4BRMA

Sulfur sad phasing of the legionella pneumophila ntpdase1 - crystal form iii (closed) in complex with sulfate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
359
structure length
359
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 115
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brmA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brmA02
2NZTA 5AQQA 4CZFA 4MO4A 1TYQB 4BG9A 3DWLA 3QB0A 3W0LA 5FPDA 3D2FB 4DQ8A 1X9JA 4B1ZA 3EN9A 5BPLA 1LOTB 3VETA 5AQOA 4XH4A 1U2VB 3BF3A 5AFUH 4B1XB 5AZIA 4A2AA 3ZETB 5BN8A 2E2OA 1MWKA 2GWKA 3DXKB 1C0FA 4HWIA 4EFHA 3S41A 3GOIA 4QS7A 2YJFA 2P9PA 3VGKA 4MO5A 3MCPA 3CI5A 3H3NO 1NGBA 4H0TB 4PL7A 3I33A 4FL9A 2D0OA 4DHYA 3QBXA 4I6MA 2ASPA 3A5LC 2P9KA 3ULEB 5AQTA 2NLXA 2A40A 3D2EA 4CZLA 3UKRB 3UB5A 3O5BA 1NM1A 4CD3A 2Q31A 3JXUA 4B1VA 4CD1A 4FWRA 2DPNA 2YI1A 3VF4A 3D7EO 4BR4A 1QQNA 4BRCA 5KPZA 1NGAA 3W3DA 4BVPA 4FSVA 1ESVA 3UKUB 3VEOA 1H1VA 1ZBSA 3A8YA 3VEVA 4WQ4A 2QWLA 2YJEA 1GLLO 5KQ8A 1HUXA 2YCHA 4FWSA 2CGKA 1GLJO 3DXKA 2ZGYA 3IUCA 4BRKA 3O80A 5AQYA 2F9WA 3H1VX 2I7NA 1LCUA 3U9ZA 2YHYA 1YVNA 4JN4A 4FPBA 3CERA 1NBWA 1E4GT 4M63C 2AA4A 1SQKA 2HMPA 5FPEA 4H5RA 4BRGA 3HSCA 4BRAA 2ZGZA 4BRDA 2Q97A 3AAQA 2P9SA 4XEIA 2IVPA 1HKGA 1Q18A 1BU6O 3HI0A 4K42A 4L3QA 4BR2A 4BR0A 2HF3A 3MK6A 2E88A 3C7NA 3EL2A 3IDHA 5AQSA 2QWMA 5I9EB 2AP1A 1ATRA 1R59O 2WUSA 4B9QA 2E1YA 4FWPA 2ASMA 2IVNA 4FWOA 3VPZA 3VEYA 2A41A 3J8AA 1WOQA 3FLCO 2P9NA 3H45C 4FWKA 1JCFA 3GG4A 1V4TA 2P9PB 1HKCA 2VCPA 3B8AX 3DAWA 5AQNA 3F9MA 1V4SA 4WYBA 1YAGA 4BRHA 5JICA 3IMXA 3ATVA 3EKSA 4I6MB 3O1BA 4JNEA 3WXKA 3EZWA 4EHTA 4FO0A 4IJAA 3D2EB 4WQ5A 2P9UA 4EHUA 3SMSA 4BQZA 1J6ZA 3HBTA 2NRHA 3HTVA 3KHYA 4BQLA 4ISGA 1BO5O 2H3GX 3CIPA 3FZKA 5BRHA 4BGAA 3SK3A 4FWQA 1BDGA 3DXMA 5AR0A 4A62A 2CH5A 3KVGA 1Y64A 3VERA 3LDQA 3M1FA 2Q0UA 2VYPA 4BC2A 5AQIA 3WEEA 1T44A 1NGCA 4IWVA 2D1KA 2YHXA 3EO3A 1XQSC 4FOEA 4Z94A 3WQTA 1BA0A 1MWMA 3MN9A 1Z6RA 3CJ9A 3MMVA 3ID8A 1NWKA 4PKIA 5KQDA 3ATUA 4YDUA 3WXIA 3AAPA 4WQ5C 1QQOA 3LM2A 4H0XB 3WXLA 2PAVA 1KXPA 1GLFO 3FFKB 4BC3A 1DGKN 2V7ZA 4CZGA 3O6WA 4JAXA 1BA1A 4BRMA 3VESA 5AQPA 2P9SB 1C0GA 2I7PA 1X3MA 3ENOA 2GUPA 3H1QA 5CE3A 2IIRA 1NGFA 1RDWX 1U6ZA 1HJOA 2HOEA 2Q2RA 4A2BA 4BC4A 4EAHD 1JCGA 2A6AA 5AQXA 3C7NB 3H6EA 4CI6A 5F2RA 4EIAA 4FWNA 4H5NA 2CH6A 3L0QA 5ADXH 4FWLA 1T6CA 3CJAA 3VF6A 3QDKA 1CZAN 2FSJA 3M3ZA 2P9NB 3G25A 5EY4A 4IZ9A 1NGHA 4BVOA 3TPQA 3LDNA 2GTDA 2E20A 4YDUC 5AQZA 2E2QA 3DJCA 3L4IA 4H0YB 1GLCG 1HKBA 4JD2A 3FR0A 3UE5A 1P8ZA 1Z05A 2P9UB 2FSNA 2ITMA 4CZMA 4O8KA 2V52B 1YUWA 5AQRA 3CQYA 4CZJA 3GBTA 5BR9A 3JS6A 2D4WA 4A61A 1G99A 4NB4A 3FZLA 1NGJA 2ASOA 3FE1A 3AY9A 3C0BA 3DXMB 3U4LA 3VOVA 1JCEA 1DEJA 4GY2B 4HTLA 1XUPO 3LDPA 5JLHA 5BPMA 4WQ4C 2QWOA 3ZEUB 3WQUA 4MLEA 4F9OA 3WEEB 4IXCA 4CBXA 2FF6A 1BOTO 4NO7A 3SJHA 5BN9A 3VEWA 5ADXA 2P9IB 1HX1A 3CHWA 5E84A 1RFQA 1ATNA 4M7XA 2A42A 1QZ5A 4PKGA 3RSEA 3SLCA 2QWQA 5EVZA 2YHWA 4K43A 2FF3B 1XC3A 5KPTA 2GELA 2UYTA 3OHRA 5EOYA 4M7YA 4C23A 2BUPA 3I8BA 2E2PA 3CQXA 1NGEA 3HM8A 5LY3A 5BPNA 3ZX2A 4CZIA 4CBWA 4FOIA 5BRDA 5AZJA 3H46O 3VGMA 3R8EA 4IO8A 3GDQA 4B1YB 1YXQA 4BREA 1BG3A 4BR5A 2D0PA 5AQVA 5TKYA 2BTFA 4H5WA 1OKJA 2P9LA 3BF1A 3IFRA 4CBUA 1NMDA 4GNIA 1MA9B 3A0IX 2F9TA 3ZEUA 4IJNA 1HPMA 4BRNA 3VEZA 4JD2B 1IJJA 2P9IA 3LDOA 2CGLA 3A5NC 2A3ZA 4AM7A 4O5FA 3QICA 2E8AA 1TUYA 1DKGD 3O08A 4BRIA 3O8MA 2QXLA 2OANA 4CZEA 5AQKA 4RWTA 2W41A 2FLOA 5AQUA 3M6GA 5AQWA 1GLDG 3U9DA 4BRPA 3KZBA 2E1ZA 2Q1NA 2QW9A 1GLAG 2W40A 4FPAA 4BR9A 2EWSA 1ZXOA 3QFUA 4ISEA 1RGIA 1TUUA 1NGIA 4CJ7A 5E26A 3O1WA 1S3XA 3H3OB 3FZMA 5B8HA 2QWRA 3FZFA 4FWMA 4ISFA 4MLHA 1K8KA 2VWBA 2HF4A 3LM9A 3MN7A 2V51B 4BC5A 1MDUB 4B1UB 4DCHA 3CJCA 3RSEB 1KAXA 1NGDA 4BRQA 5AQFA 2V7YA 3AARA 4CZKA 3FGUA 4H03B 1KAZA 4H0VB 1X3NA 4K41A 4Y0WA 1QZ6A 4J8FA 3U8XA 3ENHA 3VENA 2GWJA 4XH5A 1TYQA 5AQMA 4BR7A 5JLFA 3D2FA 5AZJB 3P4IA 1GLBG 2Q36A 1IG8A 3QBWA 1U2VA 3R9PA 2QM1A 4QS9A 5LJVA 5AFUA 3EKUA 5F1XA 3MDQA 3CJ7A 3MN6A 3QFPA 3ZETA 2P9LB 3HZ6A 1E4FT 3WXJA 4H0OA 1HLUA 4JHDB 3VEXA 5JMVA 5LJWA 3QMLA 3SMPA 4CZHA 4K25A 2E2NA 2GEMA 5ELZA 5EX5A 4E1JA 5BREA 4KBOA 1ZC6A 3ZX3A 4PKHA 2CGJA 5AQGA 2KHOA 1NLVA 1D4XA 1BWFO 4AM6A 1GLEG 3ULEA 5AQHA 5BRFA 1SAZA 2QWNA 5F0XA 3LDLA 1T6DA 3GE1A 1NGGA 3UKRA 4BG8A 1QHAA 4H5VA 1KAYA 2QWPA 4BGBA 3VGLA 2IVOA 3TU5A 5EXWA 1SZ2A 5FPNA 5AZIB 3R6MA 5FPMA 3BP8A 1EQYA 3GL1A 4BROA 2FXUA 4H0PA 4LC9B 4DB3A 4XH1A 5AQJA 3UKUA 4RCHA 3O4WA 3MN5A 1BUPA 4B1WB 1WUAA 3CETA 2ZWHA 3CJ1A 2J4RA 3A5MC 3L6QA 3CJBA 2FSKA 1K8KB 2P9KB 2A5XA 3WUHA 3BEXA 5AQLA 4H5TA 4JHDA 3VF2A 4BRLA 3LL3A 3WT0A 1QQMA 3BUZB 1S22A 4QS8A 3FZHA 4RTFD 5KPRA 1ATSA 3A5OC 2Q0RA 3ZX0A 4BRFA 4PL8A 2PBDA 2ZF5O
chains in the Genus database with same CATH superfamily
2HBMA 2NZTA 4BG9A 1SL0A 3AVAA 2UXCK 3V81A 3BF3A 4FJXA 3R3LA 3NAEA 4B1XB 1WAJA 2ITGA 2W6LA 3BY5A 3ZETB 4IOCL 1LWFA 3FFIA 1HR0K 3TAFA 4DG1A 1KLNA 2UU9K 4C8OA 4AHRA 3AA3A 3S41A 3GOIA 2WOMA 4QS7A 2HB5A 2KFNA 2P9PA 4MO5A 3MCPA 3KK3A 3ULDA 1VK0A 4CJQA 3DM2A 2D0OA 4CESA 2ASPA 3ULEB 2F8TA 2A40A 5DM7L 3J7ZO 4IFYA 3A2FA 4C8LA 1NM1A 4CD1A 4EZ6A 2YNFA 4ZHRA 3SNNA 2YI1A 4CIEA 3VF4A 2A1SA 1XC9A 4WFAL 3K57A 3ZSQA 3CCQN 1HNIA 2G8HA 4WFNL 3UKUB 4JI1K 2ZM6K 4Q0BA 3ZSXA 3AV9A 5HOOA 4CJTA 1QSYA 2YJEA 3DLKA 3WNFA 4CJFA 1GLJO 4CERA 4GMJB 2O4GA 5C10A 3ZSVA 3H1VX 3IKMA 1N32K 1LCUA 5C2DA 3KD1E 4EZ9A 4OGCA 4JN4A 1HYSA 3CERA 1NBWA 3PUFA 4J2DA 2HMPA 1X9WA 2HHHK 1RT6A 5FPEA 4LSLA 4JK9A 1J9AA 4WE1A 4AILC 2ZGZA 3TAPA 1X9MA 1N8RO 3VMFB 4XIUA 3C94A 1N5YA 4QCLA 4A5BA 4RW4A 1RT1A 3SQ4A 3KK2A 4DR1K 2QTDA 2HBKA 2AP1A 4AHSA 3VTIA 2IDOA 1VSFA 2OPSA 1C1AA 4DR5K 4DU4A 2WUSA 1Q82O 2IVNA 1KTQA 1WOQA 5J2MA 3RVCA 4JS4A 1W97L 4FLUA 5AQNA 1ASUA 5JICA 4F3TA 4YOYA 3ATVA 3EKSA 4I6MB 3O1BA 4LD0A 4AHUA 3CG7A 5LMNK 4IJAA 3D2EB 3SMSA 4E1MA 2OCEA 4CEQA 3RMDA 1TKZA 2Z1HA 3M8SA 1JLAA 4LF6K 2JWKA 4FWQA 3F5TA 5CY4A 5KRTA 3DRSA 2CH5A 1IKWA 1K73O 3DI6A 3J7AP 4IO9L 4BE0A 1QSSA 3OJUA 3WEEA 1NGCA 1VQ5N 1NJXA 4FOEA 3O9QA 1TK0A 4HUGA 1NWKA 5KQDA 2YHAA 4HUEA 1N33K 3WXLA 4H0XB 3HPOA 1KXPA 4WFBL 2XO7A 1E3MA 1QE1A 1ZBLA 2DFEA 2E6LA 4BRMA 4FJ7A 3VESA 1FXXA 3KIOA 2OYQA 5CE3A 2HOEA 2A6AA 4DR2K 3EE9A 4E7JA 3C7NB 3H6EA 3I0SA 3WNGA 4LF9K 4Z4FA 4EIAA 4H5NA 2NUBA 5HBMA 1SL2A 2NNWA 3VF6A 2P51A 3THYB 4NCGA 2G8IA 1CZAN 2FSJA 3M3ZA 2P9NB 2G8WA 3RR8A 5EY4A 4DQPA 4IZ9A 1RTHA 4YDUC 2HW3A 1VAZA 4E3SA 4IOAL 4W5NA 1HQUA 2O8DB 1GLCG 3S9HA 3FR0A 3THVA 1Q9YA 1P8ZA 4CJVA 1HRHA 2FSNA 1YUWA 3S3OA 4JI3K 3DLGA 4A61A 4NB4A 3OS0A 3B6PA 1CXQA 5DK5A 4F3OA 4I2PA 1ZBUA 4H4OA 4AHCA 5JLHA 2GUIA 5BPMA 3TAQA 3WQUA 1S6QA 3SJHA 3SI6A 5E84A 3AVBA 4CFBA 3VTHA 1C6VA 2A42A 2OZMA 4PKGA 3RSEA 4DV2K 2QWQA 5EVZA 2YHWA 1W7AA 4CF2A 4ZTFA 3HT3A 2UXDK 1QHTA 2GELA 2YNIA 5GAGP 4PWDA 4I2QA 3ZSWA 1I94K 4A5AA 1NKBA 3E66A 2BUPA 3CQXA 1NGEA 1RDCA 3HM8A 5LY3A 4FOIA 4OJRA 4RW9A 5AZJA 3VGMA 5M1KA 4B1YB 3HVRA 3THWB 1VQ8N 4DTMA 4GW6A 3RRGA 4H5WA 4YOUA 3BF1A 4ELVA 3IFRA 3M8PA 1NMDA 2RN2A 2HHWA 5GINA 4FK0A 3DMJA 3ALYA 1RCHA 2FBXA 3PX4A 1IJJA 3HPGA 3SAFA 2CGLA 4OPAA 1ZYQA 2E8AA 1TUYA 2JWLA 1DKGD 3O08A 4HHTA 3O8MA 2WBNA 4CZEA 2W41A 2FLOA 4DR3K 1HNXK 4CK2A 3KZBA 4N47A 2Q1NA 1JLGA 4NYNA 3OBWA 1GLAG 4FPAA 1FKPA 1NK5A 3LALA 1XI1A 1ZXOA 3QIPA 4CGDA 3V9ZA 1NJZA 4B3MK 4DF8A 5GAEP 5E26A 1ASVA 2HVIA 5MLCQ 5KTQA 4WF9L 3S3NA 1SS6A 4JI5K 3SAGA 4ISFA 4MLHA 1QVFM 4IDKA 4KTZA 1IH7A 2IOCA 1MDUB 4B1UB 4DCHA 3HXMA 3C6HA 1RTDA 4BRQA 5AQFA 4CZKA 4CK1A 1P90A 4H0VB 3LWLA 5JVHL 1NK4A 4MFBA 1QZ6A 3AVGA 1RBUA 4J8FA 3AO3A 3ISNC 5CYMA 3VENA 4UQGA 3NCIA 2GWJA 1TYQA 3KKSA 1F21A 4M3XA 1U2VA 3VQ8A 2QM1A 5AFUA 1D9DA 3MDQA 2HHQA 4BDPA 4UY8O 4KH6A 2P9LB 5M1PA 1SL1A 2QK9A 4KO0A 4CGJA 4H0OA 3MWPA 3QMLA 3SMPA 2E2NA 1SUQA 4E1JA 3OYBA 3ZX3A 4PKHA 2CGJA 3KJVA 2KHOA 4RW8A 1NLVA 2WTUA 1BWFO 3TABA 4DFKA 5BRFA 4KB1A 4B9VA 1T6DA 3OW2M 2F7TA 3UKRA 3TTCA 2E6MA 4KKOA 2IVOA 3TU5A 3P5JA 1EX4A 5AZIB 1OVQA 2G8VA 4M42A 1RT5A 5FPMA 3PV8A 1EQYA 3GL1A 1VQLN 1RTJA 4DQSA 4RCHA 3O4WA 3U6FA 4ILGB 1L3UA 2ZWHA 5CR4A 2R7YA 3L6QA 4A59A 3NF6A 3EYZA 1W9HA 4DSIA 5HRPA 4B3OA 4YOWA 3D45A 5I42A 3PIPL 1ASWA 3LL3A 2OPRA 2UXBK 1S22A 3AA4A 3D0PA 1WSJA 3FZHA 1U49A 4FW2A 1NJYA 3A5OC 4BRFA 4G9ZA 4KREA 1QHAA 4ILJA 3DLEA 3VN5A 4MO4A 3QB0A 4B1ZA 3EN9A 1WSHA 5FDLA 3VETA 3OVNA 2XRIA 4DQRA 4IKFA 5AZIA 3T69A 4A2AA 2KZMA 5BN8A 3DXKB 1C0FA 4I9QA 2NRTA 5HP1A 4EFHA 1RT7A 4E7HA 2JGUA 4YOTA 5FRNA 2OPPA 2AJQA 4IDHA 4DLEA 5GAHP 3CMEN 4JS5A 1SKWA 2IC3A 4DTUA 1KVAA 4CF1A 4DHYA 3NDKA 4EP5A 4CEAA 4R79A 4LH4A 4CD3A 3JXUA 2RPIA 3OYLA 4CW7B 5J2NA 3L2UA 1U48A 4O4GA 3L2QA 1RDDA 4Y1CA 1NGAA 4PHTX 1A5XA 1WNSA 4FSVA 3H08A 1TL1A 3TTDA 3J7YP 3SJJA 3V6DA 3VEVA 4WQ4A 1TKXA 1L5UA 2O8CB 2QWLA 4DR7K 4O44A 2YCHA 3KK7A 4FWSA 3K5MA 3DXKA 4E0DA 3AVLA 4K8XA 1YT3A 4BRKA 3O80A 3SUNA 3CM5A 3U9ZA 4AHTA 3KWIA 2NRWA 1YVNA 5FROA 3SPZA 5C2FA 3KLGA 3KLFA 3RMCA 4H5RA 1WBBA 3HSCA 4CEOA 4GV9A 2JLEA 2Q97A 3JYTA 4FCYA 4FLYA 1VHXA 1HKGA 3C95A 4O8UA 4BR2A 1YTAA 2E88A 4K0KK 4O0IA 2QWMA 2ZQBA 5I9EB 2XY6A 1X9SA 1IBKK 2VQFK 4CHOA 2E1YA 3PO5A 4Z0UA 4JKBA 3VEYA 3J8AA 3AVKA 3P1GA 4CHNA 4W5OA 4KHQA 1JCFA 4MDAA 1K8AO 3MWTA 1V4TA 2P9PB 3B8AX 3DAWA 3F9MA 4CEFA 1V4SA 1N6QA 2F96A 4BRHA 3OYHA 4JKHA 3CCSN 3IMXA 1W2BM 3V9SA 3WXKA 3EZWA 4EHTA 4DFPA 4WQ5A 2P9UA 4OPKA 1S72N 1J6ZA 3HBTA 3KHYA 3NFAA 3AVFA 1NMNA 3IG1A 2UUBK 1UA0A 3PY8A 1BO5O 3HO1A 4Z4IA 3CIPA 1RBSA 1G15A 3MXMA 5BRHA 3LAMA 3CMAN 1U4BA 1LAVA 3AO2A 3KVGA 4LH5A 1Y64A 2D0BA 3M1FA 2IS3A 3RMBA 1VSEA 1Q86O 5KGWA 3LPTA 2YHXA 4IWVA 3EO3A 1XQSC 2FBVA 3ZT3A 3VA3A 3Q7CA 1BA0A 2B6AA 4KAZA 1MWMA 2IAJA 3MN9A 1Z6RA 3CD6N 3V1QA 2XY8A 4B08A 3SZ2A 3R1XA 3DOLA 3WXIA 3AAPA 4FW1A 1QQOA 4HVJA 1I39A 4DTSA 4PQUA 3ZT2A 4BC3A 2XHBA 4DFMA 2V7ZA 3MX2A 3EE8A 1D8YA 1BL3A 1RT3A 4FJKA 1VSHA 4O0JA 2I7PA 3L2VA 4DQIA 2GUPA 3H1QA 1U6ZA 2G8KA 4BC4A 4EAHD 3HM9A 3BDPA 4J2AA 3MEEA 4IOXA 1ILYA 5F2RA 4FWNA 1VSIA 2PZSA 4KH4A 4MQ3A 3CJAA 3HP6A 5J2QA 3CC2N 3QDKA 3SV4A 4IBNA 4KV8A 3G71N 3U3GA 4BVOA 3LDNA 2QKKA 4KI4A 2O8BB 3HL8A 5M1QA 1YI2N 1K6YA 1TKTA 2E2QA 2LSNA 4CJEA 1NK6A 3UE5A 4JD2A 3V9XA 3QEWA 4JRQA 3HJFA 4B3TK 1HYZA 2ZE2A 3SPYA 1JL1A 3MXJA 4O8KA 2V52B 5AQRA 3CQYA 3WXMB 3MXIA 1MU2A 3L8BA 4M3WA 3E9OA 5BR9A 2WC9A 3PIOL 1IV0A 1T3VA 3T19A 4GV3A 3SQ0A 1M1KO 4F2SA 3U4LA 3VOVA 2O8FA 1JCEA 3OBYA 3PLAA 2QXFA 4HTLA 3AVIA 4JK8A 1XUPO 3V1OA 3ZEUB 4F9OA 3WEEB 2IGIA 4NO7A 5BN9A 3VEWA 5ADXA 4HTUA 1YVUA 4CFCA 3CHWA 1XMQK 4M3UA 4NCAA 5FLXO 4QOZB 1QZ5A 2HHUA 4N41A 2O8BA 3SLCA 4KB0A 3F73A 1Q9XA 2FF3B 4DUYK 2ZJRL 2GV9A 3C65A 5KPTA 3LZJA 1FKOA 3OHRA 3AVCA 2E2PA 3VQPA 4KHSA 3SUOA 1KD1O 2KTQA 3TR8A 4X64K 3OS1A 3KD5E 4IO8A 1YXQA 4BREA 4BR5A 1IKVA 4B9UA 1JKHA 3CCLN 2D0PA 5AQVA 4AQYK 2P5GA 4JI4K 3OYDA 2BTFA 3ASMA 1OKJA 2YNHA 4MDBA 2HNZA 3ZCMA 1NOYA 2F9TA 3ZEUA 1VQMN 4H8KA 3K58A 1HPMA 4IG3A 1FW6A 3QINA 3NF9A 3LDOA 3AO1A 4Z4GA 3V4IA 1Q8IA 3KWGA 1O13A 4TSXA 2QXLA 3K5OA 3M8QA 5AQUA 3ZT4A 5E41A 2Y1IA 3CYMA 4BRPA 2E1ZA 4CEEA 2W40A 4BR9A 2EWSA 4JKDA 1NKEA 4OLBA 1XMOK 1S5JA 1RGIA 1TK8A 1S3XA 1T8EA 2BE2A 5HL7L 1JLBA 1NK8A 3BZCA 4FJJA 2VWBA 4BWJA 3TAGA 3MN7A 4BC5A 3RSEB 1ZBIA 5DM6L 4ID5A 1RNHA 2RF2A 4DFJA 1S1XA 3QEIA 4Y1DA 3VQ6A 3KKRA 4CFDA 4K41A 4CGFA 4CJLA 4CEDA 3U8XA 5M1FA 3ENHA 4FXDA 3AA5X 3ZSOA 4X66K 3DLRA 3M5RA 5JLFA 3D2FA 4DS5A 1KC8O 4GVMA 5AZJB 3P4IA 4KHNA 1GLBG 1IG8A 3HOTA 1JXBA 4JV5K 3CJ7A 3MN6A 2O4IA 4DR6K 1BIUA 3IRXA 3WXJA 3ZLJA 4YHHK 3P38A 1FK9A 3NVKA 3QIOA 4F2RA 2Z1GA 4DMNA 4AH9A 4DR4K 5C15A 3ENBA 1O1WA 4DTOA 4N76A 3TSUA 3VQEA 3QNOA 3ZSRA 1QSLA 1U47A 3SQ1A 2QKBA 1RT4A 2NRRA 1VQON 1NGGA 4BG8A 4H5VA 3ZT1A 4FJNA 4BGBA 5A2QO 4W5QA 4BDZA 1T03A 4CHPA 1J5EK 1RBTA 1L3VA 4JI8K 3NGZA 2OA8A 5C25A 4BROA 1EP4A 1NJWA 1WN7A 4LC9B 5HROA 4FM1A 4HUFA 4B1WB 1WUAA 3ZSZA 4DV1K 3THXA 3A5MC 4CIFA 3KLEA 1NU0A 2FSKA 5M1OA 1JLCA 4RG8A 2P9KB 4ELUA 4YNQA 5AQLA 2W6KA 4H5TA 1KVCA 5KGXA 3VF2A 1QQMA 3HP9A 4RTFD 4KFBA 4FLXA 2Q0RA 4PL8A 3E01A 4BWMA 4FM0A 5AQQA 2O8EB 1TYQB 1OH7A 2HHTA 2ZD1A 1X9JA 3DRRA 2OZSA 2PYLA 3IAYA 3K59A 4FJ9A 1U2VB 4DSFA 4M3ZA 1QS4A 3O9RA 3O9TA 2E2OA 1MWKA 3AO5A 4KRFA 3OYGA 3LZIA 4IEIA 4JI7K 1OH5A 4KHYA 2HSTA 3VGKA 2KLAA 3CI5A 4H0TB 4F4KA 1HJRA 3I33A 2BDPA 2P9KA 5AQTA 3MCAB 2NLXA 1B9FA 3SUPA 2UUCK 3UKRB 3SYZA 3O5BA 5KI6A 2Q31A 1NK9A 1LWCA 3ITHA 4FWRA 3T1YK 4BRCA 3D7EO 4BR4A 1QQNA 3CC7N 1CLQA 3MAQA 4O55A 4BE1A 3W3DA 3G6EN 4BVPA 5SZTA 1YJ9N 1ESVA 3CPEA 2O8EA 1VQNN 1D5AA 4K8ZA 1VSLA 3KLHA 3HRGA 3QO9A 2CGKA 2Z1JA 4BE2A 4LFCK 1BIZA 2I7NA 2OTLN 1EO1A 3F9KA 1VSDA 3OY9A 4DF4A 4FPBA 4OX9K 1E4GT 1BGXT 3AGKA 2AA4A 1SQKA 1ZBFA 4BRGA 1RTIA 3J81O 1J53A 4BRAA 2HMIA 4BRDA 4CJ5A 4U7BA 2P9SA 4AF1A 1B92A 2IVPA 1Q18A 1BCMA 1BU6O 4L3QA 2HF3A 4OGEA 1I3AA 3EL2A 5AQSA 4M3TA 3VQBA 1ATRA 1R59O 3OA9A 4FWPA 5LMUK 1YJWN 1BQMA 4OKJA 4FWKA 1JXEA 3GG4A 2YV0X 3B6OA 3K2PA 3CPWM 1YF5L 3CXCM 5KRSA 4WYBA 4DLGA 3ZYYX 4OKEA 5IWAK 1JLFA 4FO0A 2E4LA 4EHUA 4L8RB 4JYAK 5CZ1A 4ISGA 2A1RA 4OKKA 1YTUA 1WSEA 4KHWA 3FZKA 1S9GA 3OYMA 4CF9A 4BGAA 3KK1A 3SK3A 1BDGA 3DXMA 3CFOA 4CGGA 2DFHA 3TSQA 2DFFA 3CCRN 1R0AA 3SAHA 4YFUA 4ID1A 4PA1A 4JLHA 3K5NA 3JSMA 1QVGM 2D1KA 4DV5K 1WLJA 1QQCA 3WQTA 4YORA 3AVHA 1HPZA 3CJ9A 3ID8A 4PKIA 3ATUA 4WQ5C 3LM2A 4FZXC 4FK4A 2KW4A 1HMVA 3QNNA 1GLFO 3FFKB 4CECA 1DGKN 4CVNE 4LFBK 1BA1A 4QAGA 5AQPA 3QESA 1C0GA 1N36K 1GOCA 1RDWX 4FLTA 2Q2RA 1JCGA 3QLHA 1Q81O 1WAFA 3VQQA 5C42A 5HRSA 2X6SA 4CI6A 1OH8A 1EWQA 2BH1A 5ADXH 3L2WA 1RDBA 1T6CA 1JJ2M 4HCCA 1J54A 3V1RA 1Z26A 4JEPA 1EKEA 3LAKA 3NH0A 1A5WA 3G25A 1TL3A 2E20A 5AQZA 3DJCA 3OYAA 3L4IA 4FJIA 3ZT0A 4H0YB 4JKCA 3QEXA 3LWMA 5JVGL 2P9UB 4GVEA 4F8RA 4M3RA 2P1JA 4CZJA 4CGIA 3JS6A 3DOKA 1G99A 4E7LA 4CHQA 3C0BA 4JKGA 4N5SA 3CCUN 2KKZA 1NG9A 3OYJA 1EETA 3M8RA 3PX6A 5CZ2A 4C8MA 4GV6A 4JKEA 1TGOA 4IXCA 4CBXA 2FF6A 1RILA 2KQ2A 1IO2A 3WNHA 1ATNA 2YNGA 4CJPA 1J5OA 2X74A 4I7FA 4G1QA 4B9LA 3E9LA 4JK7A 3VQCA 5C0YA 4DUZK 4K43A 3RMAA 3OYEA 1RT2A 5EOYA 5HRRA 4C23A 3F2KA 3T1HK 3I8BA 2NRVA 3MEDA 3WNEA 1C1BA 4DU1A 4CBWA 3GDQA 1TV6A 2HHSA 1S1VA 2UUAK 5TKYA 4OPJA 1HQEA 4CBUA 4GNIA 1MA9B 4O5BA 1BI4A 2PFUA 3DLHA 2ATQA 2E5LK 4JD2B 3LP0A 5AJ3K 3A5NC 3BZKA 4AM7A 4O5FA 4CJRA 3QICA 1C0UA 1U45A 1UAXA 2OANA 1BQNA 2WFBA 4RWTA 1T7PA 5AQWA 3U9DA 3AA2A 2QW9A 3K9JA 1L3SA 2QI2A 4DTJA 5SWMA 2G8FA 4DWIA 3T3FA 4BDYA 2O8FB 1D9FA 4ELTA 1BCOA 3EZ5A 3QFUA 3P31A 4B3SK 4RW6A 4Z4HA 1TUUA 1NGIA 4LF8K 1UA1A 4ICLA 3NGIA 1VSKA 3I8DA 4FWMA 1OH6A 1K8KA 3LM9A 1BHLA 2V51B 4WCEL 2YKNA 1KAXA 3LP3A 2D0AA 4DSEA 4B3RK 2EHGA 2V7YA 3SBTA 4H03B 1KAZA 5BR8K 2I5JA 3OYCA 4IFEA 4DU3A 2FBTA 3VQ7A 2B4JA 3QBWA 3R9PA 5LJVA 1CZBA 4B9NA 3VA0A 3OYKA 3I0RA 3QFPA 3PO4A 3C6TA 3ZETA 3HZ6A 1E4FT 1NOZA 3AVNA 3MECA 1XNRK 1HLUA 3L3VA 4JHDB 3VEXA 5LJWA 4Q5VA 4K25A 5ELZA 5EX5A 5BREA 4DV3K 1ZC6A 4M45A 1D4XA 5TKWA 3LDSA 1S1TA 3RRHA 1GLEG 3ULEA 5AQHA 5GIPA 3NHGA 1SAZA 2QWNA 3AGRA 5F0XA 3GE1A 4GKJK 2QWPA 2F8SA 3EY1A 5M1NA 3VGLA 4DTPA 2B5JA 5EXWA 3R6MA 3BP8A 2ETJA 3CFPA 2KFZA 1VQ7N 2FXUA 4H0PA 3NE6A 3BGRA 4DB3A 4XH1A 5AQJA 3UKUA 3I55N 4DS4A 3NMUA 1VQ9N 2HNYA 1BUPA 1VQ4N 4CF8A 5DMRA 2PYJA 1B9DA 3TANA 1WSFA 1WBDA 4CJWA 2D5RA 3O9SA 3VQ9A 2X78A 1HNVA 4PY5A 2A5XA 3WUHA 3BEXA 4JHDA 3LP1A 3VQ5A 3CCJN 4BRLA 4CK3A 3V9WA 4QS8A 1VQ6N 5KPRA 4FJGA 4YOXA 2FBYA 3ZX0A 2PBDA 4CZFA 1UOCA 3TI0A 3DWLA 5FPDA 3W0LA 3D2FB 2HVHA 1U04A 1JLQA 4DQ8A 5BPLA 1LOTB 3Q7BA 5AQOA 4XH4A 5AFUH 3T1AA 3O4QA 4KTWA 5H1SQ 4JI0K 1RBVA 1Z25A 2GWKA 3CF5L 4DTNA 3HSTB 4HWIA 1WB9A 3CCMN 2Q3SA 3JAMO 4IG0A 2YJFA 1JLEA 2DTUA 1KLMA 3H3NO 2W42A 4FJ8A 1NGBA 4PL7A 4FL9A 3QBXA 4I6MA 1M90O 3A5LC 3DYAA 1VRTA 2P5OA 3D2EA 3AO4A 4CZLA 3O3FA 1LW2A 3UB5A 4I9LA 4B1VA 2DPNA 1SV5A 4CHYA 5KPZA 4H4MA 4CFAA 5LL6Z 4J2EA 2VGMA 1DT9A 4KTQA 3VEOA 1H1VA 1ZBSA 3A8YA 4FM2A 3PX0A 1HNZK 3G4SN 5I3UA 1NK7A 3P39A 5IT9O 1GLLO 3HPHA 5KQ8A 3THXB 1HUXA 1DTQA 3OYFA 1L3TA 1IKXA 1C1CA 3PSIA 2ZGYA 3IUCA 5AQYA 2F9WA 4DSJA 1HYVA 4M3YA 3RWUA 4BACA 3O9UA 2KZZA 2YHYA 2D0CA 4KHPK 4CGHA 4M63C 3LP2A 3EEQA 4CCHA 2VWKA 1RDUA 3DRPA 4IEEA 4NLCA 1TAQA 3AAQA 4XEIA 3O4NA 3HI0A 4K42A 1YITN 3L4QA 2G8UA 5K14A 4BR0A 3MK6A 3IDHA 3C7NA 3U3YA 3K5LA 3NF8A 3KTQA 4B9QA 2ASMA 4FWOA 3VPZA 3SUQA 1EWRA 4B8CA 3THYA 2A41A 3TAMA 1NKCA 3FLCO 4FJLA 3VQ4A 4AHVA 2P9NA 3H45C 2YKMA 1HKCA 2VCPA 4LF5K 2GBZA 4N56A 2VQEK 1YAGA 3CCEN 1QTMA 4Z4EA 1VQKN 2O8DA 4JNEA 3NF7A 4BQZA 3HK2A 1TKDA 3HVTA 2NRHA 2RE2A 3HTVA 4BQLA 1VRUA 1XNQK 1BISA 1XHXA 4YY3K 3P83D 2HHVA 4KPYA 5JS1A 4DQQA 2HBLA 2H3GX 1IG9A 2NRXA 1NNEA 5AR0A 3TAEA 4A62A 3E9PA 4J2BA 3TSPA 3VERA 3LDQA 4CHZA 3SCXA 3MX5A 2Q0UA 4CF0A 2VYPA 4JKAA 4BC2A 4FZYA 5AQIA 4CJKA 3E1YA 1T44A 2HNDA 2VG7A 4KH5A 2HBJA 4E1NA 4Z94A 3MMVA 1DTTA 2RKIA 4YDUA 2PAVA 3AVMA 4KHUA 1RDAA 1WSIA 4CEZA 4CZGA 4CJ3A 3O6WA 1S6PA 4NYFA 4JAXA 1YIJN 1OVYA 2P9SB 4FJMA 1VQPN 1X3MA 3ENOA 1IBLK 3OTOK 2IIRA 1FJGK 1LWEA 1NGFA 2VGNA 1HJOA 4A2BA 1X1PA 1S9EA 5AQXA 5EU7A 4OVLA 4FJHA 1KSPA 2CH6A 3THWA 3L0QA 4FWLA 1T05A 1KQSM 1Q7YO 2EX3A 4FVMA 4B9TA 1NGHA 3TPQA 2GTDA 3O3HA 3IS9A 3LPUA 4GKKK 2F4VK 3CM6A 4KI6A 1HKBA 1TVRA 4FLWA 2QEXN 1KFDA 1Z05A 4NLBA 1REVA 2ITMA 4CZMA 5C12A 3C6AA 5CYQA 1S1WA 3AVJA 2ZJQL 4A57A 3GBTA 4RW7A 5GADP 2D4WA 4YOVA 3VQDA 3D6RA 3FZLA 4JI6K 1NGJA 2ASOA 3FE1A 1TAUA 3AY9A 3DXMB 2VG5A 3CFRA 1VSMA 1DEJA 4GY2B 2RHKA 3LDPA 4WQ4C 2QWOA 4MLEA 4DTRA 4E19A 1ZBHA 1BOTO 4JKFA 4V19S 2QA4N 4R5PA 3QERA 2X6NA 2P9IB 1HX1A 1VSJA 1RFQA 1DLOA 3RTVA 4M7XA 1N34K 1LAWA 5C24A 2YHBA 2GX9A 4CE9A 4CJ4A 1XC3A 5J1EA 3CQ8A 2Z1IA 2UYTA 3VQAA 4E89A 5J2PA 1CZ9A 4DV7K 4EP4A 4IFVA 1C0MA 4M7YA 4CJUA 1SKSA 5T7BA 3C6UA 5BPNA 3ZX2A 4CZIA 5BRDA 3NH2A 5D3GA 3H46O 4JRPA 3R8EA 1BG3A 1K9MO 3NVMA 2P9LA 1UWBA 3OYIA 2PY5A 4C1NI 3A0IX 4JI2K 4IJNA 4BRNA 4LY7A 3S3MA 2DY4A 3TWHA 3VEZA 2P9IA 1JL2A 1EXQA 1CXUA 3N4PA 2A3ZA 4FK2A 1Y97A 3ID6A 3HYFA 4C1NK 3SV3A 3DLBA 2OTJN 1TK5A 3TTFA 2XY5A 4BRIA 3SQ2A 5AQKA 3OJSA 3M6GA 3G10A 4NCBA 1GLDG 4DKWA 3L2RA 4DSKA 3QEPA 3CCVN 4JKGB 4LF7K 3QETA 3ZSYA 3I56N 1IKYA 4DV6K 1SKRA 4ISEA 1A5VA 4E7IA 1LV5A 4CJ7A 3RR7A 1W0HA 3MEGA 3DLLL 2XY7A 3O1WA 3H3OB 1XHZA 5FRMA 4Z4CA 4DSLA 1YHQN 1KRPA 3FZMA 5B8HA 2QWRA 3FZFA 2Y1JA 4CJSA 2HF4A 4NXNK 1S1UA 3CC4N 3CJCA 4C8NA 3LANA 3QEVA 3KLIA 4FLVA 3TARA 4FJ5A 3N4QA 1NGDA 3OYNA 4ILHA 4LSNA 4W5RA 3AARA 3FGUA 5CHIA 1X3NA 4BY9C 4Y0WA 4M41A 2HHXA 2NRZA 2OPQA 4XH5A 5AQMA 4BR7A 3J80O 2Q36A 4CEBA 1KFSA 3OS2A 4W5TA 4QS9A 4B9SA 3EKUA 5F1XA 4FLZA 4ZTJA 4LFAK 3K9KA 1XWLA 1BI4B 2BGGA 3NGYA 4E7KA 4FZZA 5JS2A 5JMVA 5GIOA 4FVUA 3PSFA 1LW0A 4CIGA 4CZHA 3SBGA 2GEMA 4FYDA 4KBOA 1NK0A 4C8KA 5AQGA 4DV4K 1GOBA 4AM6A 1NJIO 3G0ZA 3HOSA 2FC0A 3LDLA 1WSGA 4OO1J 1KAYA 2VG6A 3L3UA 1RBRA 5HRNA 5FPNA 1SZ2A 3NBPA 4U67L 3NH1A 2ZJPL 4OPHA 4DTXA 3K0SA 3V9UA 4PUOA 4OLAA 3T7ZA 2O8CA 3MN5A 4B9MA 4X65K 1C0TA 3CETA 4NXMK 3CJ1A 2J4RA 3CJBA 4X62K 3UIQA 1K8KB 4LF4K 2YX6A 1ITGA 4DV0K 1YJNN 1KVBA 2WONA 3O3GA 1KCFA 5HLFA 3WT0A 1HNWK 3BUZB 4B8AB 1ATSA 2VWJA 2BANA 1GOAA 1IBMK 4HCBA 2ZF5O
chains in the Genus database with same CATH topology
2HBMA 2NZTA 5AQQA 4CZFA 4MO4A 1TYQB 4BG9A 3DWLA 3QB0A 3W0LA 5FPDA 3D2FB 4DQ8A 1X9JA 4B1ZA 3EN9A 5BPLA 1LOTB 3Q7BA 5AQOA 3VETA 4XH4A 1U2VB 3BF3A 3R3LA 5AFUH 4B1XB 5AZIA 3T69A 5H1SQ 3O9RA 3O9TA 4A2AA 4IOCL 3ZETB 5BN8A 2E2OA 1MWKA 2GWKA 3DXKB 1C0FA 3CF5L 4HWIA 2NRTA 4EFHA 3CCMN 3S41A 4IEIA 4YOTA 3GOIA 4QS7A 4IDHA 2YJFA 5GAHP 2HSTA 2P9PA 3VGKA 3CMEN 2KLAA 4MO5A 3MCPA 3CI5A 3H3NO 1NGBA 4H0TB 4PL7A 3I33A 4FL9A 2D0OA 4DHYA 3QBXA 4I6MA 2ASPA 3A5LC 2P9KA 3ULEB 5AQTA 1M90O 3MCAB 2NLXA 2A40A 3D2EA 4CZLA 4R79A 5DM7L 3J7ZO 3UKRB 3UB5A 3O5BA 1NM1A 4CD3A 2Q31A 3JXUA 4B1VA 4CD1A 4FWRA 2DPNA 2YI1A 3VF4A 3D7EO 4BR4A 1QQNA 4BRCA 5KPZA 3CC7N 4WFAL 1NGAA 3W3DA 3G6EN 4BVPA 3CCQN 4PHTX 4FSVA 1YJ9N 1ESVA 3CPEA 4WFNL 2VGMA 3TTDA 1DT9A 3UKUB 3VEOA 1H1VA 1ZBSA 3A8YA 3VEVA 4WQ4A 1VQNN 3G4SN 5HOOA 3P39A 2QWLA 2YJEA 1GLLO 5KQ8A 1HUXA 2YCHA 3KK7A 4FWSA 3HRGA 2CGKA 1GLJO 3DXKA 2ZGYA 3IUCA 5C10A 4BRKA 3O80A 5AQYA 2F9WA 3H1VX 3IKMA 2I7NA 2OTLN 1LCUA 3O9UA 1EO1A 3U9ZA 5C2DA 2YHYA 3KWIA 2NRWA 1YVNA 4JN4A 4FPBA 3CERA 1NBWA 1E4GT 5C2FA 3AGKA 4M63C 2AA4A 1SQKA 2HMPA 5FPEA 4H5RA 4BRGA 3HSCA 1RDUA 4JK9A 4GV9A 4BRAA 2ZGZA 4IEEA 4NLCA 4BRDA 2Q97A 3AAQA 1N8RO 3VMFB 2P9SA 4U7BA 4XEIA 4AF1A 2IVPA 1HKGA 1Q18A 1BU6O 3HI0A 4K42A 4L3QA 1YITN 4O8UA 4A5BA 4BR2A 3L4QA 4BR0A 2HF3A 3MK6A 2E88A 3C7NA 3EL2A 3IDHA 5AQSA 2QWMA 5I9EB 2QTDA 2HBKA 2AP1A 3VTIA 1ATRA 1R59O 2WUSA 3OA9A 2E1YA 4FWPA 4B9QA 2ASMA 2IVNA 4FWOA 3VPZA 4JKBA 3VEYA 1YJWN 2A41A 3J8AA 1WOQA 3FLCO 3RVCA 1W97L 2P9NA 3H45C 4FWKA 1JCFA 4MDAA 3GG4A 1K8AO 3MWTA 1V4TA 2P9PB 1HKCA 2VCPA 3B8AX 3DAWA 5AQNA 1YF5L 3CPWM 3F9MA 3CXCM 1V4SA 4WYBA 1YAGA 3CCEN 4BRHA 5JICA 4JKHA 3CCSN 4YOYA 3IMXA 3ATVA 1W2BM 1VQKN 3EKSA 4I6MB 3O1BA 4JNEA 3WXKA 3ZYYX 3EZWA 4EHTA 4FO0A 4IJAA 3D2EB 4WQ5A 2P9UA 1S72N 4EHUA 3SMSA 4BQZA 1J6ZA 3HBTA 2NRHA 2RE2A 3HTVA 3KHYA 4BQLA 4ISGA 1BO5O 2HBLA 2H3GX 3CIPA 3FZKA 5BRHA 4BGAA 2NRXA 2JWKA 4FWQA 3SK3A 3CMAN 1BDGA 3DXMA 5AR0A 3F5TA 4A62A 3E9PA 2CH5A 3KVGA 3TSQA 1Y64A 3TSPA 3VERA 3CCRN 3LDQA 1K73O 3MX5A 3M1FA 2Q0UA 4IO9L 2VYPA 4JKAA 4BC2A 3SAHA 5AQIA 1Q86O 3E1YA 3WEEA 1T44A 1NGCA 4IWVA 2D1KA 2YHXA 4KH5A 2HBJA 3EO3A 1XQSC 4FOEA 1VQ5N 4Z94A 3Q7CA 1BA0A 3O9QA 3WQTA 1MWMA 4YORA 3MN9A 1Z6RA 3CJ9A 3MMVA 3CD6N 3ID8A 1NWKA 4PKIA 5KQDA 3ATUA 3R1XA 4YDUA 3WXIA 3AAPA 4WQ5C 1QQOA 3LM2A 4H0XB 3WXLA 2PAVA 1KXPA 4WFBL 1GLFO 3FFKB 4BC3A 1DGKN 2V7ZA 3MX2A 4CZGA 3O6WA 3EE8A 4JAXA 1BA1A 1OVYA 4BRMA 1YIJN 3VESA 5AQPA 2P9SB 1C0GA 1VQPN 2I7PA 1X3MA 3ENOA 2GUPA 3H1QA 5CE3A 2IIRA 1NGFA 1RDWX 1U6ZA 2VGNA 1HJOA 2HOEA 2Q2RA 4A2BA 4BC4A 4EAHD 1JCGA 2A6AA 5AQXA 1Q81O 3EE9A 3C7NB 3H6EA 4IOXA 4CI6A 1ILYA 5F2RA 4EIAA 4FWNA 4H5NA 2CH6A 2BH1A 3L0QA 5ADXH 2NNWA 4FWLA 4KH4A 1T6CA 1JJ2M 3CJAA 3VF6A 3CC2N 4JEPA 3QDKA 1KQSM 1CZAN 2FSJA 3M3ZA 2P9NB 1Q7YO 3G71N 3G25A 5EY4A 4IZ9A 1NGHA 4BVOA 3TPQA 3LDNA 2GTDA 2E20A 5M1QA 1YI2N 4YDUC 1VAZA 2E2QA 5AQZA 4IOAL 3DJCA 3L4IA 4H0YB 1GLCG 1HKBA 4JD2A 3FR0A 4JKCA 3UE5A 1P8ZA 2QEXN 5JVGL 1Z05A 2P9UB 4NLBA 4GVEA 2FSNA 2ITMA 4CZMA 5C12A 3C6AA 2V52B 4O8KA 1YUWA 5AQRA 3CQYA 3WXMB 4A57A 4CZJA 2ZJQL 3GBTA 3E9OA 3JS6A 5BR9A 5GADP 2D4WA 4A61A 4YOVA 1G99A 2WC9A 3PIOL 4NB4A 3D6RA 3FZLA 1T3VA 1NGJA 2ASOA 3FE1A 4GV3A 3AY9A 3C0BA 3DXMB 4JKGA 3CCUN 1M1KO 3U4LA 3VOVA 1JCEA 2KKZA 3OBYA 3PLAA 1DEJA 4GY2B 4HTLA 2RHKA 4JK8A 1XUPO 3LDPA 5JLHA 5BPMA 4WQ4C 2QWOA 3ZEUB 3WQUA 4GV6A 4MLEA 4JKEA 4F9OA 3WEEB 4IXCA 4CBXA 2FF6A 1BOTO 4NO7A 3SJHA 5BN9A 4JKFA 2QA4N 3VEWA 5ADXA 2P9IB 1HX1A 3CHWA 5E84A 1RFQA 1ATNA 3VTHA 4M7XA 2A42A 1QZ5A 4PKGA 3E9LA 4JK7A 3RSEA 3SLCA 2QWQA 5C0YA 5EVZA 2YHWA 4K43A 2GX9A 2FF3B 1XC3A 2ZJRL 3C65A 5KPTA 2GELA 2UYTA 3OHRA 5GAGP 5EOYA 4M7YA 4C23A 3F2KA 4A5AA 3E66A 2BUPA 3I8BA 2NRVA 2E2PA 3CQXA 1NGEA 3HM8A 5LY3A 5BPNA 3ZX2A 4CZIA 4CBWA 4FOIA 5BRDA 1KD1O 5AZJA 3H46O 3VGMA 3R8EA 5M1KA 4IO8A 3GDQA 4B1YB 1YXQA 4BREA 1BG3A 4BR5A 1K9MO 1VQ8N 3CCLN 2D0PA 5AQVA 5TKYA 3NVMA 2BTFA 4H5WA 1OKJA 4YOUA 2P9LA 3BF1A 3IFRA 4CBUA 1NMDA 4GNIA 1MA9B 4MDBA 5GINA 4C1NI 3A0IX 2F9TA 3ZEUA 2PFUA 1VQMN 4IJNA 1HPMA 4BRNA 3VEZA 4JD2B 1IJJA 2P9IA 3LDOA 3SAFA 2CGLA 3A5NC 3N4PA 2A3ZA 4OPAA 4AM7A 4O5FA 3ID6A 3QICA 2OTJN 2E8AA 4C1NK 1TUYA 3TTFA 2JWLA 1DKGD 3KWGA 1O13A 3O08A 4BRIA 3O8MA 2WBNA 2QXLA 2OANA 2WFBA 5AQKA 4CZEA 4RWTA 2W41A 2FLOA 5AQUA 3M6GA 5AQWA 1GLDG 3U9DA 4BRPA 4DKWA 3KZBA 2E1ZA 2Q1NA 2QW9A 3K9JA 2QI2A 3OBWA 1GLAG 2W40A 4FPAA 4JKGB 3CCVN 4BR9A 2EWSA 4JKDA 1ZXOA 3I56N 3QFUA 3P31A 1RGIA 4ISEA 5GAEP 1TUUA 1NGIA 4CJ7A 3DLLL 5E26A 3O1WA 1S3XA 3H3OB 5MLCQ 4WF9L 1YHQN 5HL7L 3FZMA 5B8HA 1SS6A 2QWRA 3FZFA 3SAGA 4FWMA 4ISFA 4MLHA 1QVFM 1K8KA 2VWBA 2HF4A 3LM9A 3MN7A 2V51B 4WCEL 4BC5A 1MDUB 4B1UB 4DCHA 3CC4N 3CJCA 3C6HA 3RSEB 1KAXA 5DM6L 3N4QA 1NGDA 4ILHA 4BRQA 5AQFA 2V7YA 3AARA 3SBTA 3FGUA 4H03B 4CZKA 1KAZA 1P90A 5CHIA 4H0VB 5JVHL 1X3NA 4BY9C 4K41A 4Y0WA 1QZ6A 4J8FA 3U8XA 5M1FA 3ENHA 3VENA 2NRZA 2GWJA 4XH5A 1TYQA 5AQMA 4BR7A 3M5RA 5JLFA 3D2FA 4IFEA 1KC8O 5AZJB 3P4IA 1GLBG 2Q36A 1IG8A 3QBWA 1U2VA 3R9PA 3HOTA 2QM1A 4QS9A 5LJVA 5AFUA 3EKUA 5F1XA 3MDQA 3CJ7A 4UY8O 3MN6A 3QFPA 4KH6A 3ZETA 2P9LB 3HZ6A 5M1PA 1QVGM 1E4FT 3K9KA 3WXJA 3P38A 3NVKA 4H0OA 1HLUA 3MWPA 4JHDB 3VEXA 5JMVA 5LJWA 5GIOA 4FVUA 3QMLA 3SMPA 4CZHA 4K25A 2E2NA 2GEMA 5ELZA 5EX5A 3SBGA 4E1JA 5BREA 3ENBA 4KBOA 5C15A 1ZC6A 3ZX3A 4PKHA 3TSUA 2CGJA 5AQGA 2KHOA 1NLVA 1D4XA 5TKWA 1BWFO 4AM6A 1NJIO 1GLEG 3ULEA 5AQHA 5GIPA 5BRFA 1SAZA 2QWNA 3AGRA 3HOSA 5F0XA 3LDLA 2NRRA 1T6DA 1VQON 3GE1A 4OO1J 3OW2M 1NGGA 2F7TA 3UKRA 1QHAA 4H5VA 3TTCA 4BG8A 1KAYA 2QWPA 4BGBA 5M1NA 3VGLA 2IVOA 3TU5A 5EXWA 1SZ2A 5FPNA 5AZIB 3R6MA 5FPMA 3BP8A 4U67L 1EQYA 3GL1A 2ZJPL 4BROA 1VQ7N 2FXUA 4H0PA 4OPHA 1VQLN 4LC9B 4DB3A 4XH1A 5AQJA 3UKUA 3I55N 3NMUA 3T7ZA 1VQ9N 4RCHA 3O4WA 3MN5A 1BUPA 4B1WB 1VQ4N 1WUAA 1Q82O 4ILGB 3CETA 2ZWHA 5CR4A 3CJ1A 2J4RA 3A5MC 3L6QA 4A59A 3CJBA 2FSKA 5M1OA 1K8KB 3O9SA 2YX6A 2P9KB 2A5XA 3WUHA 1YJNN 3BEXA 5AQLA 4H5TA 4YOWA 4JHDA 3PIPL 3CCJN 3VF2A 4BRLA 3LL3A 3WT0A 1QQMA 3BUZB 1S22A 4QS8A 3FZHA 4RTFD 1VQ6N 5KPRA 1ATSA 4YOXA 3A5OC 2Q0RA 3ZX0A 4BRFA 4G9ZA 4PL8A 2PBDA 4ILJA 2ZF5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZT A;  5AQQ A;  4CZF A;  4MO4 A;  1TYQ B;  4BG9 A;  3DWL A;  3QB0 A;  3W0L A;  5FPD A;  3D2F B;  4DQ8 A;  1X9J A;  4B1Z A;  3EN9 A;  5BPL A;  1LOT B;  3VET A;  5AQO A;  4XH4 A;  1U2V B;  3BF3 A;  5AFU H;  4B1X B;  5AZI A;  4A2A A;  3ZET B;  5BN8 A;  2E2O A;  1MWK A;  2GWK A;  3DXK B;  1C0F A;  4HWI A;  4EFH A;  3S41 A;  3GOI A;  4QS7 A;  2YJF A;  2P9P A;  3VGK A;  4MO5 A;  3MCP A;  3CI5 A;  3H3N O;  1NGB A;  4H0T B;  4PL7 A;  3I33 A;  4FL9 A;  2D0O A;  4DHY A;  3QBX A;  4I6M A;  2ASP A;  3A5L C;  2P9K A;  3ULE B;  5AQT A;  2NLX A;  2A40 A;  3D2E A;  4CZL A;  3UKR B;  3UB5 A;  3O5B A;  1NM1 A;  4CD3 A;  2Q31 A;  3JXU A;  4B1V A;  4CD1 A;  4FWR A;  2DPN A;  2YI1 A;  3VF4 A;  3D7E O;  4BR4 A;  1QQN A;  4BRC A;  5KPZ A;  1NGA A;  3W3D A;  4BVP A;  4FSV A;  1ESV A;  3UKU B;  3VEO A;  1H1V A;  1ZBS A;  3A8Y A;  3VEV A;  4WQ4 A;  2QWL A;  2YJE A;  1GLL O;  5KQ8 A;  1HUX A;  2YCH A;  4FWS A;  2CGK A;  1GLJ O;  3DXK A;  2ZGY A;  3IUC A;  4BRK A;  3O80 A;  5AQY A;  2F9W A;  3H1V X;  2I7N A;  1LCU A;  3U9Z A;  2YHY A;  1YVN A;  4JN4 A;  4FPB A;  3CER A;  1NBW A;  1E4G T;  4M63 C;  2AA4 A;  1SQK A;  2HMP A;  5FPE A;  4H5R A;  4BRG A;  3HSC A;  4BRA A;  2ZGZ A;  4BRD A;  2Q97 A;  3AAQ A;  2P9S A;  4XEI A;  2IVP A;  1HKG A;  1Q18 A;  1BU6 O;  3HI0 A;  4K42 A;  4L3Q A;  4BR2 A;  4BR0 A;  2HF3 A;  3MK6 A;  2E88 A;  3C7N A;  3EL2 A;  3IDH A;  5AQS A;  2QWM A;  5I9E B;  2AP1 A;  1ATR A;  1R59 O;  2WUS A;  4B9Q A;  2E1Y A;  4FWP A;  2ASM A;  2IVN A;  4FWO A;  3VPZ A;  3VEY A;  2A41 A;  3J8A A;  1WOQ A;  3FLC O;  2P9N A;  3H45 C;  4FWK A;  1JCF A;  3GG4 A;  1V4T A;  2P9P B;  1HKC A;  2VCP A;  3B8A X;  3DAW A;  5AQN A;  3F9M A;  1V4S A;  4WYB A;  1YAG A;  4BRH A;  5JIC A;  3IMX A;  3ATV A;  3EKS A;  4I6M B;  3O1B A;  4JNE A;  3WXK A;  3EZW A;  4EHT A;  4FO0 A;  4IJA A;  3D2E B;  4WQ5 A;  2P9U A;  4EHU A;  3SMS A;  4BQZ A;  1J6Z A;  3HBT A;  2NRH A;  3HTV A;  3KHY A;  4BQL A;  4ISG A;  1BO5 O;  2H3G X;  3CIP A;  3FZK A;  5BRH A;  4BGA A;  3SK3 A;  4FWQ A;  1BDG A;  3DXM A;  5AR0 A;  4A62 A;  2CH5 A;  3KVG A;  1Y64 A;  3VER A;  3LDQ A;  3M1F A;  2Q0U A;  2VYP A;  4BC2 A;  5AQI A;  3WEE A;  1T44 A;  1NGC A;  4IWV A;  2D1K A;  2YHX A;  3EO3 A;  1XQS C;  4FOE A;  4Z94 A;  3WQT A;  1BA0 A;  1MWM A;  3MN9 A;  1Z6R A;  3CJ9 A;  3MMV A;  3ID8 A;  1NWK A;  4PKI A;  5KQD A;  3ATU A;  4YDU A;  3WXI A;  3AAP A;  4WQ5 C;  1QQO A;  3LM2 A;  4H0X B;  3WXL A;  2PAV A;  1KXP A;  1GLF O;  3FFK B;  4BC3 A;  1DGK N;  2V7Z A;  4CZG A;  3O6W A;  4JAX A;  1BA1 A;  4BRM A;  3VES A;  5AQP A;  2P9S B;  1C0G A;  2I7P A;  1X3M A;  3ENO A;  2GUP A;  3H1Q A;  5CE3 A;  2IIR A;  1NGF A;  1RDW X;  1U6Z A;  1HJO A;  2HOE A;  2Q2R A;  4A2B A;  4BC4 A;  4EAH D;  1JCG A;  2A6A A;  5AQX A;  3C7N B;  3H6E A;  4CI6 A;  5F2R A;  4EIA A;  4FWN A;  4H5N A;  2CH6 A;  3L0Q A;  5ADX H;  4FWL A;  1T6C A;  3CJA A;  3VF6 A;  3QDK A;  1CZA N;  2FSJ A;  3M3Z A;  2P9N B;  3G25 A;  5EY4 A;  4IZ9 A;  1NGH A;  4BVO A;  3TPQ A;  3LDN A;  2GTD A;  2E20 A;  4YDU C;  5AQZ A;  2E2Q A;  3DJC A;  3L4I A;  4H0Y B;  1GLC G;  1HKB A;  4JD2 A;  3FR0 A;  3UE5 A;  1P8Z A;  1Z05 A;  2P9U B;  2FSN A;  2ITM A;  4CZM A;  4O8K A;  2V52 B;  1YUW A;  5AQR A;  3CQY A;  4CZJ A;  3GBT A;  5BR9 A;  3JS6 A;  2D4W A;  4A61 A;  1G99 A;  4NB4 A;  3FZL A;  1NGJ A;  2ASO A;  3FE1 A;  3AY9 A;  3C0B A;  3DXM B;  3U4L A;  3VOV A;  1JCE A;  1DEJ A;  4GY2 B;  4HTL A;  1XUP O;  3LDP A;  5JLH A;  5BPM A;  4WQ4 C;  2QWO A;  3ZEU B;  3WQU A;  4MLE A;  4F9O A;  3WEE B;  4IXC A;  4CBX A;  2FF6 A;  1BOT O;  4NO7 A;  3SJH A;  5BN9 A;  3VEW A;  5ADX A;  2P9I B;  1HX1 A;  3CHW A;  5E84 A;  1RFQ A;  1ATN A;  4M7X A;  2A42 A;  1QZ5 A;  4PKG A;  3RSE A;  3SLC A;  2QWQ A;  5EVZ A;  2YHW A;  4K43 A;  2FF3 B;  1XC3 A;  5KPT A;  2GEL A;  2UYT A;  3OHR A;  5EOY A;  4M7Y A;  4C23 A;  2BUP A;  3I8B A;  2E2P A;  3CQX A;  1NGE A;  3HM8 A;  5LY3 A;  5BPN A;  3ZX2 A;  4CZI A;  4CBW A;  4FOI A;  5BRD A;  5AZJ A;  3H46 O;  3VGM A;  3R8E A;  4IO8 A;  3GDQ A;  4B1Y B;  1YXQ A;  4BRE A;  1BG3 A;  4BR5 A;  2D0P A;  5AQV A;  5TKY A;  2BTF A;  4H5W A;  1OKJ A;  2P9L A;  3BF1 A;  3IFR A;  4CBU A;  1NMD A;  4GNI A;  1MA9 B;  3A0I X;  2F9T A;  3ZEU A;  4IJN A;  1HPM A;  4BRN A;  3VEZ A;  4JD2 B;  1IJJ A;  2P9I A;  3LDO A;  2CGL A;  3A5N C;  2A3Z A;  4AM7 A;  4O5F A;  3QIC A;  2E8A A;  1TUY A;  1DKG D;  3O08 A;  4BRI A;  3O8M A;  2QXL A;  2OAN A;  4CZE A;  5AQK A;  4RWT A;  2W41 A;  2FLO A;  5AQU A;  3M6G A;  5AQW A;  1GLD G;  3U9D A;  4BRP A;  3KZB A;  2E1Z A;  2Q1N A;  2QW9 A;  1GLA G;  2W40 A;  4FPA A;  4BR9 A;  2EWS A;  1ZXO A;  3QFU A;  4ISE A;  1RGI A;  1TUU A;  1NGI A;  4CJ7 A;  5E26 A;  3O1W A;  1S3X A;  3H3O B;  3FZM A;  5B8H A;  2QWR A;  3FZF A;  4FWM A;  4ISF A;  4MLH A;  1K8K A;  2VWB A;  2HF4 A;  3LM9 A;  3MN7 A;  2V51 B;  4BC5 A;  1MDU B;  4B1U B;  4DCH A;  3CJC A;  3RSE B;  1KAX A;  1NGD A;  4BRQ A;  5AQF A;  2V7Y A;  3AAR A;  4CZK A;  3FGU A;  4H03 B;  1KAZ A;  4H0V B;  1X3N A;  4K41 A;  4Y0W A;  1QZ6 A;  4J8F A;  3U8X A;  3ENH A;  3VEN A;  2GWJ A;  4XH5 A;  1TYQ A;  5AQM A;  4BR7 A;  5JLF A;  3D2F A;  5AZJ B;  3P4I A;  1GLB G;  2Q36 A;  1IG8 A;  3QBW A;  1U2V A;  3R9P A;  2QM1 A;  4QS9 A;  5LJV A;  5AFU A;  3EKU A;  5F1X A;  3MDQ A;  3CJ7 A;  3MN6 A;  3QFP A;  3ZET A;  2P9L B;  3HZ6 A;  1E4F T;  3WXJ A;  4H0O A;  1HLU A;  4JHD B;  3VEX A;  5JMV A;  5LJW A;  3QML A;  3SMP A;  4CZH A;  4K25 A;  2E2N A;  2GEM A;  5ELZ A;  5EX5 A;  4E1J A;  5BRE A;  4KBO A;  1ZC6 A;  3ZX3 A;  4PKH A;  2CGJ A;  5AQG A;  2KHO A;  1NLV A;  1D4X A;  1BWF O;  4AM6 A;  1GLE G;  3ULE A;  5AQH A;  5BRF A;  1SAZ A;  2QWN A;  5F0X A;  3LDL A;  1T6D A;  3GE1 A;  1NGG A;  3UKR A;  4BG8 A;  1QHA A;  4H5V A;  1KAY A;  2QWP A;  4BGB A;  3VGL A;  2IVO A;  3TU5 A;  5EXW A;  1SZ2 A;  5FPN A;  5AZI B;  3R6M A;  5FPM A;  3BP8 A;  1EQY A;  3GL1 A;  4BRO A;  2FXU A;  4H0P A;  4LC9 B;  4DB3 A;  4XH1 A;  5AQJ A;  3UKU A;  4RCH A;  3O4W A;  3MN5 A;  1BUP A;  4B1W B;  1WUA A;  3CET A;  2ZWH A;  3CJ1 A;  2J4R A;  3A5M C;  3L6Q A;  3CJB A;  2FSK A;  1K8K B;  2P9K B;  2A5X A;  3WUH A;  3BEX A;  5AQL A;  4H5T A;  4JHD A;  3VF2 A;  4BRL A;  3LL3 A;  3WT0 A;  1QQM A;  3BUZ B;  1S22 A;  4QS8 A;  3FZH A;  4RTF D;  5KPR A;  1ATS A;  3A5O C;  2Q0R A;  3ZX0 A;  4BRF A;  4PL8 A;  2PBD A;  2ZF5 O; 
#chains in the Genus database with same CATH topology
 2HBM A;  2NZT A;  4BG9 A;  1SL0 A;  3AVA A;  2UXC K;  3V81 A;  3BF3 A;  4FJX A;  3R3L A;  3NAE A;  4B1X B;  1WAJ A;  2ITG A;  2W6L A;  3BY5 A;  3ZET B;  4IOC L;  1LWF A;  3FFI A;  1HR0 K;  3TAF A;  4DG1 A;  1KLN A;  2UU9 K;  4C8O A;  4AHR A;  3AA3 A;  3S41 A;  3GOI A;  2WOM A;  4QS7 A;  2HB5 A;  2KFN A;  2P9P A;  4MO5 A;  3MCP A;  3KK3 A;  3ULD A;  1VK0 A;  4CJQ A;  3DM2 A;  2D0O A;  4CES A;  2ASP A;  3ULE B;  2F8T A;  2A40 A;  5DM7 L;  3J7Z O;  4IFY A;  3A2F A;  4C8L A;  1NM1 A;  4CD1 A;  4EZ6 A;  2YNF A;  4ZHR A;  3SNN A;  2YI1 A;  4CIE A;  3VF4 A;  2A1S A;  1XC9 A;  4WFA L;  3K57 A;  3ZSQ A;  3CCQ N;  1HNI A;  2G8H A;  4WFN L;  3UKU B;  4JI1 K;  2ZM6 K;  4Q0B A;  3ZSX A;  3AV9 A;  5HOO A;  4CJT A;  1QSY A;  2YJE A;  3DLK A;  3WNF A;  4CJF A;  1GLJ O;  4CER A;  4GMJ B;  2O4G A;  5C10 A;  3ZSV A;  3H1V X;  3IKM A;  1N32 K;  1LCU A;  5C2D A;  3KD1 E;  4EZ9 A;  4OGC A;  4JN4 A;  1HYS A;  3CER A;  1NBW A;  3PUF A;  4J2D A;  2HMP A;  1X9W A;  2HHH K;  1RT6 A;  5FPE A;  4LSL A;  4JK9 A;  1J9A A;  4WE1 A;  4AIL C;  2ZGZ A;  3TAP A;  1X9M A;  1N8R O;  3VMF B;  4XIU A;  3C94 A;  1N5Y A;  4QCL A;  4A5B A;  4RW4 A;  1RT1 A;  3SQ4 A;  3KK2 A;  4DR1 K;  2QTD A;  2HBK A;  2AP1 A;  4AHS A;  3VTI A;  2IDO A;  1VSF A;  2OPS A;  1C1A A;  4DR5 K;  4DU4 A;  2WUS A;  1Q82 O;  2IVN A;  1KTQ A;  1WOQ A;  5J2M A;  3RVC A;  4JS4 A;  1W97 L;  4FLU A;  5AQN A;  1ASU A;  5JIC A;  4F3T A;  4YOY A;  3ATV A;  3EKS A;  4I6M B;  3O1B A;  4LD0 A;  4AHU A;  3CG7 A;  5LMN K;  4IJA A;  3D2E B;  3SMS A;  4E1M A;  2OCE A;  4CEQ A;  3RMD A;  1TKZ A;  2Z1H A;  3M8S A;  1JLA A;  4LF6 K;  2JWK A;  4FWQ A;  3F5T A;  5CY4 A;  5KRT A;  3DRS A;  2CH5 A;  1IKW A;  1K73 O;  3DI6 A;  3J7A P;  4IO9 L;  4BE0 A;  1QSS A;  3OJU A;  3WEE A;  1NGC A;  1VQ5 N;  1NJX A;  4FOE A;  3O9Q A;  1TK0 A;  4HUG A;  1NWK A;  5KQD A;  2YHA A;  4HUE A;  1N33 K;  3WXL A;  4H0X B;  3HPO A;  1KXP A;  4WFB L;  2XO7 A;  1E3M A;  1QE1 A;  1ZBL A;  2DFE A;  2E6L A;  4BRM A;  4FJ7 A;  3VES A;  1FXX A;  3KIO A;  2OYQ A;  5CE3 A;  2HOE A;  2A6A A;  4DR2 K;  3EE9 A;  4E7J A;  3C7N B;  3H6E A;  3I0S A;  3WNG A;  4LF9 K;  4Z4F A;  4EIA A;  4H5N A;  2NUB A;  5HBM A;  1SL2 A;  2NNW A;  3VF6 A;  2P51 A;  3THY B;  4NCG A;  2G8I A;  1CZA N;  2FSJ A;  3M3Z A;  2P9N B;  2G8W A;  3RR8 A;  5EY4 A;  4DQP A;  4IZ9 A;  1RTH A;  4YDU C;  2HW3 A;  1VAZ A;  4E3S A;  4IOA L;  4W5N A;  1HQU A;  2O8D B;  1GLC G;  3S9H A;  3FR0 A;  3THV A;  1Q9Y A;  1P8Z A;  4CJV A;  1HRH A;  2FSN A;  1YUW A;  3S3O A;  4JI3 K;  3DLG A;  4A61 A;  4NB4 A;  3OS0 A;  3B6P A;  1CXQ A;  5DK5 A;  4F3O A;  4I2P A;  1ZBU A;  4H4O A;  4AHC A;  5JLH A;  2GUI A;  5BPM A;  3TAQ A;  3WQU A;  1S6Q A;  3SJH A;  3SI6 A;  5E84 A;  3AVB A;  4CFB A;  3VTH A;  1C6V A;  2A42 A;  2OZM A;  4PKG A;  3RSE A;  4DV2 K;  2QWQ A;  5EVZ A;  2YHW A;  1W7A A;  4CF2 A;  4ZTF A;  3HT3 A;  2UXD K;  1QHT A;  2GEL A;  2YNI A;  5GAG P;  4PWD A;  4I2Q A;  3ZSW A;  1I94 K;  4A5A A;  1NKB A;  3E66 A;  2BUP A;  3CQX A;  1NGE A;  1RDC A;  3HM8 A;  5LY3 A;  4FOI A;  4OJR A;  4RW9 A;  5AZJ A;  3VGM A;  5M1K A;  4B1Y B;  3HVR A;  3THW B;  1VQ8 N;  4DTM A;  4GW6 A;  3RRG A;  4H5W A;  4YOU A;  3BF1 A;  4ELV A;  3IFR A;  3M8P A;  1NMD A;  2RN2 A;  2HHW A;  5GIN A;  4FK0 A;  3DMJ A;  3ALY A;  1RCH A;  2FBX A;  3PX4 A;  1IJJ A;  3HPG A;  3SAF A;  2CGL A;  4OPA A;  1ZYQ A;  2E8A A;  1TUY A;  2JWL A;  1DKG D;  3O08 A;  4HHT A;  3O8M A;  2WBN A;  4CZE A;  2W41 A;  2FLO A;  4DR3 K;  1HNX K;  4CK2 A;  3KZB A;  4N47 A;  2Q1N A;  1JLG A;  4NYN A;  3OBW A;  1GLA G;  4FPA A;  1FKP A;  1NK5 A;  3LAL A;  1XI1 A;  1ZXO A;  3QIP A;  4CGD A;  3V9Z A;  1NJZ A;  4B3M K;  4DF8 A;  5GAE P;  5E26 A;  1ASV A;  2HVI A;  5MLC Q;  5KTQ A;  4WF9 L;  3S3N A;  1SS6 A;  4JI5 K;  3SAG A;  4ISF A;  4MLH A;  1QVF M;  4IDK A;  4KTZ A;  1IH7 A;  2IOC A;  1MDU B;  4B1U B;  4DCH A;  3HXM A;  3C6H A;  1RTD A;  4BRQ A;  5AQF A;  4CZK A;  4CK1 A;  1P90 A;  4H0V B;  3LWL A;  5JVH L;  1NK4 A;  4MFB A;  1QZ6 A;  3AVG A;  1RBU A;  4J8F A;  3AO3 A;  3ISN C;  5CYM A;  3VEN A;  4UQG A;  3NCI A;  2GWJ A;  1TYQ A;  3KKS A;  1F21 A;  4M3X A;  1U2V A;  3VQ8 A;  2QM1 A;  5AFU A;  1D9D A;  3MDQ A;  2HHQ A;  4BDP A;  4UY8 O;  4KH6 A;  2P9L B;  5M1P A;  1SL1 A;  2QK9 A;  4KO0 A;  4CGJ A;  4H0O A;  3MWP A;  3QML A;  3SMP A;  2E2N A;  1SUQ A;  4E1J A;  3OYB A;  3ZX3 A;  4PKH A;  2CGJ A;  3KJV A;  2KHO A;  4RW8 A;  1NLV A;  2WTU A;  1BWF O;  3TAB A;  4DFK A;  5BRF A;  4KB1 A;  4B9V A;  1T6D A;  3OW2 M;  2F7T A;  3UKR A;  3TTC A;  2E6M A;  4KKO A;  2IVO A;  3TU5 A;  3P5J A;  1EX4 A;  5AZI B;  1OVQ A;  2G8V A;  4M42 A;  1RT5 A;  5FPM A;  3PV8 A;  1EQY A;  3GL1 A;  1VQL N;  1RTJ A;  4DQS A;  4RCH A;  3O4W A;  3U6F A;  4ILG B;  1L3U A;  2ZWH A;  5CR4 A;  2R7Y A;  3L6Q A;  4A59 A;  3NF6 A;  3EYZ A;  1W9H A;  4DSI A;  5HRP A;  4B3O A;  4YOW A;  3D45 A;  5I42 A;  3PIP L;  1ASW A;  3LL3 A;  2OPR A;  2UXB K;  1S22 A;  3AA4 A;  3D0P A;  1WSJ A;  3FZH A;  1U49 A;  4FW2 A;  1NJY A;  3A5O C;  4BRF A;  4G9Z A;  4KRE A;  1QHA A;  4ILJ A;  3DLE A;  3VN5 A;  4MO4 A;  3QB0 A;  4B1Z A;  3EN9 A;  1WSH A;  5FDL A;  3VET A;  3OVN A;  2XRI A;  4DQR A;  4IKF A;  5AZI A;  3T69 A;  4A2A A;  2KZM A;  5BN8 A;  3DXK B;  1C0F A;  4I9Q A;  2NRT A;  5HP1 A;  4EFH A;  1RT7 A;  4E7H A;  2JGU A;  4YOT A;  5FRN A;  2OPP A;  2AJQ A;  4IDH A;  4DLE A;  5GAH P;  3CME N;  4JS5 A;  1SKW A;  2IC3 A;  4DTU A;  1KVA A;  4CF1 A;  4DHY A;  3NDK A;  4EP5 A;  4CEA A;  4R79 A;  4LH4 A;  4CD3 A;  3JXU A;  2RPI A;  3OYL A;  4CW7 B;  5J2N A;  3L2U A;  1U48 A;  4O4G A;  3L2Q A;  1RDD A;  4Y1C A;  1NGA A;  4PHT X;  1A5X A;  1WNS A;  4FSV A;  3H08 A;  1TL1 A;  3TTD A;  3J7Y P;  3SJJ A;  3V6D A;  3VEV A;  4WQ4 A;  1TKX A;  1L5U A;  2O8C B;  2QWL A;  4DR7 K;  4O44 A;  2YCH A;  3KK7 A;  4FWS A;  3K5M A;  3DXK A;  4E0D A;  3AVL A;  4K8X A;  1YT3 A;  4BRK A;  3O80 A;  3SUN A;  3CM5 A;  3U9Z A;  4AHT A;  3KWI A;  2NRW A;  1YVN A;  5FRO A;  3SPZ A;  5C2F A;  3KLG A;  3KLF A;  3RMC A;  4H5R A;  1WBB A;  3HSC A;  4CEO A;  4GV9 A;  2JLE A;  2Q97 A;  3JYT A;  4FCY A;  4FLY A;  1VHX A;  1HKG A;  3C95 A;  4O8U A;  4BR2 A;  1YTA A;  2E88 A;  4K0K K;  4O0I A;  2QWM A;  2ZQB A;  5I9E B;  2XY6 A;  1X9S A;  1IBK K;  2VQF K;  4CHO A;  2E1Y A;  3PO5 A;  4Z0U A;  4JKB A;  3VEY A;  3J8A A;  3AVK A;  3P1G A;  4CHN A;  4W5O A;  4KHQ A;  1JCF A;  4MDA A;  1K8A O;  3MWT A;  1V4T A;  2P9P B;  3B8A X;  3DAW A;  3F9M A;  4CEF A;  1V4S A;  1N6Q A;  2F96 A;  4BRH A;  3OYH A;  4JKH A;  3CCS N;  3IMX A;  1W2B M;  3V9S A;  3WXK A;  3EZW A;  4EHT A;  4DFP A;  4WQ5 A;  2P9U A;  4OPK A;  1S72 N;  1J6Z A;  3HBT A;  3KHY A;  3NFA A;  3AVF A;  1NMN A;  3IG1 A;  2UUB K;  1UA0 A;  3PY8 A;  1BO5 O;  3HO1 A;  4Z4I A;  3CIP A;  1RBS A;  1G15 A;  3MXM A;  5BRH A;  3LAM A;  3CMA N;  1U4B A;  1LAV A;  3AO2 A;  3KVG A;  4LH5 A;  1Y64 A;  2D0B A;  3M1F A;  2IS3 A;  3RMB A;  1VSE A;  1Q86 O;  5KGW A;  3LPT A;  2YHX A;  4IWV A;  3EO3 A;  1XQS C;  2FBV A;  3ZT3 A;  3VA3 A;  3Q7C A;  1BA0 A;  2B6A A;  4KAZ A;  1MWM A;  2IAJ A;  3MN9 A;  1Z6R A;  3CD6 N;  3V1Q A;  2XY8 A;  4B08 A;  3SZ2 A;  3R1X A;  3DOL A;  3WXI A;  3AAP A;  4FW1 A;  1QQO A;  4HVJ A;  1I39 A;  4DTS A;  4PQU A;  3ZT2 A;  4BC3 A;  2XHB A;  4DFM A;  2V7Z A;  3MX2 A;  3EE8 A;  1D8Y A;  1BL3 A;  1RT3 A;  4FJK A;  1VSH A;  4O0J A;  2I7P A;  3L2V A;  4DQI A;  2GUP A;  3H1Q A;  1U6Z A;  2G8K A;  4BC4 A;  4EAH D;  3HM9 A;  3BDP A;  4J2A A;  3MEE A;  4IOX A;  1ILY A;  5F2R A;  4FWN A;  1VSI A;  2PZS A;  4KH4 A;  4MQ3 A;  3CJA A;  3HP6 A;  5J2Q A;  3CC2 N;  3QDK A;  3SV4 A;  4IBN A;  4KV8 A;  3G71 N;  3U3G A;  4BVO A;  3LDN A;  2QKK A;  4KI4 A;  2O8B B;  3HL8 A;  5M1Q A;  1YI2 N;  1K6Y A;  1TKT A;  2E2Q A;  2LSN A;  4CJE A;  1NK6 A;  3UE5 A;  4JD2 A;  3V9X A;  3QEW A;  4JRQ A;  3HJF A;  4B3T K;  1HYZ A;  2ZE2 A;  3SPY A;  1JL1 A;  3MXJ A;  4O8K A;  2V52 B;  5AQR A;  3CQY A;  3WXM B;  3MXI A;  1MU2 A;  3L8B A;  4M3W A;  3E9O A;  5BR9 A;  2WC9 A;  3PIO L;  1IV0 A;  1T3V A;  3T19 A;  4GV3 A;  3SQ0 A;  1M1K O;  4F2S A;  3U4L A;  3VOV A;  2O8F A;  1JCE A;  3OBY A;  3PLA A;  2QXF A;  4HTL A;  3AVI A;  4JK8 A;  1XUP O;  3V1O A;  3ZEU B;  4F9O A;  3WEE B;  2IGI A;  4NO7 A;  5BN9 A;  3VEW A;  5ADX A;  4HTU A;  1YVU A;  4CFC A;  3CHW A;  1XMQ K;  4M3U A;  4NCA A;  5FLX O;  4QOZ B;  1QZ5 A;  2HHU A;  4N41 A;  2O8B A;  3SLC A;  4KB0 A;  3F73 A;  1Q9X A;  2FF3 B;  4DUY K;  2ZJR L;  2GV9 A;  3C65 A;  5KPT A;  3LZJ A;  1FKO A;  3OHR A;  3AVC A;  2E2P A;  3VQP A;  4KHS A;  3SUO A;  1KD1 O;  2KTQ A;  3TR8 A;  4X64 K;  3OS1 A;  3KD5 E;  4IO8 A;  1YXQ A;  4BRE A;  4BR5 A;  1IKV A;  4B9U A;  1JKH A;  3CCL N;  2D0P A;  5AQV A;  4AQY K;  2P5G A;  4JI4 K;  3OYD A;  2BTF A;  3ASM A;  1OKJ A;  2YNH A;  4MDB A;  2HNZ A;  3ZCM A;  1NOY A;  2F9T A;  3ZEU A;  1VQM N;  4H8K A;  3K58 A;  1HPM A;  4IG3 A;  1FW6 A;  3QIN A;  3NF9 A;  3LDO A;  3AO1 A;  4Z4G A;  3V4I A;  1Q8I A;  3KWG A;  1O13 A;  4TSX A;  2QXL A;  3K5O A;  3M8Q A;  5AQU A;  3ZT4 A;  5E41 A;  2Y1I A;  3CYM A;  4BRP A;  2E1Z A;  4CEE A;  2W40 A;  4BR9 A;  2EWS A;  4JKD A;  1NKE A;  4OLB A;  1XMO K;  1S5J A;  1RGI A;  1TK8 A;  1S3X A;  1T8E A;  2BE2 A;  5HL7 L;  1JLB A;  1NK8 A;  3BZC A;  4FJJ A;  2VWB A;  4BWJ A;  3TAG A;  3MN7 A;  4BC5 A;  3RSE B;  1ZBI A;  5DM6 L;  4ID5 A;  1RNH A;  2RF2 A;  4DFJ A;  1S1X A;  3QEI A;  4Y1D A;  3VQ6 A;  3KKR A;  4CFD A;  4K41 A;  4CGF A;  4CJL A;  4CED A;  3U8X A;  5M1F A;  3ENH A;  4FXD A;  3AA5 X;  3ZSO A;  4X66 K;  3DLR A;  3M5R A;  5JLF A;  3D2F A;  4DS5 A;  1KC8 O;  4GVM A;  5AZJ B;  3P4I A;  4KHN A;  1GLB G;  1IG8 A;  3HOT A;  1JXB A;  4JV5 K;  3CJ7 A;  3MN6 A;  2O4I A;  4DR6 K;  1BIU A;  3IRX A;  3WXJ A;  3ZLJ A;  4YHH K;  3P38 A;  1FK9 A;  3NVK A;  3QIO A;  4F2R A;  2Z1G A;  4DMN A;  4AH9 A;  4DR4 K;  5C15 A;  3ENB A;  1O1W A;  4DTO A;  4N76 A;  3TSU A;  3VQE A;  3QNO A;  3ZSR A;  1QSL A;  1U47 A;  3SQ1 A;  2QKB A;  1RT4 A;  2NRR A;  1VQO N;  1NGG A;  4BG8 A;  4H5V A;  3ZT1 A;  4FJN A;  4BGB A;  5A2Q O;  4W5Q A;  4BDZ A;  1T03 A;  4CHP A;  1J5E K;  1RBT A;  1L3V A;  4JI8 K;  3NGZ A;  2OA8 A;  5C25 A;  4BRO A;  1EP4 A;  1NJW A;  1WN7 A;  4LC9 B;  5HRO A;  4FM1 A;  4HUF A;  4B1W B;  1WUA A;  3ZSZ A;  4DV1 K;  3THX A;  3A5M C;  4CIF A;  3KLE A;  1NU0 A;  2FSK A;  5M1O A;  1JLC A;  4RG8 A;  2P9K B;  4ELU A;  4YNQ A;  5AQL A;  2W6K A;  4H5T A;  1KVC A;  5KGX A;  3VF2 A;  1QQM A;  3HP9 A;  4RTF D;  4KFB A;  4FLX A;  2Q0R A;  4PL8 A;  3E01 A;  4BWM A;  4FM0 A;  5AQQ A;  2O8E B;  1TYQ B;  1OH7 A;  2HHT A;  2ZD1 A;  1X9J A;  3DRR A;  2OZS A;  2PYL A;  3IAY A;  3K59 A;  4FJ9 A;  1U2V B;  4DSF A;  4M3Z A;  1QS4 A;  3O9R A;  3O9T A;  2E2O A;  1MWK A;  3AO5 A;  4KRF A;  3OYG A;  3LZI A;  4IEI A;  4JI7 K;  1OH5 A;  4KHY A;  2HST A;  3VGK A;  2KLA A;  3CI5 A;  4H0T B;  4F4K A;  1HJR A;  3I33 A;  2BDP A;  2P9K A;  5AQT A;  3MCA B;  2NLX A;  1B9F A;  3SUP A;  2UUC K;  3UKR B;  3SYZ A;  3O5B A;  5KI6 A;  2Q31 A;  1NK9 A;  1LWC A;  3ITH A;  4FWR A;  3T1Y K;  4BRC A;  3D7E O;  4BR4 A;  1QQN A;  3CC7 N;  1CLQ A;  3MAQ A;  4O55 A;  4BE1 A;  3W3D A;  3G6E N;  4BVP A;  5SZT A;  1YJ9 N;  1ESV A;  3CPE A;  2O8E A;  1VQN N;  1D5A A;  4K8Z A;  1VSL A;  3KLH A;  3HRG A;  3QO9 A;  2CGK A;  2Z1J A;  4BE2 A;  4LFC K;  1BIZ A;  2I7N A;  2OTL N;  1EO1 A;  3F9K A;  1VSD A;  3OY9 A;  4DF4 A;  4FPB A;  4OX9 K;  1E4G T;  1BGX T;  3AGK A;  2AA4 A;  1SQK A;  1ZBF A;  4BRG A;  1RTI A;  3J81 O;  1J53 A;  4BRA A;  2HMI A;  4BRD A;  4CJ5 A;  4U7B A;  2P9S A;  4AF1 A;  1B92 A;  2IVP A;  1Q18 A;  1BCM A;  1BU6 O;  4L3Q A;  2HF3 A;  4OGE A;  1I3A A;  3EL2 A;  5AQS A;  4M3T A;  3VQB A;  1ATR A;  1R59 O;  3OA9 A;  4FWP A;  5LMU K;  1YJW N;  1BQM A;  4OKJ A;  4FWK A;  1JXE A;  3GG4 A;  2YV0 X;  3B6O A;  3K2P A;  3CPW M;  1YF5 L;  3CXC M;  5KRS A;  4WYB A;  4DLG A;  3ZYY X;  4OKE A;  5IWA K;  1JLF A;  4FO0 A;  2E4L A;  4EHU A;  4L8R B;  4JYA K;  5CZ1 A;  4ISG A;  2A1R A;  4OKK A;  1YTU A;  1WSE A;  4KHW A;  3FZK A;  1S9G A;  3OYM A;  4CF9 A;  4BGA A;  3KK1 A;  3SK3 A;  1BDG A;  3DXM A;  3CFO A;  4CGG A;  2DFH A;  3TSQ A;  2DFF A;  3CCR N;  1R0A A;  3SAH A;  4YFU A;  4ID1 A;  4PA1 A;  4JLH A;  3K5N A;  3JSM A;  1QVG M;  2D1K A;  4DV5 K;  1WLJ A;  1QQC A;  3WQT A;  4YOR A;  3AVH A;  1HPZ A;  3CJ9 A;  3ID8 A;  4PKI A;  3ATU A;  4WQ5 C;  3LM2 A;  4FZX C;  4FK4 A;  2KW4 A;  1HMV A;  3QNN A;  1GLF O;  3FFK B;  4CEC A;  1DGK N;  4CVN E;  4LFB K;  1BA1 A;  4QAG A;  5AQP A;  3QES A;  1C0G A;  1N36 K;  1GOC A;  1RDW X;  4FLT A;  2Q2R A;  1JCG A;  3QLH A;  1Q81 O;  1WAF A;  3VQQ A;  5C42 A;  5HRS A;  2X6S A;  4CI6 A;  1OH8 A;  1EWQ A;  2BH1 A;  5ADX H;  3L2W A;  1RDB A;  1T6C A;  1JJ2 M;  4HCC A;  1J54 A;  3V1R A;  1Z26 A;  4JEP A;  1EKE A;  3LAK A;  3NH0 A;  1A5W A;  3G25 A;  1TL3 A;  2E20 A;  5AQZ A;  3DJC A;  3OYA A;  3L4I A;  4FJI A;  3ZT0 A;  4H0Y B;  4JKC A;  3QEX A;  3LWM A;  5JVG L;  2P9U B;  4GVE A;  4F8R A;  4M3R A;  2P1J A;  4CZJ A;  4CGI A;  3JS6 A;  3DOK A;  1G99 A;  4E7L A;  4CHQ A;  3C0B A;  4JKG A;  4N5S A;  3CCU N;  2KKZ A;  1NG9 A;  3OYJ A;  1EET A;  3M8R A;  3PX6 A;  5CZ2 A;  4C8M A;  4GV6 A;  4JKE A;  1TGO A;  4IXC A;  4CBX A;  2FF6 A;  1RIL A;  2KQ2 A;  1IO2 A;  3WNH A;  1ATN A;  2YNG A;  4CJP A;  1J5O A;  2X74 A;  4I7F A;  4G1Q A;  4B9L A;  3E9L A;  4JK7 A;  3VQC A;  5C0Y A;  4DUZ K;  4K43 A;  3RMA A;  3OYE A;  1RT2 A;  5EOY A;  5HRR A;  4C23 A;  3F2K A;  3T1H K;  3I8B A;  2NRV A;  3MED A;  3WNE A;  1C1B A;  4DU1 A;  4CBW A;  3GDQ A;  1TV6 A;  2HHS A;  1S1V A;  2UUA K;  5TKY A;  4OPJ A;  1HQE A;  4CBU A;  4GNI A;  1MA9 B;  4O5B A;  1BI4 A;  2PFU A;  3DLH A;  2ATQ A;  2E5L K;  4JD2 B;  3LP0 A;  5AJ3 K;  3A5N C;  3BZK A;  4AM7 A;  4O5F A;  4CJR A;  3QIC A;  1C0U A;  1U45 A;  1UAX A;  2OAN A;  1BQN A;  2WFB A;  4RWT A;  1T7P A;  5AQW A;  3U9D A;  3AA2 A;  2QW9 A;  3K9J A;  1L3S A;  2QI2 A;  4DTJ A;  5SWM A;  2G8F A;  4DWI A;  3T3F A;  4BDY A;  2O8F B;  1D9F A;  4ELT A;  1BCO A;  3EZ5 A;  3QFU A;  3P31 A;  4B3S K;  4RW6 A;  4Z4H A;  1TUU A;  1NGI A;  4LF8 K;  1UA1 A;  4ICL A;  3NGI A;  1VSK A;  3I8D A;  4FWM A;  1OH6 A;  1K8K A;  3LM9 A;  1BHL A;  2V51 B;  4WCE L;  2YKN A;  1KAX A;  3LP3 A;  2D0A A;  4DSE A;  4B3R K;  2EHG A;  2V7Y A;  3SBT A;  4H03 B;  1KAZ A;  5BR8 K;  2I5J A;  3OYC A;  4IFE A;  4DU3 A;  2FBT A;  3VQ7 A;  2B4J A;  3QBW A;  3R9P A;  5LJV A;  1CZB A;  4B9N A;  3VA0 A;  3OYK A;  3I0R A;  3QFP A;  3PO4 A;  3C6T A;  3ZET A;  3HZ6 A;  1E4F T;  1NOZ A;  3AVN A;  3MEC A;  1XNR K;  1HLU A;  3L3V A;  4JHD B;  3VEX A;  5LJW A;  4Q5V A;  4K25 A;  5ELZ A;  5EX5 A;  5BRE A;  4DV3 K;  1ZC6 A;  4M45 A;  1D4X A;  5TKW A;  3LDS A;  1S1T A;  3RRH A;  1GLE G;  3ULE A;  5AQH A;  5GIP A;  3NHG A;  1SAZ A;  2QWN A;  3AGR A;  5F0X A;  3GE1 A;  4GKJ K;  2QWP A;  2F8S A;  3EY1 A;  5M1N A;  3VGL A;  4DTP A;  2B5J A;  5EXW A;  3R6M A;  3BP8 A;  2ETJ A;  3CFP A;  2KFZ A;  1VQ7 N;  2FXU A;  4H0P A;  3NE6 A;  3BGR A;  4DB3 A;  4XH1 A;  5AQJ A;  3UKU A;  3I55 N;  4DS4 A;  3NMU A;  1VQ9 N;  2HNY A;  1BUP A;  1VQ4 N;  4CF8 A;  5DMR A;  2PYJ A;  1B9D A;  3TAN A;  1WSF A;  1WBD A;  4CJW A;  2D5R A;  3O9S A;  3VQ9 A;  2X78 A;  1HNV A;  4PY5 A;  2A5X A;  3WUH A;  3BEX A;  4JHD A;  3LP1 A;  3VQ5 A;  3CCJ N;  4BRL A;  4CK3 A;  3V9W A;  4QS8 A;  1VQ6 N;  5KPR A;  4FJG A;  4YOX A;  2FBY A;  3ZX0 A;  2PBD A;  4CZF A;  1UOC A;  3TI0 A;  3DWL A;  5FPD A;  3W0L A;  3D2F B;  2HVH A;  1U04 A;  1JLQ A;  4DQ8 A;  5BPL A;  1LOT B;  3Q7B A;  5AQO A;  4XH4 A;  5AFU H;  3T1A A;  3O4Q A;  4KTW A;  5H1S Q;  4JI0 K;  1RBV A;  1Z25 A;  2GWK A;  3CF5 L;  4DTN A;  3HST B;  4HWI A;  1WB9 A;  3CCM N;  2Q3S A;  3JAM O;  4IG0 A;  2YJF A;  1JLE A;  2DTU A;  1KLM A;  3H3N O;  2W42 A;  4FJ8 A;  1NGB A;  4PL7 A;  4FL9 A;  3QBX A;  4I6M A;  1M90 O;  3A5L C;  3DYA A;  1VRT A;  2P5O A;  3D2E A;  3AO4 A;  4CZL A;  3O3F A;  1LW2 A;  3UB5 A;  4I9L A;  4B1V A;  2DPN A;  1SV5 A;  4CHY A;  5KPZ A;  4H4M A;  4CFA A;  5LL6 Z;  4J2E A;  2VGM A;  1DT9 A;  4KTQ A;  3VEO A;  1H1V A;  1ZBS A;  3A8Y A;  4FM2 A;  3PX0 A;  1HNZ K;  3G4S N;  5I3U A;  1NK7 A;  3P39 A;  5IT9 O;  1GLL O;  3HPH A;  5KQ8 A;  3THX B;  1HUX A;  1DTQ A;  3OYF A;  1L3T A;  1IKX A;  1C1C A;  3PSI A;  2ZGY A;  3IUC A;  5AQY A;  2F9W A;  4DSJ A;  1HYV A;  4M3Y A;  3RWU A;  4BAC A;  3O9U A;  2KZZ A;  2YHY A;  2D0C A;  4KHP K;  4CGH A;  4M63 C;  3LP2 A;  3EEQ A;  4CCH A;  2VWK A;  1RDU A;  3DRP A;  4IEE A;  4NLC A;  1TAQ A;  3AAQ A;  4XEI A;  3O4N A;  3HI0 A;  4K42 A;  1YIT N;  3L4Q A;  2G8U A;  5K14 A;  4BR0 A;  3MK6 A;  3IDH A;  3C7N A;  3U3Y A;  3K5L A;  3NF8 A;  3KTQ A;  4B9Q A;  2ASM A;  4FWO A;  3VPZ A;  3SUQ A;  1EWR A;  4B8C A;  3THY A;  2A41 A;  3TAM A;  1NKC A;  3FLC O;  4FJL A;  3VQ4 A;  4AHV A;  2P9N A;  3H45 C;  2YKM A;  1HKC A;  2VCP A;  4LF5 K;  2GBZ A;  4N56 A;  2VQE K;  1YAG A;  3CCE N;  1QTM A;  4Z4E A;  1VQK N;  2O8D A;  4JNE A;  3NF7 A;  4BQZ A;  3HK2 A;  1TKD A;  3HVT A;  2NRH A;  2RE2 A;  3HTV A;  4BQL A;  1VRU A;  1XNQ K;  1BIS A;  1XHX A;  4YY3 K;  3P83 D;  2HHV A;  4KPY A;  5JS1 A;  4DQQ A;  2HBL A;  2H3G X;  1IG9 A;  2NRX A;  1NNE A;  5AR0 A;  3TAE A;  4A62 A;  3E9P A;  4J2B A;  3TSP A;  3VER A;  3LDQ A;  4CHZ A;  3SCX A;  3MX5 A;  2Q0U A;  4CF0 A;  2VYP A;  4JKA A;  4BC2 A;  4FZY A;  5AQI A;  4CJK A;  3E1Y A;  1T44 A;  2HND A;  2VG7 A;  4KH5 A;  2HBJ A;  4E1N A;  4Z94 A;  3MMV A;  1DTT A;  2RKI A;  4YDU A;  2PAV A;  3AVM A;  4KHU A;  1RDA A;  1WSI A;  4CEZ A;  4CZG A;  4CJ3 A;  3O6W A;  1S6P A;  4NYF A;  4JAX A;  1YIJ N;  1OVY A;  2P9S B;  4FJM A;  1VQP N;  1X3M A;  3ENO A;  1IBL K;  3OTO K;  2IIR A;  1FJG K;  1LWE A;  1NGF A;  2VGN A;  1HJO A;  4A2B A;  1X1P A;  1S9E A;  5AQX A;  5EU7 A;  4OVL A;  4FJH A;  1KSP A;  2CH6 A;  3THW A;  3L0Q A;  4FWL A;  1T05 A;  1KQS M;  1Q7Y O;  2EX3 A;  4FVM A;  4B9T A;  1NGH A;  3TPQ A;  2GTD A;  3O3H A;  3IS9 A;  3LPU A;  4GKK K;  2F4V K;  3CM6 A;  4KI6 A;  1HKB A;  1TVR A;  4FLW A;  2QEX N;  1KFD A;  1Z05 A;  4NLB A;  1REV A;  2ITM A;  4CZM A;  5C12 A;  3C6A A;  5CYQ A;  1S1W A;  3AVJ A;  2ZJQ L;  4A57 A;  3GBT A;  4RW7 A;  5GAD P;  2D4W A;  4YOV A;  3VQD A;  3D6R A;  3FZL A;  4JI6 K;  1NGJ A;  2ASO A;  3FE1 A;  1TAU A;  3AY9 A;  3DXM B;  2VG5 A;  3CFR A;  1VSM A;  1DEJ A;  4GY2 B;  2RHK A;  3LDP A;  4WQ4 C;  2QWO A;  4MLE A;  4DTR A;  4E19 A;  1ZBH A;  1BOT O;  4JKF A;  4V19 S;  2QA4 N;  4R5P A;  3QER A;  2X6N A;  2P9I B;  1HX1 A;  1VSJ A;  1RFQ A;  1DLO A;  3RTV A;  4M7X A;  1N34 K;  1LAW A;  5C24 A;  2YHB A;  2GX9 A;  4CE9 A;  4CJ4 A;  1XC3 A;  5J1E A;  3CQ8 A;  2Z1I A;  2UYT A;  3VQA A;  4E89 A;  5J2P A;  1CZ9 A;  4DV7 K;  4EP4 A;  4IFV A;  1C0M A;  4M7Y A;  4CJU A;  1SKS A;  5T7B A;  3C6U A;  5BPN A;  3ZX2 A;  4CZI A;  5BRD A;  3NH2 A;  5D3G A;  3H46 O;  4JRP A;  3R8E A;  1BG3 A;  1K9M O;  3NVM A;  2P9L A;  1UWB A;  3OYI A;  2PY5 A;  4C1N I;  3A0I X;  4JI2 K;  4IJN A;  4BRN A;  4LY7 A;  3S3M A;  2DY4 A;  3TWH A;  3VEZ A;  2P9I A;  1JL2 A;  1EXQ A;  1CXU A;  3N4P A;  2A3Z A;  4FK2 A;  1Y97 A;  3ID6 A;  3HYF A;  4C1N K;  3SV3 A;  3DLB A;  2OTJ N;  1TK5 A;  3TTF A;  2XY5 A;  4BRI A;  3SQ2 A;  5AQK A;  3OJS A;  3M6G A;  3G10 A;  4NCB A;  1GLD G;  4DKW A;  3L2R A;  4DSK A;  3QEP A;  3CCV N;  4JKG B;  4LF7 K;  3QET A;  3ZSY A;  3I56 N;  1IKY A;  4DV6 K;  1SKR A;  4ISE A;  1A5V A;  4E7I A;  1LV5 A;  4CJ7 A;  3RR7 A;  1W0H A;  3MEG A;  3DLL L;  2XY7 A;  3O1W A;  3H3O B;  1XHZ A;  5FRM A;  4Z4C A;  4DSL A;  1YHQ N;  1KRP A;  3FZM A;  5B8H A;  2QWR A;  3FZF A;  2Y1J A;  4CJS A;  2HF4 A;  4NXN K;  1S1U A;  3CC4 N;  3CJC A;  4C8N A;  3LAN A;  3QEV A;  3KLI A;  4FLV A;  3TAR A;  4FJ5 A;  3N4Q A;  1NGD A;  3OYN A;  4ILH A;  4LSN A;  4W5R A;  3AAR A;  3FGU A;  5CHI A;  1X3N A;  4BY9 C;  4Y0W A;  4M41 A;  2HHX A;  2NRZ A;  2OPQ A;  4XH5 A;  5AQM A;  4BR7 A;  3J80 O;  2Q36 A;  4CEB A;  1KFS A;  3OS2 A;  4W5T A;  4QS9 A;  4B9S A;  3EKU A;  5F1X A;  4FLZ A;  4ZTJ A;  4LFA K;  3K9K A;  1XWL A;  1BI4 B;  2BGG A;  3NGY A;  4E7K A;  4FZZ A;  5JS2 A;  5JMV A;  5GIO A;  4FVU A;  3PSF A;  1LW0 A;  4CIG A;  4CZH A;  3SBG A;  2GEM A;  4FYD A;  4KBO A;  1NK0 A;  4C8K A;  5AQG A;  4DV4 K;  1GOB A;  4AM6 A;  1NJI O;  3G0Z A;  3HOS A;  2FC0 A;  3LDL A;  1WSG A;  4OO1 J;  1KAY A;  2VG6 A;  3L3U A;  1RBR A;  5HRN A;  5FPN A;  1SZ2 A;  3NBP A;  4U67 L;  3NH1 A;  2ZJP L;  4OPH A;  4DTX A;  3K0S A;  3V9U A;  4PUO A;  4OLA A;  3T7Z A;  2O8C A;  3MN5 A;  4B9M A;  4X65 K;  1C0T A;  3CET A;  4NXM K;  3CJ1 A;  2J4R A;  3CJB A;  4X62 K;  3UIQ A;  1K8K B;  4LF4 K;  2YX6 A;  1ITG A;  4DV0 K;  1YJN N;  1KVB A;  2WON A;  3O3G A;  1KCF A;  5HLF A;  3WT0 A;  1HNW K;  3BUZ B;  4B8A B;  1ATS A;  2VWJ A;  2BAN A;  1GOA A;  1IBM K;  4HCB A;  2ZF5 O; 
#chains in the Genus database with same CATH homology
 2HBM A;  2NZT A;  5AQQ A;  4CZF A;  4MO4 A;  1TYQ B;  4BG9 A;  3DWL A;  3QB0 A;  3W0L A;  5FPD A;  3D2F B;  4DQ8 A;  1X9J A;  4B1Z A;  3EN9 A;  5BPL A;  1LOT B;  3Q7B A;  5AQO A;  3VET A;  4XH4 A;  1U2V B;  3BF3 A;  3R3L A;  5AFU H;  4B1X B;  5AZI A;  3T69 A;  5H1S Q;  3O9R A;  3O9T A;  4A2A A;  4IOC L;  3ZET B;  5BN8 A;  2E2O A;  1MWK A;  2GWK A;  3DXK B;  1C0F A;  3CF5 L;  4HWI A;  2NRT A;  4EFH A;  3CCM N;  3S41 A;  4IEI A;  4YOT A;  3GOI A;  4QS7 A;  4IDH A;  2YJF A;  5GAH P;  2HST A;  2P9P A;  3VGK A;  3CME N;  2KLA A;  4MO5 A;  3MCP A;  3CI5 A;  3H3N O;  1NGB A;  4H0T B;  4PL7 A;  3I33 A;  4FL9 A;  2D0O A;  4DHY A;  3QBX A;  4I6M A;  2ASP A;  3A5L C;  2P9K A;  3ULE B;  5AQT A;  1M90 O;  3MCA B;  2NLX A;  2A40 A;  3D2E A;  4CZL A;  4R79 A;  5DM7 L;  3J7Z O;  3UKR B;  3UB5 A;  3O5B A;  1NM1 A;  4CD3 A;  2Q31 A;  3JXU A;  4B1V A;  4CD1 A;  4FWR A;  2DPN A;  2YI1 A;  3VF4 A;  3D7E O;  4BR4 A;  1QQN A;  4BRC A;  5KPZ A;  3CC7 N;  4WFA L;  1NGA A;  3W3D A;  3G6E N;  4BVP A;  3CCQ N;  4PHT X;  4FSV A;  1YJ9 N;  1ESV A;  3CPE A;  4WFN L;  2VGM A;  3TTD A;  1DT9 A;  3UKU B;  3VEO A;  1H1V A;  1ZBS A;  3A8Y A;  3VEV A;  4WQ4 A;  1VQN N;  3G4S N;  5HOO A;  3P39 A;  2QWL A;  2YJE A;  1GLL O;  5KQ8 A;  1HUX A;  2YCH A;  3KK7 A;  4FWS A;  3HRG A;  2CGK A;  1GLJ O;  3DXK A;  2ZGY A;  3IUC A;  5C10 A;  4BRK A;  3O80 A;  5AQY A;  2F9W A;  3H1V X;  3IKM A;  2I7N A;  2OTL N;  1LCU A;  3O9U A;  1EO1 A;  3U9Z A;  5C2D A;  2YHY A;  3KWI A;  2NRW A;  1YVN A;  4JN4 A;  4FPB A;  3CER A;  1NBW A;  1E4G T;  5C2F A;  3AGK A;  4M63 C;  2AA4 A;  1SQK A;  2HMP A;  5FPE A;  4H5R A;  4BRG A;  3HSC A;  1RDU A;  4JK9 A;  4GV9 A;  4BRA A;  2ZGZ A;  4IEE A;  4NLC A;  4BRD A;  2Q97 A;  3AAQ A;  1N8R O;  3VMF B;  2P9S A;  4U7B A;  4XEI A;  4AF1 A;  2IVP A;  1HKG A;  1Q18 A;  1BU6 O;  3HI0 A;  4K42 A;  4L3Q A;  1YIT N;  4O8U A;  4A5B A;  4BR2 A;  3L4Q A;  4BR0 A;  2HF3 A;  3MK6 A;  2E88 A;  3C7N A;  3EL2 A;  3IDH A;  5AQS A;  2QWM A;  5I9E B;  2QTD A;  2HBK A;  2AP1 A;  3VTI A;  1ATR A;  1R59 O;  2WUS A;  3OA9 A;  2E1Y A;  4FWP A;  4B9Q A;  2ASM A;  2IVN A;  4FWO A;  3VPZ A;  4JKB A;  3VEY A;  1YJW N;  2A41 A;  3J8A A;  1WOQ A;  3FLC O;  3RVC A;  1W97 L;  2P9N A;  3H45 C;  4FWK A;  1JCF A;  4MDA A;  3GG4 A;  1K8A O;  3MWT A;  1V4T A;  2P9P B;  1HKC A;  2VCP A;  3B8A X;  3DAW A;  5AQN A;  1YF5 L;  3CPW M;  3F9M A;  3CXC M;  1V4S A;  4WYB A;  1YAG A;  3CCE N;  4BRH A;  5JIC A;  4JKH A;  3CCS N;  4YOY A;  3IMX A;  3ATV A;  1W2B M;  1VQK N;  3EKS A;  4I6M B;  3O1B A;  4JNE A;  3WXK A;  3ZYY X;  3EZW A;  4EHT A;  4FO0 A;  4IJA A;  3D2E B;  4WQ5 A;  2P9U A;  1S72 N;  4EHU A;  3SMS A;  4BQZ A;  1J6Z A;  3HBT A;  2NRH A;  2RE2 A;  3HTV A;  3KHY A;  4BQL A;  4ISG A;  1BO5 O;  2HBL A;  2H3G X;  3CIP A;  3FZK A;  5BRH A;  4BGA A;  2NRX A;  2JWK A;  4FWQ A;  3SK3 A;  3CMA N;  1BDG A;  3DXM A;  5AR0 A;  3F5T A;  4A62 A;  3E9P A;  2CH5 A;  3KVG A;  3TSQ A;  1Y64 A;  3TSP A;  3VER A;  3CCR N;  3LDQ A;  1K73 O;  3MX5 A;  3M1F A;  2Q0U A;  4IO9 L;  2VYP A;  4JKA A;  4BC2 A;  3SAH A;  5AQI A;  1Q86 O;  3E1Y A;  3WEE A;  1T44 A;  1NGC A;  4IWV A;  2D1K A;  2YHX A;  4KH5 A;  2HBJ A;  3EO3 A;  1XQS C;  4FOE A;  1VQ5 N;  4Z94 A;  3Q7C A;  1BA0 A;  3O9Q A;  3WQT A;  1MWM A;  4YOR A;  3MN9 A;  1Z6R A;  3CJ9 A;  3MMV A;  3CD6 N;  3ID8 A;  1NWK A;  4PKI A;  5KQD A;  3ATU A;  3R1X A;  4YDU A;  3WXI A;  3AAP A;  4WQ5 C;  1QQO A;  3LM2 A;  4H0X B;  3WXL A;  2PAV A;  1KXP A;  4WFB L;  1GLF O;  3FFK B;  4BC3 A;  1DGK N;  2V7Z A;  3MX2 A;  4CZG A;  3O6W A;  3EE8 A;  4JAX A;  1BA1 A;  1OVY A;  4BRM A;  1YIJ N;  3VES A;  5AQP A;  2P9S B;  1C0G A;  1VQP N;  2I7P A;  1X3M A;  3ENO A;  2GUP A;  3H1Q A;  5CE3 A;  2IIR A;  1NGF A;  1RDW X;  1U6Z A;  2VGN A;  1HJO A;  2HOE A;  2Q2R A;  4A2B A;  4BC4 A;  4EAH D;  1JCG A;  2A6A A;  5AQX A;  1Q81 O;  3EE9 A;  3C7N B;  3H6E A;  4IOX A;  4CI6 A;  1ILY A;  5F2R A;  4EIA A;  4FWN A;  4H5N A;  2CH6 A;  2BH1 A;  3L0Q A;  5ADX H;  2NNW A;  4FWL A;  4KH4 A;  1T6C A;  1JJ2 M;  3CJA A;  3VF6 A;  3CC2 N;  4JEP A;  3QDK A;  1KQS M;  1CZA N;  2FSJ A;  3M3Z A;  2P9N B;  1Q7Y O;  3G71 N;  3G25 A;  5EY4 A;  4IZ9 A;  1NGH A;  4BVO A;  3TPQ A;  3LDN A;  2GTD A;  2E20 A;  5M1Q A;  1YI2 N;  4YDU C;  1VAZ A;  2E2Q A;  5AQZ A;  4IOA L;  3DJC A;  3L4I A;  4H0Y B;  1GLC G;  1HKB A;  4JD2 A;  3FR0 A;  4JKC A;  3UE5 A;  1P8Z A;  2QEX N;  5JVG L;  1Z05 A;  2P9U B;  4NLB A;  4GVE A;  2FSN A;  2ITM A;  4CZM A;  5C12 A;  3C6A A;  2V52 B;  4O8K A;  1YUW A;  5AQR A;  3CQY A;  3WXM B;  4A57 A;  4CZJ A;  2ZJQ L;  3GBT A;  3E9O A;  3JS6 A;  5BR9 A;  5GAD P;  2D4W A;  4A61 A;  4YOV A;  1G99 A;  2WC9 A;  3PIO L;  4NB4 A;  3D6R A;  3FZL A;  1T3V A;  1NGJ A;  2ASO A;  3FE1 A;  4GV3 A;  3AY9 A;  3C0B A;  3DXM B;  4JKG A;  3CCU N;  1M1K O;  3U4L A;  3VOV A;  1JCE A;  2KKZ A;  3OBY A;  3PLA A;  1DEJ A;  4GY2 B;  4HTL A;  2RHK A;  4JK8 A;  1XUP O;  3LDP A;  5JLH A;  5BPM A;  4WQ4 C;  2QWO A;  3ZEU B;  3WQU A;  4GV6 A;  4MLE A;  4JKE A;  4F9O A;  3WEE B;  4IXC A;  4CBX A;  2FF6 A;  1BOT O;  4NO7 A;  3SJH A;  5BN9 A;  4JKF A;  2QA4 N;  3VEW A;  5ADX A;  2P9I B;  1HX1 A;  3CHW A;  5E84 A;  1RFQ A;  1ATN A;  3VTH A;  4M7X A;  2A42 A;  1QZ5 A;  4PKG A;  3E9L A;  4JK7 A;  3RSE A;  3SLC A;  2QWQ A;  5C0Y A;  5EVZ A;  2YHW A;  4K43 A;  2GX9 A;  2FF3 B;  1XC3 A;  2ZJR L;  3C65 A;  5KPT A;  2GEL A;  2UYT A;  3OHR A;  5GAG P;  5EOY A;  4M7Y A;  4C23 A;  3F2K A;  4A5A A;  3E66 A;  2BUP A;  3I8B A;  2NRV A;  2E2P A;  3CQX A;  1NGE A;  3HM8 A;  5LY3 A;  5BPN A;  3ZX2 A;  4CZI A;  4CBW A;  4FOI A;  5BRD A;  1KD1 O;  5AZJ A;  3H46 O;  3VGM A;  3R8E A;  5M1K A;  4IO8 A;  3GDQ A;  4B1Y B;  1YXQ A;  4BRE A;  1BG3 A;  4BR5 A;  1K9M O;  1VQ8 N;  3CCL N;  2D0P A;  5AQV A;  5TKY A;  3NVM A;  2BTF A;  4H5W A;  1OKJ A;  4YOU A;  2P9L A;  3BF1 A;  3IFR A;  4CBU A;  1NMD A;  4GNI A;  1MA9 B;  4MDB A;  5GIN A;  4C1N I;  3A0I X;  2F9T A;  3ZEU A;  2PFU A;  1VQM N;  4IJN A;  1HPM A;  4BRN A;  3VEZ A;  4JD2 B;  1IJJ A;  2P9I A;  3LDO A;  3SAF A;  2CGL A;  3A5N C;  3N4P A;  2A3Z A;  4OPA A;  4AM7 A;  4O5F A;  3ID6 A;  3QIC A;  2OTJ N;  2E8A A;  4C1N K;  1TUY A;  3TTF A;  2JWL A;  1DKG D;  3KWG A;  1O13 A;  3O08 A;  4BRI A;  3O8M A;  2WBN A;  2QXL A;  2OAN A;  2WFB A;  5AQK A;  4CZE A;  4RWT A;  2W41 A;  2FLO A;  5AQU A;  3M6G A;  5AQW A;  1GLD G;  3U9D A;  4BRP A;  4DKW A;  3KZB A;  2E1Z A;  2Q1N A;  2QW9 A;  3K9J A;  2QI2 A;  3OBW A;  1GLA G;  2W40 A;  4FPA A;  4JKG B;  3CCV N;  4BR9 A;  2EWS A;  4JKD A;  1ZXO A;  3I56 N;  3QFU A;  3P31 A;  1RGI A;  4ISE A;  5GAE P;  1TUU A;  1NGI A;  4CJ7 A;  3DLL L;  5E26 A;  3O1W A;  1S3X A;  3H3O B;  5MLC Q;  4WF9 L;  1YHQ N;  5HL7 L;  3FZM A;  5B8H A;  1SS6 A;  2QWR A;  3FZF A;  3SAG A;  4FWM A;  4ISF A;  4MLH A;  1QVF M;  1K8K A;  2VWB A;  2HF4 A;  3LM9 A;  3MN7 A;  2V51 B;  4WCE L;  4BC5 A;  1MDU B;  4B1U B;  4DCH A;  3CC4 N;  3CJC A;  3C6H A;  3RSE B;  1KAX A;  5DM6 L;  3N4Q A;  1NGD A;  4ILH A;  4BRQ A;  5AQF A;  2V7Y A;  3AAR A;  3SBT A;  3FGU A;  4H03 B;  4CZK A;  1KAZ A;  1P90 A;  5CHI A;  4H0V B;  5JVH L;  1X3N A;  4BY9 C;  4K41 A;  4Y0W A;  1QZ6 A;  4J8F A;  3U8X A;  5M1F A;  3ENH A;  3VEN A;  2NRZ A;  2GWJ A;  4XH5 A;  1TYQ A;  5AQM A;  4BR7 A;  3M5R A;  5JLF A;  3D2F A;  4IFE A;  1KC8 O;  5AZJ B;  3P4I A;  1GLB G;  2Q36 A;  1IG8 A;  3QBW A;  1U2V A;  3R9P A;  3HOT A;  2QM1 A;  4QS9 A;  5LJV A;  5AFU A;  3EKU A;  5F1X A;  3MDQ A;  3CJ7 A;  4UY8 O;  3MN6 A;  3QFP A;  4KH6 A;  3ZET A;  2P9L B;  3HZ6 A;  5M1P A;  1QVG M;  1E4F T;  3K9K A;  3WXJ A;  3P38 A;  3NVK A;  4H0O A;  1HLU A;  3MWP A;  4JHD B;  3VEX A;  5JMV A;  5LJW A;  5GIO A;  4FVU A;  3QML A;  3SMP A;  4CZH A;  4K25 A;  2E2N A;  2GEM A;  5ELZ A;  5EX5 A;  3SBG A;  4E1J A;  5BRE A;  3ENB A;  4KBO A;  5C15 A;  1ZC6 A;  3ZX3 A;  4PKH A;  3TSU A;  2CGJ A;  5AQG A;  2KHO A;  1NLV A;  1D4X A;  5TKW A;  1BWF O;  4AM6 A;  1NJI O;  1GLE G;  3ULE A;  5AQH A;  5GIP A;  5BRF A;  1SAZ A;  2QWN A;  3AGR A;  3HOS A;  5F0X A;  3LDL A;  2NRR A;  1T6D A;  1VQO N;  3GE1 A;  4OO1 J;  3OW2 M;  1NGG A;  2F7T A;  3UKR A;  1QHA A;  4H5V A;  3TTC A;  4BG8 A;  1KAY A;  2QWP A;  4BGB A;  5M1N A;  3VGL A;  2IVO A;  3TU5 A;  5EXW A;  1SZ2 A;  5FPN A;  5AZI B;  3R6M A;  5FPM A;  3BP8 A;  4U67 L;  1EQY A;  3GL1 A;  2ZJP L;  4BRO A;  1VQ7 N;  2FXU A;  4H0P A;  4OPH A;  1VQL N;  4LC9 B;  4DB3 A;  4XH1 A;  5AQJ A;  3UKU A;  3I55 N;  3NMU A;  3T7Z A;  1VQ9 N;  4RCH A;  3O4W A;  3MN5 A;  1BUP A;  4B1W B;  1VQ4 N;  1WUA A;  1Q82 O;  4ILG B;  3CET A;  2ZWH A;  5CR4 A;  3CJ1 A;  2J4R A;  3A5M C;  3L6Q A;  4A59 A;  3CJB A;  2FSK A;  5M1O A;  1K8K B;  3O9S A;  2YX6 A;  2P9K B;  2A5X A;  3WUH A;  1YJN N;  3BEX A;  5AQL A;  4H5T A;  4YOW A;  4JHD A;  3PIP L;  3CCJ N;  3VF2 A;  4BRL A;  3LL3 A;  3WT0 A;  1QQM A;  3BUZ B;  1S22 A;  4QS8 A;  3FZH A;  4RTF D;  1VQ6 N;  5KPR A;  1ATS A;  4YOX A;  3A5O C;  2Q0R A;  3ZX0 A;  4BRF A;  4G9Z A;  4PL8 A;  2PBD A;  4ILJ A;  2ZF5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...