4BRMA

Sulfur sad phasing of the legionella pneumophila ntpdase1 - crystal form iii (closed) in complex with sulfate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
359
structure length
359
Chain Sequence
b'NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 115
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brmA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brmA02
1X9JA 3IMXA 3WXIA 1BO5O 3FZKA 1K8KB 3CJ9A 1NGFA 4CJ7A 5F0XA 3A5NC 2F9TA 4WYBA 2GELA 2KHOA 3H1VX 1OKJA 4CZGA 1YUWA 4PKIA 4C23A 4BRFA 4CZEA 3O80A 5LJVA 4I6MA 4BR9A 3LM2A 4FWKA 4A62A 3O1BA 1S22A 1ZC6A 2NZTA 4CBUA 3WXKA 3VF4A 3AAPA 4YDUA 4AM6A 1BOTO 2Q36A 1MA9B 5AQZA 4BG8A 1QZ5A 3GL1A 5EXWA 5F1XA 3ID8A 5JICA 1TYQB 2AP1A 3CJBA 3FR0A 3JXUA 3GG4A 4JNEA 4BR2A 1ATNA 2CGKA 1QHAA 2P9KA 5AFUH 4EFHA 3C7NA 4IJAA 4CBXA 2QWPA 3LDLA 3P4IA 1BDGA 5JLHA 1J6ZA 3CIPA 3QFUA 2QWQA 3WT0A 4FO0A 2GWJA 2P9KB 4BC3A 2IVPA 3C7NB 1BWFO 5FPMA 5AQXA 4BC2A 4ISFA 3CQYA 2QWMA 4H5WA 5AQVA 3A8YA 1DKGD 3B8AX 4B1YB 3VGMA 1IG8A 4FWQA 4BR4A 3ZX3A 3LL3A 3UKRB 3O6WA 3CJAA 2D1KA 4BQZA 4EAHD 1NWKA 3L4IA 2GWKA 5BR9A 3DXMA 3VGLA 2VYPA 4BREA 1SQKA 1YVNA 4BRPA 3ATVA 3WXLA 3A5OC 3DXMB 2V7YA 2A41A 2P9LB 2P9SB 3VOVA 4CZHA 3DAWA 1JCGA 2YHXA 3RSEB 5AQPA 1NGGA 3H46O 3IFRA 1NBWA 1QZ6A 2ASMA 5KPTA 2E1YA 2QWNA 2FXUA 1X3NA 4ISEA 5KPRA 3QMLA 4XH4A 2QWOA 1GLLO 5BN9A 1NGBA 3BF1A 3VERA 4CZLA 3D2FB 4FWPA 4H03B 3H1QA 3CHWA 2YJEA 1DGKN 2VWBA 4H5TA 4Z94A 3VF6A 4FWRA 2E2NA 4MLHA 4BRLA 2QWLA 3WEEA 2QWRA 1HJOA 2A6AA 4DCHA 5BPLA 4K43A 1WOQA 4BC5A 4CBWA 3VEWA 1MWMA 3ZX2A 4BR5A 1DEJA 1LCUA 4FOEA 4LC9B 2NRHA 3EZWA 5F2RA 3U8XA 3FZMA 3H45C 1SZ2A 4IO8A 3TPQA 3VETA 2CGLA 2YI1A 2ZF5O 4DB3A 4HWIA 4DQ8A 2BUPA 1C0GA 2P9NA 3C0BA 1R59O 1T44A 4PKGA 2CGJA 2E20A 2PAVA 4WQ4C 4JAXA 3GOIA 1TUUA 1GLDG 1GLCG 1K8KA 1NGCA 2P9NB 4FOIA 2UYTA 2ZGYA 3ULEA 4M7YA 2FSNA 5AQFA 4BRQA 2CH5A 3ENOA 1KXPA 3DJCA 3MN7A 1EQYA 4WQ5C 3TU5A 3ULEB 4A2BA 3J8AA 5AQRA 1BA1A 1C0FA 4XH1A 3KVGA 3D7EO 2ZGZA 3EO3A 3M1FA 3CJ7A 1V4SA 4H5RA 1HUXA 1QQMA 1ATRA 4RCHA 1HKBA 1TYQA 5FPEA 3ZETB 4O5FA 4XH5A 1JCEA 5AQUA 3FZLA 2ITMA 3VGKA 4B9QA 3QBWA 3MCPA 2D4WA 3KZBA 3WUHA 2A5XA 2HMPA 2IVNA 5B8HA 5AQWA 3HTVA 2GUPA 2Q0RA 2HF3A 2E2QA 2V52B 3ZX0A 4CZIA 1LOTB 5LJWA 4FPAA 1T6CA 5ADXA 3HZ6A 4FSVA 3KHYA 1HX1A 3UKRA 1BU6O 3H3NO 3H6EA 4CD3A 5BN8A 3JS6A 1Z6RA 4AM7A 5AQQA 4M7XA 1BUPA 4PKHA 3VEOA 3VPZA 1NGIA 3BP8A 1U6ZA 5JLFA 5AQLA 3BEXA 5E84A 4H0VB 4H0PA 4FWSA 2HF4A 2FF6A 2P9UA 4J8FA 2P9SA 2P9LA 5AR0A 3RSEA 5EX5A 5AZIA 4BR0A 4K41A 3VF2A 4A61A 1RFQA 4BGAA 2CH6A 2P9UB 3O08A 3D2EA 5AZIB 3S41A 4IWVA 4WQ4A 2BTFA 3D2FA 3M6GA 1TUYA 3I33A 3BUZB 3CI5A 1GLEG 3D2EB 4HTLA 3UKUB 3QB0A 3HBTA 3FZFA 3EKSA 4YDUC 5ELZA 3SMSA 4GY2B 3WXJA 4BRCA 2NLXA 4BGBA 2GTDA 3FLCO 1BA0A 2P9IB 2J4RA 2Q1NA 3MN9A 5AQHA 3SMPA 2OANA 3G25A 2V51B 3SJHA 3O1WA 4FWOA 1U2VB 5AQNA 2Q0UA 4BG9A 3I8BA 3SK3A 3U4LA 1HKCA 2QW9A 1RGIA 3VEYA 1Y64A 4FWLA 1NMDA 3QBXA 3FZHA 5AQYA 3FFKB 4BRGA 1HPMA 2W41A 3A5LC 1KAZA 1YAGA 2F9WA 4F9OA 1T6DA 1P8ZA 2I7NA 3LDQA 1X3MA 3IDHA 4NO7A 4NB4A 1ESVA 1QQNA 2H3GX 3R6MA 5FPDA 5I9EB 2FSJA 3M3ZA 5BREA 4EIAA 5JMVA 3FE1A 3DWLA 4H5NA 4QS8A 2YJFA 5KQDA 4FWMA 4BRIA 1NGAA 3H3OB 4IZ9A 4BRMA 3VEZA 3GDQA 5EOYA 1S3XA 3HM8A 3ZEUA 1MWKA 1GLAG 5AQSA 4H0TB 4EHUA 5ADXH 1MDUB 3ZETA 4BC4A 1KAYA 3MN5A 4B1WB 3ZEUB 5KPZA 2P9PB 3GBTA 2EWSA 4IJNA 4XEIA 2V7ZA 2Q31A 1NGEA 4BRKA 5EY4A 2DPNA 3AY9A 1GLBG 2ZWHA 5AZJA 5LY3A 4QS9A 1ZBSA 1NM1A 3ENHA 3VENA 1ZXOA 3MDQA 5AZJB 2AA4A 3F9MA 3O8MA 3GE1A 4I6MB 1G99A 2A42A 2HOEA 1ATSA 1KAXA 3MK6A 3FGUA 3O5BA 3W0LA 2E1ZA 3IUCA 5BRHA 4BVPA 2FF3B 2E8AA 3LDPA 4BQLA 3WQTA 2WUSA 3A5MC 4H0YB 1H1VA 1GLJO 4GNIA 4FWNA 4RTFD 3EKUA 4CI6A 3CJ1A 3AAQA 3LDOA 4O8KA 2A3ZA 3VEXA 5BPMA 1XQSC 4JD2A 2IIRA 4L3QA 3O4WA 3WQUA 3QDKA 2D0PA 1Z05A 4JN4A 4A2AA 4JD2B 4Y0WA 4DHYA 1XC3A 4B1ZA 5CE3A 3LM9A 1WUAA 3R8EA 4BVOA 3UKUA 5FPNA 3HSCA 3VESA 4CZJA 1E4FT 4IXCA 2YHWA 3CQXA 4PL8A 3ATUA 3W3DA 1HKGA 4H0OA 5AFUA 1GLFO 1D4XA 2P9IA 4CZMA 5AQTA 3SLCA 2ASPA 1RDWX 2W40A 2FLOA 4CZFA 3CETA 1U2VA 4MO4A 2VCPA 4BRDA 4ISGA 4WQ5A 4PL7A 1NGDA 1V4TA 2QXLA 3UE5A 3QFPA 5EVZA 5AQJA 2PBDA 2QM1A 2Q97A 1SAZA 2IVOA 3A0IX 4E1JA 2ASOA 3R9PA 3LDNA 4FPBA 5E26A 3MN6A 4B1UB 4BRAA 3EL2A 4H5VA 3VEVA 3EN9A 2I7PA 3AARA 2YHYA 3MMVA 1XUPO 3HI0A 4BRNA 1IJJA 3OHRA 1Q18A 1NGJA 1CZAN 5BPNA 4BRHA 3L0QA 2E2PA 1BG3A 2A40A 3CERA 4H0XB 5AQGA 4RWTA 4JHDA 3UB5A 2FSKA 4QS7A 5AQMA 3U9ZA 3WEEB 4CD1A 4JHDB 2D0OA 4M63C 4EHTA 4B1XB 1NGHA 3L6QA 1NLVA 2YCHA 5KQ8A 4KBOA 1HLUA 3DXKA 2E88A 1YXQA 4K25A 2E2OA 4MLEA 4BR7A 5BRFA 4K42A 4MO5A 2GEMA 4CZKA 2P9PA 1E4GT 4FL9A 5AQIA 3BF3A 1JCFA 4BROA 3DXKB 4B1VA 3U9DA 3CJCA 5TKYA 2Q2RA 3QICA 5AQKA 5BRDA 1QQOA 5AQOA
chains in the Genus database with same CATH superfamily
3IMXA 1T7PA 4ELVA 3E66A 1VQ6N 2F9TA 1IKXA 2KHOA 1TKDA 4CZGA 3OYKA 4PKIA 4C23A 4BRFA 3OVNA 4DV6K 3O80A 4BR9A 3LM2A 2VQEK 4FWKA 3ZYYX 4A62A 4DV1K 4IKFA 1B9FA 4CK3A 1A5XA 4CFCA 3C6AA 3O4NA 3IRXA 5DK5A 3JXUA 3V6DA 3GG4A 4YNQA 4BR2A 4DSLA 1ATNA 2P9KA 4EFHA 3C7NA 4JI6K 3V9UA 3LDLA 4CJRA 4FZXC 3NF8A 3QEXA 3CCLN 3NH0A 2QWQA 2GWJA 4BC3A 3MEDA 4WFBL 5FPMA 5AQXA 3PUFA 4BC2A 4ISFA 4JKFA 5M1KA 2OTLN 2QWMA 1N36K 4LF5K 3M5RA 3WNEA 4O8UA 4CJ3A 3O6WA 1JL2A 4FK2A 5H1SQ 4JV5K 3VGLA 4H8KA 1SQKA 1JLFA 3ATVA 3U3YA 4O44A 3A5OC 3OY9A 1WB9A 3UIQA 1RDAA 2P9SB 5M1QA 3CCSN 2IAJA 2RPIA 3RSEB 3D0PA 1NGGA 3H46O 4B3RK 1NBWA 2QWNA 3O3HA 4ISEA 1BHLA 3O9TA 1HYZA 4M3WA 3THXB 4FLVA 2IC3A 1YHQN 1GLLO 5BN9A 3VERA 3HL8A 3I0SA 1R0AA 4C1NI 5HRNA 3QESA 4LF4K 1DGKN 2RKIA 4H5TA 3NVKA 4MLHA 3V1QA 4DR7K 5FROA 4CBWA 4OPKA 3CM5A 2JLEA 3HVRA 3T1AA 3WNHA 4GV9A 2KFZA 3OA9A 1DEJA 2EX3A 5M1PA 4LC9B 3EE8A 1YI2N 3AVJA 3EZWA 1JLQA 3SV3A 4OPJA 1QE1A 2ZJRL 4QOZB 2CGLA 1W7AA 3P5JA 2BUPA 4CECA 2D0BA 3C0BA 2P9NA 5IT9O 1R59O 3EZ5A 5CY4A 4WQ4C 3NH1A 3THYB 3OYJA 4GW6A 4B3MK 3KK1A 1JLCA 2UYTA 2W6LA 3VQ9A 3THVA 2FSNA 5GINA 5AQFA 3NHGA 3DJCA 4KB0A 4LFBK 2WTUA 4A2BA 2HHQA 5AQRA 5C15A 4XH1A 3OTOK 1NJXA 3PSIA 3TAFA 1TKXA 3NF6A 5KI6A 1ATRA 4RCHA 5FPEA 4L8RB 2XY7A 4B9QA 1XMQK 2D4WA 3KZBA 4ID1A 2A5XA 2IVNA 4CHYA 1NK8A 4OKKA 3MXJA 3CG7A 4CGFA 2W42A 2Z1HA 4CE9A 3SPZA 4J2EA 2HW3A 5JS1A 3E9OA 3KHYA 3UKRA 3K58A 3K0SA 5J2NA 2G8FA 3TSPA 2X74A 3I8DA 1Z6RA 5HROA 1C1BA 2ZQBA 4LF8K 4JKCA 1SS6A 3VPZA 3PX4A 1OH6A 2HHWA 1XI1A 3NDKA 3K9KA 3BEXA 3AA2A 2HF4A 2FF6A 2P9UA 3K5LA 1HRHA 3AVHA 4BR0A 4J2AA 5SZTA 3LP2A 3VF2A 4A61A 1VQ5N 4A5BA 3QEPA 5EU7A 5LMNK 4LFCK 3LAMA 4RW4A 3S41A 1BI4A 4IWVA 3D2FA 4J2BA 3I33A 4HTLA 1W2BM 1B9DA 3UKUB 1VSKA 4GV6A 5ELZA 1I94K 4CERA 3ISNC 3ZSVA 4CF8A 4DSKA 2O8BB 1KCFA 3FLCO 4I2QA 4PHTX 3SMPA 3G25A 2V51B 1BQMA 3O1WA 4OPHA 1U2VB 5HRSA 5AQNA 3C65A 3CQ8A 3TR8A 3HPOA 4DU1A 3U4LA 1KD1O 3JYTA 3NGZA 1Y64A 3SQ4A 2RN2A 3F5TA 3FZHA 4AQYK 2W41A 3A5LC 3A2FA 1YAGA 4F9OA 4E7JA 1P8ZA 3CC2N 4DFKA 3AV9A 4NO7A 1I3AA 1QQNA 2H3GX 5E41A 1YIJN 3OYIA 5I9EB 1JXEA 3FE1A 1JLEA 1N8RO 5DM6L 5KQDA 4FVMA 5JVHL 4RW9A 2GUIA 1WSEA 2B6AA 1RTJA 1S1VA 1MWKA 3I55N 4EHUA 1MDUB 3ZETA 4WFAL 4B1WB 3P1GA 4N5SA 1VQ4N 2PY5A 2P9PB 4DTNA 3GBTA 4IJNA 4JI3K 4FCYA 2XY6A 3DI6A 4JK7A 4X62K 4CEAA 1F21A 2DPNA 4YOTA 3MXMA 4KHPK 5AZJA 5HBMA 3BZKA 4AHRA 2UXBK 1IV0A 1VQLN 3PV8A 2YNHA 4DTOA 4CEDA 3CCMN 3MDQA 2UUBK 3F9MA 4FLXA 4KAZA 1NK0A 1KVCA 3K57A 3IG1A 3WNFA 2FBYA 1O13A 2E1ZA 2FF3B 2E8AA 2WUSA 3CCUN 3A5MC 1GLJO 3NBPA 4V19S 4FW2A 3CFPA 4HUGA 3AAQA 3DLHA 3QO9A 1S1TA 4DLGA 3HPGA 1QSSA 1XQSC 4CJSA 4JD2A 3K5OA 2OZSA 3O4WA 2O8FA 1P90A 4OX9K 4U7BA 4ILGB 2YKMA 4CHQA 3QDKA 4B3TK 4Y0WA 1X9WA 1XC3A 3T3FA 5CE3A 3HYFA 1WUAA 3AO5A 1RT5A 4CFBA 3NF9A 1ZBHA 4IXCA 3M8RA 1S6PA 4FJLA 3ATUA 3LALA 1GLFO 1D4XA 4CFDA 4CZMA 1NU0A 3SLCA 1HNVA 4DKWA 4E19A 3CETA 2ITGA 4KV8A 1S9EA 4BRDA 3VQQA 1NGDA 3KK2A 3QINA 5C2DA 1ZBFA 1U4BA 1SUQA 4OPAA 4CJEA 2E5LK 4FPBA 3DLLL 4TSXA 4H5VA 3VEVA 4W5QA 1QSLA 1I39A 1QTMA 1IJJA 2HNYA 1S9GA 3OHRA 5HRRA 4AILC 2O8EA 1L3TA 4BRHA 3OYHA 3TARA 1BG3A 2A40A 4N47A 4JHDA 4JK8A 3KD1E 4CEZA 2WBNA 2KW4A 3LP1A 4DTXA 2D0OA 3AA5X 4EHTA 4IOAL 4C8LA 2YCHA 5KQ8A 3QERA 4W5RA 1HLUA 1YXQA 2E2OA 3SYZA 4MO5A 3NFAA 2GEMA 1E4GT 5AQIA 1G15A 4BROA 4B1VA 4DQRA 3TABA 3HOSA 2Q2RA 3QICA 1M90O 3JSMA 4DQPA 1K8KB 4JI2K 5HL7L 2VWJA 4B9MA 4RW7A 1WSFA 4DWIA 3A5NC 3ZSRA 1HNWK 4W5NA 2GELA 3H1VX 1L3UA 4KREA 1L3VA 1YUWA 4JI1K 4CHOA 3KLGA 4I6MA 2F96A 4C8NA 2GV9A 1RT3A 1Q9YA 1ZC6A 4KTWA 1YJWN 4IO9L 4YOXA 3VF4A 3AAPA 4YDUA 3ZSXA 4AM6A 4LH4A 2Q36A 3L2QA 3O3FA 1TYQB 1LWFA 2AP1A 1IBMK 4JI0K 4I9LA 3HT3A 2CGKA 3T1HK 1TKZA 4IJAA 2D0AA 4CIFA 3QIOA 5J2MA 2QWPA 1T05A 5JLHA 4G1QA 4YORA 3P39A 3DLBA 4CEEA 3SNNA 2IVPA 2OPRA 1LV5A 4M3XA 3CQYA 4M45A 3RMDA 2P1JA 1A5WA 5AQVA 1K6YA 4F8RA 1DKGD 1WSIA 4B1YB 4FLWA 3SJJA 4Z4FA 4DMNA 4BR4A 3ZX3A 3LL3A 2FBXA 4BQZA 4EAHD 2OTJN 1IBLK 4CW7B 2Z1GA 5BR9A 3BZCA 1YVNA 4X65K 4YFUA 4BRPA 1CZBA 3TAGA 5KTQA 1NJYA 4Y1DA 4AHCA 2BDPA 2YHXA 3O3GA 4W5OA 4KI4A 4OVLA 2VWKA 1J54A 1YTUA 3IFRA 1QZ6A 2ASMA 1LW2A 3QETA 3LZIA 3EE9A 5KPRA 1HMVA 3BF1A 2ZD1A 4FWPA 4FJHA 1HPZA 4M42A 4JYAK 1LW0A 2HBLA 4BRLA 1C1CA 3WEEA 1QVGM 4DCHA 2QKKA 4JEPA 4E89A 1DTTA 3CMAN 1Q7YO 4OO1J 4FK4A 1C0MA 3F73A 3LWLA 3L2WA 3ZX2A 4BDYA 1LCUA 2B4JA 4FOEA 3H45C 3THYA 1SZ2A 3TPQA 1RBSA 4B9LA 2ZF5O 4HWIA 4DQ8A 2JWLA 1C0GA 4PKGA 4BY9C 2HHSA 2E20A 4FJMA 2HBKA 3TTDA 1GLDG 1GLCG 1NGCA 3HOTA 2ZGYA 4J2DA 1YTAA 5LMUK 3SAFA 1KXPA 3MN7A 1BCOA 1U45A 4JI7K 3OS2A 4UY8O 1NJIO 3AVLA 3AVMA 3EY1A 3J8AA 1C0FA 3MEGA 3V9WA 1EWQA 3KVGA 3NF7A 4IG3A 3QLHA 1J5OA 4IFYA 1V4SA 4AHUA 1RT2A 2HHXA 1NK6A 4DUYK 5AQUA 2HSTA 1EXQA 2ITMA 3CCVN 3QBWA 4DQSA 1SKRA 4IBNA 5GIPA 3SQ2A 5C25A 4FVUA 5B8HA 5DMRA 5AQWA 5D3GA 2HVIA 4F3TA 3PIOL 1LWCA 1GOCA 1HYVA 2E2QA 4CVNE 3C95A 4FJJA 5LJWA 2NRWA 1T6CA 4PUOA 4UQGA 1CZ9A 3AVBA 1DTQA 3J7AP 4OGCA 3Q7CA 4OKJA 1XC9A 3H6EA 4CD3A 1WSHA 1EP4A 3JS6A 2F4VK 4IDKA 5AQQA 4M7XA 1BUPA 4PKHA 3DOLA 1TV6A 3E1YA 1TKTA 4WE1A 5JLFA 5FLXO 3F2KA 5E84A 5AQLA 4B08A 4CJFA 2P9LA 5AR0A 4IDHA 3S3OA 5EX5A 4GKJK 1TK8A 4W5TA 2OA8A 3O9SA 2YX6A 1IKYA 4JS5A 3V4IA 3VQ4A 3O08A 5AZIB 1HNIA 4ILHA 4EP5A 1IO2A 3PIPL 4F3OA 3L3VA 3MXIA 4C8OA 4F2SA 2O8BA 2BGGA 3QB0A 4YDUC 3OYLA 3SMSA 4CJLA 3R3LA 4BGBA 3AGRA 5KGWA 1BA0A 4QAGA 2P9IB 4JKGB 2J4RA 1T03A 3L2UA 2Q1NA 3OJSA 3ZT3A 1X9SA 2DTUA 4KHNA 3ZLJA 4BG9A 3I8BA 1W97L 1L3SA 2QW9A 2Y1IA 1RGIA 3VEYA 4AHVA 3VTHA 3CC4N 3QBXA 2QTDA 3FFKB 4BRGA 3NGYA 1Q8IA 1X3MA 2FBVA 4NB4A 3R6MA 1K8AO 2XO7A 4B9NA 4E1MA 5FPDA 3M3ZA 4KH5A 5BREA 2XHBA 1BCMA 1YF5L 3TSQA 4FWMA 4BRIA 4FW1A 2YV0X 1Q86O 4DFPA 3TAEA 5EOYA 1S3XA 3TANA 3HM8A 4DG1A 2BANA 4CJVA 3OYNA 2G8HA 4H0TB 5ADXH 4HUFA 4M41A 4KHUA 2UXCK 2R7YA 2ZJPL 3ZEUB 5FRNA 2XY5A 1SKSA 2G8VA 2GBZA 4WF9L 2EWSA 4CJKA 1WAFA 2Q31A 3KKRA 1ZBUA 1S1WA 3ENBA 5JS2A 1D9FA 1VQ7N 1GLBG 1ZBSA 1JXBA 2KLAA 4QCLA 2HNZA 3DMJA 1ZXOA 2WOMA 3CFOA 1KRPA 4PQUA 2O8CB 3SQ0A 3CPWM 1N5YA 2HOEA 1LWEA 1KAXA 3HSTB 4DR1K 3IUCA 5BRHA 4NXNK 3L4QA 4I7FA 4LFAK 3O4QA 3WQTA 4RTFD 5K14A 1FJGK 3CJ1A 5J2QA 4B9SA 1QQCA 1NKBA 4CHPA 3ASMA 4DS5A 4O0IA 1NJZA 4DHYA 4B1ZA 5C2FA 3LM9A 4BVOA 4FLTA 3RRGA 5FPNA 4OLAA 3AVCA 1RBRA 4O55A 3OYAA 5TKWA 4CJPA 2YHWA 4AHTA 4H0OA 4A5AA 4FM2A 4Y1CA 3PY8A 3NE6A 4KHQA 4O4GA 1EKEA 2HVHA 1RDWX 2FLOA 2XY8A 3KJVA 2WC9A 1WNSA 4FXDA 1JLGA 3AVGA 4MO4A 3PX6A 4LF6K 1X9MA 2X78A 4KH6A 1CXQA 1ASVA 1S6QA 3QFPA 4IG0A 2Q97A 4K8ZA 3A0IX 4MDBA 5C10A 3R9PA 3SCXA 5E26A 1XWLA 1GOBA 1ASUA 3KLFA 2I7PA 3AARA 4BRNA 3SQ1A 1VSLA 3DRRA 3V9ZA 3DRPA 5BR8K 1BIZA 2DFEA 2E6MA 1L5UA 5AQGA 2NRXA 3M8SA 1HJRA 2FC0A 4JS4A 2FSKA 3DOKA 3MX2A 2UUAK 4CGJA 3U9ZA 1VQNN 4KTQA 1VSIA 1IH7A 2P51A 4KO0A 1FKPA 1NGHA 3L6QA 3HXMA 4E7IA 3VQEA 5GIOA 3KWIA 1VRUA 4R5PA 2E88A 4Z4IA 2OCEA 4MLEA 4ELTA 1VQMN 1YJ9N 4CZKA 2RF2A 2QK9A 3DXKB 4LF7K 4FJIA 3U9DA 5AQKA 5BRDA 4H4OA 1X9JA 4F4KA 1BO5O 3CJ9A 1RDDA 4DV0K 4DFMA 4CJ7A 3KKSA 1S1XA 3LANA 3QNOA 1OKJA 3G0ZA 5KRSA 3NVMA 3N4PA 3OJUA 4CGIA 5LJVA 5J1EA 4HCCA 4B9UA 3D45A 3O1BA 1S22A 2NNWA 1NK5A 1RT1A 2YNIA 4BE0A 4CBUA 1QVFM 3L2RA 3LWMA 4JLHA 4YHHK 5AQZA 1QZ5A 3GL1A 5EXWA 5GAGP 5F1XA 3O9RA 4DSEA 3CJBA 3FR0A 1RBTA 2X6SA 5AFUH 4CBXA 2YHBA 4CK2A 3DM2A 4B3SK 4KHSA 1BDGA 1SV5A 4LY7A 4HHTA 3QFUA 3B6OA 4HUEA 2UUCK 3WT0A 1K9MO 3SBGA 3HM9A 1BWFO 1TAUA 4AF1A 1XHZA 4H5WA 4DSFA 2ZE2A 3A8YA 4FK0A 3VGMA 4FWQA 5DM7L 5T7BA 3V9XA 4GVMA 3UKRB 1EX4A 3L4IA 2GWKA 2QKBA 2OPSA 4BREA 2VG5A 4XIUA 4MFBA 1RT6A 1S72N 3DXMB 2V7YA 1YJNN 1VQON 4CZHA 2IS3A 5AQPA 4MQ3A 4FYDA 4ZHRA 5KPTA 2E1YA 3NGIA 3KK7A 3V1RA 2FXUA 4Z4EA 3J7ZO 3E01A 1Q82O 2KTQA 1X3NA 3QMLA 3AVAA 4XH4A 4LH5A 4FJ8A 2QWOA 3CFRA 2ZM6K 3D2FB 1KFSA 4H03B 3H1QA 3CHWA 3AA4A 2VWBA 4ID5A 4N56A 3VF6A 2E2NA 5BPLA 2QWLA 1U49A 4K43A 1WOQA 3VEWA 1MWMA 3SI6A 3OYGA 2JWKA 1REVA 3AO2A 1WSJA 2NRHA 2YKNA 4KRFA 3MEEA 3JAMO 4DF4A 3IS9A 4FZZA 2YI1A 4DB3A 1NK9A 3TAQA 1DT9A 1T44A 1ZYQA 3K2PA 2PAVA 3GOIA 4DTRA 3KLIA 4YOWA 3L8BA 3VA3A 1OH7A 1BQNA 4FOIA 4B9VA 1U48A 5CR4A 3ENOA 3VQAA 1JLBA 2KQ2A 4E7HA 3ULEB 4HCBA 1BA1A 3E9PA 1GOAA 3KD5E 4CEOA 4FLYA 3D7EO 2ZGZA 1NG9A 1JJ2M 3CD6N 3K59A 4KPYA 3M1FA 5CYMA 1N32K 4H5RA 4KHWA 1QQMA 1J9AA 3ZETB 4O5FA 4XH5A 4FJNA 1BISA 3VGKA 4YY3K 3MCPA 3K5MA 3LDSA 4DQQA 3WUHA 2JGUA 3TSUA 4JI8K 2XRIA 2YHAA 2V52B 1BGXT 4CZIA 1T3VA 5ADXA 3G71N 4FSVA 1VQ8N 1D5AA 2UU9K 3SAHA 3H3NO 5BN8A 4JK9A 1E3MA 3VQPA 4BDPA 4AM7A 4DSIA 3SPYA 1Z26A 4KB1A 4FM0A 1IKWA 1U6ZA 3VA0A 4DFJA 1HQEA 4H0PA 4Z4CA 4J8FA 1N6QA 2P9SA 4DTJA 3RSEA 5AZIA 3VMFB 3MWPA 4K41A 4FJXA 4N76A 1RFQA 4BGAA 2CH6A 1KSPA 2KZMA 3HRGA 1NMNA 1WSGA 1VAZA 3THXA 5C0YA 1UWBA 3HO1A 4LD0A 3K5NA 4WQ4A 4LSNA 1VSHA 1TUYA 1RILA 3M6GA 5GAEP 3BUZB 3CI5A 1GLEG 3D2EB 3HBTA 3FZFA 3WXJA 4GY2B 4FZYA 3I0RA 3O9QA 4BRCA 3OBYA 3LZJA 3QNNA 2GTDA 5SWMA 1D9DA 4HVJA 1XNQK 3MN9A 2OANA 4FWOA 1YITN 4DTPA 3J80O 3DYAA 1C0TA 1HKCA 1BL3A 2DY4A 4FWLA 1X1PA 1JL1A 3M8QA 1KC8O 5AQYA 4O0JA 2VGNA 2IDOA 1HPMA 4DLEA 4FM1A 2F9WA 3DLRA 3G10A 4ELUA 2QXFA 4B8CA 1RBUA 3CF5L 1XNRK 2GX9A 3DWLA 4QS8A 5I42A 3G6EN 2PFUA 4IZ9A 4BRMA 3CCJN 2HHHK 3VEZA 1ITGA 1KLMA 4E7KA 2Y1JA 4CIGA 4A59A 4LSLA 3ZEUA 3ZSWA 3H08A 1O1WA 2B5JA 5AQSA 1SL1A 4BC4A 1KAYA 3MN5A 1XMOK 3V1OA 3T1YK 4NYFA 2V7ZA 4X64K 1Q81O 4B3OA 3BY5A 4KHYA 2WONA 1NGEA 3C94A 4KH4A 2ATQA 3P31A 2ZWHA 4RW8A 4CJ4A 4M3ZA 4QS9A 3VN5A 1NM1A 3ENHA 1NOYA 2O8CA 1TL1A 1QS4A 4KFBA 3MAQA 2QEXN 3RMAA 1C6VA 1VRTA 3LP3A 4YOYA 4EZ6A 2AA4A 4I6MB 4IEEA 3I56N 2A42A 3RVCA 1RDCA 3MK6A 1WAJA 3FGUA 1VSEA 3W0LA 2OYQA 2F8SA 2HHTA 2BH1A 3AO4A 3EKUA 2I5JA 4CI6A 4FJ5A 3DLKA 3LDOA 2A3ZA 4M3UA 5BPMA 3AO3A 2DFHA 3O9UA 3J81O 4CESA 1U04A 2IIRA 1TK0A 4G9ZA 3SZ2A 3EEQA 4O5BA 4NLCA 2VG7A 3SUNA 2O8DB 2HHVA 2D0PA 4A2AA 5HLFA 4DTMA 3U3GA 1QSYA 1UAXA 1RCHA 2X6NA 1LAVA 3UKUA 3MCAB 4CZJA 4H4MA 1E4FT 1RDUA 2NRRA 3CQXA 4PL8A 3W3DA 4CJQA 1HKGA 5AFUA 1FW6A 2NUBA 2HHUA 2W40A 4CZFA 3OS0A 2HMIA 1JLAA 1U2VA 1VSMA 3HJFA 3THWB 4WQ5A 1S1UA 4PL7A 2A1SA 1V4TA 3ZT1A 1NK4A 5EVZA 5AQJA 3DRSA 3SV4A 2QM1A 4DR6K 2EHGA 1SAZA 1FKOA 1N34K 1TL3A 4E1JA 1OVQA 2KKZA 4NYNA 3MN6A 4BRAA 3EL2A 3EN9A 2YHYA 3MMVA 4K8XA 3G4SN 3HI0A 1NOZA 5KRTA 1NGJA 3L0QA 4BE1A 4N41A 3C6UA 4RWTA 4DV3K 4BE2A 4JKAA 3DLGA 4QS7A 5AQMA 5HP1A 4JKHA 3WEEB 4CD1A 3AA3A 3AVIA 4FJGA 1NLVA 1CXUA 4NCAA 3ZSQA 3DXKA 2E6LA 1IBKK 2OPPA 4WCEL 4CIEA 1C1AA 1SL0A 4K42A 5GAHP 2P9PA 4FL9A 3SUPA 4DR2K 4BWJA 4B8AB 5C24A 1QQOA 5AQOA 2E4LA 1IG9A 3TWHA 3WXIA 1SL2A 4CF2A 3FZKA 1NGFA 4JKEA 3S9HA 5F0XA 4WYBA 4CJTA 2PZSA 3QIPA 2O4IA 4DQIA 3ID6A 4JKDA 4NXMK 4CZEA 1W9HA 4DF8A 3OYCA 3DLEA 2YNFA 3AO1A 5M1NA 5FDLA 1J53A 2Z1JA 3HK2A 4Z0UA 2NZTA 4FJ9A 3WXKA 4CHNA 1BOTO 1MA9B 4BG8A 1FK9A 2KFNA 5JICA 3ID8A 4C1NK 1RTDA 3OYFA 4JNEA 4I9QA 3PSFA 1QHAA 1A5VA 2NRVA 3TAPA 3P4IA 4DU3A 1K73O 5CHIA 2F8TA 4DTSA 4GKKK 1J6ZA 3CIPA 2G8KA 4FO0A 2P9KB 3C7NB 4DTUA 3SUQA 3KIOA 4RG8A 3B8AX 1NKEA 1IG8A 1RBVA 2RHKA 4EZ9A 1OVYA 4M3RA 3CCEN 2W6KA 3MX5A 1M1KO 3CJAA 2UXDK 2D1KA 1NWKA 3F9KA 3CM6A 1S5JA 3DXMA 3TI0A 4Q0BA 2VYPA 4CJ5A 3S3MA 4OJRA 1RTIA 3WXLA 1NK7A 3S3NA 5CZ1A 1VQ9N 3VTIA 2A41A 2P9LB 3VOVA 2D5RA 3DAWA 1JCGA 4M3TA 1ZBIA 3CC7N 1RTHA 1CLQA 1QHTA 3AVNA 3ZSYA 3N4QA 1VQKN 2HB5A 3NAEA 1NGBA 2QI2A 4CZLA 1Z25A 1VQPN 4NLBA 4FLZA 2Q3SA 3NMUA 2YJEA 3AVKA 4Z94A 2OZMA 4FWRA 2QWRA 1HJOA 1C0UA 2A6AA 2VG6A 4BC5A 4CGGA 3L2VA 3NH2A 4E3SA 3SAGA 3FFIA 4CCHA 4BR5A 5GADP 3ZCMA 5F2RA 3CYMA 3FZMA 3U8XA 4IO8A 5AJ3K 2P5OA 1VHXA 3VETA 1SKWA 3QEWA 4LF9K 1WBDA 2AJQA 2CGJA 2O4GA 1VSFA 4JAXA 2YNGA 4BACA 2WFBA 1TUUA 3TTCA 2IGIA 1K8KA 2BE2A 4K0KK 2P9NB 1WBBA 4DSJA 3M8PA 3PX0A 3ULEA 4M7YA 1TGOA 4BRQA 1BIUA 2CH5A 3C6TA 1EQYA 2VGMA 4WQ5C 3OS1A 3TU5A 5IWAK 3SBTA 4M3YA 1JKHA 2VQFK 1HNXK 4CGDA 3EO3A 1TK5A 3J7YP 4DR4K 5A2QO 4CF1A 3CJ7A 4KTZA 3CCRN 3RWUA 1HUXA 2FBTA 1HKBA 1TYQA 2IOCA 2P5GA 1JCEA 4Z4HA 1XHXA 3FZLA 3ZT4A 4YOUA 3SUOA 4AHSA 2HMPA 3OYDA 2D0CA 3V81A 3HTVA 2GUPA 2Q0RA 3LAKA 2HF3A 4IOCL 3WNGA 3ZX0A 1LOTB 3LP0A 5M1OA 4HTUA 1B92A 1EWRA 4KI6A 4FPAA 3L3UA 4DUZK 2HNDA 3HZ6A 1HX1A 1T8EA 1FXXA 4BWMA 1BU6O 1HR0K 3KLEA 4CFAA 3VEOA 3K9JA 4EP4A 1NGIA 3BP8A 3E9LA 3T7ZA 1ILYA 3KK3A 4ILJA 4H0VB 3VQDA 4FWSA 3NCIA 3VQBA 3B6PA 5MLCQ 2ETJA 5J2PA 2HBJA 4C8KA 4JRQA 1RNHA 5CZ2A 3P83D 2NRTA 5M1FA 2P9UB 3OYMA 2PYLA 4JKBA 5CYQA 1OH8A 4GV3A 3D2EA 3PO5A 3C6HA 3ZT0A 4OLBA 2BTFA 1HYSA 4OKEA 2OPQA 1TVRA 3KLHA 1KTQA 1NNEA 4PWDA 4RW6A 4CEBA 4Z4GA 3EKSA 3RR7A 1BI4B 2NLXA 3VQ8A 3ZSZA 3VQCA 3ZSOA 3RMCA 2F7TA 3VQ6A 3TTFA 3CCQN 4Q5VA 5AQHA 1VSDA 3SJHA 3EYZA 3ZT2A 1LAWA 4E0DA 2Q0UA 1UA0A 4IFVA 3SK3A 1MU2A 1WN7A 1ASWA 4PA1A 1UOCA 3T69A 4U67L 1NMDA 3RMBA 4DV5K 4ZTFA 3V9SA 1KAZA 3MWTA 4AH9A 1T6DA 1HQUA 2I7NA 3LDQA 4CF9A 2KZZA 3IDHA 4NCBA 1ESVA 1NJWA 3D6RA 2FSJA 4EIAA 5JMVA 2LSNA 1TAQA 4H5NA 2YJFA 3HP9A 4E7LA 1HNZK 3Q7BA 1NGAA 3H3OB 4FLUA 3GDQA 1KFDA 1D8YA 4DV4K 1VK0A 3CMEN 1UA1A 1ZBLA 1GLAG 2G8UA 1Y97A 2Z1IA 3LPUA 1VSJA 5KPZA 3PO4A 1EETA 4XEIA 5C42A 3RRHA 4BRKA 3BDPA 5EY4A 3OW2M 3AY9A 4DS4A 5LY3A 4JI5K 4CEFA 3VENA 4ZTJA 4FJKA 3OYBA 3HVTA 5AZJB 4NCGA 4ICLA 3O8MA 3GE1A 3HPHA 3VQ7A 4CHZA 2G8WA 1WLJA 3HP6A 1G99A 3KWGA 1ATSA 3ITHA 4CF0A 1RT4A 3O5BA 4F2RA 4BVPA 1OH5A 4CJWA 3LDPA 4BQLA 1IKVA 5FRMA 4H0YB 1H1VA 4GNIA 4FWNA 4WFNL 2QA4N 1U47A 3KTQA 4I2PA 4O8KA 3IAYA 3P38A 3VEXA 2O8DA 4JRPA 4MDAA 3ULDA 4L3QA 4YOVA 1DLOA 3RTVA 3WQUA 1Z05A 4JN4A 3BGRA 3WXMB 4JD2B 1KLNA 3RR8A 2O8FB 5JVGL 4JI4K 4PY5A 3CXCM 3R8EA 4DV7K 1EO1A 3HSCA 3VESA 5HRPA 2A1RA 3TAMA 4IFEA 5C12A 4DU4A 5I3UA 5HOOA 2P9IA 3OBWA 4JKGA 5AQTA 3THWA 2ASPA 1RDBA 1YT3A 3OYEA 1J5EK 4B9TA 2VCPA 4ISGA 2ZJQL 1KVAA 3CPEA 3UE5A 2QXLA 4R79A 4E1NA 2PBDA 3VQ5A 2IVOA 2ASOA 4BDZA 3LDNA 1N33K 3MECA 4CGHA 4B1UB 3AGKA 3PLAA 1XUPO 1Q18A 2RE2A 3IKMA 1CZAN 5BPNA 4GVEA 4KKOA 2NRZA 2E2PA 4DV2K 3CERA 3ALYA 4H0XB 3QEVA 3U6FA 2DFFA 4GMJB 2O8EB 3UB5A 5KGXA 4OGEA 2PYJA 3QEIA 1KVBA 3LPTA 4A57A 4CJUA 1NKCA 4IEIA 4C8MA 1W0HA 1Q9XA 4JHDB 2G8IA 4M63C 4B1XB 1KQSM 5LL6Z 2HBMA 1RT7A 4KBOA 1YVUA 3R1XA 4K25A 4IOXA 4BR7A 3T19A 5BRFA 4CK1A 4DR5K 3BF3A 1JCFA 3CJCA 4X66K 5TKYA 4CEQA 4FJ7A 4DR3K 3AVFA
chains in the Genus database with same CATH topology
1X9JA 3IMXA 3WXIA 1BO5O 3E66A 3FZKA 1K8KB 3CJ9A 1VQ6N 5HL7L 1NGFA 4JKEA 4CJ7A 5F0XA 3A5NC 2F9TA 4WYBA 2GELA 2KHOA 3ID6A 3H1VX 1OKJA 4JKDA 4CZGA 3NVMA 1YUWA 3N4PA 4PKIA 4C23A 4BRFA 4CZEA 3O80A 5LJVA 4I6MA 4BR9A 3LM2A 4FWKA 3ZYYX 4A62A 5M1NA 3O1BA 1S22A 2NNWA 1ZC6A 1YJWN 2NZTA 4CBUA 4IO9L 1QVFM 3WXKA 4YOXA 3VF4A 3AAPA 4YDUA 4AM6A 1BOTO 2Q36A 1MA9B 3C6AA 5AQZA 4BG8A 1QZ5A 3GL1A 5EXWA 5GAGP 3ID8A 3O9RA 5F1XA 5JICA 4C1NK 1TYQB 2AP1A 3CJBA 3FR0A 3JXUA 3GG4A 4JNEA 4BR2A 1ATNA 2CGKA 1QHAA 2P9KA 5AFUH 4EFHA 3C7NA 4IJAA 4CBXA 2NRVA 2QWPA 3LDLA 3P4IA 1BDGA 5CHIA 1K73O 5JLHA 4YORA 1J6ZA 3CIPA 3P39A 3QFUA 3CCLN 2QWQA 3WT0A 4FO0A 2GWJA 2P9KB 4BC3A 2IVPA 3SBGA 3C7NB 1BWFO 4WFBL 4AF1A 5FPMA 5AQXA 1K9MO 4BC2A 4ISFA 4JKFA 3CQYA 5M1KA 2QWMA 1QVGM 2OTLN 4H5WA 5AQVA 3A8YA 1DKGD 3B8AX 4B1YB 3M5RA 3VGMA 1IG8A 4FWQA 5DM7L 2RHKA 4O8UA 4BR4A 3ZX3A 3LL3A 1OVYA 3UKRB 1N8RO 3MX5A 3CCEN 3O6WA 3CJAA 1M1KO 2D1KA 4BQZA 4EAHD 1NWKA 3L4IA 2OTJN 5H1SQ 2GWKA 5BR9A 3DXMA 3VGLA 2VYPA 4BREA 1SQKA 1YVNA 4BRPA 3ATVA 3WXLA 3A5OC 1S72N 3DXMB 1VQ9N 2V7YA 3VTIA 1YJNN 2A41A 2P9LB 2P9SB 5M1QA 3VOVA 4CZHA 3CCSN 1VQON 3DAWA 1JCGA 2YHXA 3RSEB 5AQPA 1NGGA 3CC7N 3H46O 3IFRA 1NBWA 1QZ6A 2ASMA 5KPTA 2E1YA 3KK7A 2QWNA 2FXUA 3N4QA 3EE9A 3J7ZO 1Q82O 1VQKN 1X3NA 4ISEA 5KPRA 3O9TA 3QMLA 4XH4A 2QWOA 1GLLO 1YHQN 5BN9A 1NGBA 2QI2A 3BF1A 3VERA 4CZLA 3D2FB 1VQPN 4FWPA 4NLBA 4C1NI 4H03B 3H1QA 3NMUA 3CHWA 2YJEA 1DGKN 2VWBA 2HBLA 4H5TA 4Z94A 3VF6A 4FWRA 3NVKA 2E2NA 4MLHA 4BRLA 2QWLA 3WEEA 2QWRA 1HJOA 2A6AA 4DCHA 5BPLA 4K43A 1WOQA 4BC5A 4CBWA 4JEPA 3VEWA 3CMAN 1MWMA 1Q7YO 4OO1J 3SAGA 4GV9A 3ZX2A 2JWKA 4BR5A 5GADP 1DEJA 1LCUA 3OA9A 4FOEA 2NRHA 3EE8A 4LC9B 5M1PA 1YI2N 3EZWA 5F2RA 3U8XA 3FZMA 3H45C 1SZ2A 4IO8A 3TPQA 3VETA 2ZJRL 2CGLA 2YI1A 2ZF5O 4DB3A 4HWIA 4DQ8A 2BUPA 2JWLA 1C0GA 2P9NA 3C0BA 1R59O 1DT9A 1T44A 4PKGA 4BY9C 2CGJA 2E20A 2PAVA 4WQ4C 4JAXA 3GOIA 2HBKA 3TTDA 2WFBA 1TUUA 3TTCA 4YOWA 1GLDG 1GLCG 1K8KA 1NGCA 2P9NB 3HOTA 4FOIA 2UYTA 2ZGYA 3ULEA 4M7YA 2FSNA 5GINA 5AQFA 4BRQA 2CH5A 5CR4A 3ENOA 3SAFA 1KXPA 3DJCA 3MN7A 4UY8O 1EQYA 2VGMA 4WQ5C 1NJIO 3TU5A 3ULEB 4A2BA 3J8AA 5AQRA 1BA1A 3E9PA 1C0FA 3SBTA 5C15A 4XH1A 3KVGA 3D7EO 2ZGZA 3EO3A 1JJ2M 3CD6N 3M1FA 3CJ7A 3CCRN 1V4SA 4H5RA 1HUXA 1QQMA 1ATRA 4RCHA 1HKBA 1TYQA 5FPEA 3ZETB 4O5FA 4XH5A 1JCEA 5AQUA 2HSTA 3FZLA 2ITMA 3VGKA 4B9QA 3CCVN 3QBWA 3MCPA 2D4WA 3KZBA 3WUHA 4YOUA 5GIPA 2A5XA 4FVUA 2HMPA 2IVNA 3TSUA 5B8HA 5AQWA 3HTVA 2GUPA 2Q0RA 3PIOL 2HF3A 2E2QA 2V52B 4IOCL 3ZX0A 4CZIA 1LOTB 5M1OA 1T3VA 5LJWA 2NRWA 4FPAA 1T6CA 5ADXA 3HZ6A 3G71N 4FSVA 3E9OA 3KHYA 1HX1A 1VQ8N 3UKRA 3Q7CA 3SAHA 1BU6O 3H3NO 3H6EA 4JK9A 4CD3A 5BN8A 3TSPA 3JS6A 1Z6RA 4AM7A 5AQQA 4M7XA 1BUPA 4JKCA 4PKHA 1SS6A 3VEOA 3K9JA 3VPZA 3E1YA 1NGIA 3BP8A 1U6ZA 3E9LA 3T7ZA 5JLFA 1ILYA 3F2KA 3BEXA 3K9KA 4ILJA 4H0VB 5E84A 5AQLA 4H0PA 4FWSA 2HF4A 2FF6A 2P9UA 4J8FA 2P9SA 2P9LA 5MLCQ 5AR0A 4IDHA 3RSEA 5EX5A 2HBJA 5AZIA 4BR0A 3VMFB 3MWPA 4K41A 3VF2A 4A61A 1VQ5N 3O9SA 1RFQA 2NRTA 4BGAA 2CH6A 5M1FA 2P9UB 2YX6A 4A5BA 4JKBA 4GV3A 3O08A 3HRGA 3D2EA 5AZIB 4ILHA 3C6HA 1VAZA 3S41A 5C0YA 3PIPL 4IWVA 4WQ4A 2BTFA 3D2FA 3M6GA 1TUYA 3I33A 5GAEP 3BUZB 3CI5A 1GLEG 3D2EB 4HTLA 1W2BM 3UKUB 3QB0A 3HBTA 3FZFA 3EKSA 4YDUC 5ELZA 3SMSA 4GY2B 3WXJA 4GV6A 4BRCA 3O9QA 3R3LA 2NLXA 3OBYA 4BGBA 2GTDA 3AGRA 3FLCO 2F7TA 1BA0A 2P9IB 3TTFA 4JKGB 2J4RA 4PHTX 3CCQN 2Q1NA 3MN9A 5AQHA 3SMPA 2OANA 3G25A 2V51B 3SJHA 3O1WA 4OPHA 4FWOA 1U2VB 1YITN 5AQNA 3C65A 2Q0UA 4BG9A 3I8BA 1W97L 3SK3A 3U4LA 1HKCA 2QW9A 1KD1O 1RGIA 3VEYA 4U67L 1Y64A 4FWLA 3T69A 3VTHA 3CC4N 1KC8O 1NMDA 3F5TA 3QBXA 3FZHA 2QTDA 5AQYA 3FFKB 2VGNA 4BRGA 1HPMA 2W41A 3A5LC 1KAZA 3MWTA 1YAGA 2F9WA 4F9OA 1T6DA 1P8ZA 2I7NA 3LDQA 3CC2N 1X3MA 3IDHA 4NO7A 4NB4A 1ESVA 1QQNA 2H3GX 3R6MA 3CF5L 1K8AO 2GX9A 1YIJN 3D6RA 5FPDA 2FSJA 3M3ZA 4KH5A 5BREA 4EIAA 5I9EB 5JMVA 3FE1A 3DWLA 4H5NA 4QS8A 2YJFA 1YF5L 5KQDA 5DM6L 2PFUA 3TSQA 4FWMA 4BRIA 3Q7BA 3G6EN 5JVHL 1NGAA 3H3OB 4IZ9A 4BRMA 3CCJN 1Q86O 3VEZA 3GDQA 5EOYA 1S3XA 3HM8A 4A59A 3ZEUA 3CMEN 1MWKA 1GLAG 3I55N 5AQSA 4H0TB 4EHUA 5ADXH 1MDUB 3ZETA 4BC4A 4WFAL 1KAYA 3MN5A 4B1WB 2ZJPL 3ZEUB 5KPZA 1VQ4N 2P9PB 4WF9L 3GBTA 2EWSA 4IJNA 4XEIA 2V7ZA 2Q31A 1Q81O 3ENBA 4JK7A 1NGEA 4BRKA 5EY4A 1VQ7N 2DPNA 4KH4A 4YOTA 3OW2M 3AY9A 3P31A 1GLBG 2ZWHA 5AZJA 5LY3A 4QS9A 1ZBSA 1NM1A 3ENHA 3VENA 1VQLN 2KLAA 2QEXN 4YOYA 1ZXOA 3MDQA 3CCMN 5AZJB 2AA4A 3F9MA 3O8MA 3GE1A 4I6MB 3CPWM 1G99A 4IEEA 3I56N 2A42A 3KWGA 3RVCA 2HOEA 1ATSA 1KAXA 3MK6A 3FGUA 1O13A 3O5BA 3W0LA 2E1ZA 3IUCA 5BRHA 4BVPA 2FF3B 2BH1A 2E8AA 3L4QA 3LDPA 4BQLA 3WQTA 2WUSA 3CCUN 3A5MC 4H0YB 1H1VA 1GLJO 4GNIA 4FWNA 4RTFD 4WFNL 3EKUA 2QA4N 4CI6A 3CJ1A 3AAQA 3LDOA 4O8KA 2A3ZA 3P38A 3VEXA 5BPMA 1XQSC 4MDAA 3O9UA 4JD2A 2IIRA 4L3QA 4YOVA 4G9ZA 3O4WA 1P90A 3WQUA 4U7BA 4ILGB 4NLCA 3QDKA 2D0PA 1Z05A 4JN4A 3WXMB 4A2AA 4JD2B 4Y0WA 4DHYA 1XC3A 4B1ZA 5CE3A 5JVGL 5C2FA 3LM9A 3CXCM 1WUAA 3R8EA 4BVOA 1EO1A 3UKUA 5FPNA 3HSCA 3VESA 3MCAB 4CZJA 1E4FT 4IFEA 4IXCA 1RDUA 2NRRA 2YHWA 5TKWA 3CQXA 4PL8A 3ATUA 3W3DA 5C12A 1HKGA 4H0OA 4A5AA 5AFUA 5HOOA 1GLFO 1D4XA 2P9IA 3OBWA 4JKGA 4CZMA 5AQTA 3SLCA 2ASPA 1RDWX 2W40A 2FLOA 2WC9A 4DKWA 4CZFA 3CETA 1U2VA 4MO4A 2VCPA 4BRDA 4KH6A 4ISGA 4WQ5A 4PL7A 2ZJQL 3CPEA 1NGDA 1V4TA 2QXLA 3UE5A 3QFPA 4R79A 5EVZA 5AQJA 2PBDA 5C2DA 2QM1A 2Q97A 1SAZA 2IVOA 4OPAA 3A0IX 4MDBA 5C10A 4E1JA 2ASOA 3R9PA 3LDNA 4FPBA 2KKZA 5E26A 3DLLL 3MN6A 4B1UB 4BRAA 3EL2A 4H5VA 3AGKA 3EN9A 3VEVA 2I7PA 3AARA 2YHYA 3MMVA 3PLAA 1XUPO 3G4SN 3HI0A 4BRNA 1IJJA 3OHRA 1Q18A 2RE2A 3IKMA 1NGJA 1CZAN 5BPNA 4GVEA 4BRHA 2NRZA 2E2PA 3L0QA 1BG3A 2A40A 3CERA 4H0XB 5AQGA 4RWTA 2NRXA 4JHDA 3UB5A 2FSKA 3MX2A 4JK8A 4JKAA 4QS7A 5AQMA 4A57A 4IEIA 2WBNA 3U9ZA 1VQNN 4JKHA 3WEEB 4CD1A 4JHDB 2D0OA 4M63C 4EHTA 4B1XB 1KQSM 4IOAL 1NGHA 2HBMA 1NLVA 2YCHA 3L6QA 5KQ8A 5GIOA 3KWIA 4KBOA 1HLUA 3DXKA 2E88A 1YXQA 3R1XA 4K25A 2E2OA 4IOXA 4MLEA 4WCEL 4BR7A 5BRFA 4K42A 1VQMN 4MO5A 1YJ9N 5GAHP 2GEMA 4CZKA 2P9PA 1E4GT 4FL9A 5AQIA 3BF3A 1JCFA 4BROA 3DXKB 4B1VA 3HOSA 3U9DA 3CJCA 5TKYA 2Q2RA 3QICA 5AQKA 5BRDA 1QQOA 1M90O 5AQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9J A;  3IMX A;  3WXI A;  1BO5 O;  3FZK A;  1K8K B;  3CJ9 A;  1NGF A;  4CJ7 A;  5F0X A;  3A5N C;  2F9T A;  4WYB A;  2GEL A;  2KHO A;  3H1V X;  1OKJ A;  4CZG A;  1YUW A;  4PKI A;  4C23 A;  4BRF A;  4CZE A;  3O80 A;  5LJV A;  4I6M A;  4BR9 A;  3LM2 A;  4FWK A;  4A62 A;  3O1B A;  1S22 A;  1ZC6 A;  2NZT A;  4CBU A;  3WXK A;  3VF4 A;  3AAP A;  4YDU A;  4AM6 A;  1BOT O;  2Q36 A;  1MA9 B;  5AQZ A;  4BG8 A;  1QZ5 A;  3GL1 A;  5EXW A;  5F1X A;  3ID8 A;  5JIC A;  1TYQ B;  2AP1 A;  3CJB A;  3FR0 A;  3JXU A;  3GG4 A;  4JNE A;  4BR2 A;  1ATN A;  2CGK A;  1QHA A;  2P9K A;  5AFU H;  4EFH A;  3C7N A;  4IJA A;  4CBX A;  2QWP A;  3LDL A;  3P4I A;  1BDG A;  5JLH A;  1J6Z A;  3CIP A;  3QFU A;  2QWQ A;  3WT0 A;  4FO0 A;  2GWJ A;  2P9K B;  4BC3 A;  2IVP A;  3C7N B;  1BWF O;  5FPM A;  5AQX A;  4BC2 A;  4ISF A;  3CQY A;  2QWM A;  4H5W A;  5AQV A;  3A8Y A;  1DKG D;  3B8A X;  4B1Y B;  3VGM A;  1IG8 A;  4FWQ A;  4BR4 A;  3ZX3 A;  3LL3 A;  3UKR B;  3O6W A;  3CJA A;  2D1K A;  4BQZ A;  4EAH D;  1NWK A;  3L4I A;  2GWK A;  5BR9 A;  3DXM A;  3VGL A;  2VYP A;  4BRE A;  1SQK A;  1YVN A;  4BRP A;  3ATV A;  3WXL A;  3A5O C;  3DXM B;  2V7Y A;  2A41 A;  2P9L B;  2P9S B;  3VOV A;  4CZH A;  3DAW A;  1JCG A;  2YHX A;  3RSE B;  5AQP A;  1NGG A;  3H46 O;  3IFR A;  1NBW A;  1QZ6 A;  2ASM A;  5KPT A;  2E1Y A;  2QWN A;  2FXU A;  1X3N A;  4ISE A;  5KPR A;  3QML A;  4XH4 A;  2QWO A;  1GLL O;  5BN9 A;  1NGB A;  3BF1 A;  3VER A;  4CZL A;  3D2F B;  4FWP A;  4H03 B;  3H1Q A;  3CHW A;  2YJE A;  1DGK N;  2VWB A;  4H5T A;  4Z94 A;  3VF6 A;  4FWR A;  2E2N A;  4MLH A;  4BRL A;  2QWL A;  3WEE A;  2QWR A;  1HJO A;  2A6A A;  4DCH A;  5BPL A;  4K43 A;  1WOQ A;  4BC5 A;  4CBW A;  3VEW A;  1MWM A;  3ZX2 A;  4BR5 A;  1DEJ A;  1LCU A;  4FOE A;  4LC9 B;  2NRH A;  3EZW A;  5F2R A;  3U8X A;  3FZM A;  3H45 C;  1SZ2 A;  4IO8 A;  3TPQ A;  3VET A;  2CGL A;  2YI1 A;  2ZF5 O;  4DB3 A;  4HWI A;  4DQ8 A;  2BUP A;  1C0G A;  2P9N A;  3C0B A;  1R59 O;  1T44 A;  4PKG A;  2CGJ A;  2E20 A;  2PAV A;  4WQ4 C;  4JAX A;  3GOI A;  1TUU A;  1GLD G;  1GLC G;  1K8K A;  1NGC A;  2P9N B;  4FOI A;  2UYT A;  2ZGY A;  3ULE A;  4M7Y A;  2FSN A;  5AQF A;  4BRQ A;  2CH5 A;  3ENO A;  1KXP A;  3DJC A;  3MN7 A;  1EQY A;  4WQ5 C;  3TU5 A;  3ULE B;  4A2B A;  3J8A A;  5AQR A;  1BA1 A;  1C0F A;  4XH1 A;  3KVG A;  3D7E O;  2ZGZ A;  3EO3 A;  3M1F A;  3CJ7 A;  1V4S A;  4H5R A;  1HUX A;  1QQM A;  1ATR A;  4RCH A;  1HKB A;  1TYQ A;  5FPE A;  3ZET B;  4O5F A;  4XH5 A;  1JCE A;  5AQU A;  3FZL A;  2ITM A;  3VGK A;  4B9Q A;  3QBW A;  3MCP A;  2D4W A;  3KZB A;  3WUH A;  2A5X A;  2HMP A;  2IVN A;  5B8H A;  5AQW A;  3HTV A;  2GUP A;  2Q0R A;  2HF3 A;  2E2Q A;  2V52 B;  3ZX0 A;  4CZI A;  1LOT B;  5LJW A;  4FPA A;  1T6C A;  5ADX A;  3HZ6 A;  4FSV A;  3KHY A;  1HX1 A;  3UKR A;  1BU6 O;  3H3N O;  3H6E A;  4CD3 A;  5BN8 A;  3JS6 A;  1Z6R A;  4AM7 A;  5AQQ A;  4M7X A;  1BUP A;  4PKH A;  3VEO A;  3VPZ A;  1NGI A;  3BP8 A;  1U6Z A;  5JLF A;  5AQL A;  3BEX A;  5E84 A;  4H0V B;  4H0P A;  4FWS A;  2HF4 A;  2FF6 A;  2P9U A;  4J8F A;  2P9S A;  2P9L A;  5AR0 A;  3RSE A;  5EX5 A;  5AZI A;  4BR0 A;  4K41 A;  3VF2 A;  4A61 A;  1RFQ A;  4BGA A;  2CH6 A;  2P9U B;  3O08 A;  3D2E A;  5AZI B;  3S41 A;  4IWV A;  4WQ4 A;  2BTF A;  3D2F A;  3M6G A;  1TUY A;  3I33 A;  3BUZ B;  3CI5 A;  1GLE G;  3D2E B;  4HTL A;  3UKU B;  3QB0 A;  3HBT A;  3FZF A;  3EKS A;  4YDU C;  5ELZ A;  3SMS A;  4GY2 B;  3WXJ A;  4BRC A;  2NLX A;  4BGB A;  2GTD A;  3FLC O;  1BA0 A;  2P9I B;  2J4R A;  2Q1N A;  3MN9 A;  5AQH A;  3SMP A;  2OAN A;  3G25 A;  2V51 B;  3SJH A;  3O1W A;  4FWO A;  1U2V B;  5AQN A;  2Q0U A;  4BG9 A;  3I8B A;  3SK3 A;  3U4L A;  1HKC A;  2QW9 A;  1RGI A;  3VEY A;  1Y64 A;  4FWL A;  1NMD A;  3QBX A;  3FZH A;  5AQY A;  3FFK B;  4BRG A;  1HPM A;  2W41 A;  3A5L C;  1KAZ A;  1YAG A;  2F9W A;  4F9O A;  1T6D A;  1P8Z A;  2I7N A;  3LDQ A;  1X3M A;  3IDH A;  4NO7 A;  4NB4 A;  1ESV A;  1QQN A;  2H3G X;  3R6M A;  5FPD A;  5I9E B;  2FSJ A;  3M3Z A;  5BRE A;  4EIA A;  5JMV A;  3FE1 A;  3DWL A;  4H5N A;  4QS8 A;  2YJF A;  5KQD A;  4FWM A;  4BRI A;  1NGA A;  3H3O B;  4IZ9 A;  4BRM A;  3VEZ A;  3GDQ A;  5EOY A;  1S3X A;  3HM8 A;  3ZEU A;  1MWK A;  1GLA G;  5AQS A;  4H0T B;  4EHU A;  5ADX H;  1MDU B;  3ZET A;  4BC4 A;  1KAY A;  3MN5 A;  4B1W B;  3ZEU B;  5KPZ A;  2P9P B;  3GBT A;  2EWS A;  4IJN A;  4XEI A;  2V7Z A;  2Q31 A;  1NGE A;  4BRK A;  5EY4 A;  2DPN A;  3AY9 A;  1GLB G;  2ZWH A;  5AZJ A;  5LY3 A;  4QS9 A;  1ZBS A;  1NM1 A;  3ENH A;  3VEN A;  1ZXO A;  3MDQ A;  5AZJ B;  2AA4 A;  3F9M A;  3O8M A;  3GE1 A;  4I6M B;  1G99 A;  2A42 A;  2HOE A;  1ATS A;  1KAX A;  3MK6 A;  3FGU A;  3O5B A;  3W0L A;  2E1Z A;  3IUC A;  5BRH A;  4BVP A;  2FF3 B;  2E8A A;  3LDP A;  4BQL A;  3WQT A;  2WUS A;  3A5M C;  4H0Y B;  1H1V A;  1GLJ O;  4GNI A;  4FWN A;  4RTF D;  3EKU A;  4CI6 A;  3CJ1 A;  3AAQ A;  3LDO A;  4O8K A;  2A3Z A;  3VEX A;  5BPM A;  1XQS C;  4JD2 A;  2IIR A;  4L3Q A;  3O4W A;  3WQU A;  3QDK A;  2D0P A;  1Z05 A;  4JN4 A;  4A2A A;  4JD2 B;  4Y0W A;  4DHY A;  1XC3 A;  4B1Z A;  5CE3 A;  3LM9 A;  1WUA A;  3R8E A;  4BVO A;  3UKU A;  5FPN A;  3HSC A;  3VES A;  4CZJ A;  1E4F T;  4IXC A;  2YHW A;  3CQX A;  4PL8 A;  3ATU A;  3W3D A;  1HKG A;  4H0O A;  5AFU A;  1GLF O;  1D4X A;  2P9I A;  4CZM A;  5AQT A;  3SLC A;  2ASP A;  1RDW X;  2W40 A;  2FLO A;  4CZF A;  3CET A;  1U2V A;  4MO4 A;  2VCP A;  4BRD A;  4ISG A;  4WQ5 A;  4PL7 A;  1NGD A;  1V4T A;  2QXL A;  3UE5 A;  3QFP A;  5EVZ A;  5AQJ A;  2PBD A;  2QM1 A;  2Q97 A;  1SAZ A;  2IVO A;  3A0I X;  4E1J A;  2ASO A;  3R9P A;  3LDN A;  4FPB A;  5E26 A;  3MN6 A;  4B1U B;  4BRA A;  3EL2 A;  4H5V A;  3VEV A;  3EN9 A;  2I7P A;  3AAR A;  2YHY A;  3MMV A;  1XUP O;  3HI0 A;  4BRN A;  1IJJ A;  3OHR A;  1Q18 A;  1NGJ A;  1CZA N;  5BPN A;  4BRH A;  3L0Q A;  2E2P A;  1BG3 A;  2A40 A;  3CER A;  4H0X B;  5AQG A;  4RWT A;  4JHD A;  3UB5 A;  2FSK A;  4QS7 A;  5AQM A;  3U9Z A;  3WEE B;  4CD1 A;  4JHD B;  2D0O A;  4M63 C;  4EHT A;  4B1X B;  1NGH A;  3L6Q A;  1NLV A;  2YCH A;  5KQ8 A;  4KBO A;  1HLU A;  3DXK A;  2E88 A;  1YXQ A;  4K25 A;  2E2O A;  4MLE A;  4BR7 A;  5BRF A;  4K42 A;  4MO5 A;  2GEM A;  4CZK A;  2P9P A;  1E4G T;  4FL9 A;  5AQI A;  3BF3 A;  1JCF A;  4BRO A;  3DXK B;  4B1V A;  3U9D A;  3CJC A;  5TKY A;  2Q2R A;  3QIC A;  5AQK A;  5BRD A;  1QQO A;  5AQO A; 
#chains in the Genus database with same CATH topology
 3IMX A;  1T7P A;  4ELV A;  3E66 A;  1VQ6 N;  2F9T A;  1IKX A;  2KHO A;  1TKD A;  4CZG A;  3OYK A;  4PKI A;  4C23 A;  4BRF A;  3OVN A;  4DV6 K;  3O80 A;  4BR9 A;  3LM2 A;  2VQE K;  4FWK A;  3ZYY X;  4A62 A;  4DV1 K;  4IKF A;  1B9F A;  4CK3 A;  1A5X A;  4CFC A;  3C6A A;  3O4N A;  3IRX A;  5DK5 A;  3JXU A;  3V6D A;  3GG4 A;  4YNQ A;  4BR2 A;  4DSL A;  1ATN A;  2P9K A;  4EFH A;  3C7N A;  4JI6 K;  3V9U A;  3LDL A;  4CJR A;  4FZX C;  3NF8 A;  3QEX A;  3CCL N;  3NH0 A;  2QWQ A;  2GWJ A;  4BC3 A;  3MED A;  4WFB L;  5FPM A;  5AQX A;  3PUF A;  4BC2 A;  4ISF A;  4JKF A;  5M1K A;  2OTL N;  2QWM A;  1N36 K;  4LF5 K;  3M5R A;  3WNE A;  4O8U A;  4CJ3 A;  3O6W A;  1JL2 A;  4FK2 A;  5H1S Q;  4JV5 K;  3VGL A;  4H8K A;  1SQK A;  1JLF A;  3ATV A;  3U3Y A;  4O44 A;  3A5O C;  3OY9 A;  1WB9 A;  3UIQ A;  1RDA A;  2P9S B;  5M1Q A;  3CCS N;  2IAJ A;  2RPI A;  3RSE B;  3D0P A;  1NGG A;  3H46 O;  4B3R K;  1NBW A;  2QWN A;  3O3H A;  4ISE A;  1BHL A;  3O9T A;  1HYZ A;  4M3W A;  3THX B;  4FLV A;  2IC3 A;  1YHQ N;  1GLL O;  5BN9 A;  3VER A;  3HL8 A;  3I0S A;  1R0A A;  4C1N I;  5HRN A;  3QES A;  4LF4 K;  1DGK N;  2RKI A;  4H5T A;  3NVK A;  4MLH A;  3V1Q A;  4DR7 K;  5FRO A;  4CBW A;  4OPK A;  3CM5 A;  2JLE A;  3HVR A;  3T1A A;  3WNH A;  4GV9 A;  2KFZ A;  3OA9 A;  1DEJ A;  2EX3 A;  5M1P A;  4LC9 B;  3EE8 A;  1YI2 N;  3AVJ A;  3EZW A;  1JLQ A;  3SV3 A;  4OPJ A;  1QE1 A;  2ZJR L;  4QOZ B;  2CGL A;  1W7A A;  3P5J A;  2BUP A;  4CEC A;  2D0B A;  3C0B A;  2P9N A;  5IT9 O;  1R59 O;  3EZ5 A;  5CY4 A;  4WQ4 C;  3NH1 A;  3THY B;  3OYJ A;  4GW6 A;  4B3M K;  3KK1 A;  1JLC A;  2UYT A;  2W6L A;  3VQ9 A;  3THV A;  2FSN A;  5GIN A;  5AQF A;  3NHG A;  3DJC A;  4KB0 A;  4LFB K;  2WTU A;  4A2B A;  2HHQ A;  5AQR A;  5C15 A;  4XH1 A;  3OTO K;  1NJX A;  3PSI A;  3TAF A;  1TKX A;  3NF6 A;  5KI6 A;  1ATR A;  4RCH A;  5FPE A;  4L8R B;  2XY7 A;  4B9Q A;  1XMQ K;  2D4W A;  3KZB A;  4ID1 A;  2A5X A;  2IVN A;  4CHY A;  1NK8 A;  4OKK A;  3MXJ A;  3CG7 A;  4CGF A;  2W42 A;  2Z1H A;  4CE9 A;  3SPZ A;  4J2E A;  2HW3 A;  5JS1 A;  3E9O A;  3KHY A;  3UKR A;  3K58 A;  3K0S A;  5J2N A;  2G8F A;  3TSP A;  2X74 A;  3I8D A;  1Z6R A;  5HRO A;  1C1B A;  2ZQB A;  4LF8 K;  4JKC A;  1SS6 A;  3VPZ A;  3PX4 A;  1OH6 A;  2HHW A;  1XI1 A;  3NDK A;  3K9K A;  3BEX A;  3AA2 A;  2HF4 A;  2FF6 A;  2P9U A;  3K5L A;  1HRH A;  3AVH A;  4BR0 A;  4J2A A;  5SZT A;  3LP2 A;  3VF2 A;  4A61 A;  1VQ5 N;  4A5B A;  3QEP A;  5EU7 A;  5LMN K;  4LFC K;  3LAM A;  4RW4 A;  3S41 A;  1BI4 A;  4IWV A;  3D2F A;  4J2B A;  3I33 A;  4HTL A;  1W2B M;  1B9D A;  3UKU B;  1VSK A;  4GV6 A;  5ELZ A;  1I94 K;  4CER A;  3ISN C;  3ZSV A;  4CF8 A;  4DSK A;  2O8B B;  1KCF A;  3FLC O;  4I2Q A;  4PHT X;  3SMP A;  3G25 A;  2V51 B;  1BQM A;  3O1W A;  4OPH A;  1U2V B;  5HRS A;  5AQN A;  3C65 A;  3CQ8 A;  3TR8 A;  3HPO A;  4DU1 A;  3U4L A;  1KD1 O;  3JYT A;  3NGZ A;  1Y64 A;  3SQ4 A;  2RN2 A;  3F5T A;  3FZH A;  4AQY K;  2W41 A;  3A5L C;  3A2F A;  1YAG A;  4F9O A;  4E7J A;  1P8Z A;  3CC2 N;  4DFK A;  3AV9 A;  4NO7 A;  1I3A A;  1QQN A;  2H3G X;  5E41 A;  1YIJ N;  3OYI A;  5I9E B;  1JXE A;  3FE1 A;  1JLE A;  1N8R O;  5DM6 L;  5KQD A;  4FVM A;  5JVH L;  4RW9 A;  2GUI A;  1WSE A;  2B6A A;  1RTJ A;  1S1V A;  1MWK A;  3I55 N;  4EHU A;  1MDU B;  3ZET A;  4WFA L;  4B1W B;  3P1G A;  4N5S A;  1VQ4 N;  2PY5 A;  2P9P B;  4DTN A;  3GBT A;  4IJN A;  4JI3 K;  4FCY A;  2XY6 A;  3DI6 A;  4JK7 A;  4X62 K;  4CEA A;  1F21 A;  2DPN A;  4YOT A;  3MXM A;  4KHP K;  5AZJ A;  5HBM A;  3BZK A;  4AHR A;  2UXB K;  1IV0 A;  1VQL N;  3PV8 A;  2YNH A;  4DTO A;  4CED A;  3CCM N;  3MDQ A;  2UUB K;  3F9M A;  4FLX A;  4KAZ A;  1NK0 A;  1KVC A;  3K57 A;  3IG1 A;  3WNF A;  2FBY A;  1O13 A;  2E1Z A;  2FF3 B;  2E8A A;  2WUS A;  3CCU N;  3A5M C;  1GLJ O;  3NBP A;  4V19 S;  4FW2 A;  3CFP A;  4HUG A;  3AAQ A;  3DLH A;  3QO9 A;  1S1T A;  4DLG A;  3HPG A;  1QSS A;  1XQS C;  4CJS A;  4JD2 A;  3K5O A;  2OZS A;  3O4W A;  2O8F A;  1P90 A;  4OX9 K;  4U7B A;  4ILG B;  2YKM A;  4CHQ A;  3QDK A;  4B3T K;  4Y0W A;  1X9W A;  1XC3 A;  3T3F A;  5CE3 A;  3HYF A;  1WUA A;  3AO5 A;  1RT5 A;  4CFB A;  3NF9 A;  1ZBH A;  4IXC A;  3M8R A;  1S6P A;  4FJL A;  3ATU A;  3LAL A;  1GLF O;  1D4X A;  4CFD A;  4CZM A;  1NU0 A;  3SLC A;  1HNV A;  4DKW A;  4E19 A;  3CET A;  2ITG A;  4KV8 A;  1S9E A;  4BRD A;  3VQQ A;  1NGD A;  3KK2 A;  3QIN A;  5C2D A;  1ZBF A;  1U4B A;  1SUQ A;  4OPA A;  4CJE A;  2E5L K;  4FPB A;  3DLL L;  4TSX A;  4H5V A;  3VEV A;  4W5Q A;  1QSL A;  1I39 A;  1QTM A;  1IJJ A;  2HNY A;  1S9G A;  3OHR A;  5HRR A;  4AIL C;  2O8E A;  1L3T A;  4BRH A;  3OYH A;  3TAR A;  1BG3 A;  2A40 A;  4N47 A;  4JHD A;  4JK8 A;  3KD1 E;  4CEZ A;  2WBN A;  2KW4 A;  3LP1 A;  4DTX A;  2D0O A;  3AA5 X;  4EHT A;  4IOA L;  4C8L A;  2YCH A;  5KQ8 A;  3QER A;  4W5R A;  1HLU A;  1YXQ A;  2E2O A;  3SYZ A;  4MO5 A;  3NFA A;  2GEM A;  1E4G T;  5AQI A;  1G15 A;  4BRO A;  4B1V A;  4DQR A;  3TAB A;  3HOS A;  2Q2R A;  3QIC A;  1M90 O;  3JSM A;  4DQP A;  1K8K B;  4JI2 K;  5HL7 L;  2VWJ A;  4B9M A;  4RW7 A;  1WSF A;  4DWI A;  3A5N C;  3ZSR A;  1HNW K;  4W5N A;  2GEL A;  3H1V X;  1L3U A;  4KRE A;  1L3V A;  1YUW A;  4JI1 K;  4CHO A;  3KLG A;  4I6M A;  2F96 A;  4C8N A;  2GV9 A;  1RT3 A;  1Q9Y A;  1ZC6 A;  4KTW A;  1YJW N;  4IO9 L;  4YOX A;  3VF4 A;  3AAP A;  4YDU A;  3ZSX A;  4AM6 A;  4LH4 A;  2Q36 A;  3L2Q A;  3O3F A;  1TYQ B;  1LWF A;  2AP1 A;  1IBM K;  4JI0 K;  4I9L A;  3HT3 A;  2CGK A;  3T1H K;  1TKZ A;  4IJA A;  2D0A A;  4CIF A;  3QIO A;  5J2M A;  2QWP A;  1T05 A;  5JLH A;  4G1Q A;  4YOR A;  3P39 A;  3DLB A;  4CEE A;  3SNN A;  2IVP A;  2OPR A;  1LV5 A;  4M3X A;  3CQY A;  4M45 A;  3RMD A;  2P1J A;  1A5W A;  5AQV A;  1K6Y A;  4F8R A;  1DKG D;  1WSI A;  4B1Y B;  4FLW A;  3SJJ A;  4Z4F A;  4DMN A;  4BR4 A;  3ZX3 A;  3LL3 A;  2FBX A;  4BQZ A;  4EAH D;  2OTJ N;  1IBL K;  4CW7 B;  2Z1G A;  5BR9 A;  3BZC A;  1YVN A;  4X65 K;  4YFU A;  4BRP A;  1CZB A;  3TAG A;  5KTQ A;  1NJY A;  4Y1D A;  4AHC A;  2BDP A;  2YHX A;  3O3G A;  4W5O A;  4KI4 A;  4OVL A;  2VWK A;  1J54 A;  1YTU A;  3IFR A;  1QZ6 A;  2ASM A;  1LW2 A;  3QET A;  3LZI A;  3EE9 A;  5KPR A;  1HMV A;  3BF1 A;  2ZD1 A;  4FWP A;  4FJH A;  1HPZ A;  4M42 A;  4JYA K;  1LW0 A;  2HBL A;  4BRL A;  1C1C A;  3WEE A;  1QVG M;  4DCH A;  2QKK A;  4JEP A;  4E89 A;  1DTT A;  3CMA N;  1Q7Y O;  4OO1 J;  4FK4 A;  1C0M A;  3F73 A;  3LWL A;  3L2W A;  3ZX2 A;  4BDY A;  1LCU A;  2B4J A;  4FOE A;  3H45 C;  3THY A;  1SZ2 A;  3TPQ A;  1RBS A;  4B9L A;  2ZF5 O;  4HWI A;  4DQ8 A;  2JWL A;  1C0G A;  4PKG A;  4BY9 C;  2HHS A;  2E20 A;  4FJM A;  2HBK A;  3TTD A;  1GLD G;  1GLC G;  1NGC A;  3HOT A;  2ZGY A;  4J2D A;  1YTA A;  5LMU K;  3SAF A;  1KXP A;  3MN7 A;  1BCO A;  1U45 A;  4JI7 K;  3OS2 A;  4UY8 O;  1NJI O;  3AVL A;  3AVM A;  3EY1 A;  3J8A A;  1C0F A;  3MEG A;  3V9W A;  1EWQ A;  3KVG A;  3NF7 A;  4IG3 A;  3QLH A;  1J5O A;  4IFY A;  1V4S A;  4AHU A;  1RT2 A;  2HHX A;  1NK6 A;  4DUY K;  5AQU A;  2HST A;  1EXQ A;  2ITM A;  3CCV N;  3QBW A;  4DQS A;  1SKR A;  4IBN A;  5GIP A;  3SQ2 A;  5C25 A;  4FVU A;  5B8H A;  5DMR A;  5AQW A;  5D3G A;  2HVI A;  4F3T A;  3PIO L;  1LWC A;  1GOC A;  1HYV A;  2E2Q A;  4CVN E;  3C95 A;  4FJJ A;  5LJW A;  2NRW A;  1T6C A;  4PUO A;  4UQG A;  1CZ9 A;  3AVB A;  1DTQ A;  3J7A P;  4OGC A;  3Q7C A;  4OKJ A;  1XC9 A;  3H6E A;  4CD3 A;  1WSH A;  1EP4 A;  3JS6 A;  2F4V K;  4IDK A;  5AQQ A;  4M7X A;  1BUP A;  4PKH A;  3DOL A;  1TV6 A;  3E1Y A;  1TKT A;  4WE1 A;  5JLF A;  5FLX O;  3F2K A;  5E84 A;  5AQL A;  4B08 A;  4CJF A;  2P9L A;  5AR0 A;  4IDH A;  3S3O A;  5EX5 A;  4GKJ K;  1TK8 A;  4W5T A;  2OA8 A;  3O9S A;  2YX6 A;  1IKY A;  4JS5 A;  3V4I A;  3VQ4 A;  3O08 A;  5AZI B;  1HNI A;  4ILH A;  4EP5 A;  1IO2 A;  3PIP L;  4F3O A;  3L3V A;  3MXI A;  4C8O A;  4F2S A;  2O8B A;  2BGG A;  3QB0 A;  4YDU C;  3OYL A;  3SMS A;  4CJL A;  3R3L A;  4BGB A;  3AGR A;  5KGW A;  1BA0 A;  4QAG A;  2P9I B;  4JKG B;  2J4R A;  1T03 A;  3L2U A;  2Q1N A;  3OJS A;  3ZT3 A;  1X9S A;  2DTU A;  4KHN A;  3ZLJ A;  4BG9 A;  3I8B A;  1W97 L;  1L3S A;  2QW9 A;  2Y1I A;  1RGI A;  3VEY A;  4AHV A;  3VTH A;  3CC4 N;  3QBX A;  2QTD A;  3FFK B;  4BRG A;  3NGY A;  1Q8I A;  1X3M A;  2FBV A;  4NB4 A;  3R6M A;  1K8A O;  2XO7 A;  4B9N A;  4E1M A;  5FPD A;  3M3Z A;  4KH5 A;  5BRE A;  2XHB A;  1BCM A;  1YF5 L;  3TSQ A;  4FWM A;  4BRI A;  4FW1 A;  2YV0 X;  1Q86 O;  4DFP A;  3TAE A;  5EOY A;  1S3X A;  3TAN A;  3HM8 A;  4DG1 A;  2BAN A;  4CJV A;  3OYN A;  2G8H A;  4H0T B;  5ADX H;  4HUF A;  4M41 A;  4KHU A;  2UXC K;  2R7Y A;  2ZJP L;  3ZEU B;  5FRN A;  2XY5 A;  1SKS A;  2G8V A;  2GBZ A;  4WF9 L;  2EWS A;  4CJK A;  1WAF A;  2Q31 A;  3KKR A;  1ZBU A;  1S1W A;  3ENB A;  5JS2 A;  1D9F A;  1VQ7 N;  1GLB G;  1ZBS A;  1JXB A;  2KLA A;  4QCL A;  2HNZ A;  3DMJ A;  1ZXO A;  2WOM A;  3CFO A;  1KRP A;  4PQU A;  2O8C B;  3SQ0 A;  3CPW M;  1N5Y A;  2HOE A;  1LWE A;  1KAX A;  3HST B;  4DR1 K;  3IUC A;  5BRH A;  4NXN K;  3L4Q A;  4I7F A;  4LFA K;  3O4Q A;  3WQT A;  4RTF D;  5K14 A;  1FJG K;  3CJ1 A;  5J2Q A;  4B9S A;  1QQC A;  1NKB A;  4CHP A;  3ASM A;  4DS5 A;  4O0I A;  1NJZ A;  4DHY A;  4B1Z A;  5C2F A;  3LM9 A;  4BVO A;  4FLT A;  3RRG A;  5FPN A;  4OLA A;  3AVC A;  1RBR A;  4O55 A;  3OYA A;  5TKW A;  4CJP A;  2YHW A;  4AHT A;  4H0O A;  4A5A A;  4FM2 A;  4Y1C A;  3PY8 A;  3NE6 A;  4KHQ A;  4O4G A;  1EKE A;  2HVH A;  1RDW X;  2FLO A;  2XY8 A;  3KJV A;  2WC9 A;  1WNS A;  4FXD A;  1JLG A;  3AVG A;  4MO4 A;  3PX6 A;  4LF6 K;  1X9M A;  2X78 A;  4KH6 A;  1CXQ A;  1ASV A;  1S6Q A;  3QFP A;  4IG0 A;  2Q97 A;  4K8Z A;  3A0I X;  4MDB A;  5C10 A;  3R9P A;  3SCX A;  5E26 A;  1XWL A;  1GOB A;  1ASU A;  3KLF A;  2I7P A;  3AAR A;  4BRN A;  3SQ1 A;  1VSL A;  3DRR A;  3V9Z A;  3DRP A;  5BR8 K;  1BIZ A;  2DFE A;  2E6M A;  1L5U A;  5AQG A;  2NRX A;  3M8S A;  1HJR A;  2FC0 A;  4JS4 A;  2FSK A;  3DOK A;  3MX2 A;  2UUA K;  4CGJ A;  3U9Z A;  1VQN N;  4KTQ A;  1VSI A;  1IH7 A;  2P51 A;  4KO0 A;  1FKP A;  1NGH A;  3L6Q A;  3HXM A;  4E7I A;  3VQE A;  5GIO A;  3KWI A;  1VRU A;  4R5P A;  2E88 A;  4Z4I A;  2OCE A;  4MLE A;  4ELT A;  1VQM N;  1YJ9 N;  4CZK A;  2RF2 A;  2QK9 A;  3DXK B;  4LF7 K;  4FJI A;  3U9D A;  5AQK A;  5BRD A;  4H4O A;  1X9J A;  4F4K A;  1BO5 O;  3CJ9 A;  1RDD A;  4DV0 K;  4DFM A;  4CJ7 A;  3KKS A;  1S1X A;  3LAN A;  3QNO A;  1OKJ A;  3G0Z A;  5KRS A;  3NVM A;  3N4P A;  3OJU A;  4CGI A;  5LJV A;  5J1E A;  4HCC A;  4B9U A;  3D45 A;  3O1B A;  1S22 A;  2NNW A;  1NK5 A;  1RT1 A;  2YNI A;  4BE0 A;  4CBU A;  1QVF M;  3L2R A;  3LWM A;  4JLH A;  4YHH K;  5AQZ A;  1QZ5 A;  3GL1 A;  5EXW A;  5GAG P;  5F1X A;  3O9R A;  4DSE A;  3CJB A;  3FR0 A;  1RBT A;  2X6S A;  5AFU H;  4CBX A;  2YHB A;  4CK2 A;  3DM2 A;  4B3S K;  4KHS A;  1BDG A;  1SV5 A;  4LY7 A;  4HHT A;  3QFU A;  3B6O A;  4HUE A;  2UUC K;  3WT0 A;  1K9M O;  3SBG A;  3HM9 A;  1BWF O;  1TAU A;  4AF1 A;  1XHZ A;  4H5W A;  4DSF A;  2ZE2 A;  3A8Y A;  4FK0 A;  3VGM A;  4FWQ A;  5DM7 L;  5T7B A;  3V9X A;  4GVM A;  3UKR B;  1EX4 A;  3L4I A;  2GWK A;  2QKB A;  2OPS A;  4BRE A;  2VG5 A;  4XIU A;  4MFB A;  1RT6 A;  1S72 N;  3DXM B;  2V7Y A;  1YJN N;  1VQO N;  4CZH A;  2IS3 A;  5AQP A;  4MQ3 A;  4FYD A;  4ZHR A;  5KPT A;  2E1Y A;  3NGI A;  3KK7 A;  3V1R A;  2FXU A;  4Z4E A;  3J7Z O;  3E01 A;  1Q82 O;  2KTQ A;  1X3N A;  3QML A;  3AVA A;  4XH4 A;  4LH5 A;  4FJ8 A;  2QWO A;  3CFR A;  2ZM6 K;  3D2F B;  1KFS A;  4H03 B;  3H1Q A;  3CHW A;  3AA4 A;  2VWB A;  4ID5 A;  4N56 A;  3VF6 A;  2E2N A;  5BPL A;  2QWL A;  1U49 A;  4K43 A;  1WOQ A;  3VEW A;  1MWM A;  3SI6 A;  3OYG A;  2JWK A;  1REV A;  3AO2 A;  1WSJ A;  2NRH A;  2YKN A;  4KRF A;  3MEE A;  3JAM O;  4DF4 A;  3IS9 A;  4FZZ A;  2YI1 A;  4DB3 A;  1NK9 A;  3TAQ A;  1DT9 A;  1T44 A;  1ZYQ A;  3K2P A;  2PAV A;  3GOI A;  4DTR A;  3KLI A;  4YOW A;  3L8B A;  3VA3 A;  1OH7 A;  1BQN A;  4FOI A;  4B9V A;  1U48 A;  5CR4 A;  3ENO A;  3VQA A;  1JLB A;  2KQ2 A;  4E7H A;  3ULE B;  4HCB A;  1BA1 A;  3E9P A;  1GOA A;  3KD5 E;  4CEO A;  4FLY A;  3D7E O;  2ZGZ A;  1NG9 A;  1JJ2 M;  3CD6 N;  3K59 A;  4KPY A;  3M1F A;  5CYM A;  1N32 K;  4H5R A;  4KHW A;  1QQM A;  1J9A A;  3ZET B;  4O5F A;  4XH5 A;  4FJN A;  1BIS A;  3VGK A;  4YY3 K;  3MCP A;  3K5M A;  3LDS A;  4DQQ A;  3WUH A;  2JGU A;  3TSU A;  4JI8 K;  2XRI A;  2YHA A;  2V52 B;  1BGX T;  4CZI A;  1T3V A;  5ADX A;  3G71 N;  4FSV A;  1VQ8 N;  1D5A A;  2UU9 K;  3SAH A;  3H3N O;  5BN8 A;  4JK9 A;  1E3M A;  3VQP A;  4BDP A;  4AM7 A;  4DSI A;  3SPY A;  1Z26 A;  4KB1 A;  4FM0 A;  1IKW A;  1U6Z A;  3VA0 A;  4DFJ A;  1HQE A;  4H0P A;  4Z4C A;  4J8F A;  1N6Q A;  2P9S A;  4DTJ A;  3RSE A;  5AZI A;  3VMF B;  3MWP A;  4K41 A;  4FJX A;  4N76 A;  1RFQ A;  4BGA A;  2CH6 A;  1KSP A;  2KZM A;  3HRG A;  1NMN A;  1WSG A;  1VAZ A;  3THX A;  5C0Y A;  1UWB A;  3HO1 A;  4LD0 A;  3K5N A;  4WQ4 A;  4LSN A;  1VSH A;  1TUY A;  1RIL A;  3M6G A;  5GAE P;  3BUZ B;  3CI5 A;  1GLE G;  3D2E B;  3HBT A;  3FZF A;  3WXJ A;  4GY2 B;  4FZY A;  3I0R A;  3O9Q A;  4BRC A;  3OBY A;  3LZJ A;  3QNN A;  2GTD A;  5SWM A;  1D9D A;  4HVJ A;  1XNQ K;  3MN9 A;  2OAN A;  4FWO A;  1YIT N;  4DTP A;  3J80 O;  3DYA A;  1C0T A;  1HKC A;  1BL3 A;  2DY4 A;  4FWL A;  1X1P A;  1JL1 A;  3M8Q A;  1KC8 O;  5AQY A;  4O0J A;  2VGN A;  2IDO A;  1HPM A;  4DLE A;  4FM1 A;  2F9W A;  3DLR A;  3G10 A;  4ELU A;  2QXF A;  4B8C A;  1RBU A;  3CF5 L;  1XNR K;  2GX9 A;  3DWL A;  4QS8 A;  5I42 A;  3G6E N;  2PFU A;  4IZ9 A;  4BRM A;  3CCJ N;  2HHH K;  3VEZ A;  1ITG A;  1KLM A;  4E7K A;  2Y1J A;  4CIG A;  4A59 A;  4LSL A;  3ZEU A;  3ZSW A;  3H08 A;  1O1W A;  2B5J A;  5AQS A;  1SL1 A;  4BC4 A;  1KAY A;  3MN5 A;  1XMO K;  3V1O A;  3T1Y K;  4NYF A;  2V7Z A;  4X64 K;  1Q81 O;  4B3O A;  3BY5 A;  4KHY A;  2WON A;  1NGE A;  3C94 A;  4KH4 A;  2ATQ A;  3P31 A;  2ZWH A;  4RW8 A;  4CJ4 A;  4M3Z A;  4QS9 A;  3VN5 A;  1NM1 A;  3ENH A;  1NOY A;  2O8C A;  1TL1 A;  1QS4 A;  4KFB A;  3MAQ A;  2QEX N;  3RMA A;  1C6V A;  1VRT A;  3LP3 A;  4YOY A;  4EZ6 A;  2AA4 A;  4I6M B;  4IEE A;  3I56 N;  2A42 A;  3RVC A;  1RDC A;  3MK6 A;  1WAJ A;  3FGU A;  1VSE A;  3W0L A;  2OYQ A;  2F8S A;  2HHT A;  2BH1 A;  3AO4 A;  3EKU A;  2I5J A;  4CI6 A;  4FJ5 A;  3DLK A;  3LDO A;  2A3Z A;  4M3U A;  5BPM A;  3AO3 A;  2DFH A;  3O9U A;  3J81 O;  4CES A;  1U04 A;  2IIR A;  1TK0 A;  4G9Z A;  3SZ2 A;  3EEQ A;  4O5B A;  4NLC A;  2VG7 A;  3SUN A;  2O8D B;  2HHV A;  2D0P A;  4A2A A;  5HLF A;  4DTM A;  3U3G A;  1QSY A;  1UAX A;  1RCH A;  2X6N A;  1LAV A;  3UKU A;  3MCA B;  4CZJ A;  4H4M A;  1E4F T;  1RDU A;  2NRR A;  3CQX A;  4PL8 A;  3W3D A;  4CJQ A;  1HKG A;  5AFU A;  1FW6 A;  2NUB A;  2HHU A;  2W40 A;  4CZF A;  3OS0 A;  2HMI A;  1JLA A;  1U2V A;  1VSM A;  3HJF A;  3THW B;  4WQ5 A;  1S1U A;  4PL7 A;  2A1S A;  1V4T A;  3ZT1 A;  1NK4 A;  5EVZ A;  5AQJ A;  3DRS A;  3SV4 A;  2QM1 A;  4DR6 K;  2EHG A;  1SAZ A;  1FKO A;  1N34 K;  1TL3 A;  4E1J A;  1OVQ A;  2KKZ A;  4NYN A;  3MN6 A;  4BRA A;  3EL2 A;  3EN9 A;  2YHY A;  3MMV A;  4K8X A;  3G4S N;  3HI0 A;  1NOZ A;  5KRT A;  1NGJ A;  3L0Q A;  4BE1 A;  4N41 A;  3C6U A;  4RWT A;  4DV3 K;  4BE2 A;  4JKA A;  3DLG A;  4QS7 A;  5AQM A;  5HP1 A;  4JKH A;  3WEE B;  4CD1 A;  3AA3 A;  3AVI A;  4FJG A;  1NLV A;  1CXU A;  4NCA A;  3ZSQ A;  3DXK A;  2E6L A;  1IBK K;  2OPP A;  4WCE L;  4CIE A;  1C1A A;  1SL0 A;  4K42 A;  5GAH P;  2P9P A;  4FL9 A;  3SUP A;  4DR2 K;  4BWJ A;  4B8A B;  5C24 A;  1QQO A;  5AQO A;  2E4L A;  1IG9 A;  3TWH A;  3WXI A;  1SL2 A;  4CF2 A;  3FZK A;  1NGF A;  4JKE A;  3S9H A;  5F0X A;  4WYB A;  4CJT A;  2PZS A;  3QIP A;  2O4I A;  4DQI A;  3ID6 A;  4JKD A;  4NXM K;  4CZE A;  1W9H A;  4DF8 A;  3OYC A;  3DLE A;  2YNF A;  3AO1 A;  5M1N A;  5FDL A;  1J53 A;  2Z1J A;  3HK2 A;  4Z0U A;  2NZT A;  4FJ9 A;  3WXK A;  4CHN A;  1BOT O;  1MA9 B;  4BG8 A;  1FK9 A;  2KFN A;  5JIC A;  3ID8 A;  4C1N K;  1RTD A;  3OYF A;  4JNE A;  4I9Q A;  3PSF A;  1QHA A;  1A5V A;  2NRV A;  3TAP A;  3P4I A;  4DU3 A;  1K73 O;  5CHI A;  2F8T A;  4DTS A;  4GKK K;  1J6Z A;  3CIP A;  2G8K A;  4FO0 A;  2P9K B;  3C7N B;  4DTU A;  3SUQ A;  3KIO A;  4RG8 A;  3B8A X;  1NKE A;  1IG8 A;  1RBV A;  2RHK A;  4EZ9 A;  1OVY A;  4M3R A;  3CCE N;  2W6K A;  3MX5 A;  1M1K O;  3CJA A;  2UXD K;  2D1K A;  1NWK A;  3F9K A;  3CM6 A;  1S5J A;  3DXM A;  3TI0 A;  4Q0B A;  2VYP A;  4CJ5 A;  3S3M A;  4OJR A;  1RTI A;  3WXL A;  1NK7 A;  3S3N A;  5CZ1 A;  1VQ9 N;  3VTI A;  2A41 A;  2P9L B;  3VOV A;  2D5R A;  3DAW A;  1JCG A;  4M3T A;  1ZBI A;  3CC7 N;  1RTH A;  1CLQ A;  1QHT A;  3AVN A;  3ZSY A;  3N4Q A;  1VQK N;  2HB5 A;  3NAE A;  1NGB A;  2QI2 A;  4CZL A;  1Z25 A;  1VQP N;  4NLB A;  4FLZ A;  2Q3S A;  3NMU A;  2YJE A;  3AVK A;  4Z94 A;  2OZM A;  4FWR A;  2QWR A;  1HJO A;  1C0U A;  2A6A A;  2VG6 A;  4BC5 A;  4CGG A;  3L2V A;  3NH2 A;  4E3S A;  3SAG A;  3FFI A;  4CCH A;  4BR5 A;  5GAD P;  3ZCM A;  5F2R A;  3CYM A;  3FZM A;  3U8X A;  4IO8 A;  5AJ3 K;  2P5O A;  1VHX A;  3VET A;  1SKW A;  3QEW A;  4LF9 K;  1WBD A;  2AJQ A;  2CGJ A;  2O4G A;  1VSF A;  4JAX A;  2YNG A;  4BAC A;  2WFB A;  1TUU A;  3TTC A;  2IGI A;  1K8K A;  2BE2 A;  4K0K K;  2P9N B;  1WBB A;  4DSJ A;  3M8P A;  3PX0 A;  3ULE A;  4M7Y A;  1TGO A;  4BRQ A;  1BIU A;  2CH5 A;  3C6T A;  1EQY A;  2VGM A;  4WQ5 C;  3OS1 A;  3TU5 A;  5IWA K;  3SBT A;  4M3Y A;  1JKH A;  2VQF K;  1HNX K;  4CGD A;  3EO3 A;  1TK5 A;  3J7Y P;  4DR4 K;  5A2Q O;  4CF1 A;  3CJ7 A;  4KTZ A;  3CCR N;  3RWU A;  1HUX A;  2FBT A;  1HKB A;  1TYQ A;  2IOC A;  2P5G A;  1JCE A;  4Z4H A;  1XHX A;  3FZL A;  3ZT4 A;  4YOU A;  3SUO A;  4AHS A;  2HMP A;  3OYD A;  2D0C A;  3V81 A;  3HTV A;  2GUP A;  2Q0R A;  3LAK A;  2HF3 A;  4IOC L;  3WNG A;  3ZX0 A;  1LOT B;  3LP0 A;  5M1O A;  4HTU A;  1B92 A;  1EWR A;  4KI6 A;  4FPA A;  3L3U A;  4DUZ K;  2HND A;  3HZ6 A;  1HX1 A;  1T8E A;  1FXX A;  4BWM A;  1BU6 O;  1HR0 K;  3KLE A;  4CFA A;  3VEO A;  3K9J A;  4EP4 A;  1NGI A;  3BP8 A;  3E9L A;  3T7Z A;  1ILY A;  3KK3 A;  4ILJ A;  4H0V B;  3VQD A;  4FWS A;  3NCI A;  3VQB A;  3B6P A;  5MLC Q;  2ETJ A;  5J2P A;  2HBJ A;  4C8K A;  4JRQ A;  1RNH A;  5CZ2 A;  3P83 D;  2NRT A;  5M1F A;  2P9U B;  3OYM A;  2PYL A;  4JKB A;  5CYQ A;  1OH8 A;  4GV3 A;  3D2E A;  3PO5 A;  3C6H A;  3ZT0 A;  4OLB A;  2BTF A;  1HYS A;  4OKE A;  2OPQ A;  1TVR A;  3KLH A;  1KTQ A;  1NNE A;  4PWD A;  4RW6 A;  4CEB A;  4Z4G A;  3EKS A;  3RR7 A;  1BI4 B;  2NLX A;  3VQ8 A;  3ZSZ A;  3VQC A;  3ZSO A;  3RMC A;  2F7T A;  3VQ6 A;  3TTF A;  3CCQ N;  4Q5V A;  5AQH A;  1VSD A;  3SJH A;  3EYZ A;  3ZT2 A;  1LAW A;  4E0D A;  2Q0U A;  1UA0 A;  4IFV A;  3SK3 A;  1MU2 A;  1WN7 A;  1ASW A;  4PA1 A;  1UOC A;  3T69 A;  4U67 L;  1NMD A;  3RMB A;  4DV5 K;  4ZTF A;  3V9S A;  1KAZ A;  3MWT A;  4AH9 A;  1T6D A;  1HQU A;  2I7N A;  3LDQ A;  4CF9 A;  2KZZ A;  3IDH A;  4NCB A;  1ESV A;  1NJW A;  3D6R A;  2FSJ A;  4EIA A;  5JMV A;  2LSN A;  1TAQ A;  4H5N A;  2YJF A;  3HP9 A;  4E7L A;  1HNZ K;  3Q7B A;  1NGA A;  3H3O B;  4FLU A;  3GDQ A;  1KFD A;  1D8Y A;  4DV4 K;  1VK0 A;  3CME N;  1UA1 A;  1ZBL A;  1GLA G;  2G8U A;  1Y97 A;  2Z1I A;  3LPU A;  1VSJ A;  5KPZ A;  3PO4 A;  1EET A;  4XEI A;  5C42 A;  3RRH A;  4BRK A;  3BDP A;  5EY4 A;  3OW2 M;  3AY9 A;  4DS4 A;  5LY3 A;  4JI5 K;  4CEF A;  3VEN A;  4ZTJ A;  4FJK A;  3OYB A;  3HVT A;  5AZJ B;  4NCG A;  4ICL A;  3O8M A;  3GE1 A;  3HPH A;  3VQ7 A;  4CHZ A;  2G8W A;  1WLJ A;  3HP6 A;  1G99 A;  3KWG A;  1ATS A;  3ITH A;  4CF0 A;  1RT4 A;  3O5B A;  4F2R A;  4BVP A;  1OH5 A;  4CJW A;  3LDP A;  4BQL A;  1IKV A;  5FRM A;  4H0Y B;  1H1V A;  4GNI A;  4FWN A;  4WFN L;  2QA4 N;  1U47 A;  3KTQ A;  4I2P A;  4O8K A;  3IAY A;  3P38 A;  3VEX A;  2O8D A;  4JRP A;  4MDA A;  3ULD A;  4L3Q A;  4YOV A;  1DLO A;  3RTV A;  3WQU A;  1Z05 A;  4JN4 A;  3BGR A;  3WXM B;  4JD2 B;  1KLN A;  3RR8 A;  2O8F B;  5JVG L;  4JI4 K;  4PY5 A;  3CXC M;  3R8E A;  4DV7 K;  1EO1 A;  3HSC A;  3VES A;  5HRP A;  2A1R A;  3TAM A;  4IFE A;  5C12 A;  4DU4 A;  5I3U A;  5HOO A;  2P9I A;  3OBW A;  4JKG A;  5AQT A;  3THW A;  2ASP A;  1RDB A;  1YT3 A;  3OYE A;  1J5E K;  4B9T A;  2VCP A;  4ISG A;  2ZJQ L;  1KVA A;  3CPE A;  3UE5 A;  2QXL A;  4R79 A;  4E1N A;  2PBD A;  3VQ5 A;  2IVO A;  2ASO A;  4BDZ A;  3LDN A;  1N33 K;  3MEC A;  4CGH A;  4B1U B;  3AGK A;  3PLA A;  1XUP O;  1Q18 A;  2RE2 A;  3IKM A;  1CZA N;  5BPN A;  4GVE A;  4KKO A;  2NRZ A;  2E2P A;  4DV2 K;  3CER A;  3ALY A;  4H0X B;  3QEV A;  3U6F A;  2DFF A;  4GMJ B;  2O8E B;  3UB5 A;  5KGX A;  4OGE A;  2PYJ A;  3QEI A;  1KVB A;  3LPT A;  4A57 A;  4CJU A;  1NKC A;  4IEI A;  4C8M A;  1W0H A;  1Q9X A;  4JHD B;  2G8I A;  4M63 C;  4B1X B;  1KQS M;  5LL6 Z;  2HBM A;  1RT7 A;  4KBO A;  1YVU A;  3R1X A;  4K25 A;  4IOX A;  4BR7 A;  3T19 A;  5BRF A;  4CK1 A;  4DR5 K;  3BF3 A;  1JCF A;  3CJC A;  4X66 K;  5TKY A;  4CEQ A;  4FJ7 A;  4DR3 K;  3AVF A; 
#chains in the Genus database with same CATH homology
 1X9J A;  3IMX A;  3WXI A;  1BO5 O;  3E66 A;  3FZK A;  1K8K B;  3CJ9 A;  1VQ6 N;  5HL7 L;  1NGF A;  4JKE A;  4CJ7 A;  5F0X A;  3A5N C;  2F9T A;  4WYB A;  2GEL A;  2KHO A;  3ID6 A;  3H1V X;  1OKJ A;  4JKD A;  4CZG A;  3NVM A;  1YUW A;  3N4P A;  4PKI A;  4C23 A;  4BRF A;  4CZE A;  3O80 A;  5LJV A;  4I6M A;  4BR9 A;  3LM2 A;  4FWK A;  3ZYY X;  4A62 A;  5M1N A;  3O1B A;  1S22 A;  2NNW A;  1ZC6 A;  1YJW N;  2NZT A;  4CBU A;  4IO9 L;  1QVF M;  3WXK A;  4YOX A;  3VF4 A;  3AAP A;  4YDU A;  4AM6 A;  1BOT O;  2Q36 A;  1MA9 B;  3C6A A;  5AQZ A;  4BG8 A;  1QZ5 A;  3GL1 A;  5EXW A;  5GAG P;  3ID8 A;  3O9R A;  5F1X A;  5JIC A;  4C1N K;  1TYQ B;  2AP1 A;  3CJB A;  3FR0 A;  3JXU A;  3GG4 A;  4JNE A;  4BR2 A;  1ATN A;  2CGK A;  1QHA A;  2P9K A;  5AFU H;  4EFH A;  3C7N A;  4IJA A;  4CBX A;  2NRV A;  2QWP A;  3LDL A;  3P4I A;  1BDG A;  5CHI A;  1K73 O;  5JLH A;  4YOR A;  1J6Z A;  3CIP A;  3P39 A;  3QFU A;  3CCL N;  2QWQ A;  3WT0 A;  4FO0 A;  2GWJ A;  2P9K B;  4BC3 A;  2IVP A;  3SBG A;  3C7N B;  1BWF O;  4WFB L;  4AF1 A;  5FPM A;  5AQX A;  1K9M O;  4BC2 A;  4ISF A;  4JKF A;  3CQY A;  5M1K A;  2QWM A;  1QVG M;  2OTL N;  4H5W A;  5AQV A;  3A8Y A;  1DKG D;  3B8A X;  4B1Y B;  3M5R A;  3VGM A;  1IG8 A;  4FWQ A;  5DM7 L;  2RHK A;  4O8U A;  4BR4 A;  3ZX3 A;  3LL3 A;  1OVY A;  3UKR B;  1N8R O;  3MX5 A;  3CCE N;  3O6W A;  3CJA A;  1M1K O;  2D1K A;  4BQZ A;  4EAH D;  1NWK A;  3L4I A;  2OTJ N;  5H1S Q;  2GWK A;  5BR9 A;  3DXM A;  3VGL A;  2VYP A;  4BRE A;  1SQK A;  1YVN A;  4BRP A;  3ATV A;  3WXL A;  3A5O C;  1S72 N;  3DXM B;  1VQ9 N;  2V7Y A;  3VTI A;  1YJN N;  2A41 A;  2P9L B;  2P9S B;  5M1Q A;  3VOV A;  4CZH A;  3CCS N;  1VQO N;  3DAW A;  1JCG A;  2YHX A;  3RSE B;  5AQP A;  1NGG A;  3CC7 N;  3H46 O;  3IFR A;  1NBW A;  1QZ6 A;  2ASM A;  5KPT A;  2E1Y A;  3KK7 A;  2QWN A;  2FXU A;  3N4Q A;  3EE9 A;  3J7Z O;  1Q82 O;  1VQK N;  1X3N A;  4ISE A;  5KPR A;  3O9T A;  3QML A;  4XH4 A;  2QWO A;  1GLL O;  1YHQ N;  5BN9 A;  1NGB A;  2QI2 A;  3BF1 A;  3VER A;  4CZL A;  3D2F B;  1VQP N;  4FWP A;  4NLB A;  4C1N I;  4H03 B;  3H1Q A;  3NMU A;  3CHW A;  2YJE A;  1DGK N;  2VWB A;  2HBL A;  4H5T A;  4Z94 A;  3VF6 A;  4FWR A;  3NVK A;  2E2N A;  4MLH A;  4BRL A;  2QWL A;  3WEE A;  2QWR A;  1HJO A;  2A6A A;  4DCH A;  5BPL A;  4K43 A;  1WOQ A;  4BC5 A;  4CBW A;  4JEP A;  3VEW A;  3CMA N;  1MWM A;  1Q7Y O;  4OO1 J;  3SAG A;  4GV9 A;  3ZX2 A;  2JWK A;  4BR5 A;  5GAD P;  1DEJ A;  1LCU A;  3OA9 A;  4FOE A;  2NRH A;  3EE8 A;  4LC9 B;  5M1P A;  1YI2 N;  3EZW A;  5F2R A;  3U8X A;  3FZM A;  3H45 C;  1SZ2 A;  4IO8 A;  3TPQ A;  3VET A;  2ZJR L;  2CGL A;  2YI1 A;  2ZF5 O;  4DB3 A;  4HWI A;  4DQ8 A;  2BUP A;  2JWL A;  1C0G A;  2P9N A;  3C0B A;  1R59 O;  1DT9 A;  1T44 A;  4PKG A;  4BY9 C;  2CGJ A;  2E20 A;  2PAV A;  4WQ4 C;  4JAX A;  3GOI A;  2HBK A;  3TTD A;  2WFB A;  1TUU A;  3TTC A;  4YOW A;  1GLD G;  1GLC G;  1K8K A;  1NGC A;  2P9N B;  3HOT A;  4FOI A;  2UYT A;  2ZGY A;  3ULE A;  4M7Y A;  2FSN A;  5GIN A;  5AQF A;  4BRQ A;  2CH5 A;  5CR4 A;  3ENO A;  3SAF A;  1KXP A;  3DJC A;  3MN7 A;  4UY8 O;  1EQY A;  2VGM A;  4WQ5 C;  1NJI O;  3TU5 A;  3ULE B;  4A2B A;  3J8A A;  5AQR A;  1BA1 A;  3E9P A;  1C0F A;  3SBT A;  5C15 A;  4XH1 A;  3KVG A;  3D7E O;  2ZGZ A;  3EO3 A;  1JJ2 M;  3CD6 N;  3M1F A;  3CJ7 A;  3CCR N;  1V4S A;  4H5R A;  1HUX A;  1QQM A;  1ATR A;  4RCH A;  1HKB A;  1TYQ A;  5FPE A;  3ZET B;  4O5F A;  4XH5 A;  1JCE A;  5AQU A;  2HST A;  3FZL A;  2ITM A;  3VGK A;  4B9Q A;  3CCV N;  3QBW A;  3MCP A;  2D4W A;  3KZB A;  3WUH A;  4YOU A;  5GIP A;  2A5X A;  4FVU A;  2HMP A;  2IVN A;  3TSU A;  5B8H A;  5AQW A;  3HTV A;  2GUP A;  2Q0R A;  3PIO L;  2HF3 A;  2E2Q A;  2V52 B;  4IOC L;  3ZX0 A;  4CZI A;  1LOT B;  5M1O A;  1T3V A;  5LJW A;  2NRW A;  4FPA A;  1T6C A;  5ADX A;  3HZ6 A;  3G71 N;  4FSV A;  3E9O A;  3KHY A;  1HX1 A;  1VQ8 N;  3UKR A;  3Q7C A;  3SAH A;  1BU6 O;  3H3N O;  3H6E A;  4JK9 A;  4CD3 A;  5BN8 A;  3TSP A;  3JS6 A;  1Z6R A;  4AM7 A;  5AQQ A;  4M7X A;  1BUP A;  4JKC A;  4PKH A;  1SS6 A;  3VEO A;  3K9J A;  3VPZ A;  3E1Y A;  1NGI A;  3BP8 A;  1U6Z A;  3E9L A;  3T7Z A;  5JLF A;  1ILY A;  3F2K A;  3BEX A;  3K9K A;  4ILJ A;  4H0V B;  5E84 A;  5AQL A;  4H0P A;  4FWS A;  2HF4 A;  2FF6 A;  2P9U A;  4J8F A;  2P9S A;  2P9L A;  5MLC Q;  5AR0 A;  4IDH A;  3RSE A;  5EX5 A;  2HBJ A;  5AZI A;  4BR0 A;  3VMF B;  3MWP A;  4K41 A;  3VF2 A;  4A61 A;  1VQ5 N;  3O9S A;  1RFQ A;  2NRT A;  4BGA A;  2CH6 A;  5M1F A;  2P9U B;  2YX6 A;  4A5B A;  4JKB A;  4GV3 A;  3O08 A;  3HRG A;  3D2E A;  5AZI B;  4ILH A;  3C6H A;  1VAZ A;  3S41 A;  5C0Y A;  3PIP L;  4IWV A;  4WQ4 A;  2BTF A;  3D2F A;  3M6G A;  1TUY A;  3I33 A;  5GAE P;  3BUZ B;  3CI5 A;  1GLE G;  3D2E B;  4HTL A;  1W2B M;  3UKU B;  3QB0 A;  3HBT A;  3FZF A;  3EKS A;  4YDU C;  5ELZ A;  3SMS A;  4GY2 B;  3WXJ A;  4GV6 A;  4BRC A;  3O9Q A;  3R3L A;  2NLX A;  3OBY A;  4BGB A;  2GTD A;  3AGR A;  3FLC O;  2F7T A;  1BA0 A;  2P9I B;  3TTF A;  4JKG B;  2J4R A;  4PHT X;  3CCQ N;  2Q1N A;  3MN9 A;  5AQH A;  3SMP A;  2OAN A;  3G25 A;  2V51 B;  3SJH A;  3O1W A;  4OPH A;  4FWO A;  1U2V B;  1YIT N;  5AQN A;  3C65 A;  2Q0U A;  4BG9 A;  3I8B A;  1W97 L;  3SK3 A;  3U4L A;  1HKC A;  2QW9 A;  1KD1 O;  1RGI A;  3VEY A;  4U67 L;  1Y64 A;  4FWL A;  3T69 A;  3VTH A;  3CC4 N;  1KC8 O;  1NMD A;  3F5T A;  3QBX A;  3FZH A;  2QTD A;  5AQY A;  3FFK B;  2VGN A;  4BRG A;  1HPM A;  2W41 A;  3A5L C;  1KAZ A;  3MWT A;  1YAG A;  2F9W A;  4F9O A;  1T6D A;  1P8Z A;  2I7N A;  3LDQ A;  3CC2 N;  1X3M A;  3IDH A;  4NO7 A;  4NB4 A;  1ESV A;  1QQN A;  2H3G X;  3R6M A;  3CF5 L;  1K8A O;  2GX9 A;  1YIJ N;  3D6R A;  5FPD A;  2FSJ A;  3M3Z A;  4KH5 A;  5BRE A;  4EIA A;  5I9E B;  5JMV A;  3FE1 A;  3DWL A;  4H5N A;  4QS8 A;  2YJF A;  1YF5 L;  5KQD A;  5DM6 L;  2PFU A;  3TSQ A;  4FWM A;  4BRI A;  3Q7B A;  3G6E N;  5JVH L;  1NGA A;  3H3O B;  4IZ9 A;  4BRM A;  3CCJ N;  1Q86 O;  3VEZ A;  3GDQ A;  5EOY A;  1S3X A;  3HM8 A;  4A59 A;  3ZEU A;  3CME N;  1MWK A;  1GLA G;  3I55 N;  5AQS A;  4H0T B;  4EHU A;  5ADX H;  1MDU B;  3ZET A;  4BC4 A;  4WFA L;  1KAY A;  3MN5 A;  4B1W B;  2ZJP L;  3ZEU B;  5KPZ A;  1VQ4 N;  2P9P B;  4WF9 L;  3GBT A;  2EWS A;  4IJN A;  4XEI A;  2V7Z A;  2Q31 A;  1Q81 O;  3ENB A;  4JK7 A;  1NGE A;  4BRK A;  5EY4 A;  1VQ7 N;  2DPN A;  4KH4 A;  4YOT A;  3OW2 M;  3AY9 A;  3P31 A;  1GLB G;  2ZWH A;  5AZJ A;  5LY3 A;  4QS9 A;  1ZBS A;  1NM1 A;  3ENH A;  3VEN A;  1VQL N;  2KLA A;  2QEX N;  4YOY A;  1ZXO A;  3MDQ A;  3CCM N;  5AZJ B;  2AA4 A;  3F9M A;  3O8M A;  3GE1 A;  4I6M B;  3CPW M;  1G99 A;  4IEE A;  3I56 N;  2A42 A;  3KWG A;  3RVC A;  2HOE A;  1ATS A;  1KAX A;  3MK6 A;  3FGU A;  1O13 A;  3O5B A;  3W0L A;  2E1Z A;  3IUC A;  5BRH A;  4BVP A;  2FF3 B;  2BH1 A;  2E8A A;  3L4Q A;  3LDP A;  4BQL A;  3WQT A;  2WUS A;  3CCU N;  3A5M C;  4H0Y B;  1H1V A;  1GLJ O;  4GNI A;  4FWN A;  4RTF D;  4WFN L;  3EKU A;  2QA4 N;  4CI6 A;  3CJ1 A;  3AAQ A;  3LDO A;  4O8K A;  2A3Z A;  3P38 A;  3VEX A;  5BPM A;  1XQS C;  4MDA A;  3O9U A;  4JD2 A;  2IIR A;  4L3Q A;  4YOV A;  4G9Z A;  3O4W A;  1P90 A;  3WQU A;  4U7B A;  4ILG B;  4NLC A;  3QDK A;  2D0P A;  1Z05 A;  4JN4 A;  3WXM B;  4A2A A;  4JD2 B;  4Y0W A;  4DHY A;  1XC3 A;  4B1Z A;  5CE3 A;  5JVG L;  5C2F A;  3LM9 A;  3CXC M;  1WUA A;  3R8E A;  4BVO A;  1EO1 A;  3UKU A;  5FPN A;  3HSC A;  3VES A;  3MCA B;  4CZJ A;  1E4F T;  4IFE A;  4IXC A;  1RDU A;  2NRR A;  2YHW A;  5TKW A;  3CQX A;  4PL8 A;  3ATU A;  3W3D A;  5C12 A;  1HKG A;  4H0O A;  4A5A A;  5AFU A;  5HOO A;  1GLF O;  1D4X A;  2P9I A;  3OBW A;  4JKG A;  4CZM A;  5AQT A;  3SLC A;  2ASP A;  1RDW X;  2W40 A;  2FLO A;  2WC9 A;  4DKW A;  4CZF A;  3CET A;  1U2V A;  4MO4 A;  2VCP A;  4BRD A;  4KH6 A;  4ISG A;  4WQ5 A;  4PL7 A;  2ZJQ L;  3CPE A;  1NGD A;  1V4T A;  2QXL A;  3UE5 A;  3QFP A;  4R79 A;  5EVZ A;  5AQJ A;  2PBD A;  5C2D A;  2QM1 A;  2Q97 A;  1SAZ A;  2IVO A;  4OPA A;  3A0I X;  4MDB A;  5C10 A;  4E1J A;  2ASO A;  3R9P A;  3LDN A;  4FPB A;  2KKZ A;  5E26 A;  3DLL L;  3MN6 A;  4B1U B;  4BRA A;  3EL2 A;  4H5V A;  3AGK A;  3EN9 A;  3VEV A;  2I7P A;  3AAR A;  2YHY A;  3MMV A;  3PLA A;  1XUP O;  3G4S N;  3HI0 A;  4BRN A;  1IJJ A;  3OHR A;  1Q18 A;  2RE2 A;  3IKM A;  1NGJ A;  1CZA N;  5BPN A;  4GVE A;  4BRH A;  2NRZ A;  2E2P A;  3L0Q A;  1BG3 A;  2A40 A;  3CER A;  4H0X B;  5AQG A;  4RWT A;  2NRX A;  4JHD A;  3UB5 A;  2FSK A;  3MX2 A;  4JK8 A;  4JKA A;  4QS7 A;  5AQM A;  4A57 A;  4IEI A;  2WBN A;  3U9Z A;  1VQN N;  4JKH A;  3WEE B;  4CD1 A;  4JHD B;  2D0O A;  4M63 C;  4EHT A;  4B1X B;  1KQS M;  4IOA L;  1NGH A;  2HBM A;  1NLV A;  2YCH A;  3L6Q A;  5KQ8 A;  5GIO A;  3KWI A;  4KBO A;  1HLU A;  3DXK A;  2E88 A;  1YXQ A;  3R1X A;  4K25 A;  2E2O A;  4IOX A;  4MLE A;  4WCE L;  4BR7 A;  5BRF A;  4K42 A;  1VQM N;  4MO5 A;  1YJ9 N;  5GAH P;  2GEM A;  4CZK A;  2P9P A;  1E4G T;  4FL9 A;  5AQI A;  3BF3 A;  1JCF A;  4BRO A;  3DXK B;  4B1V A;  3HOS A;  3U9D A;  3CJC A;  5TKY A;  2Q2R A;  3QIC A;  5AQK A;  5BRD A;  1QQO A;  1M90 O;  5AQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...