4BRMA

Sulfur sad phasing of the legionella pneumophila ntpdase1 - crystal form iii (closed) in complex with sulfate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
359
structure length
359
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 115
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brmA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brmA02
5ADXA 4FWOA 2V51B 2D0OA 1NGHA 1X9JA 5BN9A 4CZIA 3QBXA 1XQSC 3BEXA 2ASPA 3ATUA 5E26A 1V4SA 3VEOA 3HI0A 3LM2A 4GY2B 5AQXA 3MN7A 5AQRA 1BU6O 2ZGZA 3UKRB 4DCHA 1XC3A 2P9NB 2CH6A 1ZXOA 2QWMA 3DJCA 3TPQA 1NLVA 1NGGA 2FF3B 2E2NA 4HTLA 1NGEA 2BTFA 4M63C 5AQKA 3BF1A 4FOIA 3BP8A 3GBTA 4IJAA 3W0LA 3HM8A 4H0YB 3M1FA 3GDQA 3HTVA 3KHYA 3UKRA 1ATRA 1SAZA 1Z05A 3LDQA 4FWNA 2P9NA 4MO5A 3RSEA 1U2VB 4K42A 5AQYA 4M7XA 2BUPA 5AZIB 5EXWA 4PL8A 4F9OA 4B1XB 1E4FT 1K8KB 4YDUC 4BQLA 2E8AA 3O1BA 3VGMA 1SQKA 2P9KB 3FR0A 4BRMA 3KZBA 3GG4A 4K25A 4H5WA 5EX5A 2YJFA 4A2BA 1C0GA 3EZWA 2FSJA 2YJEA 3CJBA 3CJ1A 3MN6A 2YI1A 1EQYA 4BR7A 4EHTA 2E88A 4IJNA 4B1UB 2GTDA 3RSEB 1U2VA 4CZHA 3KVGA 4QS8A 5AZIA 1MWMA 1S22A 5LY3A 1HLUA 4BR0A 1K8KA 3H45C 4FWQA 2FXUA 4YDUA 3H6EA 2P9KA 2W40A 4H0VB 1GLAG 3O80A 2E2QA 1G99A 4CBWA 3R6MA 1NM1A 2YHYA 3D7EO 4BRKA 3VOVA 4EHUA 1GLEG 1XUPO 1NGCA 3UKUA 4BC2A 3A8YA 4H5NA 4BRDA 3VEYA 1C0FA 2V7ZA 3FZLA 4XH5A 4GNIA 3D2FA 4IWVA 3TU5A 4ISFA 2I7PA 4BRFA 4PKHA 3HSCA 4BGAA 5F1XA 3SMSA 3UE5A 5AQNA 1D4XA 2WUSA 4BG8A 3C0BA 2FF6A 1NMDA 3DAWA 4BRNA 3BUZB 2FSKA 2GEMA 3MMVA 3UKUB 2ZWHA 3SLCA 3HZ6A 4H5TA 5AQSA 3D2FB 3FZMA 4PL7A 4FWRA 2EWSA 2CGJA 1GLDG 2CGKA 4IZ9A 3R9PA 1IJJA 4FWKA 1TUYA 4BR4A 3LM9A 2GWJA 4CZFA 3H1VX 4L3QA 3ZX3A 1KAXA 4BRQA 3JS6A 1MDUB 4H0PA 4H5RA 5AQOA 1CZAN 1BA1A 3WQTA 4ISEA 3L0QA 3CJAA 3H1QA 1BOTO 2Q31A 1LCUA 5AFUH 3ID8A 3A5MC 3CQYA 1HPMA 1ZBSA 3G25A 3MN5A 3QDKA 3VGLA 2E1YA 4EIAA 3OHRA 3O6WA 2ASMA 5KPRA 4FO0A 1BO5O 1HKGA 3CJCA 1MA9B 5KPZA 4IXCA 3O5BA 5AQPA 1BDGA 1J6ZA 2QWNA 2Q0RA 1E4GT 4WQ5A 2Q2RA 3SJHA 4ISGA 3I8BA 3M6GA 1YUWA 2FSNA 3QICA 1Y64A 3AAPA 2KHOA 3ENOA 4PKIA 5AQQA 3WT0A 4JNEA 5E84A 2E2PA 3ZETB 1JCEA 5F2RA 1NGJA 3A0IX 2E20A 3I33A 2IVOA 2D1KA 2NLXA 4NO7A 4K41A 1HKBA 1YAGA 4EAHD 2V7YA 4WQ5C 3L4IA 2E2OA 5AQLA 1TUUA 2QM1A 2W41A 1JCFA 4CD1A 2GWKA 3CIPA 2QWRA 2UYTA 3EKUA 2YHXA 2HMPA 3ZETA 1GLBG 3CETA 3H3OB 3GOIA 4BRHA 4CJ7A 5I9EB 5AQFA 4H0XB 1BG3A 1JCGA 3MDQA 4CBXA 4BRAA 2Q36A 1BWFO 3MK6A 4BC5A 2AP1A 4BR9A 4HWIA 2P9SB 3LDOA 2A42A 3VEXA 5F0XA 3AAQA 3AARA 5CE3A 3BF3A 3SMPA 4RWTA 1RDWX 4H0OA 4FWMA 4XEIA 5EVZA 4BRIA 2P9PB 3H46O 4RTFD 4B9QA 3QFPA 2V52B 4FWSA 4JAXA 4B1WB 5BR9A 1DEJA 4BR2A 2IVNA 4CBUA 4BROA 2P9SA 4CZMA 3VEZA 2P9UA 1U6ZA 4JD2A 1MWKA 1RFQA 4DQ8A 3FZFA 2QWLA 1T44A 5FPMA 4BC4A 5BPMA 2J4RA 2P9PA 5AQWA 4A61A 3FGUA 1NWKA 5AQUA 1GLJO 3CERA 1QQOA 2IVPA 3FZKA 3WXJA 5KQDA 2YCHA 1HJOA 1NGFA 2P9UB 3QBWA 4JD2B 3ATVA 4WQ4A 1GLFO 1NGIA 4BQZA 3U9ZA 2ZGYA 3DWLA 5EY4A 4EFHA 3IDHA 4O5FA 1SZ2A 3ZEUA 4Z94A 5EOYA 1V4TA 1DGKN 4RCHA 1RGIA 3DXKA 5FPDA 1HUXA 3AY9A 1NGAA 5AQJA 4BGBA 1GLCG 1X3NA 2ITMA 5FPNA 4IO8A 3A5LC 4DB3A 3O08A 3VEWA 2Q1NA 1WUAA 3EL2A 5ELZA 3ZX0A 1HKCA 3FFKB 3C7NA 2DPNA 2VCPA 4O8KA 5AQMA 5LJVA 1QQNA 2QW9A 3ZEUB 5LJWA 3WEEB 2NZTA 3VGKA 2GELA 3B8AX 5JMVA 3DXKB 3FLCO 3A5NC 3VERA 3EO3A 3LDPA 1TYQB 4J8FA 4B1VA 1Z6RA 3WQUA 4JHDA 1IG8A 3C7NB 1BUPA 5BPNA 5B8HA 4FL9A 2H3GX 2Q97A 4KBOA 3WEEA 2A3ZA 5AR0A 2D0PA 5BRDA 1T6CA 5BN8A 5TKYA 4NB4A 2QWPA 5BRHA 2P9IA 3VF6A 4FPBA 3VF4A 4FPAA 3D2EB 4MLEA 1QZ6A 1TYQA 4DHYA 4JHDB 1YVNA 3IUCA 1ESVA 2ZF5O 1P8ZA 2ASOA 4H0TB 1QZ5A 2GUPA 2F9TA 2PBDA 1ATNA 3FE1A 4AM7A 2HF3A 3M3ZA 1KAYA 4BG9A 3GE1A 2P9IB 1KXPA 3VETA 2P9LA 1LOTB 3ENHA 3DXMB 3IFRA 2FLOA 3D2EA 2A5XA 4K43A 3VENA 3VF2A 5FPEA 5AQHA 1T6DA 3VEVA 4E1JA 1Q18A 3O4WA 5KQ8A 5JLFA 2E1ZA 1QQMA 5BRFA 4H5VA 1GLLO 5AZJB 2F9WA 1BA0A 5AQVA 3W3DA 3ZX2A 1HX1A 3WXKA 3QFUA 5BREA 4BC3A 2P9LB 3DXMA 5AQZA 4H03B 3J8AA 1NBWA 4AM6A 4WYBA 1DKGD 2AA4A 2QWOA 2NRHA 3HBTA 4BRLA 5AZJA 2VYPA 1X3MA 3U4LA 3LDNA 3SK3A 5JLHA 2CH5A 3L6QA 4MLHA 4BREA 3U8XA 5AQIA 4FSVA 3CJ7A 5AFUA 3S41A 3FZHA 4CZGA 4BR5A 1S3XA 4QS9A 4BVPA 3JXUA 5KPTA 3R8EA 4FWPA 4BRCA 3F9MA 3QMLA 1WOQA 4CI6A 4Y0WA 3VPZA 3IMXA 1YXQA 2IIRA 3WXLA 3ULEB 3GL1A 5ADXH 1ATSA 3LDLA 3WXIA 3CHWA 3P4IA 3O1WA 4B1YB 3CQXA 3U9DA 1H1VA 3WUHA 3LL3A 3O8MA 4WQ4C 1R59O 3CJ9A 4A62A 2VWBA 2A6AA 4XH1A 5BPLA 4XH4A 1KAZA 4CZJA 2A41A 4I6MB 4B1ZA 2YHWA 4CD3A 2OANA 4CZEA 4FWLA 2Q0UA 4C23A 5JICA 3MN9A 3ULEA 2D4WA 4PKGA 2PAVA 4MO4A 2HOEA 4FOEA 1NGDA 3A5OC 4A2AA 4M7YA 2QXLA 3H3NO 4BVOA 1ZC6A 3QB0A 4BRGA 4LC9B 5AQGA 4CZLA 3CI5A 3EKSA 1QHAA 2I7NA 3MCPA 3EN9A 4JN4A 3UB5A 2CGLA 5AQTA 4QS7A 3VESA 4I6MA 1OKJA 1NGBA 2QWQA 4CZKA 2HF4A 2A40A 4BRPA
chains in the Genus database with same CATH superfamily
3L8BA 4FWOA 2V51B 4NCAA 2OPSA 3ZSVA 1K73O 2OZSA 4NYFA 4GMJB 1DT9A 4HHTA 3HI0A 3LM2A 4GY2B 5AQRA 3TAPA 4DCHA 1W7AA 4MQ3A 3OS2A 4R5PA 3S3OA 4IKFA 2FF3B 1KD1O 3OYHA 3MCAB 2HHSA 3HK2A 2F8TA 3W0LA 3GBTA 1MU2A 3M1FA 3CC4N 4IDHA 1VQKN 3K5MA 3OJSA 3OW2M 4DR3K 1RBTA 1OVQA 3MXMA 1U2VB 2QKBA 3LPUA 4PL8A 1K8KB 4YDUC 4BQLA 2G8IA 3OYCA 1NK5A 5EX5A 1VAZA 2YJFA 4CJFA 4C8MA 1C0GA 3EZWA 2FSJA 3CJBA 1U45A 1NKEA 4NXMK 2ITGA 1S6QA 2GTDA 4CFDA 3RSEB 2IGIA 4QS8A 1KLMA 3PX6A 3NGYA 4M45A 4BR0A 4DQSA 3O80A 1BHLA 1G99A 4CFBA 1UA1A 2YHBA 4YOYA 4E1NA 1GLEG 1XUPO 4B9NA 4NCBA 4BRDA 3BZKA 2V7ZA 3TTFA 4JS4A 1I39A 4DV1K 5I3UA 4JKBA 2RHKA 1ASVA 3FFIA 1QS4A 3LAKA 1BI4A 3HSCA 3O9SA 4BGAA 3IAYA 1LAVA 3C0BA 4FVUA 1UAXA 3BUZB 2Z1IA 3M5RA 4MDAA 3AVFA 3ZYYX 3KTQA 3EYZA 4PUOA 4LF8K 3HO1A 4FWRA 1JLGA 1GLDG 3CCVN 2CGKA 1I3AA 2FC0A 1IJJA 4FWKA 4DU1A 2EX3A 4B3MK 3LM9A 2GWJA 3H1VX 3T19A 4RW6A 1KAXA 2R7YA 2E5LK 4H0PA 1BL3A 3MX5A 4H5RA 2QTDA 1N36K 3WQTA 3L0QA 3CJAA 4B9TA 3H1QA 1LCUA 2OYQA 3CQYA 4DR7K 1HPMA 3MN5A 1JLQA 2ZD1A 1UWBA 4W5OA 3AGKA 4YOUA 4HUEA 4EIAA 3LPTA 4OVLA 2ATQA 5KPRA 1BO5O 4F8RA 1NK9A 1BDGA 2QWNA 3TR8A 3RR7A 4B9SA 3OYMA 2VWJA 1RT5A 4WQ5A 1WSFA 2BE2A 2O8CB 4BWMA 4DUYK 3DLGA 3JAMO 3ZSYA 4WF9L 4JK9A 1Y64A 2HBJA 2KQ2A 1VQMN 3ENOA 4PKIA 5AQQA 5E84A 4OKJA 4E7LA 3AA3A 3ZETB 1VQ6N 3RTVA 3SUNA 1TK8A 4X65K 4K41A 4O0IA 4CJRA 3CM6A 3SAFA 4J2BA 3DRSA 2QM1A 4FLXA 1UA0A 3O9TA 1EXQA 2VWKA 3CIPA 3VQPA 4C8KA 3CG7A 4CGIA 3AA4A 4JI4K 3ZT1A 2YHXA 4PA1A 1OVYA 2HMPA 4LF6K 4PWDA 3VQ7A 4ZTFA 2QKKA 1TKXA 5AQFA 3QEWA 3T1YK 3PY8A 5HBMA 1NJZA 3MDQA 4RG8A 2AJQA 4CBXA 2LSNA 4BRAA 4LH5A 3THWA 3U6FA 4HWIA 1C0UA 3LAMA 3VEXA 1YJNN 4RWTA 1RDWX 3OYGA 1N8RO 4M3TA 4DFMA 1WB9A 4B9VA 4N76A 1IKYA 2JWKA 4XEIA 2XY6A 1D5AA 5EVZA 3P31A 5J2NA 3QFPA 2NRWA 4JAXA 3G71N 4BR2A 4CF9A 4CBUA 4AHCA 3OTOK 3SQ2A 3EE9A 3CCUN 4DV4K 1LWCA 2RKIA 4JD2A 4OKKA 4DQ8A 2QA4N 3NF9A 3KJVA 2A1RA 3RWUA 3QNNA 2YX6A 4J2EA 2Y1IA 3HJFA 5AQUA 3CERA 2IVPA 5KQDA 2YCHA 1QE1A 4IG0A 4DTPA 2P9UB 2ZQBA 3CPWM 4WQ4A 1GLFO 3J81O 3HPOA 3MECA 3L4QA 3AO4A 1SZ2A 2O8EB 3ZEUA 3ZSWA 4B8CA 4Z94A 3RMCA 1DGKN 3ZSRA 1J5OA 1HUXA 3AY9A 5AQJA 3THXA 1JKHA 1HMVA 2ITMA 2VG6A 1CZ9A 5FPNA 1K9MO 4M41A 3VEWA 3EL2A 2WOMA 3ZX0A 3C7NA 1HNVA 3SBGA 2QW9A 3CXCM 3WEEB 4X64K 4IDKA 3MXIA 3DI6A 3B8AX 3TTCA 5JMVA 1W2BM 4DS5A 4KTQA 3DRPA 3LDPA 4CEZA 4B1VA 4OKEA 1Z6RA 3WQUA 5CZ2A 4KHPK 4FLTA 2QXFA 2H3GX 1SL1A 2D0PA 1FK9A 2QI2A 5TKYA 3SJJA 3PLAA 2QWPA 5LMNK 2O8DB 3VA3A 3VF6A 4M3RA 4FPAA 1TL3A 1JLEA 3PIOL 4DTRA 3G6EN 3J7AP 1VQ5N 1JL1A 3NE6A 3CF5L 4KTWA 1P8ZA 4IEEA 1QZ5A 2PBDA 1ATNA 4EZ6A 4AM7A 1N33K 1KAYA 1XHZA 3VETA 2P9LA 3K5NA 3IFRA 1I94K 1QTMA 1IKXA 2FLOA 2HNZA 3D2EA 2NNWA 2A5XA 4K43A 3ZSOA 2HSTA 1D9FA 1XNQK 1VQPN 5C0YA 1CLQA 1Q18A 5JLFA 5FDLA 3AVMA 1NJXA 4GKJK 2OTLN 1BGXT 3U3GA 3ZX2A 2ZE2A 3AVHA 5BREA 5JS1A 1RT7A 1SL0A 2GX9A 4B3RK 2VG7A 4AHTA 1ZBIA 1TL1A 4AM6A 4BY9C 4WYBA 3N4QA 4AHRA 2AA4A 3K9JA 4BRLA 4DLEA 4NLCA 1YIJN 1YT3A 4FLWA 1KQSM 3K0SA 1N6QA 3MXJA 3C95A 5SWMA 1TK5A 4CIFA 3L6QA 4ELTA 3AVGA 4BREA 4KB1A 3U8XA 5AQIA 4X66K 1B9FA 4DR1K 3FZHA 4A57A 4IOXA 3K9KA 1VQON 1J9AA 4CZGA 1QHTA 3TSUA 1IO2A 4CIEA 1L3TA 4DTOA 4CJLA 1BISA 4CJKA 1ITGA 3KK1A 4FJHA 3F9MA 4CI6A 4Y0WA 1YXQA 3ENBA 1X1PA 3LWMA 4Y1CA 4DR5K 3QEVA 4KH4A 1H1VA 4N5SA 4BACA 3E9LA 4DWIA 1R59O 1U04A 2JLEA 3CCLN 2VWBA 2W6LA 2A6AA 4I2QA 5BPLA 1VSFA 2FBTA 3V9ZA 4CZJA 4B1ZA 4CD3A 4FWLA 2YHAA 2Q0UA 3IS9A 4DSFA 2B6AA 3MN9A 4FLUA 2D4WA 4PKGA 1A5WA 3HM9A 3LP2A 3MX2A 2OPQA 2HOEA 2E6LA 2QXLA 4BVOA 3WNHA 4LC9B 3EKSA 1GOBA 5CY4A 3EN9A 4JN4A 3HL8A 3UB5A 1VHXA 4JLHA 4M3XA 3VESA 1RDAA 4DV6K 4DSLA 4DLGA 2KZMA 3K5OA 3TANA 2BGGA 4I6MA 3HP9A 3NDKA 2A40A 4BRPA 3AO1A 3NAEA 5ADXA 3NH2A 2ZJPL 3OYAA 1X9JA 4CZIA 4KHSA 3QBXA 3WNEA 3QEPA 4J2AA 5E26A 4CEAA 3L3UA 4YOXA 5AQXA 3UKRB 1BU6O 1VQ8N 1SV5A 2FBYA 3IKMA 1XC3A 3TPQA 2CH6A 2I5JA 5DMRA 3PUFA 3AO3A 4W5TA 2XRIA 2E2NA 1NGEA 2BTFA 4M63C 5AJ3K 3BF1A 2G8FA 1T7PA 1QSLA 3AVNA 3C6AA 3V9XA 5HRNA 1SAZA 1Z05A 3QO9A 1X9SA 4FWNA 1LWFA 4CESA 4K42A 4B3TK 1HYZA 4M7XA 1EWQA 4YY3K 1BCMA 1E4FT 2P9KB 3D45A 4BRMA 4CJSA 1KTQA 4K25A 4CF2A 3HOSA 4B3SK 3O9RA 4H5WA 2HB5A 4A2BA 4LF5K 3CJ1A 3MN6A 2G8WA 4GVEA 4OPAA 4EZ9A 4DTJA 4EHTA 5GADP 3DYAA 4IJNA 3IRXA 4CJUA 3KVGA 3MEDA 5LY3A 1HLUA 1TKDA 4CGDA 4FWQA 5CYMA 3L2VA 2E2QA 3CMAN 3C94A 3F9KA 5C2DA 2UXCK 4Z4IA 2YHYA 3KD1E 3D7EO 4BRKA 3VOVA 5DM6L 4J2DA 1M90O 4GV6A 1NGCA 3UKUA 3VEYA 3FZLA 3E9PA 3NF6A 3V6DA 3TU5A 4ISFA 4JK8A 2I7PA 4BRFA 1VSLA 3V9WA 3QNOA 4ZTJA 5AQNA 5IT9O 1D4XA 3LANA 4CGGA 4BRNA 3DAWA 4JKEA 2FSKA 5FROA 2VGNA 4H5TA 3D2FB 4OO1J 3FZMA 3VQCA 2X74A 1HNXK 3VN5A 2UU9K 3TABA 3M8SA 3TARA 3QETA 2FBVA 3OYIA 3V9UA 2DFEA 2NRRA 4L3QA 3C6TA 2Z1JA 3HVRA 4R79A 4KH5A 1RT4A 3I0RA 3OYEA 2O8BA 3RR8A 4NYNA 3RVCA 4LF9K 3MWTA 3ID8A 2OPPA 3CCJN 3NBPA 3G25A 1ZBSA 1TGOA 1RT6A 2HBMA 4OPHA 3VGLA 2P5GA 2X6NA 3CPEA 3THYB 2E1YA 3OHRA 2ASMA 3AVAA 2ZJRL 5HL7L 2Q3SA 1EETA 2DY4A 3J7YP 5KPZA 4IXCA 2NRVA 3SNNA 3V1OA 2Q0RA 4YOVA 1NJIO 3OYLA 3NHGA 1A5XA 3SJHA 4NXNK 5GIPA 1LW2A 3RMBA 2HNDA 1YUWA 2D0AA 2P5OA 3MWPA 2KLAA 3AAPA 4JKCA 3O9QA 3WT0A 4B9MA 1NGJA 3A0IX 2IVOA 5GAGP 2NLXA 1QVGM 4BWJA 4DU3A 2V7YA 5GAHP 5AQLA 2HHQA 3O3GA 2GWKA 4AF1A 2UYTA 3CCMN 4CJTA 4A59A 1WN7A 3ZETA 5JVGL 3ZT0A 2E6MA 3H3OB 3HT3A 3HXMA 4BRHA 4HVJA 1FJGK 5I9EB 1VSIA 3T69A 4C8NA 3N4PA 1JCGA 4DFJA 3TAMA 2Q36A 3MK6A 4BR9A 3UIQA 2OPRA 2P9SB 2XHBA 2YV0X 1NJYA 3L2WA 1VQ7N 3AAQA 5CE3A 2KKZA 4F2SA 4FZZA 4H0OA 4E7JA 4FWMA 1X9WA 2YNGA 2P9PB 4B9QA 2PYJA 2V52B 1CZBA 4FJ9A 4W5RA 4FJ5A 4BROA 5BR8K 4CZMA 3VEZA 1NOYA 4JKDA 3FZFA 1TAQA 2QWLA 2F96A 1T44A 4DSJA 4BC4A 3CM5A 4CW7B 5BPMA 3G10A 4B8AB 1C1BA 4E19A 4FM2A 3O4NA 2F4VK 2YNIA 3WXJA 2ZJQL 3I56N 2VG5A 2HBLA 2P1JA 4HUGA 3ATVA 3VQ9A 3T3FA 3ZCMA 4EFHA 1SKRA 3VQBA 4O5FA 4DQPA 4E7KA 5EOYA 5E41A 3SYZA 1RGIA 3DXKA 1WBDA 1X3NA 1K6YA 4JK7A 3D0PA 3OYKA 2HHWA 4DSIA 3RRGA 3TSQA 5FRNA 3C65A 4JI2K 2Q1NA 5ELZA 1HKCA 4KHYA 2DPNA 3HP6A 1QQNA 2KW4A 2O8EA 3B6PA 4X62K 2NZTA 1L3VA 4QAGA 2GELA 3TI0A 3TAGA 1JLAA 4Q0BA 4FCYA 1WLJA 1FXXA 1JL2A 3K2PA 1TYQB 1DLOA 4J8FA 4HCBA 2KFNA 4JHDA 4K8ZA 4CJQA 1C6VA 3C7NB 1OH6A 1FKOA 2KZZA 1NMNA 1SKWA 5BRDA 2IAJA 3AVIA 2P9IA 2GBZA 2D0BA 4FPBA 4CIGA 5A2QO 4FJXA 2G8HA 1JXEA 3JSMA 4DU4A 4DF8A 1ASWA 1J5EK 4A5BA 1KSPA 4IBNA 1NKCA 4KREA 1WAJA 3SUPA 2ZF5O 4F3TA 4DTUA 2GUPA 1T8EA 3F5TA 4CVNE 1F21A 4BG9A 4CERA 3GE1A 4OLBA 1KXPA 3PX0A 3KK2A 2BH1A 3I55N 1JXBA 5KGXA 3VEVA 4E1JA 5KQ8A 4M3UA 1VK0A 5DM7L 1T03A 4O44A 1HYVA 2F9WA 2HHTA 3A2FA 3W3DA 1HX1A 3QFUA 1BIZA 2P9LB 1S9EA 5HP1A 3KKSA 4I9QA 4BDYA 1KLNA 1KVAA 1NBWA 3ZSQA 5KRTA 1RILA 3HBTA 4PQUA 4UY8O 5AZJA 1X3MA 1B92A 3QESA 2D0CA 3SK3A 2CH5A 4DR6K 4DV0K 4MLHA 4G9ZA 2D5RA 2WC9A 2F8SA 5AFUA 3R3LA 3HYFA 1HNIA 3SQ0A 4CJVA 2XY5A 1HPZA 3VQQA 4BR5A 4DTNA 2RPIA 1VSMA 1HNWK 4KFBA 4BVPA 4CJ3A 3DOKA 5KPTA 4BRCA 1Q81O 1KVCA 4DTMA 4RW7A 1WOQA 2W42A 4FLYA 2IIRA 3ULEB 3EY1A 3OY9A 3O1WA 2XY8A 1KVBA 1BCOA 3CCEN 3B6OA 3WUHA 3LL3A 3NVKA 4WQ4C 3ALYA 3MAQA 3S9HA 2WBNA 4A62A 4BDPA 2JGUA 4XH1A 4IFYA 1VQ9N 4ILGB 2YHWA 5M1FA 4CZEA 1Q9XA 4FK0A 3NCIA 1HNZK 1D9DA 5C10A 4JI7K 4WCEL 5D3GA 1WSHA 2PAVA 4MO4A 3BDPA 3A5OC 3H3NO 3QB0A 4BRGA 5AQGA 4C8LA 3LDSA 2GUIA 3CI5A 1QHAA 3CFRA 3MCPA 5J2PA 1WSJA 2JWLA 4RW9A 3I8DA 4V19S 3KWIA 4JRPA 4CGJA 2W6KA 1VSHA 1S1WA 3OVNA 2XO7A 4CZKA 4CHPA 3DLBA 4GV9A 5EU7A 1LV5A 4F4KA 5BN9A 2PZSA 1FKPA 2G8VA 4AHUA 4DQIA 1XQSC 4AH9A 3KLFA 3E66A 4DTSA 3VQAA 1V4SA 5IWAK 3MN7A 3AA5X 3EEQA 4F3OA 4FLZA 5LMUK 2P9NB 3DJCA 1RBVA 1ZXOA 2QWMA 2VQEK 1NLVA 3DMJA 5AQKA 1JLBA 3BP8A 4H0YB 1YI2N 4CJWA 3GDQA 4CEOA 3HTVA 4CK1A 2RF2A 2HMIA 3OYDA 2PYLA 3RSEA 3CC2N 3LP0A 5FLXO 2BUPA 5AZIB 5EXWA 4F9OA 4B1XB 3G4SN 1DTTA 1SQKA 3FR0A 3GG4A 1NKBA 4FJJA 4FZXC 5C24A 1Q86O 2NRZA 4KO0A 3VQ6A 2YI1A 1EQYA 3VQ8A 1TKZA 1VSJA 3BZCA 1U2VA 2KFZA 4KKOA 1K8KA 4E1MA 3J80O 1W0HA 4YDUA 1SUQA 3H6EA 2P9KA 1GLAG 4MFBA 1BI4B 4FJNA 1CXUA 4OPJA 1QSYA 3CYMA 3R6MA 1NM1A 4CHQA 3S3NA 4EHUA 4BC2A 4H5NA 2OZMA 1C0FA 3QERA 4H8KA 2YKMA 4AQYK 4ID5A 4IWVA 1KC8O 4RW4A 3TAEA 4FJ8A 3SMSA 3UE5A 2KTQA 2WUSA 1S6PA 4IG3A 4BG8A 3L2QA 2FF6A 1A5VA 1NMDA 3O3HA 3CFOA 4ILJA 2GEMA 1UOCA 3KLHA 1VRUA 2IS3A 4FXDA 2O8FA 3DLRA 3KLEA 4PL7A 4IFVA 3E9OA 3O3FA 4LFAK 1KCFA 5C25A 2EHGA 2HW3A 3SQ1A 1EX4A 3ZX3A 3QEXA 2UUBK 4M3ZA 1MDUB 1XC9A 1CZAN 4QCLA 5J2QA 4ISEA 3ULDA 3NMUA 4OX9K 1YTUA 3WNFA 4LFBK 4FJKA 5AFUH 4BDZA 4DG1A 1DTQA 3A5MC 4AHVA 3ID6A 3OYNA 4EP4A 4FK4A 3O6WA 4JKAA 4FO0A 4OGCA 3QEIA 3CJCA 3HPGA 3O5BA 5AQPA 3C6UA 3CCRN 3D6RA 1J6ZA 1R0AA 1S1TA 1XI1A 2HVIA 4YOWA 4ISGA 3I8BA 3M6GA 4Z4FA 4DV7K 4U67L 4CF8A 2HVHA 2KHOA 4HCCA 4LF7K 2PFUA 1JCEA 5F2RA 5GINA 2E20A 1HQEA 4KI6A 4NO7A 3S3MA 1HKBA 3L2UA 4EAHD 4WQ5C 4E7HA 2E2OA 3VTHA 1XNRK 2O8CA 1IV0A 2W41A 3DRRA 2QWRA 3EKUA 4FJ7A 2X6SA 3CETA 4JI1K 1L3SA 3GOIA 4H0XB 5T7BA 1N5YA 1BG3A 3V81A 5KTQA 2NUBA 1BWFO 1IH7A 4BC5A 2AP1A 2B5JA 4OJRA 4WFAL 4HUFA 1SL2A 4C1NK 3U3YA 4K8XA 3DOLA 2UXDK 3AARA 4NCGA 3BF3A 4KB0A 3WXMB 3QIPA 3V1QA 3PSFA 4FW2A 4IOCL 3P83D 3THWB 1DEJA 2IVNA 1S5JA 2P9SA 4CJPA 2B4JA 4LY7A 2P9UA 3T1HK 1MWKA 1RFQA 4Z4EA 2VQFK 1X9MA 4A61A 3AVKA 5AQWA 5FRMA 3FGUA 5JS2A 2DFHA 1VSEA 4TSXA 1QQOA 4JKGA 3NFAA 4FVMA 1HJOA 4E7IA 4JI0K 3QIOA 1U47A 2HHVA 4JD2B 5HLFA 1NGIA 2ZGYA 2FBXA 3IDHA 1V4TA 4MDBA 3DLEA 4RCHA 5FPDA 1QSSA 3ZT4A 4EP5A 3OS1A 4CJ5A 4LF4K 5C12A 4IO8A 1P90A 4O4GA 5M1NA 3K57A 3AA2A 4DB3A 4DF4A 3O08A 4Z4CA 1WUAA 3FFKB 2ZM6K 4YFUA 2VCPA 1ZBHA 5JVHL 3ZEUB 1RTHA 5LJWA 4HTUA 3WNGA 1RBUA 3C6HA 4OLAA 3FLCO 4WE1A 4DUZK 2O8DA 3KKRA 3VQDA 4JEPA 3SAHA 1JLCA 3EO3A 3PIPL 3VA0A 4ILHA 1SS6A 3VMFB 5BPNA 5B8HA 4AILC 1OH7A 4FL9A 2Q97A 3J7ZO 4DFKA 1RTIA 4KBOA 3WEEA 2A3ZA 5AR0A 1T6CA 1WSGA 5GAEP 4LFCK 4NB4A 1IKVA 2P51A 5BRHA 3R1XA 1TK0A 2NRXA 3THVA 1L5UA 2X78A 3D2EB 4MLEA 1WBBA 3CFPA 4CHNA 4I9LA 3IUCA 4KTZA 3SI6A 3AV9A 4O8UA 2ASOA 1QVFM 1XMQK 2UUAK 2F9TA 2HF3A 3NF8A 3V4IA 2P9IB 4F2RA 3DXMB 4DQRA 4GVMA 3VENA 1IBKK 1RBSA 3VF2A 3ZT3A 1YJWN 3V1RA 5AQHA 1T6DA 3LZJA 3CCSN 4H5VA 2HHUA 3P39A 2UUCK 4IFEA 1XHXA 5CYQA 5CZ1A 4IOAL 4KHNA 4BC3A 4B9UA 4H03B 3AGRA 1DKGD 2QWOA 4YOTA 3VTIA 3TAQA 3SV3A 1VSKA 1LAWA 3VQEA 3O4QA 1WNSA 3LDNA 1ASUA 4CHOA 2OA8A 1JLFA 1TV6A 4Q5VA 3CJ7A 3S41A 5J1EA 1Q7YO 1WAFA 4ID1A 3K58A 2GV9A 3Q7BA 4QS9A 4L8RB 1GOCA 3R8EA 1LW0A 1RDBA 4KH6A 3QMLA 3VPZA 3SBTA 2G8KA 1NNEA 3AO2A 3LDLA 3CHWA 1S9GA 5MLCQ 2DTUA 4CE9A 3O8MA 1LWEA 3CJ9A 1W97L 4QOZB 4GW6A 4N41A 2NRTA 1KAZA 2A41A 1J54A 4C23A 3ULEA 1B9DA 3AVLA 1RT2A 4KI4A 3MEEA 4A2AA 4FOEA 1NGDA 1TKTA 4DS4A 4JYAK 4G1QA 4BE2A 4CZLA 2XY7A 4LD0A 1VQLN 2CGLA 5AQTA 3ASMA 4QS7A 1Z26A 1NGBA 4ZHRA 2QWQA 4M3WA 2HF4A 4O0JA 3DLHA 2D0OA 1NGHA 3NVMA 3TAFA 4I7FA 1M1KO 3CC7N 4DV2K 1S72N 3BEXA 2ASPA 2RN2A 4ICLA 3ATUA 2E4LA 4OGEA 3VEOA 2ZGZA 4NLBA 3ZT2A 4C1NI 1NGGA 3KK7A 2BANA 3OYJA 5HROA 1C1AA 4O55A 3Q7CA 4HTLA 5M1KA 1RDDA 4FOIA 4IJAA 1HYSA 3HM8A 4N47A 4A5AA 4H4MA 1U48A 3KHYA 4JI6K 4GV3A 3UKRA 1ATRA 3LDQA 3LWLA 4CGHA 2Y1JA 5DK5A 2P9NA 4MO5A 5LL6Z 1EP4A 5AQYA 4CEDA 3OJUA 2Z1HA 3L2RA 3IG1A 2E8AA 3O1BA 3VGMA 4N56A 5GIOA 3NGIA 3KZBA 1NK8A 2F7TA 4Z4HA 3TSPA 4FK2A 1NK7A 2YJEA 1HRHA 3EZ5A 4BR7A 3CD6N 2E88A 1YITN 4B1UB 1Q82O 4CZHA 5M1OA 5AZIA 1VQNN 1MWMA 1S22A 4FM0A 3H45C 2FXUA 3ZLJA 4H0VB 2W40A 2G8UA 4CBWA 4DV3K 1XWLA 2DFFA 3SQ4A 1VRTA 4WFNL 3A8YA 1EWRA 4XH5A 4GNIA 3D2FA 2ETJA 3M8PA 3PO5A 4CF1A 2WFBA 4RW8A 4CF0A 4PKHA 1S1XA 5J2MA 5F1XA 4CJEA 5H1SQ 1IKWA 4LSLA 3I0SA 5HRSA 3MMVA 3F73A 3UKUB 1WSIA 4DR2K 2ZWHA 3SLCA 3HZ6A 5AQSA 4KPYA 3SUQA 4GKKK 2O8BB 3SPYA 2WTUA 1NK6A 2EWSA 2CGJA 4IZ9A 3R9PA 4UQGA 4CEQA 1TUYA 4BR4A 3OBWA 1O13A 1N32K 3THYA 4CZFA 3PX4A 4BRQA 3JS6A 1IG9A 5AQOA 3QINA 4C8OA 4FJIA 1BA1A 2O8FB 4ELVA 4FJGA 3ISNC 3PO4A 4CFCA 3NH0A 1BOTO 2Q31A 4DFPA 3K59A 3G0ZA 3CMEN 3RMAA 5KI6A 3QDKA 4Z4GA 4ELUA 4W5NA 3CCQN 5HRPA 3E01A 1HKGA 4BE0A 1JJ2M 3P38A 1MA9B 2VGMA 3DLLL 1OH5A 1ZBFA 2QK9A 4JV5K 3ZSZA 3ITHA 3CQ8A 3M8QA 1E4GT 2Q2RA 1EKEA 3SCXA 2YKNA 4FM1A 2FSNA 3QICA 3SUOA 4AHSA 3NF7A 4DR4K 3O9UA 4JNEA 3M8RA 2E2PA 3DM2A 4E0DA 4YORA 3I33A 2D1KA 2IDOA 1T3VA 1YAGA 3L3VA 1U4BA 3L4IA 1ZBLA 1YTAA 3DLKA 1TUUA 1SKSA 1JCFA 1U49A 3NGZA 4CD1A 3KIOA 4DMNA 1GOAA 1RDCA 5I42A 3KD5E 1N34K 3HPHA 1YJ9N 5M1QA 4YHHK 4I2PA 1GLBG 4DSKA 1Y97A 1E3MA 2OTJN 4CJ7A 3AVJA 4CK2A 4K0KK 4KHWA 1RDUA 4LH4A 4Y1DA 3EE8A 3BGRA 4WFBL 4DQQA 3LDOA 2O4IA 2IC3A 2A42A 5F0XA 4XIUA 3SMPA 4U7BA 3HOTA 5K14A 2IOCA 3AVBA 4BRIA 1CXQA 3H46O 4RTFD 4CJ4A 4FWSA 2HNYA 4B1WB 5BR9A 1J53A 3MEGA 4H4OA 3LZIA 3TWHA 1BQNA 1EO1A 3KLGA 1U6ZA 4JRQA 1ZYQA 1REVA 5FPMA 1TVRA 3OYBA 4LSNA 2J4RA 2P9PA 2Z1GA 4CHZA 1NJWA 1NWKA 1GLJO 1RCHA 3FZKA 3VQ4A 1HR0K 1RTDA 3THXB 1NGFA 2UXBK 3LP1A 4JKFA 3P1GA 3QBWA 1NG9A 1RNHA 4BQZA 4JS5A 4M42A 3U9ZA 3DWLA 5EY4A 4BE1A 1KFSA 5KGWA 3LALA 1OH8A 1S1VA 4CGFA 4JKGB 3KK3A 1NGAA 1YVUA 4BGBA 1GLCG 4O5BA 1IBLK 3A5LC 5C2FA 4PHTX 1C0TA 3F2KA 5HRRA 4O8KA 5AQMA 3TTDA 3QLHA 5LJVA 4PY5A 3OA9A 3VGKA 4DSEA 3DXKB 3A5NC 5HOOA 3VERA 4JKHA 1Q9YA 3SPZA 4DTXA 4FZYA 4CK3A 1KRPA 1G15A 3BY5A 3AVCA 3T7ZA 1IG8A 1BUPA 5SZTA 4FW1A 1BQMA 5BN8A 1W9HA 3PSIA 1NK4A 3E1YA 5CR4A 1IBMK 1L3UA 1C1CA 4JI8K 1HQUA 2QEXN 4M3YA 3VF4A 5CHIA 1QZ6A 1TYQA 1O1WA 3LP3A 1YHQN 4DHYA 2YNFA 4FLVA 4JHDB 1YVNA 3H08A 4H0TB 3P5JA 3FE1A 4KHUA 2YNHA 3M3ZA 3V9SA 3RMDA 4KAZA 1NU0A 5C42A 2BDPA 1LOTB 3ENHA 1TAUA 1S1UA 2PY5A 4CEEA 3NH1A 4FJLA 4OPKA 1K8AO 5FPEA 3AO5A 3ZSXA 4FJMA 3O4WA 2E1ZA 1QQMA 5BRFA 1GLLO 5AZJB 2HHHK 1BA0A 5AQVA 1BIUA 5C15A 3WXKA 1ILYA 2OCEA 3SAGA 3DXMA 5AQZA 4KV8A 3OS0A 1RT3A 3K5LA 1RBRA 1ZBUA 1VSDA 3J8AA 3HRGA 4CFAA 2NRHA 4E89A 1NK0A 4FYDA 3SV4A 2VYPA 4IEIA 1WSEA 1KFDA 3U4LA 1YF5L 3JYTA 5JLHA 2RE2A 4KHQA 4B3OA 2HBKA 3KLIA 3KWGA 2WONA 4FSVA 5TKWA 3SZ2A 4CECA 4YNQA 1Q8IA 2HHXA 1D8YA 1FW6A 3PV8A 4CHYA 4CEBA 3HSTB 1S3XA 4DV5K 3JXUA 4FWPA 3RRHA 1VQ4N 3VQ5A 3IMXA 3WXLA 3GL1A 3HVTA 1ATSA 3WXIA 5ADXH 3P4IA 4B1YB 1T05A 4CEFA 1RT1A 1Z25A 3CQXA 3U9DA 4W5QA 4E3SA 1NOZA 3T1AA 3OBYA 2A1SA 5M1PA 4B08A 1C0MA 1QQCA 4XH4A 4I6MB 5KRSA 2OANA 3OYFA 4B9LA 4KRFA 5JICA 1XMOK 4DKWA 4M7YA 4JI3K 1ZC6A 4CCHA 2I7NA 2O4GA 4JI5K 1RTJA 1HJRA 1OKJA 4IO9L 1ESVA 4Z0UA
chains in the Genus database with same CATH topology
5ADXA 4GV9A 4FWOA 2ZJPL 2V51B 2D0OA 1NGHA 1X9JA 3NVMA 5BN9A 4CZIA 1K73O 1M1KO 3CC7N 3QBXA 1XQSC 1S72N 3BEXA 2ASPA 3E66A 3ATUA 5E26A 1DT9A 1V4SA 3VEOA 3HI0A 3LM2A 4GY2B 4YOXA 5AQXA 3MN7A 5AQRA 1BU6O 2ZGZA 4NLBA 3UKRB 1VQ8N 4DCHA 3IKMA 1XC3A 2P9NB 2CH6A 1ZXOA 2QWMA 3DJCA 3TPQA 4C1NI 1NLVA 1NGGA 3KK7A 2FF3B 2E2NA 1KD1O 3Q7CA 4HTLA 1NGEA 3MCAB 5M1KA 2BTFA 4M63C 5AQKA 3BF1A 4FOIA 3BP8A 3GBTA 4IJAA 3W0LA 3HM8A 4H0YB 3M1FA 1YI2N 3C6AA 3CC4N 4A5AA 4IDHA 3GDQA 3HTVA 1VQKN 3KHYA 4GV3A 3OW2M 3UKRA 1ATRA 1SAZA 1Z05A 3LDQA 4FWNA 2P9NA 4MO5A 3RSEA 1U2VB 4K42A 3CC2N 5AQYA 4M7XA 2BUPA 5AZIB 5EXWA 4PL8A 4F9OA 4B1XB 3G4SN 1E4FT 1K8KB 4YDUC 4BQLA 2E8AA 3O1BA 3VGMA 1SQKA 2P9KB 3FR0A 5GIOA 4BRMA 3KZBA 3GG4A 4K25A 3HOSA 2F7TA 3O9RA 4H5WA 5EX5A 1VAZA 2YJFA 3TSPA 4A2BA 1Q86O 1C0GA 3EZWA 2FSJA 2NRZA 2YJEA 3CJ1A 3CJBA 3MN6A 2YI1A 1EQYA 4GVEA 4OPAA 4BR7A 4EHTA 5GADP 2E88A 3CD6N 4IJNA 4B1UB 1YITN 2GTDA 3RSEB 1U2VA 1Q82O 4CZHA 3KVGA 5M1OA 4QS8A 5AZIA 1VQNN 1MWMA 1S22A 5LY3A 1HLUA 4BR0A 1K8KA 3H45C 4FWQA 2FXUA 4YDUA 3H6EA 2P9KA 2W40A 4H0VB 1GLAG 3O80A 2E2QA 3CMAN 1G99A 5C2DA 4CBWA 3R6MA 4BRNA 1NM1A 2YHYA 4YOYA 3D7EO 4BRKA 3VOVA 4EHUA 5DM6L 1M90O 4GV6A 1GLEG 1XUPO 4WFNL 1NGCA 3UKUA 4BC2A 3A8YA 4H5NA 4BRDA 3VEYA 1C0FA 2V7ZA 3FZLA 3TTFA 4XH5A 4GNIA 3D2FA 4JKBA 3E9PA 2RHKA 4IWVA 1KC8O 2WFBA 3TU5A 4ISFA 4JK8A 2I7PA 4BRFA 4PKHA 3HSCA 3O9SA 4BGAA 5F1XA 3SMSA 3UE5A 5AQNA 1D4XA 2WUSA 5H1SQ 4BG8A 3C0BA 2FF6A 4FVUA 1NMDA 3DAWA 4JKEA 3BUZB 2FSKA 2GEMA 3MMVA 4ILJA 3UKUB 3M5RA 4MDAA 2ZWHA 3SLCA 3HZ6A 2VGNA 4H5TA 3ZYYX 5AQSA 3D2FB 4OO1J 3FZMA 4PL7A 3E9OA 4FWRA 2EWSA 2CGJA 1GLDG 3CCVN 2CGKA 4IZ9A 3R9PA 1IJJA 4FWKA 1TUYA 4BR4A 3OBWA 3LM9A 1O13A 2GWJA 2NRRA 4CZFA 3H1VX 4L3QA 3ZX3A 1KAXA 4BRQA 3JS6A 1MDUB 4H0PA 3MX5A 4H5RA 5AQOA 4R79A 1CZAN 1BA1A 2QTDA 4KH5A 3WQTA 4ISEA 3L0QA 3CJAA 3NMUA 3H1QA 3RVCA 1BOTO 2Q31A 1LCUA 5AFUH 3MWTA 3ID8A 3CCJN 3A5MC 3CQYA 1HPMA 1ZBSA 3G25A 3MN5A 3CMEN 2HBMA 3ID6A 4OPHA 3QDKA 3AGKA 4YOUA 3VGLA 3CPEA 2E1YA 4EIAA 3OHRA 3O6WA 3CCQN 2ASMA 2ZJRL 4JKAA 5HL7L 5KPRA 4FO0A 1BO5O 1HKGA 1JJ2M 3CJCA 3P38A 1MA9B 2VGMA 3DLLL 5KPZA 4IXCA 3O5BA 5AQPA 2NRVA 1BDGA 3CCRN 3D6RA 1J6ZA 2QWNA 2Q0RA 4YOVA 1NJIO 4YOWA 1E4GT 4WQ5A 2Q2RA 3SJHA 4ISGA 3I8BA 3M6GA 5GIPA 1YUWA 4U67L 2FSNA 3QICA 4JK9A 3MWPA 4WF9L 1Y64A 2HBJA 2KLAA 3AAPA 2KHOA 3ENOA 4JKCA 3O9QA 4PKIA 5AQQA 1VQMN 3WT0A 3O9UA 4JNEA 5E84A 2E2PA 3ZETB 2PFUA 1JCEA 5F2RA 5GINA 1VQ6N 4YORA 1NGJA 3A0IX 2E20A 3I33A 2IVOA 2D1KA 2NLXA 4NO7A 4K41A 5GAGP 1T3VA 1HKBA 1QVGM 1YAGA 4EAHD 2V7YA 4WQ5C 3SAFA 3L4IA 2E2OA 5GAHP 3VTHA 5AQLA 1TUUA 2QM1A 2W41A 3O9TA 1JCFA 4CD1A 2GWKA 3CIPA 4AF1A 2QWRA 2UYTA 3CCMN 3EKUA 1YJ9N 2YHXA 1OVYA 2HMPA 5M1QA 4A59A 3ZETA 1GLBG 5JVGL 3CETA 3H3OB 3GOIA 4BRHA 2OTJN 4CJ7A 5I9EB 5AQFA 4H0XB 3T69A 1BG3A 3N4PA 1JCGA 3MDQA 1RDUA 4CBXA 4BRAA 2Q36A 1BWFO 3EE8A 3MK6A 4BC5A 2AP1A 4BR9A 4WFAL 4HWIA 2P9SB 4WFBL 3LDOA 4C1NK 2A42A 3VEXA 5F0XA 1YJNN 1VQ7N 3AAQA 3AARA 5CE3A 2KKZA 3BF3A 3SMPA 4RWTA 1RDWX 4H0OA 4U7BA 1N8RO 3WXMB 3HOTA 4FWMA 2JWKA 4XEIA 5EVZA 4BRIA 2P9PB 3P31A 3H46O 4RTFD 4IOCL 4B9QA 3QFPA 2NRWA 2V52B 4FWSA 4JAXA 4B1WB 5BR9A 1DEJA 4BR2A 3G71N 2IVNA 4CBUA 4BROA 2P9SA 4CZMA 3VEZA 2P9UA 1EO1A 3EE9A 3CCUN 1U6ZA 4JD2A 1MWKA 4JKDA 1RFQA 4DQ8A 3FZFA 2QWLA 1T44A 2QA4N 5FPMA 4BC4A 5BPMA 2YX6A 2J4RA 2P9PA 5AQWA 4A61A 3FGUA 1NWKA 5AQUA 1GLJO 3CERA 1QQOA 2IVPA 3FZKA 4JKGA 3WXJA 2ZJQL 5KQDA 2YCHA 3I56N 1HJOA 1NGFA 2P9UB 4JKFA 2HBLA 3QBWA 4JD2B 3CPWM 3ATVA 4WQ4A 1GLFO 1NGIA 4BQZA 3U9ZA 2ZGYA 3DWLA 5EY4A 3L4QA 3IDHA 4EFHA 4O5FA 1SZ2A 3ZEUA 4Z94A 5EOYA 1V4TA 1DGKN 4MDBA 4RCHA 1RGIA 4JKGB 3DXKA 5FPDA 1HUXA 3AY9A 1NGAA 5AQJA 4BGBA 1GLCG 1X3NA 2ITMA 5C12A 5FPNA 4JK7A 1K9MO 4IO8A 1P90A 5M1NA 3A5LC 5C2FA 3TSQA 4DB3A 3C65A 3O08A 4PHTX 3VEWA 2Q1NA 1WUAA 3EL2A 3F2KA 5ELZA 3ZX0A 1HKCA 3FFKB 3C7NA 2DPNA 2VCPA 4O8KA 5AQMA 3SBGA 3TTDA 1QQNA 2QW9A 3ZEUB 3OA9A 3WEEB 5LJVA 5LJWA 3CXCM 5JVHL 2NZTA 3VGKA 3C6HA 3TTCA 2GELA 3B8AX 5JMVA 3DXKB 3A5NC 3FLCO 3VERA 5HOOA 1W2BM 4JKHA 4JEPA 3SAHA 3EO3A 3PIPL 3LDPA 1TYQB 4J8FA 4B1VA 1Z6RA 3T7ZA 4ILHA 3WQUA 1SS6A 4JHDA 1IG8A 3C7NB 3VMFB 1BUPA 5BPNA 5B8HA 4FL9A 2H3GX 2Q97A 3J7ZO 4KBOA 3WEEA 2A3ZA 5AR0A 2D0PA 5BRDA 2QI2A 1T6CA 5BN8A 5GAEP 5TKYA 3E1YA 4NB4A 5CR4A 3PLAA 2QWPA 5BRHA 3R1XA 2P9IA 3VF6A 2QEXN 4FPBA 3VF4A 2NRXA 4FPAA 5CHIA 3D2EB 4MLEA 1QZ6A 1TYQA 3PIOL 1YHQN 4DHYA 3G6EN 4JHDB 1YVNA 4A5BA 1ESVA 3IUCA 1VQ5N 3CF5L 2ZF5O 1P8ZA 4O8UA 2ASOA 4H0TB 1QVFM 4IEEA 1QZ5A 2GUPA 2F9TA 2PBDA 1ATNA 3F5TA 3FE1A 4AM7A 2HF3A 3M3ZA 1KAYA 4BG9A 3GE1A 2P9IB 1KXPA 3VETA 2P9LA 1LOTB 3ENHA 3DXMB 3IFRA 2FLOA 3D2EA 2NNWA 2A5XA 4K43A 2HSTA 3VENA 2BH1A 3VF2A 3I55N 1VQPN 1YJWN 5FPEA 1K8AO 5AQHA 1T6DA 3VEVA 5C0YA 4E1JA 1Q18A 3O4WA 5KQ8A 5JLFA 2E1ZA 1QQMA 5BRFA 4H5VA 3CCSN 1GLLO 5AZJB 3P39A 5DM7L 2F9WA 2OTLN 1BA0A 4IFEA 5AQVA 3W3DA 3ZX2A 5C15A 1HX1A 3WXKA 3QFUA 4IOAL 5BREA 4BC3A 1ILYA 2P9LB 3SAGA 2GX9A 3DXMA 5AQZA 4H03B 3AGRA 3J8AA 1NBWA 4AM6A 4BY9C 4WYBA 3HRGA 3N4QA 1DKGD 2AA4A 2QWOA 3K9JA 2NRHA 4YOTA 3HBTA 3VTIA 4BRLA 4NLCA 1YIJN 4UY8O 5AZJA 2VYPA 1X3MA 4IEIA 1KQSM 3U4LA 1YF5L 3LDNA 3SK3A 5JLHA 2CH5A 2RE2A 3L6QA 2HBKA 4MLHA 4BREA 3KWGA 3U8XA 5AQIA 4G9ZA 2WC9A 4FSVA 5TKWA 3CJ7A 5AFUA 3R3LA 3S41A 1Q7YO 3FZHA 4A57A 4IOXA 3K9KA 1VQON 4CZGA 4BR5A 3TSUA 3Q7BA 1S3XA 4QS9A 4BVPA 3JXUA 5KPTA 3R8EA 4FWPA 4BRCA 1Q81O 3F9MA 4KH6A 3QMLA 1VQ4N 1WOQA 4CI6A 4Y0WA 3VPZA 3IMXA 3SBTA 1YXQA 2IIRA 3WXLA 3ULEB 3GL1A 5ADXH 1ATSA 3ENBA 3LDLA 3CHWA 3P4IA 3O1WA 3WXIA 4B1YB 5MLCQ 3CQXA 4KH4A 3U9DA 1H1VA 3CCEN 3WUHA 3LL3A 3O8MA 3E9LA 3NVKA 4WQ4C 1R59O 3OBYA 3CJ9A 1W97L 3CCLN 5M1PA 2WBNA 4A62A 2NRTA 2VWBA 2A6AA 4XH1A 5BPLA 4XH4A 1KAZA 4ILGB 4CZJA 1VQ9N 2A41A 4I6MB 4B1ZA 2YHWA 5M1FA 4CD3A 2OANA 4CZEA 4FWLA 2Q0UA 4C23A 5C10A 5JICA 3MN9A 3ULEA 2D4WA 4PKGA 4WCEL 2PAVA 3MX2A 4MO4A 2HOEA 4FOEA 1NGDA 3A5OC 4A2AA 4M7YA 4DKWA 2QXLA 3H3NO 4BVOA 1ZC6A 3QB0A 4BRGA 4LC9B 5AQGA 4CZLA 3CI5A 3EKSA 1QHAA 1VQLN 2I7NA 3MCPA 3EN9A 4JN4A 3UB5A 2CGLA 5AQTA 2JWLA 4QS7A 3VESA 3KWIA 4I6MA 1OKJA 4IO9L 1NGBA 2QWQA 4CZKA 2HF4A 2A40A 4BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX A;  4FWO A;  2V51 B;  2D0O A;  1NGH A;  1X9J A;  5BN9 A;  4CZI A;  3QBX A;  1XQS C;  3BEX A;  2ASP A;  3ATU A;  5E26 A;  1V4S A;  3VEO A;  3HI0 A;  3LM2 A;  4GY2 B;  5AQX A;  3MN7 A;  5AQR A;  1BU6 O;  2ZGZ A;  3UKR B;  4DCH A;  1XC3 A;  2P9N B;  2CH6 A;  1ZXO A;  2QWM A;  3DJC A;  3TPQ A;  1NLV A;  1NGG A;  2FF3 B;  2E2N A;  4HTL A;  1NGE A;  2BTF A;  4M63 C;  5AQK A;  3BF1 A;  4FOI A;  3BP8 A;  3GBT A;  4IJA A;  3W0L A;  3HM8 A;  4H0Y B;  3M1F A;  3GDQ A;  3HTV A;  3KHY A;  3UKR A;  1ATR A;  1SAZ A;  1Z05 A;  3LDQ A;  4FWN A;  2P9N A;  4MO5 A;  3RSE A;  1U2V B;  4K42 A;  5AQY A;  4M7X A;  2BUP A;  5AZI B;  5EXW A;  4PL8 A;  4F9O A;  4B1X B;  1E4F T;  1K8K B;  4YDU C;  4BQL A;  2E8A A;  3O1B A;  3VGM A;  1SQK A;  2P9K B;  3FR0 A;  4BRM A;  3KZB A;  3GG4 A;  4K25 A;  4H5W A;  5EX5 A;  2YJF A;  4A2B A;  1C0G A;  3EZW A;  2FSJ A;  2YJE A;  3CJB A;  3CJ1 A;  3MN6 A;  2YI1 A;  1EQY A;  4BR7 A;  4EHT A;  2E88 A;  4IJN A;  4B1U B;  2GTD A;  3RSE B;  1U2V A;  4CZH A;  3KVG A;  4QS8 A;  5AZI A;  1MWM A;  1S22 A;  5LY3 A;  1HLU A;  4BR0 A;  1K8K A;  3H45 C;  4FWQ A;  2FXU A;  4YDU A;  3H6E A;  2P9K A;  2W40 A;  4H0V B;  1GLA G;  3O80 A;  2E2Q A;  1G99 A;  4CBW A;  3R6M A;  1NM1 A;  2YHY A;  3D7E O;  4BRK A;  3VOV A;  4EHU A;  1GLE G;  1XUP O;  1NGC A;  3UKU A;  4BC2 A;  3A8Y A;  4H5N A;  4BRD A;  3VEY A;  1C0F A;  2V7Z A;  3FZL A;  4XH5 A;  4GNI A;  3D2F A;  4IWV A;  3TU5 A;  4ISF A;  2I7P A;  4BRF A;  4PKH A;  3HSC A;  4BGA A;  5F1X A;  3SMS A;  3UE5 A;  5AQN A;  1D4X A;  2WUS A;  4BG8 A;  3C0B A;  2FF6 A;  1NMD A;  3DAW A;  4BRN A;  3BUZ B;  2FSK A;  2GEM A;  3MMV A;  3UKU B;  2ZWH A;  3SLC A;  3HZ6 A;  4H5T A;  5AQS A;  3D2F B;  3FZM A;  4PL7 A;  4FWR A;  2EWS A;  2CGJ A;  1GLD G;  2CGK A;  4IZ9 A;  3R9P A;  1IJJ A;  4FWK A;  1TUY A;  4BR4 A;  3LM9 A;  2GWJ A;  4CZF A;  3H1V X;  4L3Q A;  3ZX3 A;  1KAX A;  4BRQ A;  3JS6 A;  1MDU B;  4H0P A;  4H5R A;  5AQO A;  1CZA N;  1BA1 A;  3WQT A;  4ISE A;  3L0Q A;  3CJA A;  3H1Q A;  1BOT O;  2Q31 A;  1LCU A;  5AFU H;  3ID8 A;  3A5M C;  3CQY A;  1HPM A;  1ZBS A;  3G25 A;  3MN5 A;  3QDK A;  3VGL A;  2E1Y A;  4EIA A;  3OHR A;  3O6W A;  2ASM A;  5KPR A;  4FO0 A;  1BO5 O;  1HKG A;  3CJC A;  1MA9 B;  5KPZ A;  4IXC A;  3O5B A;  5AQP A;  1BDG A;  1J6Z A;  2QWN A;  2Q0R A;  1E4G T;  4WQ5 A;  2Q2R A;  3SJH A;  4ISG A;  3I8B A;  3M6G A;  1YUW A;  2FSN A;  3QIC A;  1Y64 A;  3AAP A;  2KHO A;  3ENO A;  4PKI A;  5AQQ A;  3WT0 A;  4JNE A;  5E84 A;  2E2P A;  3ZET B;  1JCE A;  5F2R A;  1NGJ A;  3A0I X;  2E20 A;  3I33 A;  2IVO A;  2D1K A;  2NLX A;  4NO7 A;  4K41 A;  1HKB A;  1YAG A;  4EAH D;  2V7Y A;  4WQ5 C;  3L4I A;  2E2O A;  5AQL A;  1TUU A;  2QM1 A;  2W41 A;  1JCF A;  4CD1 A;  2GWK A;  3CIP A;  2QWR A;  2UYT A;  3EKU A;  2YHX A;  2HMP A;  3ZET A;  1GLB G;  3CET A;  3H3O B;  3GOI A;  4BRH A;  4CJ7 A;  5I9E B;  5AQF A;  4H0X B;  1BG3 A;  1JCG A;  3MDQ A;  4CBX A;  4BRA A;  2Q36 A;  1BWF O;  3MK6 A;  4BC5 A;  2AP1 A;  4BR9 A;  4HWI A;  2P9S B;  3LDO A;  2A42 A;  3VEX A;  5F0X A;  3AAQ A;  3AAR A;  5CE3 A;  3BF3 A;  3SMP A;  4RWT A;  1RDW X;  4H0O A;  4FWM A;  4XEI A;  5EVZ A;  4BRI A;  2P9P B;  3H46 O;  4RTF D;  4B9Q A;  3QFP A;  2V52 B;  4FWS A;  4JAX A;  4B1W B;  5BR9 A;  1DEJ A;  4BR2 A;  2IVN A;  4CBU A;  4BRO A;  2P9S A;  4CZM A;  3VEZ A;  2P9U A;  1U6Z A;  4JD2 A;  1MWK A;  1RFQ A;  4DQ8 A;  3FZF A;  2QWL A;  1T44 A;  5FPM A;  4BC4 A;  5BPM A;  2J4R A;  2P9P A;  5AQW A;  4A61 A;  3FGU A;  1NWK A;  5AQU A;  1GLJ O;  3CER A;  1QQO A;  2IVP A;  3FZK A;  3WXJ A;  5KQD A;  2YCH A;  1HJO A;  1NGF A;  2P9U B;  3QBW A;  4JD2 B;  3ATV A;  4WQ4 A;  1GLF O;  1NGI A;  4BQZ A;  3U9Z A;  2ZGY A;  3DWL A;  5EY4 A;  4EFH A;  3IDH A;  4O5F A;  1SZ2 A;  3ZEU A;  4Z94 A;  5EOY A;  1V4T A;  1DGK N;  4RCH A;  1RGI A;  3DXK A;  5FPD A;  1HUX A;  3AY9 A;  1NGA A;  5AQJ A;  4BGB A;  1GLC G;  1X3N A;  2ITM A;  5FPN A;  4IO8 A;  3A5L C;  4DB3 A;  3O08 A;  3VEW A;  2Q1N A;  1WUA A;  3EL2 A;  5ELZ A;  3ZX0 A;  1HKC A;  3FFK B;  3C7N A;  2DPN A;  2VCP A;  4O8K A;  5AQM A;  5LJV A;  1QQN A;  2QW9 A;  3ZEU B;  5LJW A;  3WEE B;  2NZT A;  3VGK A;  2GEL A;  3B8A X;  5JMV A;  3DXK B;  3FLC O;  3A5N C;  3VER A;  3EO3 A;  3LDP A;  1TYQ B;  4J8F A;  4B1V A;  1Z6R A;  3WQU A;  4JHD A;  1IG8 A;  3C7N B;  1BUP A;  5BPN A;  5B8H A;  4FL9 A;  2H3G X;  2Q97 A;  4KBO A;  3WEE A;  2A3Z A;  5AR0 A;  2D0P A;  5BRD A;  1T6C A;  5BN8 A;  5TKY A;  4NB4 A;  2QWP A;  5BRH A;  2P9I A;  3VF6 A;  4FPB A;  3VF4 A;  4FPA A;  3D2E B;  4MLE A;  1QZ6 A;  1TYQ A;  4DHY A;  4JHD B;  1YVN A;  3IUC A;  1ESV A;  2ZF5 O;  1P8Z A;  2ASO A;  4H0T B;  1QZ5 A;  2GUP A;  2F9T A;  2PBD A;  1ATN A;  3FE1 A;  4AM7 A;  2HF3 A;  3M3Z A;  1KAY A;  4BG9 A;  3GE1 A;  2P9I B;  1KXP A;  3VET A;  2P9L A;  1LOT B;  3ENH A;  3DXM B;  3IFR A;  2FLO A;  3D2E A;  2A5X A;  4K43 A;  3VEN A;  3VF2 A;  5FPE A;  5AQH A;  1T6D A;  3VEV A;  4E1J A;  1Q18 A;  3O4W A;  5KQ8 A;  5JLF A;  2E1Z A;  1QQM A;  5BRF A;  4H5V A;  1GLL O;  5AZJ B;  2F9W A;  1BA0 A;  5AQV A;  3W3D A;  3ZX2 A;  1HX1 A;  3WXK A;  3QFU A;  5BRE A;  4BC3 A;  2P9L B;  3DXM A;  5AQZ A;  4H03 B;  3J8A A;  1NBW A;  4AM6 A;  4WYB A;  1DKG D;  2AA4 A;  2QWO A;  2NRH A;  3HBT A;  4BRL A;  5AZJ A;  2VYP A;  1X3M A;  3U4L A;  3LDN A;  3SK3 A;  5JLH A;  2CH5 A;  3L6Q A;  4MLH A;  4BRE A;  3U8X A;  5AQI A;  4FSV A;  3CJ7 A;  5AFU A;  3S41 A;  3FZH A;  4CZG A;  4BR5 A;  1S3X A;  4QS9 A;  4BVP A;  3JXU A;  5KPT A;  3R8E A;  4FWP A;  4BRC A;  3F9M A;  3QML A;  1WOQ A;  4CI6 A;  4Y0W A;  3VPZ A;  3IMX A;  1YXQ A;  2IIR A;  3WXL A;  3ULE B;  3GL1 A;  5ADX H;  1ATS A;  3LDL A;  3WXI A;  3CHW A;  3P4I A;  3O1W A;  4B1Y B;  3CQX A;  3U9D A;  1H1V A;  3WUH A;  3LL3 A;  3O8M A;  4WQ4 C;  1R59 O;  3CJ9 A;  4A62 A;  2VWB A;  2A6A A;  4XH1 A;  5BPL A;  4XH4 A;  1KAZ A;  4CZJ A;  2A41 A;  4I6M B;  4B1Z A;  2YHW A;  4CD3 A;  2OAN A;  4CZE A;  4FWL A;  2Q0U A;  4C23 A;  5JIC A;  3MN9 A;  3ULE A;  2D4W A;  4PKG A;  2PAV A;  4MO4 A;  2HOE A;  4FOE A;  1NGD A;  3A5O C;  4A2A A;  4M7Y A;  2QXL A;  3H3N O;  4BVO A;  1ZC6 A;  3QB0 A;  4BRG A;  4LC9 B;  5AQG A;  4CZL A;  3CI5 A;  3EKS A;  1QHA A;  2I7N A;  3MCP A;  3EN9 A;  4JN4 A;  3UB5 A;  2CGL A;  5AQT A;  4QS7 A;  3VES A;  4I6M A;  1OKJ A;  1NGB A;  2QWQ A;  4CZK A;  2HF4 A;  2A40 A;  4BRP A; 
#chains in the Genus database with same CATH topology
 3L8B A;  4FWO A;  2V51 B;  4NCA A;  2OPS A;  3ZSV A;  1K73 O;  2OZS A;  4NYF A;  4GMJ B;  1DT9 A;  4HHT A;  3HI0 A;  3LM2 A;  4GY2 B;  5AQR A;  3TAP A;  4DCH A;  1W7A A;  4MQ3 A;  3OS2 A;  4R5P A;  3S3O A;  4IKF A;  2FF3 B;  1KD1 O;  3OYH A;  3MCA B;  2HHS A;  3HK2 A;  2F8T A;  3W0L A;  3GBT A;  1MU2 A;  3M1F A;  3CC4 N;  4IDH A;  1VQK N;  3K5M A;  3OJS A;  3OW2 M;  4DR3 K;  1RBT A;  1OVQ A;  3MXM A;  1U2V B;  2QKB A;  3LPU A;  4PL8 A;  1K8K B;  4YDU C;  4BQL A;  2G8I A;  3OYC A;  1NK5 A;  5EX5 A;  1VAZ A;  2YJF A;  4CJF A;  4C8M A;  1C0G A;  3EZW A;  2FSJ A;  3CJB A;  1U45 A;  1NKE A;  4NXM K;  2ITG A;  1S6Q A;  2GTD A;  4CFD A;  3RSE B;  2IGI A;  4QS8 A;  1KLM A;  3PX6 A;  3NGY A;  4M45 A;  4BR0 A;  4DQS A;  3O80 A;  1BHL A;  1G99 A;  4CFB A;  1UA1 A;  2YHB A;  4YOY A;  4E1N A;  1GLE G;  1XUP O;  4B9N A;  4NCB A;  4BRD A;  3BZK A;  2V7Z A;  3TTF A;  4JS4 A;  1I39 A;  4DV1 K;  5I3U A;  4JKB A;  2RHK A;  1ASV A;  3FFI A;  1QS4 A;  3LAK A;  1BI4 A;  3HSC A;  3O9S A;  4BGA A;  3IAY A;  1LAV A;  3C0B A;  4FVU A;  1UAX A;  3BUZ B;  2Z1I A;  3M5R A;  4MDA A;  3AVF A;  3ZYY X;  3KTQ A;  3EYZ A;  4PUO A;  4LF8 K;  3HO1 A;  4FWR A;  1JLG A;  1GLD G;  3CCV N;  2CGK A;  1I3A A;  2FC0 A;  1IJJ A;  4FWK A;  4DU1 A;  2EX3 A;  4B3M K;  3LM9 A;  2GWJ A;  3H1V X;  3T19 A;  4RW6 A;  1KAX A;  2R7Y A;  2E5L K;  4H0P A;  1BL3 A;  3MX5 A;  4H5R A;  2QTD A;  1N36 K;  3WQT A;  3L0Q A;  3CJA A;  4B9T A;  3H1Q A;  1LCU A;  2OYQ A;  3CQY A;  4DR7 K;  1HPM A;  3MN5 A;  1JLQ A;  2ZD1 A;  1UWB A;  4W5O A;  3AGK A;  4YOU A;  4HUE A;  4EIA A;  3LPT A;  4OVL A;  2ATQ A;  5KPR A;  1BO5 O;  4F8R A;  1NK9 A;  1BDG A;  2QWN A;  3TR8 A;  3RR7 A;  4B9S A;  3OYM A;  2VWJ A;  1RT5 A;  4WQ5 A;  1WSF A;  2BE2 A;  2O8C B;  4BWM A;  4DUY K;  3DLG A;  3JAM O;  3ZSY A;  4WF9 L;  4JK9 A;  1Y64 A;  2HBJ A;  2KQ2 A;  1VQM N;  3ENO A;  4PKI A;  5AQQ A;  5E84 A;  4OKJ A;  4E7L A;  3AA3 A;  3ZET B;  1VQ6 N;  3RTV A;  3SUN A;  1TK8 A;  4X65 K;  4K41 A;  4O0I A;  4CJR A;  3CM6 A;  3SAF A;  4J2B A;  3DRS A;  2QM1 A;  4FLX A;  1UA0 A;  3O9T A;  1EXQ A;  2VWK A;  3CIP A;  3VQP A;  4C8K A;  3CG7 A;  4CGI A;  3AA4 A;  4JI4 K;  3ZT1 A;  2YHX A;  4PA1 A;  1OVY A;  2HMP A;  4LF6 K;  4PWD A;  3VQ7 A;  4ZTF A;  2QKK A;  1TKX A;  5AQF A;  3QEW A;  3T1Y K;  3PY8 A;  5HBM A;  1NJZ A;  3MDQ A;  4RG8 A;  2AJQ A;  4CBX A;  2LSN A;  4BRA A;  4LH5 A;  3THW A;  3U6F A;  4HWI A;  1C0U A;  3LAM A;  3VEX A;  1YJN N;  4RWT A;  1RDW X;  3OYG A;  1N8R O;  4M3T A;  4DFM A;  1WB9 A;  4B9V A;  4N76 A;  1IKY A;  2JWK A;  4XEI A;  2XY6 A;  1D5A A;  5EVZ A;  3P31 A;  5J2N A;  3QFP A;  2NRW A;  4JAX A;  3G71 N;  4BR2 A;  4CF9 A;  4CBU A;  4AHC A;  3OTO K;  3SQ2 A;  3EE9 A;  3CCU N;  4DV4 K;  1LWC A;  2RKI A;  4JD2 A;  4OKK A;  4DQ8 A;  2QA4 N;  3NF9 A;  3KJV A;  2A1R A;  3RWU A;  3QNN A;  2YX6 A;  4J2E A;  2Y1I A;  3HJF A;  5AQU A;  3CER A;  2IVP A;  5KQD A;  2YCH A;  1QE1 A;  4IG0 A;  4DTP A;  2P9U B;  2ZQB A;  3CPW M;  4WQ4 A;  1GLF O;  3J81 O;  3HPO A;  3MEC A;  3L4Q A;  3AO4 A;  1SZ2 A;  2O8E B;  3ZEU A;  3ZSW A;  4B8C A;  4Z94 A;  3RMC A;  1DGK N;  3ZSR A;  1J5O A;  1HUX A;  3AY9 A;  5AQJ A;  3THX A;  1JKH A;  1HMV A;  2ITM A;  2VG6 A;  1CZ9 A;  5FPN A;  1K9M O;  4M41 A;  3VEW A;  3EL2 A;  2WOM A;  3ZX0 A;  3C7N A;  1HNV A;  3SBG A;  2QW9 A;  3CXC M;  3WEE B;  4X64 K;  4IDK A;  3MXI A;  3DI6 A;  3B8A X;  3TTC A;  5JMV A;  1W2B M;  4DS5 A;  4KTQ A;  3DRP A;  3LDP A;  4CEZ A;  4B1V A;  4OKE A;  1Z6R A;  3WQU A;  5CZ2 A;  4KHP K;  4FLT A;  2QXF A;  2H3G X;  1SL1 A;  2D0P A;  1FK9 A;  2QI2 A;  5TKY A;  3SJJ A;  3PLA A;  2QWP A;  5LMN K;  2O8D B;  3VA3 A;  3VF6 A;  4M3R A;  4FPA A;  1TL3 A;  1JLE A;  3PIO L;  4DTR A;  3G6E N;  3J7A P;  1VQ5 N;  1JL1 A;  3NE6 A;  3CF5 L;  4KTW A;  1P8Z A;  4IEE A;  1QZ5 A;  2PBD A;  1ATN A;  4EZ6 A;  4AM7 A;  1N33 K;  1KAY A;  1XHZ A;  3VET A;  2P9L A;  3K5N A;  3IFR A;  1I94 K;  1QTM A;  1IKX A;  2FLO A;  2HNZ A;  3D2E A;  2NNW A;  2A5X A;  4K43 A;  3ZSO A;  2HST A;  1D9F A;  1XNQ K;  1VQP N;  5C0Y A;  1CLQ A;  1Q18 A;  5JLF A;  5FDL A;  3AVM A;  1NJX A;  4GKJ K;  2OTL N;  1BGX T;  3U3G A;  3ZX2 A;  2ZE2 A;  3AVH A;  5BRE A;  5JS1 A;  1RT7 A;  1SL0 A;  2GX9 A;  4B3R K;  2VG7 A;  4AHT A;  1ZBI A;  1TL1 A;  4AM6 A;  4BY9 C;  4WYB A;  3N4Q A;  4AHR A;  2AA4 A;  3K9J A;  4BRL A;  4DLE A;  4NLC A;  1YIJ N;  1YT3 A;  4FLW A;  1KQS M;  3K0S A;  1N6Q A;  3MXJ A;  3C95 A;  5SWM A;  1TK5 A;  4CIF A;  3L6Q A;  4ELT A;  3AVG A;  4BRE A;  4KB1 A;  3U8X A;  5AQI A;  4X66 K;  1B9F A;  4DR1 K;  3FZH A;  4A57 A;  4IOX A;  3K9K A;  1VQO N;  1J9A A;  4CZG A;  1QHT A;  3TSU A;  1IO2 A;  4CIE A;  1L3T A;  4DTO A;  4CJL A;  1BIS A;  4CJK A;  1ITG A;  3KK1 A;  4FJH A;  3F9M A;  4CI6 A;  4Y0W A;  1YXQ A;  3ENB A;  1X1P A;  3LWM A;  4Y1C A;  4DR5 K;  3QEV A;  4KH4 A;  1H1V A;  4N5S A;  4BAC A;  3E9L A;  4DWI A;  1R59 O;  1U04 A;  2JLE A;  3CCL N;  2VWB A;  2W6L A;  2A6A A;  4I2Q A;  5BPL A;  1VSF A;  2FBT A;  3V9Z A;  4CZJ A;  4B1Z A;  4CD3 A;  4FWL A;  2YHA A;  2Q0U A;  3IS9 A;  4DSF A;  2B6A A;  3MN9 A;  4FLU A;  2D4W A;  4PKG A;  1A5W A;  3HM9 A;  3LP2 A;  3MX2 A;  2OPQ A;  2HOE A;  2E6L A;  2QXL A;  4BVO A;  3WNH A;  4LC9 B;  3EKS A;  1GOB A;  5CY4 A;  3EN9 A;  4JN4 A;  3HL8 A;  3UB5 A;  1VHX A;  4JLH A;  4M3X A;  3VES A;  1RDA A;  4DV6 K;  4DSL A;  4DLG A;  2KZM A;  3K5O A;  3TAN A;  2BGG A;  4I6M A;  3HP9 A;  3NDK A;  2A40 A;  4BRP A;  3AO1 A;  3NAE A;  5ADX A;  3NH2 A;  2ZJP L;  3OYA A;  1X9J A;  4CZI A;  4KHS A;  3QBX A;  3WNE A;  3QEP A;  4J2A A;  5E26 A;  4CEA A;  3L3U A;  4YOX A;  5AQX A;  3UKR B;  1BU6 O;  1VQ8 N;  1SV5 A;  2FBY A;  3IKM A;  1XC3 A;  3TPQ A;  2CH6 A;  2I5J A;  5DMR A;  3PUF A;  3AO3 A;  4W5T A;  2XRI A;  2E2N A;  1NGE A;  2BTF A;  4M63 C;  5AJ3 K;  3BF1 A;  2G8F A;  1T7P A;  1QSL A;  3AVN A;  3C6A A;  3V9X A;  5HRN A;  1SAZ A;  1Z05 A;  3QO9 A;  1X9S A;  4FWN A;  1LWF A;  4CES A;  4K42 A;  4B3T K;  1HYZ A;  4M7X A;  1EWQ A;  4YY3 K;  1BCM A;  1E4F T;  2P9K B;  3D45 A;  4BRM A;  4CJS A;  1KTQ A;  4K25 A;  4CF2 A;  3HOS A;  4B3S K;  3O9R A;  4H5W A;  2HB5 A;  4A2B A;  4LF5 K;  3CJ1 A;  3MN6 A;  2G8W A;  4GVE A;  4OPA A;  4EZ9 A;  4DTJ A;  4EHT A;  5GAD P;  3DYA A;  4IJN A;  3IRX A;  4CJU A;  3KVG A;  3MED A;  5LY3 A;  1HLU A;  1TKD A;  4CGD A;  4FWQ A;  5CYM A;  3L2V A;  2E2Q A;  3CMA N;  3C94 A;  3F9K A;  5C2D A;  2UXC K;  4Z4I A;  2YHY A;  3KD1 E;  3D7E O;  4BRK A;  3VOV A;  5DM6 L;  4J2D A;  1M90 O;  4GV6 A;  1NGC A;  3UKU A;  3VEY A;  3FZL A;  3E9P A;  3NF6 A;  3V6D A;  3TU5 A;  4ISF A;  4JK8 A;  2I7P A;  4BRF A;  1VSL A;  3V9W A;  3QNO A;  4ZTJ A;  5AQN A;  5IT9 O;  1D4X A;  3LAN A;  4CGG A;  4BRN A;  3DAW A;  4JKE A;  2FSK A;  5FRO A;  2VGN A;  4H5T A;  3D2F B;  4OO1 J;  3FZM A;  3VQC A;  2X74 A;  1HNX K;  3VN5 A;  2UU9 K;  3TAB A;  3M8S A;  3TAR A;  3QET A;  2FBV A;  3OYI A;  3V9U A;  2DFE A;  2NRR A;  4L3Q A;  3C6T A;  2Z1J A;  3HVR A;  4R79 A;  4KH5 A;  1RT4 A;  3I0R A;  3OYE A;  2O8B A;  3RR8 A;  4NYN A;  3RVC A;  4LF9 K;  3MWT A;  3ID8 A;  2OPP A;  3CCJ N;  3NBP A;  3G25 A;  1ZBS A;  1TGO A;  1RT6 A;  2HBM A;  4OPH A;  3VGL A;  2P5G A;  2X6N A;  3CPE A;  3THY B;  2E1Y A;  3OHR A;  2ASM A;  3AVA A;  2ZJR L;  5HL7 L;  2Q3S A;  1EET A;  2DY4 A;  3J7Y P;  5KPZ A;  4IXC A;  2NRV A;  3SNN A;  3V1O A;  2Q0R A;  4YOV A;  1NJI O;  3OYL A;  3NHG A;  1A5X A;  3SJH A;  4NXN K;  5GIP A;  1LW2 A;  3RMB A;  2HND A;  1YUW A;  2D0A A;  2P5O A;  3MWP A;  2KLA A;  3AAP A;  4JKC A;  3O9Q A;  3WT0 A;  4B9M A;  1NGJ A;  3A0I X;  2IVO A;  5GAG P;  2NLX A;  1QVG M;  4BWJ A;  4DU3 A;  2V7Y A;  5GAH P;  5AQL A;  2HHQ A;  3O3G A;  2GWK A;  4AF1 A;  2UYT A;  3CCM N;  4CJT A;  4A59 A;  1WN7 A;  3ZET A;  5JVG L;  3ZT0 A;  2E6M A;  3H3O B;  3HT3 A;  3HXM A;  4BRH A;  4HVJ A;  1FJG K;  5I9E B;  1VSI A;  3T69 A;  4C8N A;  3N4P A;  1JCG A;  4DFJ A;  3TAM A;  2Q36 A;  3MK6 A;  4BR9 A;  3UIQ A;  2OPR A;  2P9S B;  2XHB A;  2YV0 X;  1NJY A;  3L2W A;  1VQ7 N;  3AAQ A;  5CE3 A;  2KKZ A;  4F2S A;  4FZZ A;  4H0O A;  4E7J A;  4FWM A;  1X9W A;  2YNG A;  2P9P B;  4B9Q A;  2PYJ A;  2V52 B;  1CZB A;  4FJ9 A;  4W5R A;  4FJ5 A;  4BRO A;  5BR8 K;  4CZM A;  3VEZ A;  1NOY A;  4JKD A;  3FZF A;  1TAQ A;  2QWL A;  2F96 A;  1T44 A;  4DSJ A;  4BC4 A;  3CM5 A;  4CW7 B;  5BPM A;  3G10 A;  4B8A B;  1C1B A;  4E19 A;  4FM2 A;  3O4N A;  2F4V K;  2YNI A;  3WXJ A;  2ZJQ L;  3I56 N;  2VG5 A;  2HBL A;  2P1J A;  4HUG A;  3ATV A;  3VQ9 A;  3T3F A;  3ZCM A;  4EFH A;  1SKR A;  3VQB A;  4O5F A;  4DQP A;  4E7K A;  5EOY A;  5E41 A;  3SYZ A;  1RGI A;  3DXK A;  1WBD A;  1X3N A;  1K6Y A;  4JK7 A;  3D0P A;  3OYK A;  2HHW A;  4DSI A;  3RRG A;  3TSQ A;  5FRN A;  3C65 A;  4JI2 K;  2Q1N A;  5ELZ A;  1HKC A;  4KHY A;  2DPN A;  3HP6 A;  1QQN A;  2KW4 A;  2O8E A;  3B6P A;  4X62 K;  2NZT A;  1L3V A;  4QAG A;  2GEL A;  3TI0 A;  3TAG A;  1JLA A;  4Q0B A;  4FCY A;  1WLJ A;  1FXX A;  1JL2 A;  3K2P A;  1TYQ B;  1DLO A;  4J8F A;  4HCB A;  2KFN A;  4JHD A;  4K8Z A;  4CJQ A;  1C6V A;  3C7N B;  1OH6 A;  1FKO A;  2KZZ A;  1NMN A;  1SKW A;  5BRD A;  2IAJ A;  3AVI A;  2P9I A;  2GBZ A;  2D0B A;  4FPB A;  4CIG A;  5A2Q O;  4FJX A;  2G8H A;  1JXE A;  3JSM A;  4DU4 A;  4DF8 A;  1ASW A;  1J5E K;  4A5B A;  1KSP A;  4IBN A;  1NKC A;  4KRE A;  1WAJ A;  3SUP A;  2ZF5 O;  4F3T A;  4DTU A;  2GUP A;  1T8E A;  3F5T A;  4CVN E;  1F21 A;  4BG9 A;  4CER A;  3GE1 A;  4OLB A;  1KXP A;  3PX0 A;  3KK2 A;  2BH1 A;  3I55 N;  1JXB A;  5KGX A;  3VEV A;  4E1J A;  5KQ8 A;  4M3U A;  1VK0 A;  5DM7 L;  1T03 A;  4O44 A;  1HYV A;  2F9W A;  2HHT A;  3A2F A;  3W3D A;  1HX1 A;  3QFU A;  1BIZ A;  2P9L B;  1S9E A;  5HP1 A;  3KKS A;  4I9Q A;  4BDY A;  1KLN A;  1KVA A;  1NBW A;  3ZSQ A;  5KRT A;  1RIL A;  3HBT A;  4PQU A;  4UY8 O;  5AZJ A;  1X3M A;  1B92 A;  3QES A;  2D0C A;  3SK3 A;  2CH5 A;  4DR6 K;  4DV0 K;  4MLH A;  4G9Z A;  2D5R A;  2WC9 A;  2F8S A;  5AFU A;  3R3L A;  3HYF A;  1HNI A;  3SQ0 A;  4CJV A;  2XY5 A;  1HPZ A;  3VQQ A;  4BR5 A;  4DTN A;  2RPI A;  1VSM A;  1HNW K;  4KFB A;  4BVP A;  4CJ3 A;  3DOK A;  5KPT A;  4BRC A;  1Q81 O;  1KVC A;  4DTM A;  4RW7 A;  1WOQ A;  2W42 A;  4FLY A;  2IIR A;  3ULE B;  3EY1 A;  3OY9 A;  3O1W A;  2XY8 A;  1KVB A;  1BCO A;  3CCE N;  3B6O A;  3WUH A;  3LL3 A;  3NVK A;  4WQ4 C;  3ALY A;  3MAQ A;  3S9H A;  2WBN A;  4A62 A;  4BDP A;  2JGU A;  4XH1 A;  4IFY A;  1VQ9 N;  4ILG B;  2YHW A;  5M1F A;  4CZE A;  1Q9X A;  4FK0 A;  3NCI A;  1HNZ K;  1D9D A;  5C10 A;  4JI7 K;  4WCE L;  5D3G A;  1WSH A;  2PAV A;  4MO4 A;  3BDP A;  3A5O C;  3H3N O;  3QB0 A;  4BRG A;  5AQG A;  4C8L A;  3LDS A;  2GUI A;  3CI5 A;  1QHA A;  3CFR A;  3MCP A;  5J2P A;  1WSJ A;  2JWL A;  4RW9 A;  3I8D A;  4V19 S;  3KWI A;  4JRP A;  4CGJ A;  2W6K A;  1VSH A;  1S1W A;  3OVN A;  2XO7 A;  4CZK A;  4CHP A;  3DLB A;  4GV9 A;  5EU7 A;  1LV5 A;  4F4K A;  5BN9 A;  2PZS A;  1FKP A;  2G8V A;  4AHU A;  4DQI A;  1XQS C;  4AH9 A;  3KLF A;  3E66 A;  4DTS A;  3VQA A;  1V4S A;  5IWA K;  3MN7 A;  3AA5 X;  3EEQ A;  4F3O A;  4FLZ A;  5LMU K;  2P9N B;  3DJC A;  1RBV A;  1ZXO A;  2QWM A;  2VQE K;  1NLV A;  3DMJ A;  5AQK A;  1JLB A;  3BP8 A;  4H0Y B;  1YI2 N;  4CJW A;  3GDQ A;  4CEO A;  3HTV A;  4CK1 A;  2RF2 A;  2HMI A;  3OYD A;  2PYL A;  3RSE A;  3CC2 N;  3LP0 A;  5FLX O;  2BUP A;  5AZI B;  5EXW A;  4F9O A;  4B1X B;  3G4S N;  1DTT A;  1SQK A;  3FR0 A;  3GG4 A;  1NKB A;  4FJJ A;  4FZX C;  5C24 A;  1Q86 O;  2NRZ A;  4KO0 A;  3VQ6 A;  2YI1 A;  1EQY A;  3VQ8 A;  1TKZ A;  1VSJ A;  3BZC A;  1U2V A;  2KFZ A;  4KKO A;  1K8K A;  4E1M A;  3J80 O;  1W0H A;  4YDU A;  1SUQ A;  3H6E A;  2P9K A;  1GLA G;  4MFB A;  1BI4 B;  4FJN A;  1CXU A;  4OPJ A;  1QSY A;  3CYM A;  3R6M A;  1NM1 A;  4CHQ A;  3S3N A;  4EHU A;  4BC2 A;  4H5N A;  2OZM A;  1C0F A;  3QER A;  4H8K A;  2YKM A;  4AQY K;  4ID5 A;  4IWV A;  1KC8 O;  4RW4 A;  3TAE A;  4FJ8 A;  3SMS A;  3UE5 A;  2KTQ A;  2WUS A;  1S6P A;  4IG3 A;  4BG8 A;  3L2Q A;  2FF6 A;  1A5V A;  1NMD A;  3O3H A;  3CFO A;  4ILJ A;  2GEM A;  1UOC A;  3KLH A;  1VRU A;  2IS3 A;  4FXD A;  2O8F A;  3DLR A;  3KLE A;  4PL7 A;  4IFV A;  3E9O A;  3O3F A;  4LFA K;  1KCF A;  5C25 A;  2EHG A;  2HW3 A;  3SQ1 A;  1EX4 A;  3ZX3 A;  3QEX A;  2UUB K;  4M3Z A;  1MDU B;  1XC9 A;  1CZA N;  4QCL A;  5J2Q A;  4ISE A;  3ULD A;  3NMU A;  4OX9 K;  1YTU A;  3WNF A;  4LFB K;  4FJK A;  5AFU H;  4BDZ A;  4DG1 A;  1DTQ A;  3A5M C;  4AHV A;  3ID6 A;  3OYN A;  4EP4 A;  4FK4 A;  3O6W A;  4JKA A;  4FO0 A;  4OGC A;  3QEI A;  3CJC A;  3HPG A;  3O5B A;  5AQP A;  3C6U A;  3CCR N;  3D6R A;  1J6Z A;  1R0A A;  1S1T A;  1XI1 A;  2HVI A;  4YOW A;  4ISG A;  3I8B A;  3M6G A;  4Z4F A;  4DV7 K;  4U67 L;  4CF8 A;  2HVH A;  2KHO A;  4HCC A;  4LF7 K;  2PFU A;  1JCE A;  5F2R A;  5GIN A;  2E20 A;  1HQE A;  4KI6 A;  4NO7 A;  3S3M A;  1HKB A;  3L2U A;  4EAH D;  4WQ5 C;  4E7H A;  2E2O A;  3VTH A;  1XNR K;  2O8C A;  1IV0 A;  2W41 A;  3DRR A;  2QWR A;  3EKU A;  4FJ7 A;  2X6S A;  3CET A;  4JI1 K;  1L3S A;  3GOI A;  4H0X B;  5T7B A;  1N5Y A;  1BG3 A;  3V81 A;  5KTQ A;  2NUB A;  1BWF O;  1IH7 A;  4BC5 A;  2AP1 A;  2B5J A;  4OJR A;  4WFA L;  4HUF A;  1SL2 A;  4C1N K;  3U3Y A;  4K8X A;  3DOL A;  2UXD K;  3AAR A;  4NCG A;  3BF3 A;  4KB0 A;  3WXM B;  3QIP A;  3V1Q A;  3PSF A;  4FW2 A;  4IOC L;  3P83 D;  3THW B;  1DEJ A;  2IVN A;  1S5J A;  2P9S A;  4CJP A;  2B4J A;  4LY7 A;  2P9U A;  3T1H K;  1MWK A;  1RFQ A;  4Z4E A;  2VQF K;  1X9M A;  4A61 A;  3AVK A;  5AQW A;  5FRM A;  3FGU A;  5JS2 A;  2DFH A;  1VSE A;  4TSX A;  1QQO A;  4JKG A;  3NFA A;  4FVM A;  1HJO A;  4E7I A;  4JI0 K;  3QIO A;  1U47 A;  2HHV A;  4JD2 B;  5HLF A;  1NGI A;  2ZGY A;  2FBX A;  3IDH A;  1V4T A;  4MDB A;  3DLE A;  4RCH A;  5FPD A;  1QSS A;  3ZT4 A;  4EP5 A;  3OS1 A;  4CJ5 A;  4LF4 K;  5C12 A;  4IO8 A;  1P90 A;  4O4G A;  5M1N A;  3K57 A;  3AA2 A;  4DB3 A;  4DF4 A;  3O08 A;  4Z4C A;  1WUA A;  3FFK B;  2ZM6 K;  4YFU A;  2VCP A;  1ZBH A;  5JVH L;  3ZEU B;  1RTH A;  5LJW A;  4HTU A;  3WNG A;  1RBU A;  3C6H A;  4OLA A;  3FLC O;  4WE1 A;  4DUZ K;  2O8D A;  3KKR A;  3VQD A;  4JEP A;  3SAH A;  1JLC A;  3EO3 A;  3PIP L;  3VA0 A;  4ILH A;  1SS6 A;  3VMF B;  5BPN A;  5B8H A;  4AIL C;  1OH7 A;  4FL9 A;  2Q97 A;  3J7Z O;  4DFK A;  1RTI A;  4KBO A;  3WEE A;  2A3Z A;  5AR0 A;  1T6C A;  1WSG A;  5GAE P;  4LFC K;  4NB4 A;  1IKV A;  2P51 A;  5BRH A;  3R1X A;  1TK0 A;  2NRX A;  3THV A;  1L5U A;  2X78 A;  3D2E B;  4MLE A;  1WBB A;  3CFP A;  4CHN A;  4I9L A;  3IUC A;  4KTZ A;  3SI6 A;  3AV9 A;  4O8U A;  2ASO A;  1QVF M;  1XMQ K;  2UUA K;  2F9T A;  2HF3 A;  3NF8 A;  3V4I A;  2P9I B;  4F2R A;  3DXM B;  4DQR A;  4GVM A;  3VEN A;  1IBK K;  1RBS A;  3VF2 A;  3ZT3 A;  1YJW N;  3V1R A;  5AQH A;  1T6D A;  3LZJ A;  3CCS N;  4H5V A;  2HHU A;  3P39 A;  2UUC K;  4IFE A;  1XHX A;  5CYQ A;  5CZ1 A;  4IOA L;  4KHN A;  4BC3 A;  4B9U A;  4H03 B;  3AGR A;  1DKG D;  2QWO A;  4YOT A;  3VTI A;  3TAQ A;  3SV3 A;  1VSK A;  1LAW A;  3VQE A;  3O4Q A;  1WNS A;  3LDN A;  1ASU A;  4CHO A;  2OA8 A;  1JLF A;  1TV6 A;  4Q5V A;  3CJ7 A;  3S41 A;  5J1E A;  1Q7Y O;  1WAF A;  4ID1 A;  3K58 A;  2GV9 A;  3Q7B A;  4QS9 A;  4L8R B;  1GOC A;  3R8E A;  1LW0 A;  1RDB A;  4KH6 A;  3QML A;  3VPZ A;  3SBT A;  2G8K A;  1NNE A;  3AO2 A;  3LDL A;  3CHW A;  1S9G A;  5MLC Q;  2DTU A;  4CE9 A;  3O8M A;  1LWE A;  3CJ9 A;  1W97 L;  4QOZ B;  4GW6 A;  4N41 A;  2NRT A;  1KAZ A;  2A41 A;  1J54 A;  4C23 A;  3ULE A;  1B9D A;  3AVL A;  1RT2 A;  4KI4 A;  3MEE A;  4A2A A;  4FOE A;  1NGD A;  1TKT A;  4DS4 A;  4JYA K;  4G1Q A;  4BE2 A;  4CZL A;  2XY7 A;  4LD0 A;  1VQL N;  2CGL A;  5AQT A;  3ASM A;  4QS7 A;  1Z26 A;  1NGB A;  4ZHR A;  2QWQ A;  4M3W A;  2HF4 A;  4O0J A;  3DLH A;  2D0O A;  1NGH A;  3NVM A;  3TAF A;  4I7F A;  1M1K O;  3CC7 N;  4DV2 K;  1S72 N;  3BEX A;  2ASP A;  2RN2 A;  4ICL A;  3ATU A;  2E4L A;  4OGE A;  3VEO A;  2ZGZ A;  4NLB A;  3ZT2 A;  4C1N I;  1NGG A;  3KK7 A;  2BAN A;  3OYJ A;  5HRO A;  1C1A A;  4O55 A;  3Q7C A;  4HTL A;  5M1K A;  1RDD A;  4FOI A;  4IJA A;  1HYS A;  3HM8 A;  4N47 A;  4A5A A;  4H4M A;  1U48 A;  3KHY A;  4JI6 K;  4GV3 A;  3UKR A;  1ATR A;  3LDQ A;  3LWL A;  4CGH A;  2Y1J A;  5DK5 A;  2P9N A;  4MO5 A;  5LL6 Z;  1EP4 A;  5AQY A;  4CED A;  3OJU A;  2Z1H A;  3L2R A;  3IG1 A;  2E8A A;  3O1B A;  3VGM A;  4N56 A;  5GIO A;  3NGI A;  3KZB A;  1NK8 A;  2F7T A;  4Z4H A;  3TSP A;  4FK2 A;  1NK7 A;  2YJE A;  1HRH A;  3EZ5 A;  4BR7 A;  3CD6 N;  2E88 A;  1YIT N;  4B1U B;  1Q82 O;  4CZH A;  5M1O A;  5AZI A;  1VQN N;  1MWM A;  1S22 A;  4FM0 A;  3H45 C;  2FXU A;  3ZLJ A;  4H0V B;  2W40 A;  2G8U A;  4CBW A;  4DV3 K;  1XWL A;  2DFF A;  3SQ4 A;  1VRT A;  4WFN L;  3A8Y A;  1EWR A;  4XH5 A;  4GNI A;  3D2F A;  2ETJ A;  3M8P A;  3PO5 A;  4CF1 A;  2WFB A;  4RW8 A;  4CF0 A;  4PKH A;  1S1X A;  5J2M A;  5F1X A;  4CJE A;  5H1S Q;  1IKW A;  4LSL A;  3I0S A;  5HRS A;  3MMV A;  3F73 A;  3UKU B;  1WSI A;  4DR2 K;  2ZWH A;  3SLC A;  3HZ6 A;  5AQS A;  4KPY A;  3SUQ A;  4GKK K;  2O8B B;  3SPY A;  2WTU A;  1NK6 A;  2EWS A;  2CGJ A;  4IZ9 A;  3R9P A;  4UQG A;  4CEQ A;  1TUY A;  4BR4 A;  3OBW A;  1O13 A;  1N32 K;  3THY A;  4CZF A;  3PX4 A;  4BRQ A;  3JS6 A;  1IG9 A;  5AQO A;  3QIN A;  4C8O A;  4FJI A;  1BA1 A;  2O8F B;  4ELV A;  4FJG A;  3ISN C;  3PO4 A;  4CFC A;  3NH0 A;  1BOT O;  2Q31 A;  4DFP A;  3K59 A;  3G0Z A;  3CME N;  3RMA A;  5KI6 A;  3QDK A;  4Z4G A;  4ELU A;  4W5N A;  3CCQ N;  5HRP A;  3E01 A;  1HKG A;  4BE0 A;  1JJ2 M;  3P38 A;  1MA9 B;  2VGM A;  3DLL L;  1OH5 A;  1ZBF A;  2QK9 A;  4JV5 K;  3ZSZ A;  3ITH A;  3CQ8 A;  3M8Q A;  1E4G T;  2Q2R A;  1EKE A;  3SCX A;  2YKN A;  4FM1 A;  2FSN A;  3QIC A;  3SUO A;  4AHS A;  3NF7 A;  4DR4 K;  3O9U A;  4JNE A;  3M8R A;  2E2P A;  3DM2 A;  4E0D A;  4YOR A;  3I33 A;  2D1K A;  2IDO A;  1T3V A;  1YAG A;  3L3V A;  1U4B A;  3L4I A;  1ZBL A;  1YTA A;  3DLK A;  1TUU A;  1SKS A;  1JCF A;  1U49 A;  3NGZ A;  4CD1 A;  3KIO A;  4DMN A;  1GOA A;  1RDC A;  5I42 A;  3KD5 E;  1N34 K;  3HPH A;  1YJ9 N;  5M1Q A;  4YHH K;  4I2P A;  1GLB G;  4DSK A;  1Y97 A;  1E3M A;  2OTJ N;  4CJ7 A;  3AVJ A;  4CK2 A;  4K0K K;  4KHW A;  1RDU A;  4LH4 A;  4Y1D A;  3EE8 A;  3BGR A;  4WFB L;  4DQQ A;  3LDO A;  2O4I A;  2IC3 A;  2A42 A;  5F0X A;  4XIU A;  3SMP A;  4U7B A;  3HOT A;  5K14 A;  2IOC A;  3AVB A;  4BRI A;  1CXQ A;  3H46 O;  4RTF D;  4CJ4 A;  4FWS A;  2HNY A;  4B1W B;  5BR9 A;  1J53 A;  3MEG A;  4H4O A;  3LZI A;  3TWH A;  1BQN A;  1EO1 A;  3KLG A;  1U6Z A;  4JRQ A;  1ZYQ A;  1REV A;  5FPM A;  1TVR A;  3OYB A;  4LSN A;  2J4R A;  2P9P A;  2Z1G A;  4CHZ A;  1NJW A;  1NWK A;  1GLJ O;  1RCH A;  3FZK A;  3VQ4 A;  1HR0 K;  1RTD A;  3THX B;  1NGF A;  2UXB K;  3LP1 A;  4JKF A;  3P1G A;  3QBW A;  1NG9 A;  1RNH A;  4BQZ A;  4JS5 A;  4M42 A;  3U9Z A;  3DWL A;  5EY4 A;  4BE1 A;  1KFS A;  5KGW A;  3LAL A;  1OH8 A;  1S1V A;  4CGF A;  4JKG B;  3KK3 A;  1NGA A;  1YVU A;  4BGB A;  1GLC G;  4O5B A;  1IBL K;  3A5L C;  5C2F A;  4PHT X;  1C0T A;  3F2K A;  5HRR A;  4O8K A;  5AQM A;  3TTD A;  3QLH A;  5LJV A;  4PY5 A;  3OA9 A;  3VGK A;  4DSE A;  3DXK B;  3A5N C;  5HOO A;  3VER A;  4JKH A;  1Q9Y A;  3SPZ A;  4DTX A;  4FZY A;  4CK3 A;  1KRP A;  1G15 A;  3BY5 A;  3AVC A;  3T7Z A;  1IG8 A;  1BUP A;  5SZT A;  4FW1 A;  1BQM A;  5BN8 A;  1W9H A;  3PSI A;  1NK4 A;  3E1Y A;  5CR4 A;  1IBM K;  1L3U A;  1C1C A;  4JI8 K;  1HQU A;  2QEX N;  4M3Y A;  3VF4 A;  5CHI A;  1QZ6 A;  1TYQ A;  1O1W A;  3LP3 A;  1YHQ N;  4DHY A;  2YNF A;  4FLV A;  4JHD B;  1YVN A;  3H08 A;  4H0T B;  3P5J A;  3FE1 A;  4KHU A;  2YNH A;  3M3Z A;  3V9S A;  3RMD A;  4KAZ A;  1NU0 A;  5C42 A;  2BDP A;  1LOT B;  3ENH A;  1TAU A;  1S1U A;  2PY5 A;  4CEE A;  3NH1 A;  4FJL A;  4OPK A;  1K8A O;  5FPE A;  3AO5 A;  3ZSX A;  4FJM A;  3O4W A;  2E1Z A;  1QQM A;  5BRF A;  1GLL O;  5AZJ B;  2HHH K;  1BA0 A;  5AQV A;  1BIU A;  5C15 A;  3WXK A;  1ILY A;  2OCE A;  3SAG A;  3DXM A;  5AQZ A;  4KV8 A;  3OS0 A;  1RT3 A;  3K5L A;  1RBR A;  1ZBU A;  1VSD A;  3J8A A;  3HRG A;  4CFA A;  2NRH A;  4E89 A;  1NK0 A;  4FYD A;  3SV4 A;  2VYP A;  4IEI A;  1WSE A;  1KFD A;  3U4L A;  1YF5 L;  3JYT A;  5JLH A;  2RE2 A;  4KHQ A;  4B3O A;  2HBK A;  3KLI A;  3KWG A;  2WON A;  4FSV A;  5TKW A;  3SZ2 A;  4CEC A;  4YNQ A;  1Q8I A;  2HHX A;  1D8Y A;  1FW6 A;  3PV8 A;  4CHY A;  4CEB A;  3HST B;  1S3X A;  4DV5 K;  3JXU A;  4FWP A;  3RRH A;  1VQ4 N;  3VQ5 A;  3IMX A;  3WXL A;  3GL1 A;  3HVT A;  1ATS A;  3WXI A;  5ADX H;  3P4I A;  4B1Y B;  1T05 A;  4CEF A;  1RT1 A;  1Z25 A;  3CQX A;  3U9D A;  4W5Q A;  4E3S A;  1NOZ A;  3T1A A;  3OBY A;  2A1S A;  5M1P A;  4B08 A;  1C0M A;  1QQC A;  4XH4 A;  4I6M B;  5KRS A;  2OAN A;  3OYF A;  4B9L A;  4KRF A;  5JIC A;  1XMO K;  4DKW A;  4M7Y A;  4JI3 K;  1ZC6 A;  4CCH A;  2I7N A;  2O4G A;  4JI5 K;  1RTJ A;  1HJR A;  1OKJ A;  4IO9 L;  1ESV A;  4Z0U A; 
#chains in the Genus database with same CATH homology
 5ADX A;  4GV9 A;  4FWO A;  2ZJP L;  2V51 B;  2D0O A;  1NGH A;  1X9J A;  3NVM A;  5BN9 A;  4CZI A;  1K73 O;  1M1K O;  3CC7 N;  3QBX A;  1XQS C;  1S72 N;  3BEX A;  2ASP A;  3E66 A;  3ATU A;  5E26 A;  1DT9 A;  1V4S A;  3VEO A;  3HI0 A;  3LM2 A;  4GY2 B;  4YOX A;  5AQX A;  3MN7 A;  5AQR A;  1BU6 O;  2ZGZ A;  4NLB A;  3UKR B;  1VQ8 N;  4DCH A;  3IKM A;  1XC3 A;  2P9N B;  2CH6 A;  1ZXO A;  2QWM A;  3DJC A;  3TPQ A;  4C1N I;  1NLV A;  1NGG A;  3KK7 A;  2FF3 B;  2E2N A;  1KD1 O;  3Q7C A;  4HTL A;  1NGE A;  3MCA B;  5M1K A;  2BTF A;  4M63 C;  5AQK A;  3BF1 A;  4FOI A;  3BP8 A;  3GBT A;  4IJA A;  3W0L A;  3HM8 A;  4H0Y B;  3M1F A;  1YI2 N;  3C6A A;  3CC4 N;  4A5A A;  4IDH A;  3GDQ A;  3HTV A;  1VQK N;  3KHY A;  4GV3 A;  3OW2 M;  3UKR A;  1ATR A;  1SAZ A;  1Z05 A;  3LDQ A;  4FWN A;  2P9N A;  4MO5 A;  3RSE A;  1U2V B;  4K42 A;  3CC2 N;  5AQY A;  4M7X A;  2BUP A;  5AZI B;  5EXW A;  4PL8 A;  4F9O A;  4B1X B;  3G4S N;  1E4F T;  1K8K B;  4YDU C;  4BQL A;  2E8A A;  3O1B A;  3VGM A;  1SQK A;  2P9K B;  3FR0 A;  5GIO A;  4BRM A;  3KZB A;  3GG4 A;  4K25 A;  3HOS A;  2F7T A;  3O9R A;  4H5W A;  5EX5 A;  1VAZ A;  2YJF A;  3TSP A;  4A2B A;  1Q86 O;  1C0G A;  3EZW A;  2FSJ A;  2NRZ A;  2YJE A;  3CJ1 A;  3CJB A;  3MN6 A;  2YI1 A;  1EQY A;  4GVE A;  4OPA A;  4BR7 A;  4EHT A;  5GAD P;  2E88 A;  3CD6 N;  4IJN A;  4B1U B;  1YIT N;  2GTD A;  3RSE B;  1U2V A;  1Q82 O;  4CZH A;  3KVG A;  5M1O A;  4QS8 A;  5AZI A;  1VQN N;  1MWM A;  1S22 A;  5LY3 A;  1HLU A;  4BR0 A;  1K8K A;  3H45 C;  4FWQ A;  2FXU A;  4YDU A;  3H6E A;  2P9K A;  2W40 A;  4H0V B;  1GLA G;  3O80 A;  2E2Q A;  3CMA N;  1G99 A;  5C2D A;  4CBW A;  3R6M A;  4BRN A;  1NM1 A;  2YHY A;  4YOY A;  3D7E O;  4BRK A;  3VOV A;  4EHU A;  5DM6 L;  1M90 O;  4GV6 A;  1GLE G;  1XUP O;  4WFN L;  1NGC A;  3UKU A;  4BC2 A;  3A8Y A;  4H5N A;  4BRD A;  3VEY A;  1C0F A;  2V7Z A;  3FZL A;  3TTF A;  4XH5 A;  4GNI A;  3D2F A;  4JKB A;  3E9P A;  2RHK A;  4IWV A;  1KC8 O;  2WFB A;  3TU5 A;  4ISF A;  4JK8 A;  2I7P A;  4BRF A;  4PKH A;  3HSC A;  3O9S A;  4BGA A;  5F1X A;  3SMS A;  3UE5 A;  5AQN A;  1D4X A;  2WUS A;  5H1S Q;  4BG8 A;  3C0B A;  2FF6 A;  4FVU A;  1NMD A;  3DAW A;  4JKE A;  3BUZ B;  2FSK A;  2GEM A;  3MMV A;  4ILJ A;  3UKU B;  3M5R A;  4MDA A;  2ZWH A;  3SLC A;  3HZ6 A;  2VGN A;  4H5T A;  3ZYY X;  5AQS A;  3D2F B;  4OO1 J;  3FZM A;  4PL7 A;  3E9O A;  4FWR A;  2EWS A;  2CGJ A;  1GLD G;  3CCV N;  2CGK A;  4IZ9 A;  3R9P A;  1IJJ A;  4FWK A;  1TUY A;  4BR4 A;  3OBW A;  3LM9 A;  1O13 A;  2GWJ A;  2NRR A;  4CZF A;  3H1V X;  4L3Q A;  3ZX3 A;  1KAX A;  4BRQ A;  3JS6 A;  1MDU B;  4H0P A;  3MX5 A;  4H5R A;  5AQO A;  4R79 A;  1CZA N;  1BA1 A;  2QTD A;  4KH5 A;  3WQT A;  4ISE A;  3L0Q A;  3CJA A;  3NMU A;  3H1Q A;  3RVC A;  1BOT O;  2Q31 A;  1LCU A;  5AFU H;  3MWT A;  3ID8 A;  3CCJ N;  3A5M C;  3CQY A;  1HPM A;  1ZBS A;  3G25 A;  3MN5 A;  3CME N;  2HBM A;  3ID6 A;  4OPH A;  3QDK A;  3AGK A;  4YOU A;  3VGL A;  3CPE A;  2E1Y A;  4EIA A;  3OHR A;  3O6W A;  3CCQ N;  2ASM A;  2ZJR L;  4JKA A;  5HL7 L;  5KPR A;  4FO0 A;  1BO5 O;  1HKG A;  1JJ2 M;  3CJC A;  3P38 A;  1MA9 B;  2VGM A;  3DLL L;  5KPZ A;  4IXC A;  3O5B A;  5AQP A;  2NRV A;  1BDG A;  3CCR N;  3D6R A;  1J6Z A;  2QWN A;  2Q0R A;  4YOV A;  1NJI O;  4YOW A;  1E4G T;  4WQ5 A;  2Q2R A;  3SJH A;  4ISG A;  3I8B A;  3M6G A;  5GIP A;  1YUW A;  4U67 L;  2FSN A;  3QIC A;  4JK9 A;  3MWP A;  4WF9 L;  1Y64 A;  2HBJ A;  2KLA A;  3AAP A;  2KHO A;  3ENO A;  4JKC A;  3O9Q A;  4PKI A;  5AQQ A;  1VQM N;  3WT0 A;  3O9U A;  4JNE A;  5E84 A;  2E2P A;  3ZET B;  2PFU A;  1JCE A;  5F2R A;  5GIN A;  1VQ6 N;  4YOR A;  1NGJ A;  3A0I X;  2E20 A;  3I33 A;  2IVO A;  2D1K A;  2NLX A;  4NO7 A;  4K41 A;  5GAG P;  1T3V A;  1HKB A;  1QVG M;  1YAG A;  4EAH D;  2V7Y A;  4WQ5 C;  3SAF A;  3L4I A;  2E2O A;  5GAH P;  3VTH A;  5AQL A;  1TUU A;  2QM1 A;  2W41 A;  3O9T A;  1JCF A;  4CD1 A;  2GWK A;  3CIP A;  4AF1 A;  2QWR A;  2UYT A;  3CCM N;  3EKU A;  1YJ9 N;  2YHX A;  1OVY A;  2HMP A;  5M1Q A;  4A59 A;  3ZET A;  1GLB G;  5JVG L;  3CET A;  3H3O B;  3GOI A;  4BRH A;  2OTJ N;  4CJ7 A;  5I9E B;  5AQF A;  4H0X B;  3T69 A;  1BG3 A;  3N4P A;  1JCG A;  3MDQ A;  1RDU A;  4CBX A;  4BRA A;  2Q36 A;  1BWF O;  3EE8 A;  3MK6 A;  4BC5 A;  2AP1 A;  4BR9 A;  4WFA L;  4HWI A;  2P9S B;  4WFB L;  3LDO A;  4C1N K;  2A42 A;  3VEX A;  5F0X A;  1YJN N;  1VQ7 N;  3AAQ A;  3AAR A;  5CE3 A;  2KKZ A;  3BF3 A;  3SMP A;  4RWT A;  1RDW X;  4H0O A;  4U7B A;  1N8R O;  3WXM B;  3HOT A;  4FWM A;  2JWK A;  4XEI A;  5EVZ A;  4BRI A;  2P9P B;  3P31 A;  3H46 O;  4RTF D;  4IOC L;  4B9Q A;  3QFP A;  2NRW A;  2V52 B;  4FWS A;  4JAX A;  4B1W B;  5BR9 A;  1DEJ A;  4BR2 A;  3G71 N;  2IVN A;  4CBU A;  4BRO A;  2P9S A;  4CZM A;  3VEZ A;  2P9U A;  1EO1 A;  3EE9 A;  3CCU N;  1U6Z A;  4JD2 A;  1MWK A;  4JKD A;  1RFQ A;  4DQ8 A;  3FZF A;  2QWL A;  1T44 A;  2QA4 N;  5FPM A;  4BC4 A;  5BPM A;  2YX6 A;  2J4R A;  2P9P A;  5AQW A;  4A61 A;  3FGU A;  1NWK A;  5AQU A;  1GLJ O;  3CER A;  1QQO A;  2IVP A;  3FZK A;  4JKG A;  3WXJ A;  2ZJQ L;  5KQD A;  2YCH A;  3I56 N;  1HJO A;  1NGF A;  2P9U B;  4JKF A;  2HBL A;  3QBW A;  4JD2 B;  3CPW M;  3ATV A;  4WQ4 A;  1GLF O;  1NGI A;  4BQZ A;  3U9Z A;  2ZGY A;  3DWL A;  5EY4 A;  3L4Q A;  3IDH A;  4EFH A;  4O5F A;  1SZ2 A;  3ZEU A;  4Z94 A;  5EOY A;  1V4T A;  1DGK N;  4MDB A;  4RCH A;  1RGI A;  4JKG B;  3DXK A;  5FPD A;  1HUX A;  3AY9 A;  1NGA A;  5AQJ A;  4BGB A;  1GLC G;  1X3N A;  2ITM A;  5C12 A;  5FPN A;  4JK7 A;  1K9M O;  4IO8 A;  1P90 A;  5M1N A;  3A5L C;  5C2F A;  3TSQ A;  4DB3 A;  3C65 A;  3O08 A;  4PHT X;  3VEW A;  2Q1N A;  1WUA A;  3EL2 A;  3F2K A;  5ELZ A;  3ZX0 A;  1HKC A;  3FFK B;  3C7N A;  2DPN A;  2VCP A;  4O8K A;  5AQM A;  3SBG A;  3TTD A;  1QQN A;  2QW9 A;  3ZEU B;  3OA9 A;  3WEE B;  5LJV A;  5LJW A;  3CXC M;  5JVH L;  2NZT A;  3VGK A;  3C6H A;  3TTC A;  2GEL A;  3B8A X;  5JMV A;  3DXK B;  3A5N C;  3FLC O;  3VER A;  5HOO A;  1W2B M;  4JKH A;  4JEP A;  3SAH A;  3EO3 A;  3PIP L;  3LDP A;  1TYQ B;  4J8F A;  4B1V A;  1Z6R A;  3T7Z A;  4ILH A;  3WQU A;  1SS6 A;  4JHD A;  1IG8 A;  3C7N B;  3VMF B;  1BUP A;  5BPN A;  5B8H A;  4FL9 A;  2H3G X;  2Q97 A;  3J7Z O;  4KBO A;  3WEE A;  2A3Z A;  5AR0 A;  2D0P A;  5BRD A;  2QI2 A;  1T6C A;  5BN8 A;  5GAE P;  5TKY A;  3E1Y A;  4NB4 A;  5CR4 A;  3PLA A;  2QWP A;  5BRH A;  3R1X A;  2P9I A;  3VF6 A;  2QEX N;  4FPB A;  3VF4 A;  2NRX A;  4FPA A;  5CHI A;  3D2E B;  4MLE A;  1QZ6 A;  1TYQ A;  3PIO L;  1YHQ N;  4DHY A;  3G6E N;  4JHD B;  1YVN A;  4A5B A;  1ESV A;  3IUC A;  1VQ5 N;  3CF5 L;  2ZF5 O;  1P8Z A;  4O8U A;  2ASO A;  4H0T B;  1QVF M;  4IEE A;  1QZ5 A;  2GUP A;  2F9T A;  2PBD A;  1ATN A;  3F5T A;  3FE1 A;  4AM7 A;  2HF3 A;  3M3Z A;  1KAY A;  4BG9 A;  3GE1 A;  2P9I B;  1KXP A;  3VET A;  2P9L A;  1LOT B;  3ENH A;  3DXM B;  3IFR A;  2FLO A;  3D2E A;  2NNW A;  2A5X A;  4K43 A;  2HST A;  3VEN A;  2BH1 A;  3VF2 A;  3I55 N;  1VQP N;  1YJW N;  5FPE A;  1K8A O;  5AQH A;  1T6D A;  3VEV A;  5C0Y A;  4E1J A;  1Q18 A;  3O4W A;  5KQ8 A;  5JLF A;  2E1Z A;  1QQM A;  5BRF A;  4H5V A;  3CCS N;  1GLL O;  5AZJ B;  3P39 A;  5DM7 L;  2F9W A;  2OTL N;  1BA0 A;  4IFE A;  5AQV A;  3W3D A;  3ZX2 A;  5C15 A;  1HX1 A;  3WXK A;  3QFU A;  4IOA L;  5BRE A;  4BC3 A;  1ILY A;  2P9L B;  3SAG A;  2GX9 A;  3DXM A;  5AQZ A;  4H03 B;  3AGR A;  3J8A A;  1NBW A;  4AM6 A;  4BY9 C;  4WYB A;  3HRG A;  3N4Q A;  1DKG D;  2AA4 A;  2QWO A;  3K9J A;  2NRH A;  4YOT A;  3HBT A;  3VTI A;  4BRL A;  4NLC A;  1YIJ N;  4UY8 O;  5AZJ A;  2VYP A;  1X3M A;  4IEI A;  1KQS M;  3U4L A;  1YF5 L;  3LDN A;  3SK3 A;  5JLH A;  2CH5 A;  2RE2 A;  3L6Q A;  2HBK A;  4MLH A;  4BRE A;  3KWG A;  3U8X A;  5AQI A;  4G9Z A;  2WC9 A;  4FSV A;  5TKW A;  3CJ7 A;  5AFU A;  3R3L A;  3S41 A;  1Q7Y O;  3FZH A;  4A57 A;  4IOX A;  3K9K A;  1VQO N;  4CZG A;  4BR5 A;  3TSU A;  3Q7B A;  1S3X A;  4QS9 A;  4BVP A;  3JXU A;  5KPT A;  3R8E A;  4FWP A;  4BRC A;  1Q81 O;  3F9M A;  4KH6 A;  3QML A;  1VQ4 N;  1WOQ A;  4CI6 A;  4Y0W A;  3VPZ A;  3IMX A;  3SBT A;  1YXQ A;  2IIR A;  3WXL A;  3ULE B;  3GL1 A;  5ADX H;  1ATS A;  3ENB A;  3LDL A;  3CHW A;  3P4I A;  3O1W A;  3WXI A;  4B1Y B;  5MLC Q;  3CQX A;  4KH4 A;  3U9D A;  1H1V A;  3CCE N;  3WUH A;  3LL3 A;  3O8M A;  3E9L A;  3NVK A;  4WQ4 C;  1R59 O;  3OBY A;  3CJ9 A;  1W97 L;  3CCL N;  5M1P A;  2WBN A;  4A62 A;  2NRT A;  2VWB A;  2A6A A;  4XH1 A;  5BPL A;  4XH4 A;  1KAZ A;  4ILG B;  4CZJ A;  1VQ9 N;  2A41 A;  4I6M B;  4B1Z A;  2YHW A;  5M1F A;  4CD3 A;  2OAN A;  4CZE A;  4FWL A;  2Q0U A;  4C23 A;  5C10 A;  5JIC A;  3MN9 A;  3ULE A;  2D4W A;  4PKG A;  4WCE L;  2PAV A;  3MX2 A;  4MO4 A;  2HOE A;  4FOE A;  1NGD A;  3A5O C;  4A2A A;  4M7Y A;  4DKW A;  2QXL A;  3H3N O;  4BVO A;  1ZC6 A;  3QB0 A;  4BRG A;  4LC9 B;  5AQG A;  4CZL A;  3CI5 A;  3EKS A;  1QHA A;  1VQL N;  2I7N A;  3MCP A;  3EN9 A;  4JN4 A;  3UB5 A;  2CGL A;  5AQT A;  2JWL A;  4QS7 A;  3VES A;  3KWI A;  4I6M A;  1OKJ A;  4IO9 L;  1NGB A;  2QWQ A;  4CZK A;  2HF4 A;  2A40 A;  4BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...