  3JSM A;  2KZZ A;  4CF2 A;  4YNQ A;  3LDS A;  3DMJ A;  1E4F T;  4W5T A;  4IFE A;  5HRR A;  4DTO A;  3HK2 A;  4CJL A;  2AA4 A;  2DFE A;  3VOV A;  3DXK A;  2UUB K;  1T44 A;  2P9S A;  5CE3 A;  3DLK A;  3F5T A;  3KWG A;  5DM7 L;  3ENH A;  3E01 A;  2OTJ N;  5JLF A;  4DR7 K;  4Q5V A;  2VG6 A;  1S6P A;  4C23 A;  1NOZ A;  4WFA L;  4N41 A;  3LP2 A;  2ATQ A;  1GLC G;  1OVY A;  1SKS A;  1VQ4 N;  3MMV A;  3KK7 A;  1E4G T;  4FW2 A;  2YHY A;  5AQJ A;  2UXB K;  4WE1 A;  4JI0 K;  3LL3 A;  1JXB A;  2ZD1 A;  3NH0 A;  1QSS A;  4XEI A;  4KFB A;  4H5N A;  4QCL A;  4O55 A;  3SPZ A;  4JKG B;  3FZL A;  1X9M A;  1WN7 A;  1VQ5 N;  1HYV A;  3K5O A;  5KRT A;  3L2U A;  4FCY A;  2QXL A;  4IDH A;  2YHB A;  4W5N A;  2Q36 A;  4DFK A;  4ELT A;  5GIN A;  1F21 A;  4JD2 A;  1S22 A;  4FL9 A;  1QHT A;  3CJC A;  2YV0 X;  3N4Q A;  3BDP A;  3PY8 A;  4Q0B A;  1ASV A;  4X66 K;  1LW2 A;  4H0Y B;  3HXM A;  5KGW A;  3MN9 A;  4FLT A;  3B8A X;  3JYT A;  2Q0U A;  4JKF A;  4CEZ A;  1ASW A;  2D0O A;  2OA8 A;  3LM2 A;  2DTU A;  4C8M A;  3RSE B;  1KTQ A;  5C24 A;  4KHW A;  3SYZ A;  3VEZ A;  1K8K A;  1NU0 A;  3VF2 A;  1KXP A;  5EXW A;  3ZT2 A;  3THY B;  3WXL A;  5KI6 A;  2HND A;  3VQ9 A;  4FLU A;  4M42 A;  2XHB A;  2OYQ A;  4KRE A;  1EWR A;  4CJR A;  2IGI A;  1I3A A;  2NRX A;  3HP9 A;  4IJA A;  5HL7 L;  3VA0 A;  3NVM A;  3CET A;  4BRQ A;  2I7P A;  4PL7 A;  4BDZ A;  3V9W A;  2VGN A;  4WQ4 C;  2UUC K;  1UA1 A;  1E3M A;  4E19 A;  4JRP A;  1HKG A;  3D2F A;  5EU7 A;  1HNX K;  3D2E B;  4BC3 A;  1JLQ A;  3ZSY A;  3K0S A;  2HHX A;  3MX5 A;  1A5V A;  5AQW A;  3DLG A;  2DY4 A;  1X3M A;  3VEV A;  3TAF A;  5I42 A;  2QWQ A;  3ENO A;  4B3R K;  4QS8 A;  5E26 A;  3QNO A;  1YJ9 N;  2E20 A;  4GVE A;  4H0T B;  2ZJP L;  4IDK A;  3JAM O;  2E2P A;  2W42 A;  4CJ4 A;  4HUE A;  1IKX A;  5MLC Q;  1NJI O;  4GKJ K;  4MDA A;  4CEA A;  3MWP A;  5BN8 A;  5BRE A;  4CHO A;  2X6S A;  5E41 A;  3QLH A;  1C1A A;  3FZM A;  3HI0 A;  4OKK A;  4FJI A;  3SV4 A;  1NK4 A;  3PX4 A;  4B08 A;  2HHS A;  3UKR A;  2HHQ A;  1NG9 A;  3EKS A;  4B1X B;  4O5F A;  3D0P A;  3ISN C;  4GY2 B;  5JS2 A;  4DTM A;  3S3M A;  3G10 A;  4LFC K;  4MO5 A;  1RT6 A;  2YJF A;  4M7Y A;  1T6D A;  1UA0 A;  1QSL A;  2O8B A;  3TPQ A;  3V1Q A;  2F7T A;  4FOE A;  3LP0 A;  3CD6 N;  1DKG D;  1XWL A;  1X9S A;  1T03 A;  4IWV A;  3TSQ A;  1SQK A;  1QQM A;  4CED A;  5AFU A;  4CJ5 A;  1TKZ A;  3NDK A;  3I0S A;  1V4S A;  5B8H A;  1VRT A;  5C10 A;  2QWN A;  5HRO A;  4ELV A;  3UE5 A;  4NXN K;  3G25 A;  4FLW A;  1VHX A;  2HF4 A;  2FF6 A;  3I8B A;  3CFO A;  5AZI A;  3TAM A;  3ITH A;  1O1W A;  4IG3 A;  1VSK A;  5HRS A;  4MLH A;  1BHL A;  4NLC A;  1KVC A;  2P9I A;  4IFV A;  3TAE A;  3ZT1 A;  4IEI A;  4DFJ A;  3A5L C;  3DRR A;  3WQT A;  4KH6 A;  2Q3S A;  3ULE A;  5C42 A;  4JI4 K;  2ZE2 A;  4DR2 K;  2KQ2 A;  1VQ9 N;  2IVP A;  4PKG A;  5KPR A;  3CFR A;  3O8M A;  4FJX A;  2UXC K;  2VWB A;  1ZBL A;  5AQZ A;  5CYQ A;  3EKU A;  1J6Z A;  5EOY A;  3VQ6 A;  1XI1 A;  3V81 A;  4IBN A;  4O8K A;  3AVJ A;  4BR7 A;  4CE9 A;  4CJS A;  3B6P A;  1Z25 A;  2NZT A;  4NO7 A;  4EP5 A;  4AIL C;  4N56 A;  3P4I A;  1K73 O;  1TK5 A;  1KLN A;  1NKE A;  1NJX A;  3TAP A;  1JXE A;  3F2K A;  3MN5 A;  4A57 A;  3CYM A;  3PO4 A;  4JS5 A;  1EO1 A;  3H1Q A;  2QKB A;  5I3U A;  4E1J A;  1N32 K;  4CJU A;  3VEY A;  5M1K A;  4Z4H A;  2O4G A;  4KHS A;  4DLG A;  3S9H A;  4IKF A;  4QAG A;  3O3F A;  3CER A;  2P9N B;  3LAN A;  1MA9 B;  1U45 A;  3VGL A;  1Q86 O;  1TK0 A;  4BRL A;  2G8U A;  4AHT A;  1MWM A;  3C95 A;  1TKD A;  2HB5 A;  1VSJ A;  3TU5 A;  1HJR A;  2UYT A;  4LF4 K;  2OAN A;  2H3G X;  1GOC A;  4B9U A;  5M1Q A;  4C8K A;  3BY5 A;  3RMB A;  1JJ2 M;  4M41 A;  3O3H A;  3T1A A;  2QXF A;  2DPN A;  4NXM K;  4CHN A;  1EWQ A;  3OHR A;  3QFP A;  4GV6 A;  2CGL A;  2W40 A;  4R79 A;  2F96 A;  4BDP A;  3O1W A;  3WNE A;  3AVM A;  3CM5 A;  4AHR A;  1QQC A;  2Q0R A;  1C1C A;  1BIZ A;  4BRE A;  3OYA A;  1YVN A;  2P5G A;  3L0Q A;  2PFU A;  4JI7 K;  4DB3 A;  3AVN A;  4OKE A;  2XY6 A;  4JHD A;  4CFC A;  1Z6R A;  1BOT O;  3LDP A;  2FSK A;  4LSN A;  3THW A;  2E6L A;  5BN9 A;  4A5A A;  5A2Q O;  1IO2 A;  1NBW A;  4CEB A;  1BGX T;  3VER A;  4JKA A;  4AH9 A;  1KRP A;  4JS4 A;  3ZSQ A;  4BR4 A;  1XHX A;  4R5P A;  2BUP A;  4ILG B;  2VWJ A;  2HVH A;  2V51 B;  1VQN N;  4IG0 A;  3LAK A;  1LV5 A;  2WFB A;  3I33 A;  3OYB A;  2GWK A;  1U2V B;  4KPY A;  3WXM B;  5JVH L;  3R1X A;  5AQG A;  3NHG A;  4Z4E A;  1EKE A;  1JLE A;  1S5J A;  3EEQ A;  3O08 A;  4DV6 K;  2IAJ A;  2FBX A;  5CY4 A;  2B4J A;  2FBY A;  1MDU B;  2P9U A;  2P5O A;  3CFP A;  4RW4 A;  2Z1H A;  4CVN E;  2O8D B;  3O9Q A;  1NGC A;  2E2O A;  2A1R A;  3HVR A;  1NKB A;  3WUH A;  2QA4 N;  3E1Y A;  3AO5 A;  3FGU A;  3QML A;  3HYF A;  1X3N A;  4YDU A;  2J4R A;  1VSM A;  5CZ1 A;  3L2V A;  4BQL A;  4DLE A;  5F2R A;  2GUI A;  4FLV A;  5AQM A;  3RRG A;  5TKW A;  3ZET A;  1WBD A;  3NVK A;  1LWE A;  3BUZ B;  5AQV A;  3K58 A;  1D4X A;  1VSF A;  3QEV A;  2PY5 A;  4GKK K;  2A40 A;  1U47 A;  5HP1 A;  5BPL A;  3CC7 N;  2IDO A;  1VAZ A;  4DF8 A;  3F73 A;  1N5Y A;  3OA9 A;  4IZ9 A;  2IVN A;  4DSF A;  4CIE A;  2I5J A;  2AJQ A;  2DFH A;  3L2R A;  4HTL A;  3KLG A;  3QIP A;  3TWH A;  2RF2 A;  4BE1 A;  4DS4 A;  1T8E A;  1XMQ K;  1IG9 A;  4X64 K;  3T3F A;  2O4I A;  1D9D A;  1GLL O;  3AAQ A;  5FRM A;  4NCB A;  2JWL A;  2HNZ A;  3TAG A;  4BRI A;  4H0X B;  1IV0 A;  4CZJ A;  4CBX A;  3M8Q A;  4DTS A;  4CJP A;  1W7A A;  4K42 A;  3MN7 A;  3KK3 A;  4CZG A;  2CH5 A;  1KSP A;  1WB9 A;  2G8F A;  2P9P B;  3CJA A;  1HKB A;  3ZEU A;  1VQ8 N;  5AQH A;  4E3S A;  4J2E A;  3IKM A;  3WXJ A;  5BPM A;  3UIQ A;  3H45 C;  1VRU A;  2QW9 A;  4M3R A;  1YT3 A;  3DXM B;  3CCL N;  3EE9 A;  4PKI A;  4IOC L;  3NF6 A;  4H0V B;  1DTT A;  1RFQ A;  2XY8 A;  3CJ1 A;  4EZ6 A;  1C6V A;  4ZTF A;  4KHU A;  1SAZ A;  1ATR A;  3K5M A;  1SV5 A;  2X74 A;  5JMV A;  3M5R A;  2P9K B;  1S6Q A;  1JLG A;  4BG8 A;  1Y64 A;  4DG1 A;  4Y1C A;  4LH4 A;  3W0L A;  4MDB A;  4H4M A;  1VK0 A;  4BGA A;  3CCU N;  4PL8 A;  4FJ5 A;  2HHU A;  1Q9Y A;  4CJW A;  3SAH A;  3OJS A;  3THX B;  4KB1 A;  3O9U A;  4CF8 A;  3J80 O;  4HTU A;  4M3X A;  3LPU A;  4DV2 K;  3FZK A;  5EVZ A;  4JKB A;  1NJW A;  1HJO A;  4BG9 A;  3EO3 A;  3FZF A;  1XQS C;  1IJJ A;  1R0A A;  3VGK A;  4KHY A;  4CEF A;  3HPH A;  1KAY A;  4DV1 K;  3P31 A;  1RBV A;  3ZX2 A;  3QBW A;  1SZ2 A;  1XMO K;  4KI6 A;  3DRS A;  1ZYQ A;  3U4L A;  4B3S K;  4CFA A;  4YOT A;  5AQN A;  3V9U A;  4CF0 A;  3O9R A;  5J2N A;  4DSI A;  4KO0 A;  1GLJ O;  3IG1 A;  4FSV A;  1NGD A;  1VSI A;  3RTV A;  4E0D A;  3F9K A;  3LDN A;  2OTL N;  4PHT X;  4A2A A;  3E66 A;  5AQY A;  1ATS A;  4NYN A;  4OVL A;  3DI6 A;  1C0T A;  4DKW A;  4NCA A;  1RTD A;  3BEX A;  3RMC A;  5KQ8 A;  4H5T A;  3O5B A;  3RMA A;  1S1V A;  1VSE A;  4JLH A;  2KLA A;  1HKC A;  4CK1 A;  2V52 B;  3HJF A;  3DM2 A;  3P5J A;  4CZH A;  4FVU A;  4C1N K;  4NLB A;  4AHU A;  3VQP A;  4EFH A;  3AGK A;  3C0B A;  4ICL A;  3IAY A;  4B1W B;  3KZB A;  3VN5 A;  3DYA A;  3CI5 A;  4H0O A;  1TYQ B;  2EX3 A;  3CIP A;  3OS0 A;  1RDB A;  3CQX A;  4BC4 A;  5AZJ B;  2QTD A;  3AO1 A;  4FJG A;  4W5R A;  3SBT A;  3O9T A;  5C12 A;  4FZY A;  4E7K A;  4HUG A;  4G9Z A;  2G8V A;  4KHP K;  3SNN A;  5FRN A;  2KFZ A;  1KVA A;  4B9S A;  3TAQ A;  4RTF D;  1W97 L;  3AAR A;  2ITM A;  4CGJ A;  2P51 A;  4YOU A;  2KZM A;  4A62 A;  1BIS A;  3E9O A;  4BGB A;  3SCX A;  2FC0 A;  4FWQ A;  1VQL N;  4CW7 B;  1K8A O;  3QDK A;  4QOZ B;  4QS7 A;  3S3N A;  5FDL A;  3W3D A;  4HVJ A;  1NM1 A;  2Q31 A;  1BQM A;  2OPP A;  4YOR A;  3CMA N;  1KVB A;  1FK9 A;  4AHC A;  4FLZ A;  2NRH A;  3VA3 A;  2KTQ A;  3KLE A;  3VQ5 A;  5BR8 K;  4X62 K;  1KFS A;  3VES A;  3DXK B;  4BRD A;  3THY A;  4X65 K;  1NGJ A;  4DTP A;  5ADX A;  3P39 A;  5HRN A;  4I6M B;  1HYS A;  3M8R A;  2D4W A;  4I7F A;  1RDD A;  2Z1I A;  5AQT A;  3NGI A;  2B5J A;  1FKP A;  1GLD G;  1TV6 A;  2HW3 A;  2YNG A;  3HOT A;  1WSH A;  1RNH A;  4CK3 A;  3GOI A;  1NK0 A;  2FF3 B;  4KHN A;  3NF9 A;  4DTX A;  1ZBI A;  4JV5 K;  4CJT A;  1TKT A;  2KKZ A;  3CCV N;  1ATN A;  3KLH A;  2IVO A;  3MXJ A;  2XRI A;  3SJJ A;  1N36 K;  1RBT A;  3VEO A;  4C8N A;  3BZC A;  3AA4 A;  3OYG A;  4FJM A;  1Q7Y O;  4LF7 K;  3VF6 A;  3DOL A;  4RW9 A;  2F4V K;  1WAF A;  3V1O A;  3AAP A;  1WSI A;  3CCS N;  4JD2 B;  3KWI A;  4E1M A;  4H8K A;  3O1B A;  4IOX A;  1SUQ A;  2P9L A;  5AQX A;  4CJE A;  2GWJ A;  1N34 K;  1SS6 A;  3GE1 A;  2NRT A;  3FLC O;  1J53 A;  2O8F B;  4F2R A;  3PX6 A;  5SZT A;  1RTH A;  1U04 A;  3QER A;  1YIJ N;  3D45 A;  1VSD A;  3MEG A;  1QHA A;  1Q8I A;  3ZYY X;  3OYD A;  4H4O A;  2IIR A;  1C0F A;  4LFA K;  3ID6 A;  3DWL A;  4CD3 A;  1QSY A;  4W5Q A;  1HMV A;  1ASU A;  4FO0 A;  4ELU A;  1G99 A;  2ZJR L;  4JKH A;  1HR0 K;  4FM1 A;  1IKV A;  3O4Q A;  1NMN A;  3DOK A;  3OYL A;  4K0K K;  2HHH K;  4A59 A;  4XH1 A;  1VSH A;  4FPB A;  3CC4 N;  3ZT4 A;  3KK1 A;  2FSN A;  2NRZ A;  3QES A;  1XHZ A;  1CLQ A;  1CZ9 A;  1RT3 A;  1ZBS A;  2GTD A;  3NE6 A;  3QEI A;  1ZBH A;  4CEQ A;  4CGI A;  4CZF A;  2WTU A;  4HCC A;  1EP4 A;  5C2D A;  3PX0 A;  1YJW N;  3GL1 A;  4JK9 A;  4EZ9 A;  4CER A;  2UU9 K;  5CHI A;  2GBZ A;  1ESV A;  4CJV A;  5K14 A;  4YOW A;  3ASM A;  1IH7 A;  3OVN A;  2CH6 A;  3SZ2 A;  1S1U A;  3UKU A;  4CJK A;  4C8L A;  4FJ9 A;  2KW4 A;  3EY1 A;  1OH6 A; 
#chains in the Genus database with same CATH homology
 1ILY A;  1NBW A;  3BF3 A;  3CJ7 A;  3HRG A;  4JKA A;  3VER A;  5JVG L;  5DM6 L;  5LY3 A;  4BR4 A;  3CQY A;  5BRF A;  2BUP A;  5CR4 A;  4ILG B;  3SMS A;  1O13 A;  4HWI A;  4OO1 J;  4EIA A;  5KPT A;  2V51 B;  1VQN N;  3BF1 A;  1OKJ A;  1P8Z A;  1XUP O;  4BC5 A;  2HBM A;  2GEL A;  3IUC A;  4FWR A;  5AQS A;  3WT0 A;  4BVP A;  3IMX A;  4DCH A;  2HBJ A;  2WFB A;  3I33 A;  3D6R A;  5AQQ A;  3MX2 A;  2GWK A;  1U2V B;  3UKR B;  3WXM B;  3AGR A;  5JVH L;  3DJC A;  3H6E A;  3R1X A;  5AQG A;  3VET A;  1YIT N;  2ASO A;  3ATV A;  3D2E A;  3O08 A;  2ZGZ A;  4FWK A;  1MDU B;  2P9U A;  2WBN A;  2D0P A;  1Q81 O;  2HOE A;  3A5O C;  1ZXO A;  3H1V X;  2QWM A;  2VCP A;  3GBT A;  3HTV A;  3O9Q A;  4PKH A;  2F9W A;  1NGC A;  3HSC A;  3O80 A;  4JKE A;  4BR2 A;  3TSU A;  2E2O A;  4FWL A;  4WQ4 A;  3VPZ A;  2GEM A;  3O4W A;  5TKY A;  3ENB A;  3OW2 M;  4CZL A;  3WUH A;  4BRK A;  4IO8 A;  3QIC A;  3E1Y A;  2QA4 N;  2Q1N A;  3FGU A;  3QML A;  2E1Y A;  5C15 A;  1X3N A;  4QS9 A;  2J4R A;  4YDU A;  4A5B A;  1Q82 O;  1KC8 O;  4IXC A;  4B1V A;  1NLV A;  4BQL A;  2HF3 A;  3HM8 A;  3QB0 A;  5F2R A;  5AQM A;  5TKW A;  3ZET A;  4WQ5 A;  3NVK A;  3FZH A;  3N4P A;  5M1O A;  4KH4 A;  2HBK A;  3BUZ B;  4L3Q A;  5AZJ A;  4IOA L;  5AQV A;  2V7Y A;  2VGM A;  3CPE A;  2WUS A;  5GIO A;  4GV9 A;  4JKC A;  2QI2 A;  3HBT A;  1D4X A;  4Y0W A;  1U6Z A;  2A40 A;  4B1Y B;  2I7N A;  4FWP A;  1EQY A;  3OBW A;  5AZI B;  2ZGY A;  5BPL A;  3CC7 N;  4WF9 L;  1NGI A;  1VAZ A;  3CME N;  2F9T A;  3M1F A;  2P9I B;  4IJN A;  1QQO A;  1RDW X;  1K8K B;  3OA9 A;  4IZ9 A;  5JIC A;  2IVN A;  1VQP N;  3D7E O;  1GLB G;  4JN4 A;  3O6W A;  2BTF A;  1NWK A;  3HZ6 A;  2Q2R A;  1W2B M;  3E9P A;  4HTL A;  5C0Y A;  3IDH A;  4BVO A;  1VQM N;  5M1N A;  1BO5 O;  4BRO A;  1TUY A;  3FE1 A;  1YJN N;  3JS6 A;  4IEE A;  5AQR A;  3QFU A;  5E84 A;  3C7N A;  4H5R A;  1GLL O;  2HBL A;  1E4F T;  1BDG A;  2EWS A;  3AAQ A;  4IFE A;  2CGJ A;  3WEE A;  5GAH P;  1C0G A;  2JWL A;  2QM1 A;  2AA4 A;  3VOV A;  1K9M O;  1NGG A;  4BRI A;  4ILJ A;  3DXK A;  4H0X B;  4BY9 C;  3WQU A;  1T44 A;  4JAX A;  4CZJ A;  4CBX A;  2P9S A;  5CE3 A;  1BU6 O;  4OPH A;  4K42 A;  3MN7 A;  3F5T A;  2NRW A;  3KWG A;  3H3O B;  3MN6 A;  3DAW A;  4CZG A;  5DM7 L;  2CH5 A;  3ENH A;  1BA0 A;  2OTJ N;  5JLF A;  5BRH A;  4JNE A;  3D2F B;  4Z94 A;  5JLH A;  2P9L B;  2P9P B;  5ADX H;  3T7Z A;  1X9J A;  1KAX A;  3CJA A;  4C23 A;  4YOY A;  5F0X A;  1HKB A;  3ZEU A;  4WFA L;  5AQH A;  3HOS A;  3CF5 L;  1VQ8 N;  3NMU A;  3IKM A;  3QBX A;  3WXJ A;  4B1U B;  5BPM A;  4CBW A;  3H45 C;  4B1Z A;  1GLC G;  1OVY A;  1T3V A;  2QW9 A;  3DXM B;  3CCL N;  3EE9 A;  5AQP A;  4FPA A;  3MMV A;  5FPN A;  1VQ4 N;  4PKI A;  4IOC L;  1BUP A;  3KK7 A;  1ZC6 A;  3GG4 A;  2BH1 A;  1E4G T;  4BRH A;  4H0V B;  2YHY A;  4BRM A;  1RFQ A;  1JCE A;  3EN9 A;  5AQJ A;  3CJ1 A;  3LL3 A;  3DLL L;  3LDQ A;  5AQK A;  2A3Z A;  4BC2 A;  3FR0 A;  4BQZ A;  1QVG M;  1BG3 A;  1MWK A;  5C2F A;  1KD1 O;  4XEI A;  4H5N A;  1SAZ A;  1ATR A;  2AP1 A;  4BRC A;  3VEN A;  3H3N O;  1N8R O;  3U8X A;  4JKG B;  3FZL A;  3M5R A;  5JMV A;  2P9K B;  1VQ5 N;  4OPA A;  4BG8 A;  4BRP A;  1Y64 A;  5AQL A;  3W0L A;  4AM6 A;  1DGK N;  1R59 O;  3WXK A;  4MDB A;  2QXL A;  5BR9 A;  4BGA A;  1YXQ A;  2YCH A;  4IDH A;  3CCU N;  3CCE N;  4PL8 A;  1LCU A;  2JWK A;  2Q36 A;  5GIN A;  1YI2 N;  1KQS M;  4JD2 A;  3SAH A;  1S22 A;  4FL9 A;  3CJC A;  3N4Q A;  3O9U A;  3CJ9 A;  1NGB A;  1NGF A;  2HST A;  4H0Y B;  4FWM A;  2W41 A;  4XH5 A;  3MN9 A;  3VTH A;  4M7X A;  3SBG A;  4DHY A;  1S72 N;  3B8A X;  2Q0U A;  4JKF A;  3UB5 A;  1QVF M;  3FZK A;  5EVZ A;  2NLX A;  4BR5 A;  4AM7 A;  3MDQ A;  4ILH A;  2D0O A;  4JKB A;  3EE8 A;  1XC3 A;  3LM2 A;  1HJO A;  3RSE B;  4BG9 A;  1RDU A;  3EO3 A;  3Q7B A;  3VEZ A;  1K8K A;  1JCF A;  3FZF A;  5EX5 A;  3VF2 A;  2QWO A;  3R8E A;  5GIP A;  2ASP A;  1XQS C;  1IJJ A;  2A6A A;  1KXP A;  4RWT A;  3VGK A;  4JK8 A;  4RCH A;  5EXW A;  5I9E B;  3A8Y A;  3KHY A;  1KAY A;  3R3L A;  3P31 A;  4JHD B;  3WXL A;  1YF5 L;  3QBW A;  1SZ2 A;  2A5X A;  3S41 A;  3ZX2 A;  3CXC M;  1M1K O;  3UKU B;  2P9N A;  3SLC A;  3VEX A;  5AQO A;  2QWL A;  4K43 A;  3U4L A;  4YOT A;  5AQN A;  5GAE P;  4M63 C;  3CCM N;  3O9R A;  4K25 A;  3R6M A;  1KAZ A;  5KPZ A;  2NRX A;  4IJA A;  1GLJ O;  4FSV A;  1NGD A;  4EHU A;  5HL7 L;  3LDN A;  3EL2 A;  3NVM A;  3O9S A;  2OTL N;  4PHT X;  3CET A;  4A2A A;  2I7P A;  4BRQ A;  4PL7 A;  2VGN A;  4WQ4 C;  3G4S N;  3E66 A;  5AQY A;  1ATS A;  3JXU A;  3CPW M;  4CD1 A;  3EZW A;  3C65 A;  1HKG A;  3D2F A;  4IO9 L;  4DKW A;  3ZX3 A;  3BEX A;  3D2E B;  4CJ7 A;  5FPE A;  5KQ8 A;  3SAF A;  3M6G A;  3VGM A;  4H5T A;  3O5B A;  3ULE B;  3VF4 A;  4CBU A;  2P9U B;  2NNW A;  3OBY A;  2KLA A;  4BRF A;  4FWS A;  1HKC A;  2YI1 A;  4BC3 A;  1JCG A;  2V52 B;  3CC2 N;  4A2B A;  3TTF A;  4CZH A;  3MX5 A;  4FVU A;  5AQW A;  4FOI A;  4U7B A;  4C1N K;  5AQF A;  3G6E N;  1X3M A;  4JK7 A;  3VEV A;  3SAG A;  5BPN A;  4NLB A;  1Z05 A;  2QWQ A;  4EFH A;  3ENO A;  1CZA N;  4QS8 A;  5E26 A;  1TUU A;  1YJ9 N;  3AGK A;  2E20 A;  3C0B A;  4GVE A;  4H0T B;  4LC9 B;  2CGK A;  4B1W B;  4BR0 A;  5LJV A;  2ZJP L;  3KZB A;  2ZF5 O;  1GLF O;  3L4I A;  3CI5 A;  2E2P A;  4H0O A;  3SMP A;  1TYQ B;  5GAD P;  4MO4 A;  2FXU A;  3G71 N;  2A41 A;  3CIP A;  3IFR A;  5MLC Q;  3PIP L;  3GDQ A;  3WXI A;  3ZET B;  3PIO L;  4MDA A;  5F1X A;  1NJI O;  3MWP A;  3CQX A;  4BC4 A;  5AZJ B;  5BN8 A;  2QTD A;  1NMD A;  5BRE A;  1T6C A;  1H1V A;  2QWP A;  3O9T A;  5AFU H;  3SBT A;  3TSP A;  5GAG P;  5C12 A;  2E2Q A;  1NGH A;  4ISE A;  3FZM A;  3HI0 A;  4G9Z A;  1HLU A;  1VQO N;  5H1S Q;  1GLA G;  4RTF D;  1W97 L;  4B9Q A;  3AAR A;  2ITM A;  4GV3 A;  3MK6 A;  1U2V A;  3UKR A;  3J8A A;  4YOU A;  5FPM A;  2YHX A;  4A62 A;  3E9O A;  3EKS A;  4B1X B;  4BGB A;  4O5F A;  4BRG A;  1NGA A;  2YHW A;  4KBO A;  4FWQ A;  4GY2 B;  1VQL N;  1K8A O;  3QDK A;  4QS7 A;  3C7N B;  1Q18 A;  4ISF A;  3W3D A;  1DEJ A;  1NM1 A;  3K9J A;  4MO5 A;  2Q31 A;  2YJF A;  4M7Y A;  1T6D A;  4YOR A;  3VMF B;  3ZX0 A;  3I55 N;  3CMA N;  3CCJ N;  3TPQ A;  2F7T A;  4FWN A;  4FOE A;  2NRH A;  3WEE B;  4U67 L;  3KVG A;  3CD6 N;  1DKG D;  4UY8 O;  3CJB A;  3VES A;  3DXK B;  4BRD A;  4F9O A;  4YOV A;  2V7Z A;  3L4Q A;  4IWV A;  3TSQ A;  3ID8 A;  5FPD A;  1NGJ A;  1SQK A;  2E88 A;  5ADX A;  1QQM A;  2YJE A;  3P39 A;  3VEW A;  5AFU A;  4I6M B;  2D4W A;  2ASM A;  1V4S A;  5B8H A;  5C10 A;  2FLO A;  2QWN A;  5KQD A;  5AQT A;  3UE5 A;  3G25 A;  3ZEU B;  4CZM A;  1GLE G;  1GLD G;  5ELZ A;  2HF4 A;  2FF6 A;  3I8B A;  5AZI A;  3FFK B;  5EY4 A;  1QZ5 A;  3HOT A;  4MLH A;  3GOI A;  4NLC A;  2P9I A;  2FF3 B;  4O8U A;  3E9L A;  5LJW A;  1YHQ N;  2ZJQ L;  2QWR A;  4IEI A;  3CCR N;  2KKZ A;  3A0I X;  2WC9 A;  3CCV N;  4WYB A;  3AY9 A;  4NB4 A;  5M1F A;  1ATN A;  3A5L C;  3WQT A;  2IVO A;  4KH6 A;  3RVC A;  4XH4 A;  4K41 A;  4C1N I;  4H0P A;  3ULE A;  2A42 A;  3C6H A;  3A5N C;  3VEO A;  1VQ9 N;  2IVP A;  4PKG A;  3CCQ N;  5KPR A;  1QQN A;  1VQ6 N;  3O8M A;  2VWB A;  4JEP A;  4WCE L;  5AQZ A;  3EKU A;  1J6Z A;  5EOY A;  1Q7Y O;  3BP8 A;  4H5V A;  3VF6 A;  2PBD A;  1VQK N;  4O8K A;  4BR7 A;  3AAP A;  2NZT A;  4NO7 A;  4GNI A;  4BR9 A;  4WFB L;  3CCS N;  1TYQ A;  3KWI A;  4JD2 B;  3C6A A;  3A5M C;  3P4I A;  5AQI A;  3O1B A;  3LDO A;  4IOX A;  1K73 O;  4ISG A;  1VQ7 N;  2D1K A;  2P9L A;  2KHO A;  4YDU C;  1YAG A;  2P9P A;  5AQX A;  3Q7C A;  3TTD A;  4YOX A;  2GWJ A;  3F2K A;  4A57 A;  3MN5 A;  4KH5 A;  3R9P A;  1SS6 A;  3GE1 A;  2NRT A;  3DXM A;  3FLC O;  4WQ5 C;  4CZI A;  3K9K A;  4CZK A;  3MCA B;  3H1Q A;  1EO1 A;  5AR0 A;  4WFN L;  2PAV A;  1IG8 A;  2RHK A;  4JKD A;  1YIJ N;  3U9Z A;  4AF1 A;  4E1J A;  4EHT A;  3P38 A;  1QHA A;  3VEY A;  3ZYY X;  3T69 A;  4BRA A;  5M1K A;  2IIR A;  1C0F A;  3J7Z O;  3ID6 A;  1M90 O;  3DWL A;  4CD3 A;  1RGI A;  4FO0 A;  4H03 B;  3M3Z A;  3CER A;  1G99 A;  2P9N B;  2ZJR L;  2GUP A;  1MA9 B;  3VGL A;  1Q86 O;  4JKG A;  4JKH A;  2P9K A;  1HX1 A;  1QZ6 A;  3F9M A;  4BRL A;  3H46 O;  1MWM A;  1P90 A;  5AQU A;  2VYP A;  4DQ8 A;  2GX9 A;  3MCP A;  4FWO A;  5M1P A;  2ZWH A;  2NRV A;  2HMP A;  4A59 A;  2FSJ A;  4XH1 A;  3MWT A;  2UYT A;  3TU5 A;  3VTI A;  1YUW A;  2OAN A;  3ATU A;  2H3G X;  5M1Q A;  2YX6 A;  4J8F A;  3L6Q A;  2NRR A;  5HOO A;  4FPB A;  3CC4 N;  1JJ2 M;  3LDL A;  4I6M A;  4MLE A;  4BRN A;  2FSN A;  2NRZ A;  1NGE A;  2DPN A;  1LOT B;  1BA1 A;  1V4T A;  3OHR A;  3QFP A;  1ZBS A;  2GTD A;  4GV6 A;  2E2N A;  2CGL A;  4CZE A;  2W40 A;  3RSE A;  4R79 A;  3PLA A;  4H5W A;  4CI6 A;  3O1W A;  2RE2 A;  2QEX N;  2E8A A;  3SK3 A;  4CZF A;  3SJH A;  5C2D A;  1YJW N;  3GL1 A;  4JK9 A;  4EAH D;  2Q0R A;  2E1Z A;  3TTC A;  4BRE A;  1BWF O;  5CHI A;  1YVN A;  1WUA A;  5BRD A;  1HUX A;  3L0Q A;  2PFU A;  1HPM A;  1ESV A;  1S3X A;  4DB3 A;  4YOW A;  1WOQ A;  2P9S B;  4JHD A;  4A61 A;  1Z6R A;  1BOT O;  2CH6 A;  3LDP A;  2FSK A;  3LM9 A;  3CHW A;  3UKU A;  1DT9 A;  3U9D A;  2Q97 A;  5BN9 A;  3I56 N;  4A5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...