4BRPA

Legionella pneumophila ntpdase1 crystal form v (part-open)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
355
structure length
355
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 109
structure length 355
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brpA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brpA02
1ZXOA 2E1YA 1NM1A 5AQLA 4IO8A 5AQIA 4BQLA 2NRHA 4B1YB 1C0GA 3HI0A 4LC9B 1IG8A 4FO0A 3CETA 2CGJA 4FWOA 1RGIA 2ZGZA 2Q1NA 3ID8A 4ISGA 3CJBA 4CI6A 4FWSA 1NGBA 3CIPA 4XEIA 4MO5A 3EN9A 5AQHA 3VENA 2CGKA 2ASMA 1GLJO 3VGMA 2A6AA 2QWMA 1QQNA 4C23A 2FSNA 4K42A 4JHDB 4FL9A 3VF4A 3O5BA 3SLCA 3ATUA 5I9EB 1U6ZA 3L0QA 3TU5A 3MN6A 3WUHA 1NGIA 3EKUA 4BR4A 4Z94A 2UYTA 2ZF5O 1ATSA 3VGLA 3KHYA 4I6MB 3WXLA 5AZJB 4JHDA 5B8HA 4DQ8A 3FZKA 2Q31A 5ADXH 5BRFA 2Q0UA 1YXQA 1G99A 4PKIA 2A42A 3QDKA 4DHYA 3D2FB 4YDUC 4FSVA 5KQDA 3HZ6A 4BC2A 3FZHA 3MN9A 4NB4A 5AQXA 5KPTA 1ATRA 3M6GA 4I6MA 4O5FA 2QWNA 1BU6O 4E1JA 1NGAA 4CZGA 1E4GT 2E2NA 2IVNA 3D2FA 3D2EB 1NGDA 4CBXA 5AQMA 5AQZA 1TUYA 3WXKA 2P9IB 3KVGA 2YHWA 3MK6A 4BRFA 3L6QA 4H5NA 4BREA 4GNIA 4BRGA 1T44A 2E20A 5BPMA 4FWLA 2IVOA 3R8EA 3D2EA 4WYBA 2VYPA 3VGKA 4CJ7A 4DCHA 1Q18A 2QWLA 3SMSA 1YAGA 5AQGA 3FLCO 4BR2A 3LDNA 2A40A 2P9IA 3CQYA 2YHYA 1LCUA 2D0OA 5AQQA 3LDOA 3FZLA 3L4IA 1NGHA 4BRIA 1NGGA 5AQNA 4A62A 1WOQA 3DWLA 1HX1A 1GLEG 3O1WA 5AQPA 4XH5A 4K41A 1XC3A 4WQ5C 3B8AX 4BG8A 2Q2RA 2P9UA 3CJCA 4H0XB 4HWIA 1KAYA 4H5WA 2ZWHA 1LOTB 3CERA 3FZMA 2KHOA 3VETA 2GUPA 4JD2B 3A5MC 1QQOA 4O8KA 3O08A 5AQOA 3CJ1A 3EKSA 3UKRA 3VERA 1TUUA 1SQKA 4FWRA 1GLLO 2IVPA 3H1VX 3HM8A 3HBTA 4JD2A 3QMLA 3ULEA 1V4TA 3QFPA 1BDGA 5BREA 1S22A 5EY4A 2J4RA 1HPMA 3HTVA 2H3GX 5E26A 1GLCG 1QHAA 5LJVA 2IIRA 5BRHA 3LDPA 3QB0A 2DPNA 3JS6A 3VPZA 4KBOA 1BA1A 3HSCA 4AM6A 4J8FA 4M63C 5JMVA 2A41A 3MMVA 2CH5A 1NGFA 2HOEA 1XUPO 1GLBG 3IFRA 1GLAG 2E2PA 2FLOA 3O80A 5EVZA 2QWPA 2AP1A 4JNEA 5AFUA 3VEYA 3VOVA 4CZJA 2FSJA 2HF4A 3A5OC 1D4XA 2HF3A 5F0XA 3VEZA 4BG9A 2QWRA 4FOIA 4EHUA 4PKGA 4PL8A 3DXMB 1NMDA 2EWSA 5BPNA 1DKGD 3G25A 3CHWA 2ITMA 2QWOA 4Y0WA 3O1BA 1HLUA 4QS7A 4EFHA 1QZ6A 4BROA 2P9SA 3DXMA 4F9OA 1SAZA 3U8XA 3BUZB 5JLFA 2FSKA 3WQUA 4BR7A 1MA9B 3A0IX 5AQFA 3S41A 5BRDA 4B1UB 4IJAA 4CD3A 1GLFO 2CH6A 2W40A 3LM2A 3QICA 3ZETB 3H3OB 2F9TA 3I8BA 3GL1A 1RDWX 3LM9A 2P9NB 3P4IA 3D7EO 3H46O 1J6ZA 3FFKB 4MLEA 5AZIB 2PBDA 4IJNA 4MLHA 4H5RA 4DB3A 5EXWA 2NLXA 4A2AA 4BRMA 3FE1A 4FWPA 4MO4A 3ZETA 3LL3A 5FPEA 4XH1A 3A5LC 2P9NA 3ENOA 1MWMA 5AZIA 4L3QA 4HTLA 1YVNA 4BRAA 2D4WA 3VESA 4BGAA 4H0TB 4K43A 3W0LA 1ATNA 4FOEA 3CQXA 2A3ZA 3U4LA 1HUXA 2OANA 5LJWA 4ISFA 2P9UB 4BGBA 5EOYA 1DGKN 5FPDA 3GE1A 3W3DA 2GELA 1ESVA 1OKJA 3GDQA 3DXKB 1DEJA 4EHTA 1C0FA 3UKRB 4H0OA 4H03B 3UKUA 1NGJA 4CZEA 5KPRA 2GWJA 3JXUA 2V51B 4RWTA 4ISEA 4H5TA 3A8YA 2VWBA 2V7YA 3MN5A 4IWVA 3ULEB 3ZX0A 1MDUB 2V52B 1NGEA 3RSEB 3DXKA 1WUAA 2GTDA 3FGUA 2Q97A 4H0PA 4B1ZA 4CBWA 4BRHA 2E1ZA 4JAXA 3LDQA 1Z05A 4CBUA 4EIAA 3H45C 2D1KA 4QS9A 2A5XA 5AQSA 4AM7A 3DJCA 3RSEA 2FXUA 1ZC6A 5BPLA 5LY3A 2YJFA 4BRNA 2FF3B 4CZLA 1IJJA 2PAVA 4WQ4A 4BRQA 4FWKA 3WXIA 5E84A 1RFQA 2YJEA 3VF2A 3VEWA 5ELZA 1S3XA 2ASPA 3H1QA 3UE5A 1CZAN 4GY2B 2GEMA 1HKCA 4RCHA 2YI1A 4QS8A 3OHRA 1U2VB 2YCHA 3LDLA 1NGCA 1HKBA 2E88A 3MN7A 4FWMA 3BF3A 4A61A 5F1XA 4IZ9A 4BC5A 4H5VA 3KZBA 5AQRA 2AA4A 2FF6A 2QXLA 2E8AA 1KAXA 1U2VA 5AR0A 5AQJA 3VEOA 1NLVA 5AFUH 1YUWA 3O8MA 3H6EA 4IXCA 4BVOA 5AQYA 2W41A 4BR5A 2P9SB 4BC4A 4CZMA 3EL2A 3VF6A 2P9KB 1EQYA 4BRKA 5EX5A 4FPBA 2ZGYA 5F2RA 4CZHA 2E2OA 3IDHA 4BC3A 2D0PA 2HMPA 4M7XA 4NO7A 5KQ8A 5AQTA 5BN8A 1K8KB 3DAWA 4M7YA 4H0VB 1NBWA 2P9KA 4B1XB 5AQWA 2ASOA 4CD1A 3FZFA 3F9MA 3GG4A 3QBWA 4EAHD 5ADXA 2QM1A 3J8AA 3VEVA 4CZKA 3VEXA 3R6MA 4JN4A 2E2QA 1TYQB 1JCGA 1K8KA 3QBXA 3QFUA 3WQTA 5JICA 3WT0A 1JCFA 1X3NA 4CZIA 1T6CA 3C7NB 3U9DA 3ENHA 1BWFO 3O4WA 1BA0A 3SJHA 1MWKA 5KPZA 3H3NO 1HKGA 1X3MA 2I7NA 5BR9A 1TYQA 3SK3A 5AZJA 5CE3A 1SZ2A 2CGLA 4BRPA 1QQMA 4BQZA 3ZX2A 3C7NA 3GOIA 1BUPA 3GBTA 1Y64A 3U9ZA 4YDUA 3R9PA 1H1VA 4FPAA 2P9PB 2VCPA 3CJ7A 3C0BA 4BRDA 3M3ZA 3CI5A 3BP8A 3EO3A 4B1WB 1BG3A 3UKUB 4A2BA 1HJOA 3CJ9A 1V4SA 2P9PA 2QWQA 3SMPA 4FWQA 3AAQA 5AQUA 5JLHA 3ZEUB 1T6DA 3WEEB 3ZX3A 2WUSA 3M1FA 5AQVA 3AARA 3AY9A 2QW9A 2BTFA 3I33A 1P8ZA 2Q36A 4CZFA 1KXPA 3ZEUA 3ATVA 3IUCA 1ZBSA 1BOTO 3WEEA 3BF1A 4BRCA 2GWKA 2Q0RA 2P9LB 4WQ4C 1KAZA 2NZTA 4FWNA 3TPQA 3WXJA 4BRLA 2YHXA 1R59O 2BUPA 3IMXA 3O6WA 3FR0A 4BR0A 5FPNA 5BN9A 4XH4A 1E4FT 2P9LA 5AQKA 2F9WA 4BR9A 4PKHA 1JCEA 4WQ5A 4B9QA 4H0YB 4RTFD 5TKYA 1X9JA 1QZ5A 1GLDG 3EZWA 5FPMA 4BVPA 1XQSC 3A5NC 3BEXA 3MCPA 1NWKA 2V7ZA 3UB5A 2I7PA 4PL7A 3AAPA 1BO5O 1Z6RA 3CJAA 3MDQA 4K25A 4B1VA
chains in the Genus database with same CATH superfamily
1TV6A 1ZXOA 3VQ7A 1NM1A 5AQLA 4BQLA 3VQQA 1D9FA 4B1YB 4FK4A 4LC9B 3PO5A 1IG8A 1M1KO 4B3MK 1YT3A 3CETA 3MEGA 4LH5A 1TGOA 2Q1NA 3EEQA 4DV2K 4G9ZA 5KGWA 4JS5A 3CIPA 4MO5A 3VENA 3VN5A 2CGKA 4FLZA 4OKEA 4KPYA 4K42A 4B8CA 1KVCA 1VSLA 3O5BA 2FBXA 3SLCA 2HHHK 4J2EA 3F9KA 3TAMA 1NGIA 4F8RA 3QIOA 5C10A 3KK7A 2VWJA 5LMUK 3KHYA 5AZJB 4JHDA 3KLFA 3TTDA 2Q0UA 4CK1A 1YXQA 1G99A 5J2MA 3VQ6A 3MDQA 5FRMA 4CJFA 5GADP 5AQXA 1CXQA 4AHTA 4E1JA 3C6AA 1NOZA 1B9DA 4ELTA 1FKOA 3TWHA 3D2EB 1J9AA 4IBNA 5AQMA 1TUYA 4AHSA 1HNVA 3CFRA 4BRFA 4H5NA 4BREA 4BRGA 3PX0A 1T44A 1OH8A 4AHVA 3THXB 2XO7A 1N6QA 3SBTA 3VQCA 3T1YK 1Q18A 3C6TA 3BZCA 4RW9A 4QAGA 3K59A 1OVYA 3LDNA 3KIOA 3CQYA 4X64K 3OYBA 1LCUA 3SPYA 5AQQA 4A5BA 3L4IA 4BRIA 3CCLN 1NGGA 4A62A 4I2PA 1HX1A 1VQMN 1GLEG 3G0ZA 2P1JA 5J2QA 4DSIA 4XH5A 1WLJA 4OGCA 1XNQK 2Q2RA 3RRGA 4H0XB 4H5WA 2YNFA 2ZWHA 5CR4A 4FZYA 3CERA 3AO5A 3QEPA 1ASUA 3O08A 3VQ4A 1SL0A 1LW2A 1S6QA 4FWRA 1GLLO 3O4NA 4CGIA 1BDGA 4DTUA 4CECA 5M1NA 2RPIA 3THWA 2G8UA 3HTVA 4B9MA 3RMDA 3TSUA 5E26A 4Q0BA 1BCMA 3EYZA 3SZ2A 1HYZA 3DLBA 5HRRA 3VPZA 4DV7K 5JMVA 4J8FA 2A41A 4CJ3A 3SI6A 2PYLA 2CH5A 4M45A 2UUAK 3HK2A 2HOEA 4CFCA 3O80A 5EVZA 2QWPA 3VOVA 4MFBA 1NK7A 1L3SA 3AO4A 1GOBA 1RTIA 2QWRA 3TI0A 4KHSA 4CF8A 3KKSA 4OJRA 4CEQA 5LL6Z 3DXMB 1KSPA 1JLAA 5BPNA 3WNEA 1RBSA 1QQCA 2Y1JA 2OZMA 1QVGM 3O3HA 4F3TA 1RDAA 3O1BA 4BROA 1WSIA 2HBJA 3VTIA 2OPQA 3KWIA 3ZSZA 1QVFM 3VQBA 2FSKA 5FROA 3WQUA 4BR7A 1YIJN 1GOCA 4PQUA 5BRDA 4YOUA 4DQQA 5C2FA 4M3WA 2X78A 4CEFA 4CD3A 4Z4GA 3LM2A 3H3OB 3N4PA 3GL1A 1RDWX 4YOWA 1XWLA 2NUBA 4CHPA 3D7EO 1LWCA 1J6ZA 1LWEA 4MLEA 2KLAA 2PBDA 4FJIA 4MLHA 5C15A 2JWKA 4JV5K 3OBWA 1VAZA 2HBKA 3FE1A 3ZETA 4XH1A 4OPAA 3K58A 3ENOA 4FM0A 1I94K 4HTLA 1YVNA 3LP3A 1FW6A 2HHTA 1VQNN 2PY5A 1YJ9N 4BGAA 1ATNA 2YV0X 3U4LA 3QIPA 2OANA 4BGBA 1O13A 2QA4N 3W3DA 2GELA 2HB5A 3QEVA 3H08A 3ZSWA 1DEJA 1C0FA 4H0OA 4GKJK 2NNWA 4CZEA 2VGNA 2F8SA 4HTUA 3JXUA 3ZX0A 2V7YA 2RN2A 2GV9A 3BDPA 4J2BA 3P1GA 3IRXA 3PV8A 1WUAA 2Q97A 3THWB 4ELVA 2VGMA 1XHXA 3LDQA 4CBUA 3LAKA 4NXNK 1UWBA 2A5XA 1F21A 2FXUA 1D8YA 3O9TA 3AO2A 3SYZA 1RCHA 3AVGA 4BRNA 2BGGA 2FF3B 1LWFA 1XNRK 2PAVA 1RFQA 3UE5A 3QNNA 4C1NK 3LZJA 3NVKA 2A1SA 3KLEA 1T8EA 4QS8A 3CCVN 1U2VB 1NGCA 3TAQA 2FBVA 4CHNA 4HVJA 3V9UA 2HBMA 3CXCM 3C65A 2AA4A 2QXLA 2E8AA 3OJSA 4CGFA 1RDCA 5AR0A 5AQJA 3K9JA 3O8MA 4BVOA 3HXMA 2F8TA 1X9MA 5AQYA 3J7AP 2JWLA 1OVQA 4FLVA 3OYAA 4Z4HA 4N47A 4B9LA 1VSHA 1TVRA 5KI6A 5EX5A 1OH6A 4JK9A 1Q82O 1N33K 2NRWA 2D0PA 3PSFA 2LSNA 4YOVA 3DAWA 3DLGA 4B1XB 3VQ5A 3VQEA 2ASOA 3FZFA 3QBWA 4EAHD 3R6MA 1BQNA 4KH6A 2D0BA 2E2QA 1K8KA 3QFUA 3QBXA 4JI5K 4IOAL 5GAEP 1X3NA 1SKSA 1T6CA 3OYGA 4K0KK 1BA0A 3SJHA 4CGGA 1ITGA 1KFSA 3AVLA 2I7NA 5BR9A 1TYQA 3OYFA 1SZ2A 2CGLA 3IS9A 3CCMN 3C7NA 1NK0A 3R3LA 1RT2A 3LWLA 1Y64A 2ITGA 3NHGA 4DUYK 5KGXA 4KAZA 3R9PA 5CY4A 4FVUA 4PHTX 4JRPA 3SQ2A 1VQ5N 2FC0A 4DTRA 1K6YA 3M3ZA 2DFHA 4BE0A 2F96A 4CJWA 5M1FA 3TAFA 3P83D 3O9RA 4BY9C 1L5UA 2P9PA 5D3GA 5HLFA 4FWQA 1KVBA 3BGRA 1HPZA 5MLCQ 2R7YA 1VSMA 3RMBA 2WUSA 4DS5A 3AARA 2QW9A 2BTFA 3OS0A 3NCIA 3I33A 3ZYYX 2O8CB 1KXPA 4B3TK 3B6OA 1WSEA 2OPPA 4F2RA 4BRCA 4JI6K 1TAQA 4U7BA 5SWMA 4JS4A 3SUNA 4YORA 3NF7A 1XHZA 4BR0A 3VMFB 3IG1A 3OYNA 4LFCK 1W97L 3OYJA 4H0YB 5TKYA 1IKVA 1QZ5A 3KK2A 4UY8O 3EZWA 3HP6A 4BVPA 3P31A 2PYJA 1QTMA 4C8OA 1NWKA 2V7ZA 3CC2N 2I7PA 3CJAA 1RT5A 2O8EA 4K25A 3M8SA 3RWUA 4PY5A 1U48A 5AQIA 2NRHA 4PA1A 5C0YA 3M8PA 1ZBIA 4W5QA 1C0GA 4FLTA 4B3RK 3ZSOA 4E7HA 4FO0A 1S5JA 2O4IA 1RGIA 2ZGZA 4KHWA 3OBYA 2IGIA 3ID8A 4ISGA 3CJBA 4CI6A 4FWSA 4XEIA 3KLIA 3EN9A 4NLBA 5AQHA 1NJWA 4WFNL 2QWMA 2YNHA 1QQNA 4KO0A 4C23A 3NMUA 3CC4N 3ULDA 3VF4A 1VQ9N 4CF1A 3ATUA 4Z4FA 1U6ZA 3TU5A 3MN6A 3MWTA 3WUHA 4I7FA 4CJ4A 3I55N 3F5TA 4BR4A 3OTOK 3DM2A 4FJJA 1TAUA 2ZF5O 3VGLA 4AF1A 4I6MB 3WXLA 1QS4A 3OJUA 5JS2A 3WNFA 1NG9A 1NKBA 4PKIA 4YDUC 3ZSQA 4CJSA 3HZ6A 5KPTA 3RVCA 3QEXA 4O5FA 3CMAN 4ID5A 1CZ9A 1BU6O 3SAHA 3JAMO 2WC9A 5J2PA 1NGAA 4LFBK 4CZGA 2O8BB 2E2NA 1FJGK 2IVNA 4N41A 4CBXA 1JXEA 3DLKA 4A57A 1KFDA 3MK6A 4KH5A 1YITN 3L6QA 2VQFK 4GNIA 3QNOA 2IVOA 4KI6A 3R8EA 3K57A 3D2EA 1RT1A 5EU7A 4DCHA 1VSJA 1YAGA 5AQGA 1RT6A 3FLCO 4BR2A 4ELUA 4LF5K 4DFMA 3E9PA 3U3GA 1KLMA 1LW0A 2D0OA 3THXA 5K14A 2EHGA 1QSSA 4CEDA 1EX4A 2WONA 5AQNA 3PX4A 5C25A 2JLEA 3O1WA 2WBNA 1J5OA 4CVNE 4K41A 4WCEL 4WQ5C 3B8AX 4BG8A 1VQKN 2P9UA 4IKFA 4CF0A 1LOTB 2QXFA 4HUGA 1WSHA 4HUEA 1QQOA 4JLHA 5AQOA 3CJ1A 3J7YP 3EKSA 3UKRA 4MQ3A 1G15A 4I2QA 1JL2A 4DR2K 2IOCA 2Q3SA 3HBTA 1UA0A 2KZMA 2B6AA 5BREA 5EY4A 3VA0A 4KTQA 2Z1JA 4FJLA 3QEWA 3SBGA 3G4SN 1BIUA 1QHTA 2XY6A 4IOXA 4YY3K 2ETJA 2NRXA 2ATQA 4CJVA 1BA1A 3HSCA 4AM6A 3MMVA 2ZM6K 1JKHA 2B5JA 3KJVA 1XUPO 3TARA 1VRUA 2X74A 1GLAG 3HPHA 4OVLA 4CEOA 3OYLA 4JNEA 1JLBA 4E1NA 4IG3A 2FSJA 3HP9A 3SV3A 1D4XA 5F0XA 1S1TA 4E3SA 3MAQA 4EHUA 1HYVA 1TKZA 1C0MA 1JLFA 5DM7L 1NMDA 2EWSA 3O9SA 3V81A 3DLLL 2DY4A 3TTFA 3N4QA 2QWOA 1S9GA 4M42A 4YNQA 1HLUA 2ZJRL 4DQRA 1QZ6A 2P9SA 3PLAA 3DXMA 3OW2M 2NRRA 1RTDA 4KHNA 3BUZB 1NK5A 3LAMA 4RW6A 4FW1A 5M1PA 3S41A 4B1UB 3TABA 1ZYQA 2CH6A 2X6SA 2F9TA 4CJEA 1EETA 2FBTA 3H46O 1JL1A 5AZIB 4AHCA 4M3YA 3RRHA 2ZJQL 4IJNA 4OPJA 3TAEA 1T7PA 4DB3A 4H5RA 2G8KA 4BRMA 2HNZA 1KQSM 4MO4A 4DV1K 1VQ7N 3AVKA 3NBPA 3LL3A 5FPEA 2A1RA 1NKCA 1Q8IA 4L3QA 4Y1CA 4DSKA 2YHBA 3QINA 4H0TB 4FK2A 4K43A 1Q9YA 3CQXA 3O3GA 1SKRA 4EZ9A 4W5NA 2P9UB 5HRPA 3HL8A 5EOYA 3THYB 1VSIA 3GE1A 1VHXA 1YJWN 1ESVA 3M8RA 1NJZA 3KLGA 3GDQA 3DXKB 2VWKA 3UKRB 2HW3A 4H03B 2HHVA 4EP5A 3AVCA 2V51B 1VSDA 4H5TA 3ASMA 4IEEA 2P5GA 1MDUB 4RW4A 3RSEB 1ZBLA 3CCEN 4Z0UA 4B1ZA 3K0SA 3OVNA 4JAXA 1W2BM 1O1WA 1Z05A 4AQYK 3ZSVA 1D9DA 4F4KA 4WF9L 3SUOA 5AQSA 1SUQA 1RBRA 3QLHA 1ZC6A 2E5LK 3ZCMA 3EE9A 2YJFA 4OKKA 4W5OA 4CZLA 1IJJA 4JK7A 1XC9A 3CFPA 3WXIA 3NH0A 1B92A 4DQPA 1S3XA 1BI4B 5C12A 4FLXA 3OHRA 4NLCA 2Z1GA 1IBKK 4B08A 2YCHA 3LDLA 3S3NA 2G8FA 3HT3A 2E88A 4Y1DA 3MN7A 3OA9A 4R5PA 3V9SA 4FVMA 5F1XA 1VQLN 3DLHA 1BCOA 1HQEA 2G8WA 4H5VA 4FLUA 3SAGA 1WB9A 2FF6A 1T05A 1S6PA 4FCYA 1U2VA 3LP1A 3VEOA 4IXCA 3ZT2A 4IFVA 5J2NA 2HHQA 3WXMB 4CHZA 4CJUA 2P9SB 1IKWA 4CZMA 3OY9A 4DUZK 3MXIA 2P9KB 3AVAA 4BRKA 2ZGYA 1SS6A 2UXCK 4JEPA 4DLEA 4M7XA 4NO7A 4C8MA 3TTCA 4DV5K 3R1XA 4M7YA 1EWRA 2O8DA 5AQWA 2KFNA 3ZSYA 4M41A 1HMVA 4FJ7A 3F9MA 3GG4A 5ADXA 3J8AA 4CZKA 4WE1A 2BE2A 2AJQA 3K9KA 3E1YA 4V19S 3L2WA 3VQDA 3U9DA 5FRNA 3ENHA 3O4WA 4DQSA 3H3NO 4FLYA 1Q7YO 2KKZA 3RMCA 1X3MA 4FJMA 4JKCA 3I0RA 1QQMA 1B9FA 4JKBA 4BRPA 4BQZA 4E89A 3SV4A 1XI1A 3E9LA 1BUPA 4CEEA 3D45A 4N5SA 4E1MA 1JLGA 4WFBL 3ID6A 1HNIA 3KD1E 4DWIA 3L2VA 2VCPA 3CJ7A 4KRFA 1S72N 1JXBA 4X62K 3CI5A 3EO3A 3AVHA 4A2BA 4DSFA 1KCFA 3UIQA 4R79A 4B1VA 5HBMA 2YHAA 1V4SA 1L3VA 1RTJA 4DV6K 3CCUN 3DYAA 3ZEUB 4DLGA 2P51A 1A5VA 1WSGA 3NH2A 4DR5K 4FJGA 3C94A 1S1UA 2HBLA 2UUCK 1Z25A 4BWMA 1P8ZA 2Q36A 4AHRA 3BF1A 4KKOA 2BDPA 2GWKA 4CIGA 4KHQA 1KAZA 1FXXA 4FWNA 2UXDK 4HUFA 3WXJA 1NK8A 1T03A 1DTTA 2O8CA 2O4GA 4LF8K 2E4LA 5FPNA 4XH4A 3E66A 1JLEA 3SQ4A 2GX9A 5J1EA 1TL1A 3A5NC 4GMJB 1VQ8N 3HM9A 1WSJA 3BZKA 4PL7A 4HCCA 1N5YA 3AAPA 4DQIA 4X66K 2E1YA 3M8QA 1U47A 3CM5A 1I3AA 3ISNC 1TL3A 4JRQA 3G71N 4JKAA 2CGJA 4FWOA 1IV0A 2HHUA 4JKFA 2QKKA 3IAYA 1RBTA 2XHBA 2O8DB 1DLOA 1YHQN 3VQ8A 3D6RA 1GLJO 3VGMA 1EXQA 3HRGA 2FSNA 3MX2A 5DK5A 1NU0A 4FL9A 1GOAA 1S1XA 5GAHP 5LMNK 1P90A 2OZSA 3C95A 3L0QA 4JI8K 4O44A 3MEEA 4JI7K 4F3OA 3CQ8A 4Z94A 1NMNA 2UYTA 1ATSA 4IFYA 1BQMA 2G8HA 4DQ8A 2KTQA 3FZKA 4FJKA 4G1QA 5BRFA 5ADXH 4CW7B 4DHYA 3D2FB 5KQDA 4BC2A 3FZHA 3MN9A 1ATRA 4FJXA 3CCJN 3M6GA 4I6MA 1N34K 3DOLA 3P39A 1E4GT 1HQUA 3THVA 1NGDA 1XMQK 5C42A 4DF8A 1VQ6N 1EO1A 1JLQA 1NK9A 2P9IB 3KVGA 4IEIA 4FLWA 4FJHA 2O8BA 3KWGA 3OS2A 5BPMA 3AGKA 4FWLA 4Z4IA 3VQPA 2VYPA 3VGKA 4CJ7A 3CMEN 3AA4A 1S1VA 2QWLA 3LP2A 4DSLA 2VG7A 4DFJA 1IG9A 4DTJA 4DR7K 4JKGB 3LDOA 3FZLA 4RW8A 1TKDA 3NF9A 1HYSA 3SPZA 3PIPL 2G8VA 4GVEA 3NF8A 4H8KA 4E7LA 3MCAB 3WNGA 5I3UA 5JVGL 4ID1A 3V1OA 5DMRA 3CJCA 5FDLA 4DFKA 4FJ8A 5IT9O 1KAYA 1N32K 3HVTA 3Q7BA 3T69A 3FZMA 3VQ9A 1U45A 1VSEA 1VSFA 2KHOA 2GUPA 4JD2B 3MXMA 3A5MC 1HR0K 1UA1A 4O8KA 4E7IA 4AHUA 1NJYA 5KTQA 2E6LA 2F4VK 4JKEA 5C2DA 4O0IA 3HSTB 3NGYA 4ZTJA 3KK1A 2KW4A 2IVPA 5CYMA 4DFPA 3HM8A 3ULEA 3QETA 3ZSXA 5HROA 1S22A 3T19A 1TKTA 3OYKA 2G8IA 4JYAK 2WOMA 1BHLA 3LDSA 4OO1J 2H3GX 5M1OA 4FZZA 1QHAA 4CHQA 4OX9K 1D5AA 4MDAA 4CERA 3QB0A 2DPNA 4FJ5A 4M63C 3TSQA 2O8FB 1NGFA 3AVMA 3IFRA 4CEBA 4FYDA 4FXDA 4DU4A 1ASVA 1I39A 2AP1A 1NNEA 2YX6A 5JVHL 3VEYA 4CZJA 3LZIA 1WN7A 1K8AO 2HF4A 4KHUA 2HF3A 3G6EN 4DF4A 3VEZA 4BG9A 4PKGA 2QK9A 4PUOA 1EP4A 3G25A 2YNGA 2ITMA 4Y0WA 1OH7A 4GV3A 5T7BA 4JI3K 4Z4EA 4I9QA 4EFHA 3LPUA 4C8NA 3NGZA 4BE1A 3DRSA 1SKWA 1DTQA 3NF6A 4HCBA 3ZT4A 4OLBA 3AVNA 2W40A 3QICA 3VQAA 3LM9A 2P9NB 1XMOK 4O5BA 3FFKB 4I9LA 3NAEA 5EXWA 2PZSA 3VTHA 5E41A 4A2AA 4IFEA 3T1HK 1TK0A 4CJTA 1J5EK 3F2KA 4LY7A 2IS3A 5AZIA 4GKKK 1A5XA 4DSEA 3CFOA 4BDPA 3S3OA 2WFBA 3VESA 1QSYA 3C6HA 4KFBA 2A3ZA 4LF6K 4CGJA 1C0TA 4M3TA 2Y1IA 4QOZB 4LF7K 4YOYA 3AVBA 1OKJA 3O3FA 4CGHA 1KLNA 1KC8O 4L8RB 3HPOA 4DV3K 4CF2A 4JKHA 3UKUA 4E7KA 3THYA 1NGJA 3CPEA 3OYIA 2NRZA 4RWTA 4DTMA 3Q7CA 4K8XA 3A8YA 3MN5A 3ULEB 4IWVA 1FK9A 3DXKA 1YVUA 4RW7A 3SAFA 2GTDA 1RNHA 4CESA 1X1PA 4CK3A 2HNYA 4CBWA 4BRHA 2E1ZA 2YKMA 4UQGA 2OPRA 3H45C 2D1KA 3L2RA 3L3UA 2FBYA 3DJCA 3G10A 4AM7A 3RSEA 1VQ4N 3EE8A 5BPLA 5LY3A 2E6MA 1JJ2M 1RILA 4EZ6A 4FJNA 4WQ4A 4BRQA 2KFZA 5E84A 2RKIA 1Q86O 5ELZA 3MECA 5CHIA 3O4QA 1YI2N 2GEMA 4Z4CA 5HL7L 5DM6L 3ITHA 3NGIA 2UUBK 1BL3A 4OPKA 4DTXA 3RTVA 4CJQA 3AO3A 4A5AA 4FWMA 3BF3A 3JYTA 1BIZA 1OH5A 1UOCA 4IZ9A 5AQRA 2XY7A 1BI4A 3QERA 4FM2A 4ZTFA 4CJLA 4DR6K 3NE6A 1SL2A 3NH1A 1NLVA 1YTAA 4JI1K 3H6EA 4ILGB 2W41A 4BR5A 4IO9L 4K8ZA 1NOYA 4BC4A 4QCLA 4NCBA 2HMIA 5HRNA 4O55A 2UU9K 5F2RA 4CZHA 3KD5E 3CCQN 1C1AA 5KQ8A 5AQTA 3AVIA 2OTLN 2WTUA 4JI2K 2P9KA 1W7AA 1TK5A 5SZTA 4IDHA 4CD1A 1WSFA 2W42A 4XIUA 4C8LA 4JK8A 5M1KA 5GINA 3WQTA 4OKJA 1NKEA 5JICA 4CCHA 3KKRA 1R0AA 3RR7A 2DFEA 3K5LA 3TAGA 4FZXC 1KTQA 2OA8A 3OS1A 4M3XA 3M5RA 4Q5VA 1HNWK 1MWKA 2ZD1A 5HRSA 3AA5X 4LFAK 3V6DA 3A2FA 3J80O 3DRRA 3GOIA 3J81O 4DU3A 3U9ZA 2DTUA 1K73O 3KK3A 3TAPA 1H1VA 4FPAA 3WNHA 3ZSRA 2HHXA 1SL1A 3C0BA 4BRDA 1U04A 3V9ZA 3BP8A 1Q81O 3UKUB 4AILC 2I5JA 3E01A 3SCXA 2BH1A 3L2UA 3EY1A 3SMPA 3B6PA 5JLHA 4FW2A 4ILJA 3WEEB 1C1BA 4O0JA 1ASWA 5AQVA 3QEIA 3TR8A 2GUIA 5HOOA 4GW6A 4CZFA 1LV5A 4KB0A 3ZEUA 1ZBSA 3HJFA 2P9LB 3AVJA 1W9HA 3TPQA 4CJ5A 1E3MA 1ILYA 3TANA 1R59O 5IWAK 3O6WA 1VK0A 4KB1A 1CXUA 1TKXA 5AQKA 4PKHA 4B9QA 2HHWA 1X9JA 5FPMA 2F7TA 5A2QO 3V1QA 3BEXA 3MCPA 1CZBA 3UB5A 4BACA 5AJ3K 3KLHA 3TSPA 2HHSA 1BO5O 2ZJPL 3C6UA 4IO8A 1RTHA 4FJ9A 3E9OA 1RT4A 1WAJA 3HPGA 4CFDA 3NFAA 1A5WA 3HI0A 1CLQA 2X6NA 4J2AA 4KTZA 4KH4A 2D5RA 2UXBK 2KZZA 5GIOA 5FLXO 1NGBA 4CE9A 4OPHA 1BGXT 4OGEA 2ASMA 2A6AA 3K5MA 4JHDB 1YF5L 4IG0A 5I9EB 4CFAA 3EKUA 3SQ1A 1HNZK 1YTUA 5B8HA 1L3UA 4B3OA 3S3MA 3ZLJA 1ZBHA 2Q31A 2HVIA 4IDKA 2A42A 3QDKA 1HRHA 4FSVA 3I0SA 3P38A 5CYQA 4NB4A 4LF4K 3ZT0A 1EWQA 4YOTA 2QWNA 2DFFA 4E19A 3D2FA 3K2PA 4DTOA 4GV9A 5AQZA 1BISA 4B9UA 3WXKA 1MU2A 3IKMA 5H1SQ 4N56A 2YHWA 3LWMA 2E20A 4NYFA 3HOSA 3FFIA 4CJPA 3ZT3A 4WYBA 5TKWA 3SNNA 4CGDA 3SMSA 3AA2A 3AVFA 2W6LA 2A40A 2P9IA 2OPSA 3L3VA 3LPTA 4PWDA 4MDBA 4E7JA 2YHYA 2W6KA 1NGHA 4B8AB 4KHPK 1IBLK 1REVA 1WOQA 4NXMK 4B9NA 3DWLA 1QSLA 5AQPA 4JKGA 1NK6A 1YJNN 1XC3A 2KQ2A 5GAGP 1NJXA 4HWIA 1J53A 3AGRA 3VETA 1JLCA 3PUFA 3SUQA 3MXJA 2YKNA 3VERA 1TUUA 1SQKA 4M3UA 3H1VX 3J7ZO 4H4MA 4JD2A 1Y97A 4C8KA 3QMLA 3NVMA 1V4TA 3QFPA 2VG5A 3HO1A 2J4RA 1HPMA 2QTDA 4ILHA 1NJIO 3V9WA 1IBMK 3SQ0A 1GLCG 5LJVA 4JI4K 2IIRA 5BRHA 3LDPA 3JS6A 1DT9A 3AV9A 4KBOA 4BDYA 4CIEA 1HJRA 1S1WA 2Z1HA 4B9TA 2PFUA 3V9XA 1WBDA 2XY8A 3O9UA 1GLBG 4DTSA 4DSJA 2E2PA 2FLOA 3DLEA 3JSMA 4DR1K 5AFUA 3CPWM 4CEAA 3S9HA 2O8FA 3A5OC 4YFUA 3VA3A 3PY8A 4FOIA 4KTWA 4PL8A 4KV8A 1DKGD 1ZBFA 3CHWA 5KRTA 2ZQBA 1IH7A 3SUPA 4QS7A 4KREA 4J2DA 4F9OA 4DV0K 1SAZA 3ZT1A 3U8XA 5JLFA 2D0CA 1MA9B 3A0IX 5AQFA 2XY5A 2QKBA 3LALA 4IJAA 2RF2A 1U49A 4KHYA 1GLFO 1N36K 3ZETB 3I8BA 4CJRA 4O4GA 1Q9XA 4DS4A 3MWPA 3OYEA 3CM6A 3P4IA 4F2SA 4O8UA 1W0HA 1LAVA 3EZ5A 4B3SK 1FKPA 1X9SA 3DOKA 4WFAL 4CHYA 2NLXA 4LSLA 4FWPA 3T7ZA 1RT7A 3K5NA 3BY5A 4X65K 4DG1A 3A5LC 2P9NA 3OYCA 1KRPA 3MEDA 3PSIA 1MWMA 1UAXA 3PIOL 4BRAA 2D4WA 3W0LA 4FOEA 1RBVA 3L2QA 1HUXA 5LJWA 4ISFA 1SV5A 2NRTA 4OLAA 2NRVA 1DGKN 5FPDA 4BWJA 4HHTA 2OCEA 4A59A 3SJJA 4M3ZA 4EHTA 2IDOA 5JS1A 1HNXK 1C0UA 1KVAA 5KPRA 4JKDA 2RHKA 2GWJA 4NCAA 3LP0A 4ISEA 4N76A 2VWBA 5CZ2A 2V52B 4EP4A 1NGEA 4W5TA 3FGUA 3DLRA 4GVMA 1ZBUA 2IAJA 3CD6N 2GBZA 1WAFA 1IKYA 4DU1A 1C6VA 4B9VA 3NDKA 4U67L 3PO4A 2YNIA 4EIAA 1M90O 3O9QA 4QS9A 1C1CA 5GIPA 4NYNA 1VQPN 1NK4A 3AO1A 4W5RA 2B4JA 1TK8A 3HYFA 3QESA 3D0PA 4FWKA 4CJKA 2YJEA 3VF2A 3VEWA 3L8BA 3H1QA 2ASPA 3L4QA 1CZAN 4CEZA 4GY2B 3AA3A 4M3RA 2OTJN 1HKCA 4RCHA 2YI1A 3U6FA 4YOXA 1WNSA 3ENBA 1L3TA 1HKBA 2EX3A 3DMJA 4A61A 4JI0K 4BC5A 2D0AA 3KZBA 4B9SA 1KAXA 4DR4K 5C24A 4DMNA 4LSNA 5AFUH 1VQON 3OYHA 4DTPA 1YUWA 4DV4K 1EKEA 5M1QA 3EL2A 3VF6A 1EQYA 4FPBA 1IKXA 2E2OA 2XRIA 3IDHA 4BC3A 3HOTA 2HMPA 3ALYA 2OYQA 4YHHK 5BN8A 1K8KB 1J54A 4H0VB 4LH4A 1NBWA 4GV6A 1WBBA 1RT3A 2QM1A 3VEVA 2QEXN 3VEXA 3RR8A 2HNDA 3I8DA 4JN4A 1TYQB 1JCGA 4FM1A 3V4IA 4NCGA 1JCFA 3WT0A 4CZIA 2VQEK 1RBUA 3C7NB 3V1RA 1BWFO 1S9EA 4AH9A 5KPZA 3HVRA 4ZHRA 3DRPA 1HKGA 4CFBA 5AZJA 3SK3A 4BDZA 1X9WA 2P5OA 5CE3A 3F73A 1QE1A 3ZX2A 4CK2A 3GBTA 5KRSA 4YDUA 3DI6A 2RE2A 3CC7N 3QO9A 2BANA 3U3YA 1KD1O 3K5OA 3CCSN 2P9PB 2IC3A 5BR8K 5I42A 4B1WB 1BG3A 1T3VA 4IOCL 1Z26A 2HVHA 4TSXA 3PX6A 4CIFA 1HJOA 2JGUA 3CJ9A 1LAWA 4C1NI 4ICLA 4DTNA 2QWQA 5HP1A 3AAQA 3CYMA 5AQUA 3MX5A 2QI2A 1T6DA 4FK0A 3T1AA 1K9MO 3LANA 3ZX3A 3M1FA 3CG7A 2VG6A 3AY9A 3CCRN 4LF9K 4E0DA 3ATVA 4KI4A 3IUCA 3WEEA 1BOTO 3RMAA 4CHOA 2Q0RA 1VRTA 4WQ4C 4BE2A 2NZTA 4DKWA 4RG8A 1IO2A 1VSKA 4BRLA 1U4BA 2YHXA 1RDUA 2BUPA 3IMXA 3P5JA 4DR3K 3T3FA 3CF5L 3FR0A 5BN9A 3OYDA 1E4FT 2P9LA 4BR9A 2F9WA 1RDBA 1JCEA 1RDDA 3KTQA 4WQ5A 4CF9A 2O8EB 4RTFD 2HSTA 1GLDG 4LD0A 2ZE2A 1XQSC 3I56N 1N8RO 2Z1IA 4H0PA 1Z6RA 5CZ1A 3OYMA 4H4OA
chains in the Genus database with same CATH topology
1ZXOA 2E1YA 1NM1A 5AQLA 4IO8A 5AQIA 4BQLA 2NRHA 5C0YA 3E9OA 4B1YB 1C0GA 3HI0A 4LC9B 3G71N 1IG8A 1M1KO 4JKAA 4KH4A 4FO0A 3CETA 2CGJA 4FWOA 1RGIA 2ZGZA 2Q1NA 3OBYA 4G9ZA 4JKFA 3ID8A 4ISGA 3CJBA 4CI6A 5GIOA 4FWSA 1NGBA 3CIPA 4XEIA 4MO5A 4OPHA 3EN9A 4NLBA 5AQHA 3VENA 1YHQN 2CGKA 3D6RA 2ASMA 1GLJO 3VGMA 2A6AA 4WFNL 3HRGA 2QWMA 1QQNA 4C23A 2FSNA 3MX2A 4K42A 3CC4N 3NMUA 4JHDB 1YF5L 4FL9A 3VF4A 1VQ9N 3O5BA 5GAHP 1P90A 3SLCA 3ATUA 5I9EB 1U6ZA 3L0QA 3TU5A 3MN6A 3MWTA 3WUHA 1NGIA 3I55N 3EKUA 3F5TA 4BR4A 4Z94A 2UYTA 2ZF5O 1ATSA 3VGLA 3KK7A 4AF1A 5C10A 3KHYA 4I6MB 3WXLA 5AZJB 4JHDA 5B8HA 4DQ8A 3FZKA 3TTDA 2Q31A 5ADXH 5BRFA 2Q0UA 1YXQA 1G99A 4PKIA 2A42A 3QDKA 4DHYA 3D2FB 4YDUC 4FSVA 5KQDA 5GADP 3HZ6A 4BC2A 3FZHA 3MN9A 3P38A 4NB4A 5AQXA 5KPTA 1ATRA 3RVCA 3CCJN 3M6GA 4I6MA 4O5FA 3CMAN 4YOTA 2QWNA 1BU6O 4E1JA 3SAHA 2WC9A 3C6AA 1NGAA 4CZGA 3P39A 1E4GT 2E2NA 2IVNA 3D2FA 3D2EB 1NGDA 4CBXA 5AQMA 4GV9A 5AQZA 1TUYA 3WXKA 4A57A 1VQ6N 1EO1A 3IKMA 5H1SQ 2P9IB 3KVGA 2YHWA 4IEIA 3MK6A 4KH5A 4BRFA 1YITN 3L6QA 4H5NA 4BREA 4GNIA 4BRGA 1T44A 2E20A 3KWGA 5BPMA 3HOSA 3AGKA 4FWLA 2IVOA 3R8EA 3D2EA 4WYBA 2VYPA 3VGKA 5TKWA 3SBTA 4CJ7A 1Q18A 4DCHA 3CMEN 2QWLA 3SMSA 1YAGA 5AQGA 1OVYA 3FLCO 4BR2A 3LDNA 2A40A 2P9IA 3CQYA 3E9PA 4MDBA 2YHYA 1LCUA 2D0OA 5AQQA 4JKGB 3LDOA 4A5BA 3FZLA 2ZJPL 3L4IA 1NGHA 4BRIA 3CCLN 1NGGA 5AQNA 4A62A 1WOQA 3PIPL 3DWLA 4GVEA 1HX1A 1VQMN 1GLEG 3O1WA 2WBNA 3MCAB 4JKGA 5AQPA 4XH5A 5JVGL 4K41A 4WCEL 1XC3A 1YJNN 4WQ5C 5GAGP 3B8AX 4BG8A 2Q2RA 1VQKN 2P9UA 3CJCA 4H0XB 4HWIA 1KAYA 4H5WA 2ZWHA 1LOTB 5CR4A 3CERA 3Q7BA 3T69A 3FZMA 3AGRA 2KHOA 3VETA 2GUPA 4JD2B 3A5MC 1QQOA 4O8KA 3O08A 5AQOA 3CJ1A 4JKEA 3EKSA 5C2DA 3UKRA 3VERA 1TUUA 1SQKA 4FWRA 1GLLO 2IVPA 3H1VX 3J7ZO 3HM8A 3HBTA 4JD2A 3QMLA 3NVMA 1V4TA 3ULEA 3QFPA 1BDGA 5BREA 1S22A 5EY4A 2J4RA 5M1NA 1HPMA 2QTDA 3HTVA 4ILHA 4OO1J 2H3GX 1NJIO 3SBGA 3G4SN 3TSUA 5E26A 4IOXA 5M1OA 1GLCG 1QHAA 5LJVA 2IIRA 4MDAA 5BRHA 3LDPA 3QB0A 2DPNA 2NRXA 3JS6A 3VPZA 1DT9A 4KBOA 1BA1A 3HSCA 4AM6A 4J8FA 4M63C 3TSQA 5JMVA 2A41A 3MMVA 2CH5A 2PFUA 1NGFA 3O9UA 2HOEA 1XUPO 1GLBG 3IFRA 1GLAG 2E2PA 2FLOA 3O80A 5EVZA 2QWPA 2AP1A 4JNEA 2YX6A 5AFUA 3CPWM 5JVHL 3VEYA 3VOVA 4CZJA 2FSJA 1K8AO 2HF4A 3A5OC 1D4XA 2HF3A 5F0XA 3G6EN 3VEZA 4BG9A 2QWRA 4FOIA 4EHUA 4PKGA 4PL8A 3DXMB 5DM7L 1NMDA 2EWSA 3O9SA 5BPNA 3DLLL 1DKGD 3G25A 3CHWA 2ITMA 3TTFA 3N4QA 1QVGM 2QWOA 4Y0WA 4GV3A 3O1BA 1HLUA 4QS7A 4EFHA 1QZ6A 4BROA 2ZJRL 2P9SA 2HBJA 3PLAA 3DXMA 3VTIA 4F9OA 3OW2M 2NRRA 3KWIA 1SAZA 1QVFM 3U8XA 3BUZB 5JLFA 2FSKA 3WQUA 4BR7A 1MA9B 1YIJN 3A0IX 5M1PA 5AQFA 3S41A 5BRDA 4YOUA 4B1UB 5C2FA 4IJAA 4CD3A 1GLFO 2CH6A 2W40A 3LM2A 3QICA 3ZETB 3H3OB 2F9TA 3I8BA 3N4PA 3GL1A 1RDWX 3MWPA 4YOWA 3LM9A 2P9NB 3P4IA 4O8UA 3D7EO 3H46O 1J6ZA 3FFKB 4MLEA 5AZIB 2KLAA 2PBDA 2ZJQL 4IJNA 4MLHA 4H5RA 2JWKA 4DB3A 5C15A 5EXWA 3OBWA 1VAZA 2HBKA 3VTHA 4WFAL 2NLXA 4A2AA 4IFEA 4BRMA 3FE1A 4FWPA 4MO4A 3T7ZA 3ZETA 1KQSM 3F2KA 1VQ7N 3LL3A 5FPEA 4XH1A 4OPAA 3A5LC 2P9NA 3ENOA 1MWMA 5AZIA 4L3QA 4HTLA 1YVNA 3PIOL 4BRAA 1VQNN 2WFBA 2D4WA 3VESA 4BGAA 3C6HA 1YJ9N 4H0TB 4K43A 3W0LA 1ATNA 4FOEA 3CQXA 2A3ZA 3U4LA 1HUXA 2OANA 5LJWA 4ISFA 2P9UB 2NRTA 4BGBA 5EOYA 2NRVA 1DGKN 1O13A 5FPDA 3GE1A 2QA4N 4YOYA 3W3DA 2GELA 1YJWN 1ESVA 1OKJA 4A59A 1KC8O 3GDQA 3DXKB 1DEJA 4EHTA 1C0FA 3UKRB 4H0OA 4H03B 4JKHA 3UKUA 1NGJA 2NNWA 3CPEA 2VGNA 4CZEA 5KPRA 4JKDA 2RHKA 2GWJA 3JXUA 2V51B 2NRZA 4RWTA 3Q7CA 4ISEA 4H5TA 3A8YA 2VWBA 2V7YA 3MN5A 4IEEA 4IWVA 3ULEB 3ZX0A 1MDUB 2V52B 1NGEA 3RSEB 3DXKA 3SAFA 3CCEN 1WUAA 2GTDA 3FGUA 2Q97A 4H0PA 4B1ZA 3CD6N 4CBWA 4BRHA 2VGMA 2E1ZA 4JAXA 3LDQA 4U67L 1Z05A 1W2BM 4CBUA 4EIAA 3H45C 1M90O 3O9QA 2D1KA 4QS9A 4WF9L 2A5XA 5AQSA 4AM7A 3DJCA 5GIPA 3RSEA 2FXUA 1VQPN 1VQ4N 3O9TA 3EE8A 1ZC6A 5BPLA 3EE9A 5LY3A 2YJFA 4BRNA 1JJ2M 2FF3B 4CZLA 1IJJA 4JK7A 2PAVA 4WQ4A 4BRQA 4FWKA 3WXIA 5E84A 1RFQA 2YJEA 3VF2A 3VEWA 1Q86O 5ELZA 1S3XA 2ASPA 3H1QA 3L4QA 3UE5A 1CZAN 4C1NK 5CHIA 4GY2B 1YI2N 3NVKA 2GEMA 5HL7L 2OTJN 1HKCA 4RCHA 2YI1A 4QS8A 5C12A 5DM6L 4YOXA 3OHRA 4NLCA 3CCVN 1U2VB 2YCHA 3ENBA 3LDLA 1NGCA 1HKBA 2E88A 3MN7A 3OA9A 4A5AA 4FWMA 3BF3A 4A61A 1VQLN 5F1XA 4IZ9A 4BC5A 4H5VA 3KZBA 2HBMA 5AQRA 3C65A 2AA4A 2FF6A 2QXLA 3SAGA 3CXCM 2E8AA 1KAXA 1U2VA 5AR0A 5AQJA 3VEOA 1NLVA 5AFUH 1VQON 3K9JA 1YUWA 3O8MA 3H6EA 4IXCA 4ILGB 4BVOA 5AQYA 2W41A 4BR5A 4IO9L 3WXMB 5M1QA 2JWLA 2P9SB 4BC4A 4CZMA 3EL2A 3VF6A 2P9KB 1EQYA 4BRKA 5EX5A 4FPBA 2ZGYA 4JK9A 5F2RA 1Q82O 1SS6A 4CZHA 2E2OA 3IDHA 4BC3A 2NRWA 3CCQN 3HOTA 2D0PA 4JEPA 2HMPA 4M7XA 4NO7A 5KQ8A 3TTCA 5AQTA 5BN8A 1K8KB 2OTLN 4YOVA 3DAWA 3R1XA 4H0VB 4M7YA 1NBWA 2P9KA 4B1XB 5AQWA 4GV6A 2ASOA 4IDHA 4CD1A 3FZFA 3F9MA 3GG4A 3QBWA 4EAHD 5ADXA 2QM1A 3J8AA 3VEVA 4CZKA 3VEXA 2QEXN 3R6MA 4JK8A 4JN4A 4KH6A 5M1KA 2E2QA 1TYQB 3K9KA 1JCGA 1K8KA 3E1YA 3QBXA 3QFUA 3WQTA 5JICA 4IOAL 5GAEP 3WT0A 1JCFA 1X3NA 4CZIA 1T6CA 3C7NB 3U9DA 3ENHA 1BWFO 3M5RA 3O4WA 1BA0A 3SJHA 1MWKA 5KPZA 3H3NO 1Q7YO 2KKZA 1HKGA 1X3MA 2I7NA 5BR9A 1TYQA 3SK3A 5AZJA 5CE3A 1SZ2A 2CGLA 4JKCA 4JKBA 1QQMA 4BRPA 4BQZA 3ZX2A 3CCMN 3C7NA 3E9LA 3GOIA 1BUPA 3GBTA 3R3LA 1Y64A 3U9ZA 4WFBL 4YDUA 2RE2A 3ID6A 1K73O 3CC7N 3R9PA 1H1VA 1KD1O 4FPAA 3CCSN 2P9PB 4PHTX 1VQ5N 4FVUA 2VCPA 3CJ7A 3C0BA 4BRDA 3M3ZA 1S72N 3CI5A 3BP8A 3EO3A 4B1WB 1BG3A 1T3VA 3UKUB 4IOCL 1Q81O 5M1FA 4A2BA 3O9RA 1HJOA 4BY9C 4R79A 3CJ9A 1V4SA 4C1NI 2BH1A 2P9PA 2QWQA 3SMPA 4FWQA 3AAQA 5AQUA 5JLHA 3MX5A 3CCUN 2QI2A 3ZEUB 5MLCQ 1T6DA 4ILJA 3WEEB 1K9MO 3ZX3A 2WUSA 3M1FA 5AQVA 3AARA 3AY9A 3CCRN 2HBLA 2QW9A 2BTFA 3I33A 1P8ZA 2Q36A 3ZYYX 5HOOA 4CZFA 1KXPA 3ZEUA 3ATVA 3IUCA 1ZBSA 1BOTO 3WEEA 3BF1A 4BRCA 2GWKA 2Q0RA 2P9LB 4U7BA 4WQ4C 1KAZA 2NZTA 4FWNA 3TPQA 4DKWA 3WXJA 4BRLA 1ILYA 4YORA 2YHXA 1R59O 1RDUA 2BUPA 3IMXA 3O6WA 3CF5L 3FR0A 4BR0A 5FPNA 5BN9A 3VMFB 4XH4A 1E4FT 2P9LA 5AQKA 2F9WA 4BR9A 4PKHA 3E66A 1JCEA 1W97L 4WQ5A 4B9QA 4H0YB 4RTFD 2HSTA 5TKYA 1X9JA 1QZ5A 2GX9A 4UY8O 1GLDG 3EZWA 5FPMA 4BVPA 1XQSC 2F7TA 3P31A 3I56N 1N8RO 3A5NC 3BEXA 3MCPA 1VQ8N 1NWKA 2V7ZA 3UB5A 3CC2N 2I7PA 4PL7A 5GINA 3TSPA 3AAPA 1BO5O 1Z6RA 3CJAA 3MDQA 4K25A 4B1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXO A;  2E1Y A;  1NM1 A;  5AQL A;  4IO8 A;  5AQI A;  4BQL A;  2NRH A;  4B1Y B;  1C0G A;  3HI0 A;  4LC9 B;  1IG8 A;  4FO0 A;  3CET A;  2CGJ A;  4FWO A;  1RGI A;  2ZGZ A;  2Q1N A;  3ID8 A;  4ISG A;  3CJB A;  4CI6 A;  4FWS A;  1NGB A;  3CIP A;  4XEI A;  4MO5 A;  3EN9 A;  5AQH A;  3VEN A;  2CGK A;  2ASM A;  1GLJ O;  3VGM A;  2A6A A;  2QWM A;  1QQN A;  4C23 A;  2FSN A;  4K42 A;  4JHD B;  4FL9 A;  3VF4 A;  3O5B A;  3SLC A;  3ATU A;  5I9E B;  1U6Z A;  3L0Q A;  3TU5 A;  3MN6 A;  3WUH A;  1NGI A;  3EKU A;  4BR4 A;  4Z94 A;  2UYT A;  2ZF5 O;  1ATS A;  3VGL A;  3KHY A;  4I6M B;  3WXL A;  5AZJ B;  4JHD A;  5B8H A;  4DQ8 A;  3FZK A;  2Q31 A;  5ADX H;  5BRF A;  2Q0U A;  1YXQ A;  1G99 A;  4PKI A;  2A42 A;  3QDK A;  4DHY A;  3D2F B;  4YDU C;  4FSV A;  5KQD A;  3HZ6 A;  4BC2 A;  3FZH A;  3MN9 A;  4NB4 A;  5AQX A;  5KPT A;  1ATR A;  3M6G A;  4I6M A;  4O5F A;  2QWN A;  1BU6 O;  4E1J A;  1NGA A;  4CZG A;  1E4G T;  2E2N A;  2IVN A;  3D2F A;  3D2E B;  1NGD A;  4CBX A;  5AQM A;  5AQZ A;  1TUY A;  3WXK A;  2P9I B;  3KVG A;  2YHW A;  3MK6 A;  4BRF A;  3L6Q A;  4H5N A;  4BRE A;  4GNI A;  4BRG A;  1T44 A;  2E20 A;  5BPM A;  4FWL A;  2IVO A;  3R8E A;  3D2E A;  4WYB A;  2VYP A;  3VGK A;  4CJ7 A;  4DCH A;  1Q18 A;  2QWL A;  3SMS A;  1YAG A;  5AQG A;  3FLC O;  4BR2 A;  3LDN A;  2A40 A;  2P9I A;  3CQY A;  2YHY A;  1LCU A;  2D0O A;  5AQQ A;  3LDO A;  3FZL A;  3L4I A;  1NGH A;  4BRI A;  1NGG A;  5AQN A;  4A62 A;  1WOQ A;  3DWL A;  1HX1 A;  1GLE G;  3O1W A;  5AQP A;  4XH5 A;  4K41 A;  1XC3 A;  4WQ5 C;  3B8A X;  4BG8 A;  2Q2R A;  2P9U A;  3CJC A;  4H0X B;  4HWI A;  1KAY A;  4H5W A;  2ZWH A;  1LOT B;  3CER A;  3FZM A;  2KHO A;  3VET A;  2GUP A;  4JD2 B;  3A5M C;  1QQO A;  4O8K A;  3O08 A;  5AQO A;  3CJ1 A;  3EKS A;  3UKR A;  3VER A;  1TUU A;  1SQK A;  4FWR A;  1GLL O;  2IVP A;  3H1V X;  3HM8 A;  3HBT A;  4JD2 A;  3QML A;  3ULE A;  1V4T A;  3QFP A;  1BDG A;  5BRE A;  1S22 A;  5EY4 A;  2J4R A;  1HPM A;  3HTV A;  2H3G X;  5E26 A;  1GLC G;  1QHA A;  5LJV A;  2IIR A;  5BRH A;  3LDP A;  3QB0 A;  2DPN A;  3JS6 A;  3VPZ A;  4KBO A;  1BA1 A;  3HSC A;  4AM6 A;  4J8F A;  4M63 C;  5JMV A;  2A41 A;  3MMV A;  2CH5 A;  1NGF A;  2HOE A;  1XUP O;  1GLB G;  3IFR A;  1GLA G;  2E2P A;  2FLO A;  3O80 A;  5EVZ A;  2QWP A;  2AP1 A;  4JNE A;  5AFU A;  3VEY A;  3VOV A;  4CZJ A;  2FSJ A;  2HF4 A;  3A5O C;  1D4X A;  2HF3 A;  5F0X A;  3VEZ A;  4BG9 A;  2QWR A;  4FOI A;  4EHU A;  4PKG A;  4PL8 A;  3DXM B;  1NMD A;  2EWS A;  5BPN A;  1DKG D;  3G25 A;  3CHW A;  2ITM A;  2QWO A;  4Y0W A;  3O1B A;  1HLU A;  4QS7 A;  4EFH A;  1QZ6 A;  4BRO A;  2P9S A;  3DXM A;  4F9O A;  1SAZ A;  3U8X A;  3BUZ B;  5JLF A;  2FSK A;  3WQU A;  4BR7 A;  1MA9 B;  3A0I X;  5AQF A;  3S41 A;  5BRD A;  4B1U B;  4IJA A;  4CD3 A;  1GLF O;  2CH6 A;  2W40 A;  3LM2 A;  3QIC A;  3ZET B;  3H3O B;  2F9T A;  3I8B A;  3GL1 A;  1RDW X;  3LM9 A;  2P9N B;  3P4I A;  3D7E O;  3H46 O;  1J6Z A;  3FFK B;  4MLE A;  5AZI B;  2PBD A;  4IJN A;  4MLH A;  4H5R A;  4DB3 A;  5EXW A;  2NLX A;  4A2A A;  4BRM A;  3FE1 A;  4FWP A;  4MO4 A;  3ZET A;  3LL3 A;  5FPE A;  4XH1 A;  3A5L C;  2P9N A;  3ENO A;  1MWM A;  5AZI A;  4L3Q A;  4HTL A;  1YVN A;  4BRA A;  2D4W A;  3VES A;  4BGA A;  4H0T B;  4K43 A;  3W0L A;  1ATN A;  4FOE A;  3CQX A;  2A3Z A;  3U4L A;  1HUX A;  2OAN A;  5LJW A;  4ISF A;  2P9U B;  4BGB A;  5EOY A;  1DGK N;  5FPD A;  3GE1 A;  3W3D A;  2GEL A;  1ESV A;  1OKJ A;  3GDQ A;  3DXK B;  1DEJ A;  4EHT A;  1C0F A;  3UKR B;  4H0O A;  4H03 B;  3UKU A;  1NGJ A;  4CZE A;  5KPR A;  2GWJ A;  3JXU A;  2V51 B;  4RWT A;  4ISE A;  4H5T A;  3A8Y A;  2VWB A;  2V7Y A;  3MN5 A;  4IWV A;  3ULE B;  3ZX0 A;  1MDU B;  2V52 B;  1NGE A;  3RSE B;  3DXK A;  1WUA A;  2GTD A;  3FGU A;  2Q97 A;  4H0P A;  4B1Z A;  4CBW A;  4BRH A;  2E1Z A;  4JAX A;  3LDQ A;  1Z05 A;  4CBU A;  4EIA A;  3H45 C;  2D1K A;  4QS9 A;  2A5X A;  5AQS A;  4AM7 A;  3DJC A;  3RSE A;  2FXU A;  1ZC6 A;  5BPL A;  5LY3 A;  2YJF A;  4BRN A;  2FF3 B;  4CZL A;  1IJJ A;  2PAV A;  4WQ4 A;  4BRQ A;  4FWK A;  3WXI A;  5E84 A;  1RFQ A;  2YJE A;  3VF2 A;  3VEW A;  5ELZ A;  1S3X A;  2ASP A;  3H1Q A;  3UE5 A;  1CZA N;  4GY2 B;  2GEM A;  1HKC A;  4RCH A;  2YI1 A;  4QS8 A;  3OHR A;  1U2V B;  2YCH A;  3LDL A;  1NGC A;  1HKB A;  2E88 A;  3MN7 A;  4FWM A;  3BF3 A;  4A61 A;  5F1X A;  4IZ9 A;  4BC5 A;  4H5V A;  3KZB A;  5AQR A;  2AA4 A;  2FF6 A;  2QXL A;  2E8A A;  1KAX A;  1U2V A;  5AR0 A;  5AQJ A;  3VEO A;  1NLV A;  5AFU H;  1YUW A;  3O8M A;  3H6E A;  4IXC A;  4BVO A;  5AQY A;  2W41 A;  4BR5 A;  2P9S B;  4BC4 A;  4CZM A;  3EL2 A;  3VF6 A;  2P9K B;  1EQY A;  4BRK A;  5EX5 A;  4FPB A;  2ZGY A;  5F2R A;  4CZH A;  2E2O A;  3IDH A;  4BC3 A;  2D0P A;  2HMP A;  4M7X A;  4NO7 A;  5KQ8 A;  5AQT A;  5BN8 A;  1K8K B;  3DAW A;  4M7Y A;  4H0V B;  1NBW A;  2P9K A;  4B1X B;  5AQW A;  2ASO A;  4CD1 A;  3FZF A;  3F9M A;  3GG4 A;  3QBW A;  4EAH D;  5ADX A;  2QM1 A;  3J8A A;  3VEV A;  4CZK A;  3VEX A;  3R6M A;  4JN4 A;  2E2Q A;  1TYQ B;  1JCG A;  1K8K A;  3QBX A;  3QFU A;  3WQT A;  5JIC A;  3WT0 A;  1JCF A;  1X3N A;  4CZI A;  1T6C A;  3C7N B;  3U9D A;  3ENH A;  1BWF O;  3O4W A;  1BA0 A;  3SJH A;  1MWK A;  5KPZ A;  3H3N O;  1HKG A;  1X3M A;  2I7N A;  5BR9 A;  1TYQ A;  3SK3 A;  5AZJ A;  5CE3 A;  1SZ2 A;  2CGL A;  4BRP A;  1QQM A;  4BQZ A;  3ZX2 A;  3C7N A;  3GOI A;  1BUP A;  3GBT A;  1Y64 A;  3U9Z A;  4YDU A;  3R9P A;  1H1V A;  4FPA A;  2P9P B;  2VCP A;  3CJ7 A;  3C0B A;  4BRD A;  3M3Z A;  3CI5 A;  3BP8 A;  3EO3 A;  4B1W B;  1BG3 A;  3UKU B;  4A2B A;  1HJO A;  3CJ9 A;  1V4S A;  2P9P A;  2QWQ A;  3SMP A;  4FWQ A;  3AAQ A;  5AQU A;  5JLH A;  3ZEU B;  1T6D A;  3WEE B;  3ZX3 A;  2WUS A;  3M1F A;  5AQV A;  3AAR A;  3AY9 A;  2QW9 A;  2BTF A;  3I33 A;  1P8Z A;  2Q36 A;  4CZF A;  1KXP A;  3ZEU A;  3ATV A;  3IUC A;  1ZBS A;  1BOT O;  3WEE A;  3BF1 A;  4BRC A;  2GWK A;  2Q0R A;  2P9L B;  4WQ4 C;  1KAZ A;  2NZT A;  4FWN A;  3TPQ A;  3WXJ A;  4BRL A;  2YHX A;  1R59 O;  2BUP A;  3IMX A;  3O6W A;  3FR0 A;  4BR0 A;  5FPN A;  5BN9 A;  4XH4 A;  1E4F T;  2P9L A;  5AQK A;  2F9W A;  4BR9 A;  4PKH A;  1JCE A;  4WQ5 A;  4B9Q A;  4H0Y B;  4RTF D;  5TKY A;  1X9J A;  1QZ5 A;  1GLD G;  3EZW A;  5FPM A;  4BVP A;  1XQS C;  3A5N C;  3BEX A;  3MCP A;  1NWK A;  2V7Z A;  3UB5 A;  2I7P A;  4PL7 A;  3AAP A;  1BO5 O;  1Z6R A;  3CJA A;  3MDQ A;  4K25 A;  4B1V A; 
#chains in the Genus database with same CATH topology
 1TV6 A;  1ZXO A;  3VQ7 A;  1NM1 A;  5AQL A;  4BQL A;  3VQQ A;  1D9F A;  4B1Y B;  4FK4 A;  4LC9 B;  3PO5 A;  1IG8 A;  1M1K O;  4B3M K;  1YT3 A;  3CET A;  3MEG A;  4LH5 A;  1TGO A;  2Q1N A;  3EEQ A;  4DV2 K;  4G9Z A;  5KGW A;  4JS5 A;  3CIP A;  4MO5 A;  3VEN A;  3VN5 A;  2CGK A;  4FLZ A;  4OKE A;  4KPY A;  4K42 A;  4B8C A;  1KVC A;  1VSL A;  3O5B A;  2FBX A;  3SLC A;  2HHH K;  4J2E A;  3F9K A;  3TAM A;  1NGI A;  4F8R A;  3QIO A;  5C10 A;  3KK7 A;  2VWJ A;  5LMU K;  3KHY A;  5AZJ B;  4JHD A;  3KLF A;  3TTD A;  2Q0U A;  4CK1 A;  1YXQ A;  1G99 A;  5J2M A;  3VQ6 A;  3MDQ A;  5FRM A;  4CJF A;  5GAD P;  5AQX A;  1CXQ A;  4AHT A;  4E1J A;  3C6A A;  1NOZ A;  1B9D A;  4ELT A;  1FKO A;  3TWH A;  3D2E B;  1J9A A;  4IBN A;  5AQM A;  1TUY A;  4AHS A;  1HNV A;  3CFR A;  4BRF A;  4H5N A;  4BRE A;  4BRG A;  3PX0 A;  1T44 A;  1OH8 A;  4AHV A;  3THX B;  2XO7 A;  1N6Q A;  3SBT A;  3VQC A;  3T1Y K;  1Q18 A;  3C6T A;  3BZC A;  4RW9 A;  4QAG A;  3K59 A;  1OVY A;  3LDN A;  3KIO A;  3CQY A;  4X64 K;  3OYB A;  1LCU A;  3SPY A;  5AQQ A;  4A5B A;  3L4I A;  4BRI A;  3CCL N;  1NGG A;  4A62 A;  4I2P A;  1HX1 A;  1VQM N;  1GLE G;  3G0Z A;  2P1J A;  5J2Q A;  4DSI A;  4XH5 A;  1WLJ A;  4OGC A;  1XNQ K;  2Q2R A;  3RRG A;  4H0X B;  4H5W A;  2YNF A;  2ZWH A;  5CR4 A;  4FZY A;  3CER A;  3AO5 A;  3QEP A;  1ASU A;  3O08 A;  3VQ4 A;  1SL0 A;  1LW2 A;  1S6Q A;  4FWR A;  1GLL O;  3O4N A;  4CGI A;  1BDG A;  4DTU A;  4CEC A;  5M1N A;  2RPI A;  3THW A;  2G8U A;  3HTV A;  4B9M A;  3RMD A;  3TSU A;  5E26 A;  4Q0B A;  1BCM A;  3EYZ A;  3SZ2 A;  1HYZ A;  3DLB A;  5HRR A;  3VPZ A;  4DV7 K;  5JMV A;  4J8F A;  2A41 A;  4CJ3 A;  3SI6 A;  2PYL A;  2CH5 A;  4M45 A;  2UUA K;  3HK2 A;  2HOE A;  4CFC A;  3O80 A;  5EVZ A;  2QWP A;  3VOV A;  4MFB A;  1NK7 A;  1L3S A;  3AO4 A;  1GOB A;  1RTI A;  2QWR A;  3TI0 A;  4KHS A;  4CF8 A;  3KKS A;  4OJR A;  4CEQ A;  5LL6 Z;  3DXM B;  1KSP A;  1JLA A;  5BPN A;  3WNE A;  1RBS A;  1QQC A;  2Y1J A;  2OZM A;  1QVG M;  3O3H A;  4F3T A;  1RDA A;  3O1B A;  4BRO A;  1WSI A;  2HBJ A;  3VTI A;  2OPQ A;  3KWI A;  3ZSZ A;  1QVF M;  3VQB A;  2FSK A;  5FRO A;  3WQU A;  4BR7 A;  1YIJ N;  1GOC A;  4PQU A;  5BRD A;  4YOU A;  4DQQ A;  5C2F A;  4M3W A;  2X78 A;  4CEF A;  4CD3 A;  4Z4G A;  3LM2 A;  3H3O B;  3N4P A;  3GL1 A;  1RDW X;  4YOW A;  1XWL A;  2NUB A;  4CHP A;  3D7E O;  1LWC A;  1J6Z A;  1LWE A;  4MLE A;  2KLA A;  2PBD A;  4FJI A;  4MLH A;  5C15 A;  2JWK A;  4JV5 K;  3OBW A;  1VAZ A;  2HBK A;  3FE1 A;  3ZET A;  4XH1 A;  4OPA A;  3K58 A;  3ENO A;  4FM0 A;  1I94 K;  4HTL A;  1YVN A;  3LP3 A;  1FW6 A;  2HHT A;  1VQN N;  2PY5 A;  1YJ9 N;  4BGA A;  1ATN A;  2YV0 X;  3U4L A;  3QIP A;  2OAN A;  4BGB A;  1O13 A;  2QA4 N;  3W3D A;  2GEL A;  2HB5 A;  3QEV A;  3H08 A;  3ZSW A;  1DEJ A;  1C0F A;  4H0O A;  4GKJ K;  2NNW A;  4CZE A;  2VGN A;  2F8S A;  4HTU A;  3JXU A;  3ZX0 A;  2V7Y A;  2RN2 A;  2GV9 A;  3BDP A;  4J2B A;  3P1G A;  3IRX A;  3PV8 A;  1WUA A;  2Q97 A;  3THW B;  4ELV A;  2VGM A;  1XHX A;  3LDQ A;  4CBU A;  3LAK A;  4NXN K;  1UWB A;  2A5X A;  1F21 A;  2FXU A;  1D8Y A;  3O9T A;  3AO2 A;  3SYZ A;  1RCH A;  3AVG A;  4BRN A;  2BGG A;  2FF3 B;  1LWF A;  1XNR K;  2PAV A;  1RFQ A;  3UE5 A;  3QNN A;  4C1N K;  3LZJ A;  3NVK A;  2A1S A;  3KLE A;  1T8E A;  4QS8 A;  3CCV N;  1U2V B;  1NGC A;  3TAQ A;  2FBV A;  4CHN A;  4HVJ A;  3V9U A;  2HBM A;  3CXC M;  3C65 A;  2AA4 A;  2QXL A;  2E8A A;  3OJS A;  4CGF A;  1RDC A;  5AR0 A;  5AQJ A;  3K9J A;  3O8M A;  4BVO A;  3HXM A;  2F8T A;  1X9M A;  5AQY A;  3J7A P;  2JWL A;  1OVQ A;  4FLV A;  3OYA A;  4Z4H A;  4N47 A;  4B9L A;  1VSH A;  1TVR A;  5KI6 A;  5EX5 A;  1OH6 A;  4JK9 A;  1Q82 O;  1N33 K;  2NRW A;  2D0P A;  3PSF A;  2LSN A;  4YOV A;  3DAW A;  3DLG A;  4B1X B;  3VQ5 A;  3VQE A;  2ASO A;  3FZF A;  3QBW A;  4EAH D;  3R6M A;  1BQN A;  4KH6 A;  2D0B A;  2E2Q A;  1K8K A;  3QFU A;  3QBX A;  4JI5 K;  4IOA L;  5GAE P;  1X3N A;  1SKS A;  1T6C A;  3OYG A;  4K0K K;  1BA0 A;  3SJH A;  4CGG A;  1ITG A;  1KFS A;  3AVL A;  2I7N A;  5BR9 A;  1TYQ A;  3OYF A;  1SZ2 A;  2CGL A;  3IS9 A;  3CCM N;  3C7N A;  1NK0 A;  3R3L A;  1RT2 A;  3LWL A;  1Y64 A;  2ITG A;  3NHG A;  4DUY K;  5KGX A;  4KAZ A;  3R9P A;  5CY4 A;  4FVU A;  4PHT X;  4JRP A;  3SQ2 A;  1VQ5 N;  2FC0 A;  4DTR A;  1K6Y A;  3M3Z A;  2DFH A;  4BE0 A;  2F96 A;  4CJW A;  5M1F A;  3TAF A;  3P83 D;  3O9R A;  4BY9 C;  1L5U A;  2P9P A;  5D3G A;  5HLF A;  4FWQ A;  1KVB A;  3BGR A;  1HPZ A;  5MLC Q;  2R7Y A;  1VSM A;  3RMB A;  2WUS A;  4DS5 A;  3AAR A;  2QW9 A;  2BTF A;  3OS0 A;  3NCI A;  3I33 A;  3ZYY X;  2O8C B;  1KXP A;  4B3T K;  3B6O A;  1WSE A;  2OPP A;  4F2R A;  4BRC A;  4JI6 K;  1TAQ A;  4U7B A;  5SWM A;  4JS4 A;  3SUN A;  4YOR A;  3NF7 A;  1XHZ A;  4BR0 A;  3VMF B;  3IG1 A;  3OYN A;  4LFC K;  1W97 L;  3OYJ A;  4H0Y B;  5TKY A;  1IKV A;  1QZ5 A;  3KK2 A;  4UY8 O;  3EZW A;  3HP6 A;  4BVP A;  3P31 A;  2PYJ A;  1QTM A;  4C8O A;  1NWK A;  2V7Z A;  3CC2 N;  2I7P A;  3CJA A;  1RT5 A;  2O8E A;  4K25 A;  3M8S A;  3RWU A;  4PY5 A;  1U48 A;  5AQI A;  2NRH A;  4PA1 A;  5C0Y A;  3M8P A;  1ZBI A;  4W5Q A;  1C0G A;  4FLT A;  4B3R K;  3ZSO A;  4E7H A;  4FO0 A;  1S5J A;  2O4I A;  1RGI A;  2ZGZ A;  4KHW A;  3OBY A;  2IGI A;  3ID8 A;  4ISG A;  3CJB A;  4CI6 A;  4FWS A;  4XEI A;  3KLI A;  3EN9 A;  4NLB A;  5AQH A;  1NJW A;  4WFN L;  2QWM A;  2YNH A;  1QQN A;  4KO0 A;  4C23 A;  3NMU A;  3CC4 N;  3ULD A;  3VF4 A;  1VQ9 N;  4CF1 A;  3ATU A;  4Z4F A;  1U6Z A;  3TU5 A;  3MN6 A;  3MWT A;  3WUH A;  4I7F A;  4CJ4 A;  3I55 N;  3F5T A;  4BR4 A;  3OTO K;  3DM2 A;  4FJJ A;  1TAU A;  2ZF5 O;  3VGL A;  4AF1 A;  4I6M B;  3WXL A;  1QS4 A;  3OJU A;  5JS2 A;  3WNF A;  1NG9 A;  1NKB A;  4PKI A;  4YDU C;  3ZSQ A;  4CJS A;  3HZ6 A;  5KPT A;  3RVC A;  3QEX A;  4O5F A;  3CMA N;  4ID5 A;  1CZ9 A;  1BU6 O;  3SAH A;  3JAM O;  2WC9 A;  5J2P A;  1NGA A;  4LFB K;  4CZG A;  2O8B B;  2E2N A;  1FJG K;  2IVN A;  4N41 A;  4CBX A;  1JXE A;  3DLK A;  4A57 A;  1KFD A;  3MK6 A;  4KH5 A;  1YIT N;  3L6Q A;  2VQF K;  4GNI A;  3QNO A;  2IVO A;  4KI6 A;  3R8E A;  3K57 A;  3D2E A;  1RT1 A;  5EU7 A;  4DCH A;  1VSJ A;  1YAG A;  5AQG A;  1RT6 A;  3FLC O;  4BR2 A;  4ELU A;  4LF5 K;  4DFM A;  3E9P A;  3U3G A;  1KLM A;  1LW0 A;  2D0O A;  3THX A;  5K14 A;  2EHG A;  1QSS A;  4CED A;  1EX4 A;  2WON A;  5AQN A;  3PX4 A;  5C25 A;  2JLE A;  3O1W A;  2WBN A;  1J5O A;  4CVN E;  4K41 A;  4WCE L;  4WQ5 C;  3B8A X;  4BG8 A;  1VQK N;  2P9U A;  4IKF A;  4CF0 A;  1LOT B;  2QXF A;  4HUG A;  1WSH A;  4HUE A;  1QQO A;  4JLH A;  5AQO A;  3CJ1 A;  3J7Y P;  3EKS A;  3UKR A;  4MQ3 A;  1G15 A;  4I2Q A;  1JL2 A;  4DR2 K;  2IOC A;  2Q3S A;  3HBT A;  1UA0 A;  2KZM A;  2B6A A;  5BRE A;  5EY4 A;  3VA0 A;  4KTQ A;  2Z1J A;  4FJL A;  3QEW A;  3SBG A;  3G4S N;  1BIU A;  1QHT A;  2XY6 A;  4IOX A;  4YY3 K;  2ETJ A;  2NRX A;  2ATQ A;  4CJV A;  1BA1 A;  3HSC A;  4AM6 A;  3MMV A;  2ZM6 K;  1JKH A;  2B5J A;  3KJV A;  1XUP O;  3TAR A;  1VRU A;  2X74 A;  1GLA G;  3HPH A;  4OVL A;  4CEO A;  3OYL A;  4JNE A;  1JLB A;  4E1N A;  4IG3 A;  2FSJ A;  3HP9 A;  3SV3 A;  1D4X A;  5F0X A;  1S1T A;  4E3S A;  3MAQ A;  4EHU A;  1HYV A;  1TKZ A;  1C0M A;  1JLF A;  5DM7 L;  1NMD A;  2EWS A;  3O9S A;  3V81 A;  3DLL L;  2DY4 A;  3TTF A;  3N4Q A;  2QWO A;  1S9G A;  4M42 A;  4YNQ A;  1HLU A;  2ZJR L;  4DQR A;  1QZ6 A;  2P9S A;  3PLA A;  3DXM A;  3OW2 M;  2NRR A;  1RTD A;  4KHN A;  3BUZ B;  1NK5 A;  3LAM A;  4RW6 A;  4FW1 A;  5M1P A;  3S41 A;  4B1U B;  3TAB A;  1ZYQ A;  2CH6 A;  2X6S A;  2F9T A;  4CJE A;  1EET A;  2FBT A;  3H46 O;  1JL1 A;  5AZI B;  4AHC A;  4M3Y A;  3RRH A;  2ZJQ L;  4IJN A;  4OPJ A;  3TAE A;  1T7P A;  4DB3 A;  4H5R A;  2G8K A;  4BRM A;  2HNZ A;  1KQS M;  4MO4 A;  4DV1 K;  1VQ7 N;  3AVK A;  3NBP A;  3LL3 A;  5FPE A;  2A1R A;  1NKC A;  1Q8I A;  4L3Q A;  4Y1C A;  4DSK A;  2YHB A;  3QIN A;  4H0T B;  4FK2 A;  4K43 A;  1Q9Y A;  3CQX A;  3O3G A;  1SKR A;  4EZ9 A;  4W5N A;  2P9U B;  5HRP A;  3HL8 A;  5EOY A;  3THY B;  1VSI A;  3GE1 A;  1VHX A;  1YJW N;  1ESV A;  3M8R A;  1NJZ A;  3KLG A;  3GDQ A;  3DXK B;  2VWK A;  3UKR B;  2HW3 A;  4H03 B;  2HHV A;  4EP5 A;  3AVC A;  2V51 B;  1VSD A;  4H5T A;  3ASM A;  4IEE A;  2P5G A;  1MDU B;  4RW4 A;  3RSE B;  1ZBL A;  3CCE N;  4Z0U A;  4B1Z A;  3K0S A;  3OVN A;  4JAX A;  1W2B M;  1O1W A;  1Z05 A;  4AQY K;  3ZSV A;  1D9D A;  4F4K A;  4WF9 L;  3SUO A;  5AQS A;  1SUQ A;  1RBR A;  3QLH A;  1ZC6 A;  2E5L K;  3ZCM A;  3EE9 A;  2YJF A;  4OKK A;  4W5O A;  4CZL A;  1IJJ A;  4JK7 A;  1XC9 A;  3CFP A;  3WXI A;  3NH0 A;  1B92 A;  4DQP A;  1S3X A;  1BI4 B;  5C12 A;  4FLX A;  3OHR A;  4NLC A;  2Z1G A;  1IBK K;  4B08 A;  2YCH A;  3LDL A;  3S3N A;  2G8F A;  3HT3 A;  2E88 A;  4Y1D A;  3MN7 A;  3OA9 A;  4R5P A;  3V9S A;  4FVM A;  5F1X A;  1VQL N;  3DLH A;  1BCO A;  1HQE A;  2G8W A;  4H5V A;  4FLU A;  3SAG A;  1WB9 A;  2FF6 A;  1T05 A;  1S6P A;  4FCY A;  1U2V A;  3LP1 A;  3VEO A;  4IXC A;  3ZT2 A;  4IFV A;  5J2N A;  2HHQ A;  3WXM B;  4CHZ A;  4CJU A;  2P9S B;  1IKW A;  4CZM A;  3OY9 A;  4DUZ K;  3MXI A;  2P9K B;  3AVA A;  4BRK A;  2ZGY A;  1SS6 A;  2UXC K;  4JEP A;  4DLE A;  4M7X A;  4NO7 A;  4C8M A;  3TTC A;  4DV5 K;  3R1X A;  4M7Y A;  1EWR A;  2O8D A;  5AQW A;  2KFN A;  3ZSY A;  4M41 A;  1HMV A;  4FJ7 A;  3F9M A;  3GG4 A;  5ADX A;  3J8A A;  4CZK A;  4WE1 A;  2BE2 A;  2AJQ A;  3K9K A;  3E1Y A;  4V19 S;  3L2W A;  3VQD A;  3U9D A;  5FRN A;  3ENH A;  3O4W A;  4DQS A;  3H3N O;  4FLY A;  1Q7Y O;  2KKZ A;  3RMC A;  1X3M A;  4FJM A;  4JKC A;  3I0R A;  1QQM A;  1B9F A;  4JKB A;  4BRP A;  4BQZ A;  4E89 A;  3SV4 A;  1XI1 A;  3E9L A;  1BUP A;  4CEE A;  3D45 A;  4N5S A;  4E1M A;  1JLG A;  4WFB L;  3ID6 A;  1HNI A;  3KD1 E;  4DWI A;  3L2V A;  2VCP A;  3CJ7 A;  4KRF A;  1S72 N;  1JXB A;  4X62 K;  3CI5 A;  3EO3 A;  3AVH A;  4A2B A;  4DSF A;  1KCF A;  3UIQ A;  4R79 A;  4B1V A;  5HBM A;  2YHA A;  1V4S A;  1L3V A;  1RTJ A;  4DV6 K;  3CCU N;  3DYA A;  3ZEU B;  4DLG A;  2P51 A;  1A5V A;  1WSG A;  3NH2 A;  4DR5 K;  4FJG A;  3C94 A;  1S1U A;  2HBL A;  2UUC K;  1Z25 A;  4BWM A;  1P8Z A;  2Q36 A;  4AHR A;  3BF1 A;  4KKO A;  2BDP A;  2GWK A;  4CIG A;  4KHQ A;  1KAZ A;  1FXX A;  4FWN A;  2UXD K;  4HUF A;  3WXJ A;  1NK8 A;  1T03 A;  1DTT A;  2O8C A;  2O4G A;  4LF8 K;  2E4L A;  5FPN A;  4XH4 A;  3E66 A;  1JLE A;  3SQ4 A;  2GX9 A;  5J1E A;  1TL1 A;  3A5N C;  4GMJ B;  1VQ8 N;  3HM9 A;  1WSJ A;  3BZK A;  4PL7 A;  4HCC A;  1N5Y A;  3AAP A;  4DQI A;  4X66 K;  2E1Y A;  3M8Q A;  1U47 A;  3CM5 A;  1I3A A;  3ISN C;  1TL3 A;  4JRQ A;  3G71 N;  4JKA A;  2CGJ A;  4FWO A;  1IV0 A;  2HHU A;  4JKF A;  2QKK A;  3IAY A;  1RBT A;  2XHB A;  2O8D B;  1DLO A;  1YHQ N;  3VQ8 A;  3D6R A;  1GLJ O;  3VGM A;  1EXQ A;  3HRG A;  2FSN A;  3MX2 A;  5DK5 A;  1NU0 A;  4FL9 A;  1GOA A;  1S1X A;  5GAH P;  5LMN K;  1P90 A;  2OZS A;  3C95 A;  3L0Q A;  4JI8 K;  4O44 A;  3MEE A;  4JI7 K;  4F3O A;  3CQ8 A;  4Z94 A;  1NMN A;  2UYT A;  1ATS A;  4IFY A;  1BQM A;  2G8H A;  4DQ8 A;  2KTQ A;  3FZK A;  4FJK A;  4G1Q A;  5BRF A;  5ADX H;  4CW7 B;  4DHY A;  3D2F B;  5KQD A;  4BC2 A;  3FZH A;  3MN9 A;  1ATR A;  4FJX A;  3CCJ N;  3M6G A;  4I6M A;  1N34 K;  3DOL A;  3P39 A;  1E4G T;  1HQU A;  3THV A;  1NGD A;  1XMQ K;  5C42 A;  4DF8 A;  1VQ6 N;  1EO1 A;  1JLQ A;  1NK9 A;  2P9I B;  3KVG A;  4IEI A;  4FLW A;  4FJH A;  2O8B A;  3KWG A;  3OS2 A;  5BPM A;  3AGK A;  4FWL A;  4Z4I A;  3VQP A;  2VYP A;  3VGK A;  4CJ7 A;  3CME N;  3AA4 A;  1S1V A;  2QWL A;  3LP2 A;  4DSL A;  2VG7 A;  4DFJ A;  1IG9 A;  4DTJ A;  4DR7 K;  4JKG B;  3LDO A;  3FZL A;  4RW8 A;  1TKD A;  3NF9 A;  1HYS A;  3SPZ A;  3PIP L;  2G8V A;  4GVE A;  3NF8 A;  4H8K A;  4E7L A;  3MCA B;  3WNG A;  5I3U A;  5JVG L;  4ID1 A;  3V1O A;  5DMR A;  3CJC A;  5FDL A;  4DFK A;  4FJ8 A;  5IT9 O;  1KAY A;  1N32 K;  3HVT A;  3Q7B A;  3T69 A;  3FZM A;  3VQ9 A;  1U45 A;  1VSE A;  1VSF A;  2KHO A;  2GUP A;  4JD2 B;  3MXM A;  3A5M C;  1HR0 K;  1UA1 A;  4O8K A;  4E7I A;  4AHU A;  1NJY A;  5KTQ A;  2E6L A;  2F4V K;  4JKE A;  5C2D A;  4O0I A;  3HST B;  3NGY A;  4ZTJ A;  3KK1 A;  2KW4 A;  2IVP A;  5CYM A;  4DFP A;  3HM8 A;  3ULE A;  3QET A;  3ZSX A;  5HRO A;  1S22 A;  3T19 A;  1TKT A;  3OYK A;  2G8I A;  4JYA K;  2WOM A;  1BHL A;  3LDS A;  4OO1 J;  2H3G X;  5M1O A;  4FZZ A;  1QHA A;  4CHQ A;  4OX9 K;  1D5A A;  4MDA A;  4CER A;  3QB0 A;  2DPN A;  4FJ5 A;  4M63 C;  3TSQ A;  2O8F B;  1NGF A;  3AVM A;  3IFR A;  4CEB A;  4FYD A;  4FXD A;  4DU4 A;  1ASV A;  1I39 A;  2AP1 A;  1NNE A;  2YX6 A;  5JVH L;  3VEY A;  4CZJ A;  3LZI A;  1WN7 A;  1K8A O;  2HF4 A;  4KHU A;  2HF3 A;  3G6E N;  4DF4 A;  3VEZ A;  4BG9 A;  4PKG A;  2QK9 A;  4PUO A;  1EP4 A;  3G25 A;  2YNG A;  2ITM A;  4Y0W A;  1OH7 A;  4GV3 A;  5T7B A;  4JI3 K;  4Z4E A;  4I9Q A;  4EFH A;  3LPU A;  4C8N A;  3NGZ A;  4BE1 A;  3DRS A;  1SKW A;  1DTQ A;  3NF6 A;  4HCB A;  3ZT4 A;  4OLB A;  3AVN A;  2W40 A;  3QIC A;  3VQA A;  3LM9 A;  2P9N B;  1XMO K;  4O5B A;  3FFK B;  4I9L A;  3NAE A;  5EXW A;  2PZS A;  3VTH A;  5E41 A;  4A2A A;  4IFE A;  3T1H K;  1TK0 A;  4CJT A;  1J5E K;  3F2K A;  4LY7 A;  2IS3 A;  5AZI A;  4GKK K;  1A5X A;  4DSE A;  3CFO A;  4BDP A;  3S3O A;  2WFB A;  3VES A;  1QSY A;  3C6H A;  4KFB A;  2A3Z A;  4LF6 K;  4CGJ A;  1C0T A;  4M3T A;  2Y1I A;  4QOZ B;  4LF7 K;  4YOY A;  3AVB A;  1OKJ A;  3O3F A;  4CGH A;  1KLN A;  1KC8 O;  4L8R B;  3HPO A;  4DV3 K;  4CF2 A;  4JKH A;  3UKU A;  4E7K A;  3THY A;  1NGJ A;  3CPE A;  3OYI A;  2NRZ A;  4RWT A;  4DTM A;  3Q7C A;  4K8X A;  3A8Y A;  3MN5 A;  3ULE B;  4IWV A;  1FK9 A;  3DXK A;  1YVU A;  4RW7 A;  3SAF A;  2GTD A;  1RNH A;  4CES A;  1X1P A;  4CK3 A;  2HNY A;  4CBW A;  4BRH A;  2E1Z A;  2YKM A;  4UQG A;  2OPR A;  3H45 C;  2D1K A;  3L2R A;  3L3U A;  2FBY A;  3DJC A;  3G10 A;  4AM7 A;  3RSE A;  1VQ4 N;  3EE8 A;  5BPL A;  5LY3 A;  2E6M A;  1JJ2 M;  1RIL A;  4EZ6 A;  4FJN A;  4WQ4 A;  4BRQ A;  2KFZ A;  5E84 A;  2RKI A;  1Q86 O;  5ELZ A;  3MEC A;  5CHI A;  3O4Q A;  1YI2 N;  2GEM A;  4Z4C A;  5HL7 L;  5DM6 L;  3ITH A;  3NGI A;  2UUB K;  1BL3 A;  4OPK A;  4DTX A;  3RTV A;  4CJQ A;  3AO3 A;  4A5A A;  4FWM A;  3BF3 A;  3JYT A;  1BIZ A;  1OH5 A;  1UOC A;  4IZ9 A;  5AQR A;  2XY7 A;  1BI4 A;  3QER A;  4FM2 A;  4ZTF A;  4CJL A;  4DR6 K;  3NE6 A;  1SL2 A;  3NH1 A;  1NLV A;  1YTA A;  4JI1 K;  3H6E A;  4ILG B;  2W41 A;  4BR5 A;  4IO9 L;  4K8Z A;  1NOY A;  4BC4 A;  4QCL A;  4NCB A;  2HMI A;  5HRN A;  4O55 A;  2UU9 K;  5F2R A;  4CZH A;  3KD5 E;  3CCQ N;  1C1A A;  5KQ8 A;  5AQT A;  3AVI A;  2OTL N;  2WTU A;  4JI2 K;  2P9K A;  1W7A A;  1TK5 A;  5SZT A;  4IDH A;  4CD1 A;  1WSF A;  2W42 A;  4XIU A;  4C8L A;  4JK8 A;  5M1K A;  5GIN A;  3WQT A;  4OKJ A;  1NKE A;  5JIC A;  4CCH A;  3KKR A;  1R0A A;  3RR7 A;  2DFE A;  3K5L A;  3TAG A;  4FZX C;  1KTQ A;  2OA8 A;  3OS1 A;  4M3X A;  3M5R A;  4Q5V A;  1HNW K;  1MWK A;  2ZD1 A;  5HRS A;  3AA5 X;  4LFA K;  3V6D A;  3A2F A;  3J80 O;  3DRR A;  3GOI A;  3J81 O;  4DU3 A;  3U9Z A;  2DTU A;  1K73 O;  3KK3 A;  3TAP A;  1H1V A;  4FPA A;  3WNH A;  3ZSR A;  2HHX A;  1SL1 A;  3C0B A;  4BRD A;  1U04 A;  3V9Z A;  3BP8 A;  1Q81 O;  3UKU B;  4AIL C;  2I5J A;  3E01 A;  3SCX A;  2BH1 A;  3L2U A;  3EY1 A;  3SMP A;  3B6P A;  5JLH A;  4FW2 A;  4ILJ A;  3WEE B;  1C1B A;  4O0J A;  1ASW A;  5AQV A;  3QEI A;  3TR8 A;  2GUI A;  5HOO A;  4GW6 A;  4CZF A;  1LV5 A;  4KB0 A;  3ZEU A;  1ZBS A;  3HJF A;  2P9L B;  3AVJ A;  1W9H A;  3TPQ A;  4CJ5 A;  1E3M A;  1ILY A;  3TAN A;  1R59 O;  5IWA K;  3O6W A;  1VK0 A;  4KB1 A;  1CXU A;  1TKX A;  5AQK A;  4PKH A;  4B9Q A;  2HHW A;  1X9J A;  5FPM A;  2F7T A;  5A2Q O;  3V1Q A;  3BEX A;  3MCP A;  1CZB A;  3UB5 A;  4BAC A;  5AJ3 K;  3KLH A;  3TSP A;  2HHS A;  1BO5 O;  2ZJP L;  3C6U A;  4IO8 A;  1RTH A;  4FJ9 A;  3E9O A;  1RT4 A;  1WAJ A;  3HPG A;  4CFD A;  3NFA A;  1A5W A;  3HI0 A;  1CLQ A;  2X6N A;  4J2A A;  4KTZ A;  4KH4 A;  2D5R A;  2UXB K;  2KZZ A;  5GIO A;  5FLX O;  1NGB A;  4CE9 A;  4OPH A;  1BGX T;  4OGE A;  2ASM A;  2A6A A;  3K5M A;  4JHD B;  1YF5 L;  4IG0 A;  5I9E B;  4CFA A;  3EKU A;  3SQ1 A;  1HNZ K;  1YTU A;  5B8H A;  1L3U A;  4B3O A;  3S3M A;  3ZLJ A;  1ZBH A;  2Q31 A;  2HVI A;  4IDK A;  2A42 A;  3QDK A;  1HRH A;  4FSV A;  3I0S A;  3P38 A;  5CYQ A;  4NB4 A;  4LF4 K;  3ZT0 A;  1EWQ A;  4YOT A;  2QWN A;  2DFF A;  4E19 A;  3D2F A;  3K2P A;  4DTO A;  4GV9 A;  5AQZ A;  1BIS A;  4B9U A;  3WXK A;  1MU2 A;  3IKM A;  5H1S Q;  4N56 A;  2YHW A;  3LWM A;  2E20 A;  4NYF A;  3HOS A;  3FFI A;  4CJP A;  3ZT3 A;  4WYB A;  5TKW A;  3SNN A;  4CGD A;  3SMS A;  3AA2 A;  3AVF A;  2W6L A;  2A40 A;  2P9I A;  2OPS A;  3L3V A;  3LPT A;  4PWD A;  4MDB A;  4E7J A;  2YHY A;  2W6K A;  1NGH A;  4B8A B;  4KHP K;  1IBL K;  1REV A;  1WOQ A;  4NXM K;  4B9N A;  3DWL A;  1QSL A;  5AQP A;  4JKG A;  1NK6 A;  1YJN N;  1XC3 A;  2KQ2 A;  5GAG P;  1NJX A;  4HWI A;  1J53 A;  3AGR A;  3VET A;  1JLC A;  3PUF A;  3SUQ A;  3MXJ A;  2YKN A;  3VER A;  1TUU A;  1SQK A;  4M3U A;  3H1V X;  3J7Z O;  4H4M A;  4JD2 A;  1Y97 A;  4C8K A;  3QML A;  3NVM A;  1V4T A;  3QFP A;  2VG5 A;  3HO1 A;  2J4R A;  1HPM A;  2QTD A;  4ILH A;  1NJI O;  3V9W A;  1IBM K;  3SQ0 A;  1GLC G;  5LJV A;  4JI4 K;  2IIR A;  5BRH A;  3LDP A;  3JS6 A;  1DT9 A;  3AV9 A;  4KBO A;  4BDY A;  4CIE A;  1HJR A;  1S1W A;  2Z1H A;  4B9T A;  2PFU A;  3V9X A;  1WBD A;  2XY8 A;  3O9U A;  1GLB G;  4DTS A;  4DSJ A;  2E2P A;  2FLO A;  3DLE A;  3JSM A;  4DR1 K;  5AFU A;  3CPW M;  4CEA A;  3S9H A;  2O8F A;  3A5O C;  4YFU A;  3VA3 A;  3PY8 A;  4FOI A;  4KTW A;  4PL8 A;  4KV8 A;  1DKG D;  1ZBF A;  3CHW A;  5KRT A;  2ZQB A;  1IH7 A;  3SUP A;  4QS7 A;  4KRE A;  4J2D A;  4F9O A;  4DV0 K;  1SAZ A;  3ZT1 A;  3U8X A;  5JLF A;  2D0C A;  1MA9 B;  3A0I X;  5AQF A;  2XY5 A;  2QKB A;  3LAL A;  4IJA A;  2RF2 A;  1U49 A;  4KHY A;  1GLF O;  1N36 K;  3ZET B;  3I8B A;  4CJR A;  4O4G A;  1Q9X A;  4DS4 A;  3MWP A;  3OYE A;  3CM6 A;  3P4I A;  4F2S A;  4O8U A;  1W0H A;  1LAV A;  3EZ5 A;  4B3S K;  1FKP A;  1X9S A;  3DOK A;  4WFA L;  4CHY A;  2NLX A;  4LSL A;  4FWP A;  3T7Z A;  1RT7 A;  3K5N A;  3BY5 A;  4X65 K;  4DG1 A;  3A5L C;  2P9N A;  3OYC A;  1KRP A;  3MED A;  3PSI A;  1MWM A;  1UAX A;  3PIO L;  4BRA A;  2D4W A;  3W0L A;  4FOE A;  1RBV A;  3L2Q A;  1HUX A;  5LJW A;  4ISF A;  1SV5 A;  2NRT A;  4OLA A;  2NRV A;  1DGK N;  5FPD A;  4BWJ A;  4HHT A;  2OCE A;  4A59 A;  3SJJ A;  4M3Z A;  4EHT A;  2IDO A;  5JS1 A;  1HNX K;  1C0U A;  1KVA A;  5KPR A;  4JKD A;  2RHK A;  2GWJ A;  4NCA A;  3LP0 A;  4ISE A;  4N76 A;  2VWB A;  5CZ2 A;  2V52 B;  4EP4 A;  1NGE A;  4W5T A;  3FGU A;  3DLR A;  4GVM A;  1ZBU A;  2IAJ A;  3CD6 N;  2GBZ A;  1WAF A;  1IKY A;  4DU1 A;  1C6V A;  4B9V A;  3NDK A;  4U67 L;  3PO4 A;  2YNI A;  4EIA A;  1M90 O;  3O9Q A;  4QS9 A;  1C1C A;  5GIP A;  4NYN A;  1VQP N;  1NK4 A;  3AO1 A;  4W5R A;  2B4J A;  1TK8 A;  3HYF A;  3QES A;  3D0P A;  4FWK A;  4CJK A;  2YJE A;  3VF2 A;  3VEW A;  3L8B A;  3H1Q A;  2ASP A;  3L4Q A;  1CZA N;  4CEZ A;  4GY2 B;  3AA3 A;  4M3R A;  2OTJ N;  1HKC A;  4RCH A;  2YI1 A;  3U6F A;  4YOX A;  1WNS A;  3ENB A;  1L3T A;  1HKB A;  2EX3 A;  3DMJ A;  4A61 A;  4JI0 K;  4BC5 A;  2D0A A;  3KZB A;  4B9S A;  1KAX A;  4DR4 K;  5C24 A;  4DMN A;  4LSN A;  5AFU H;  1VQO N;  3OYH A;  4DTP A;  1YUW A;  4DV4 K;  1EKE A;  5M1Q A;  3EL2 A;  3VF6 A;  1EQY A;  4FPB A;  1IKX A;  2E2O A;  2XRI A;  3IDH A;  4BC3 A;  3HOT A;  2HMP A;  3ALY A;  2OYQ A;  4YHH K;  5BN8 A;  1K8K B;  1J54 A;  4H0V B;  4LH4 A;  1NBW A;  4GV6 A;  1WBB A;  1RT3 A;  2QM1 A;  3VEV A;  2QEX N;  3VEX A;  3RR8 A;  2HND A;  3I8D A;  4JN4 A;  1TYQ B;  1JCG A;  4FM1 A;  3V4I A;  4NCG A;  1JCF A;  3WT0 A;  4CZI A;  2VQE K;  1RBU A;  3C7N B;  3V1R A;  1BWF O;  1S9E A;  4AH9 A;  5KPZ A;  3HVR A;  4ZHR A;  3DRP A;  1HKG A;  4CFB A;  5AZJ A;  3SK3 A;  4BDZ A;  1X9W A;  2P5O A;  5CE3 A;  3F73 A;  1QE1 A;  3ZX2 A;  4CK2 A;  3GBT A;  5KRS A;  4YDU A;  3DI6 A;  2RE2 A;  3CC7 N;  3QO9 A;  2BAN A;  3U3Y A;  1KD1 O;  3K5O A;  3CCS N;  2P9P B;  2IC3 A;  5BR8 K;  5I42 A;  4B1W B;  1BG3 A;  1T3V A;  4IOC L;  1Z26 A;  2HVH A;  4TSX A;  3PX6 A;  4CIF A;  1HJO A;  2JGU A;  3CJ9 A;  1LAW A;  4C1N I;  4ICL A;  4DTN A;  2QWQ A;  5HP1 A;  3AAQ A;  3CYM A;  5AQU A;  3MX5 A;  2QI2 A;  1T6D A;  4FK0 A;  3T1A A;  1K9M O;  3LAN A;  3ZX3 A;  3M1F A;  3CG7 A;  2VG6 A;  3AY9 A;  3CCR N;  4LF9 K;  4E0D A;  3ATV A;  4KI4 A;  3IUC A;  3WEE A;  1BOT O;  3RMA A;  4CHO A;  2Q0R A;  1VRT A;  4WQ4 C;  4BE2 A;  2NZT A;  4DKW A;  4RG8 A;  1IO2 A;  1VSK A;  4BRL A;  1U4B A;  2YHX A;  1RDU A;  2BUP A;  3IMX A;  3P5J A;  4DR3 K;  3T3F A;  3CF5 L;  3FR0 A;  5BN9 A;  3OYD A;  1E4F T;  2P9L A;  4BR9 A;  2F9W A;  1RDB A;  1JCE A;  1RDD A;  3KTQ A;  4WQ5 A;  4CF9 A;  2O8E B;  4RTF D;  2HST A;  1GLD G;  4LD0 A;  2ZE2 A;  1XQS C;  3I56 N;  1N8R O;  2Z1I A;  4H0P A;  1Z6R A;  5CZ1 A;  3OYM A;  4H4O A; 
#chains in the Genus database with same CATH homology
 1ZXO A;  2E1Y A;  1NM1 A;  5AQL A;  4IO8 A;  5AQI A;  4BQL A;  2NRH A;  5C0Y A;  3E9O A;  4B1Y B;  1C0G A;  3HI0 A;  4LC9 B;  3G71 N;  1IG8 A;  1M1K O;  4JKA A;  4KH4 A;  4FO0 A;  3CET A;  2CGJ A;  4FWO A;  1RGI A;  2ZGZ A;  2Q1N A;  3OBY A;  4G9Z A;  4JKF A;  3ID8 A;  4ISG A;  3CJB A;  4CI6 A;  5GIO A;  4FWS A;  1NGB A;  3CIP A;  4XEI A;  4MO5 A;  4OPH A;  3EN9 A;  4NLB A;  5AQH A;  3VEN A;  1YHQ N;  2CGK A;  3D6R A;  2ASM A;  1GLJ O;  3VGM A;  2A6A A;  4WFN L;  3HRG A;  2QWM A;  1QQN A;  4C23 A;  2FSN A;  3MX2 A;  4K42 A;  3CC4 N;  3NMU A;  4JHD B;  1YF5 L;  4FL9 A;  3VF4 A;  1VQ9 N;  3O5B A;  5GAH P;  1P90 A;  3SLC A;  3ATU A;  5I9E B;  1U6Z A;  3L0Q A;  3TU5 A;  3MN6 A;  3MWT A;  3WUH A;  1NGI A;  3I55 N;  3EKU A;  3F5T A;  4BR4 A;  4Z94 A;  2UYT A;  2ZF5 O;  1ATS A;  3VGL A;  3KK7 A;  4AF1 A;  5C10 A;  3KHY A;  4I6M B;  3WXL A;  5AZJ B;  4JHD A;  5B8H A;  4DQ8 A;  3FZK A;  3TTD A;  2Q31 A;  5ADX H;  5BRF A;  2Q0U A;  1YXQ A;  1G99 A;  4PKI A;  2A42 A;  3QDK A;  4DHY A;  3D2F B;  4YDU C;  4FSV A;  5KQD A;  5GAD P;  3HZ6 A;  4BC2 A;  3FZH A;  3MN9 A;  3P38 A;  4NB4 A;  5AQX A;  5KPT A;  1ATR A;  3RVC A;  3CCJ N;  3M6G A;  4I6M A;  4O5F A;  3CMA N;  4YOT A;  2QWN A;  1BU6 O;  4E1J A;  3SAH A;  2WC9 A;  3C6A A;  1NGA A;  4CZG A;  3P39 A;  1E4G T;  2E2N A;  2IVN A;  3D2F A;  3D2E B;  1NGD A;  4CBX A;  5AQM A;  4GV9 A;  5AQZ A;  1TUY A;  3WXK A;  4A57 A;  1VQ6 N;  1EO1 A;  3IKM A;  5H1S Q;  2P9I B;  3KVG A;  2YHW A;  4IEI A;  3MK6 A;  4KH5 A;  4BRF A;  1YIT N;  3L6Q A;  4H5N A;  4BRE A;  4GNI A;  4BRG A;  1T44 A;  2E20 A;  3KWG A;  5BPM A;  3HOS A;  3AGK A;  4FWL A;  2IVO A;  3R8E A;  3D2E A;  4WYB A;  2VYP A;  3VGK A;  5TKW A;  3SBT A;  4CJ7 A;  1Q18 A;  4DCH A;  3CME N;  2QWL A;  3SMS A;  1YAG A;  5AQG A;  1OVY A;  3FLC O;  4BR2 A;  3LDN A;  2A40 A;  2P9I A;  3CQY A;  3E9P A;  4MDB A;  2YHY A;  1LCU A;  2D0O A;  5AQQ A;  4JKG B;  3LDO A;  4A5B A;  3FZL A;  2ZJP L;  3L4I A;  1NGH A;  4BRI A;  3CCL N;  1NGG A;  5AQN A;  4A62 A;  1WOQ A;  3PIP L;  3DWL A;  4GVE A;  1HX1 A;  1VQM N;  1GLE G;  3O1W A;  2WBN A;  3MCA B;  4JKG A;  5AQP A;  4XH5 A;  5JVG L;  4K41 A;  4WCE L;  1XC3 A;  1YJN N;  4WQ5 C;  5GAG P;  3B8A X;  4BG8 A;  2Q2R A;  1VQK N;  2P9U A;  3CJC A;  4H0X B;  4HWI A;  1KAY A;  4H5W A;  2ZWH A;  1LOT B;  5CR4 A;  3CER A;  3Q7B A;  3T69 A;  3FZM A;  3AGR A;  2KHO A;  3VET A;  2GUP A;  4JD2 B;  3A5M C;  1QQO A;  4O8K A;  3O08 A;  5AQO A;  3CJ1 A;  4JKE A;  3EKS A;  5C2D A;  3UKR A;  3VER A;  1TUU A;  1SQK A;  4FWR A;  1GLL O;  2IVP A;  3H1V X;  3J7Z O;  3HM8 A;  3HBT A;  4JD2 A;  3QML A;  3NVM A;  1V4T A;  3ULE A;  3QFP A;  1BDG A;  5BRE A;  1S22 A;  5EY4 A;  2J4R A;  5M1N A;  1HPM A;  2QTD A;  3HTV A;  4ILH A;  4OO1 J;  2H3G X;  1NJI O;  3SBG A;  3G4S N;  3TSU A;  5E26 A;  4IOX A;  5M1O A;  1GLC G;  1QHA A;  5LJV A;  2IIR A;  4MDA A;  5BRH A;  3LDP A;  3QB0 A;  2DPN A;  2NRX A;  3JS6 A;  3VPZ A;  1DT9 A;  4KBO A;  1BA1 A;  3HSC A;  4AM6 A;  4J8F A;  4M63 C;  3TSQ A;  5JMV A;  2A41 A;  3MMV A;  2CH5 A;  2PFU A;  1NGF A;  3O9U A;  2HOE A;  1XUP O;  1GLB G;  3IFR A;  1GLA G;  2E2P A;  2FLO A;  3O80 A;  5EVZ A;  2QWP A;  2AP1 A;  4JNE A;  2YX6 A;  5AFU A;  3CPW M;  5JVH L;  3VEY A;  3VOV A;  4CZJ A;  2FSJ A;  1K8A O;  2HF4 A;  3A5O C;  1D4X A;  2HF3 A;  5F0X A;  3G6E N;  3VEZ A;  4BG9 A;  2QWR A;  4FOI A;  4EHU A;  4PKG A;  4PL8 A;  3DXM B;  5DM7 L;  1NMD A;  2EWS A;  3O9S A;  5BPN A;  3DLL L;  1DKG D;  3G25 A;  3CHW A;  2ITM A;  3TTF A;  3N4Q A;  1QVG M;  2QWO A;  4Y0W A;  4GV3 A;  3O1B A;  1HLU A;  4QS7 A;  4EFH A;  1QZ6 A;  4BRO A;  2ZJR L;  2P9S A;  2HBJ A;  3PLA A;  3DXM A;  3VTI A;  4F9O A;  3OW2 M;  2NRR A;  3KWI A;  1SAZ A;  1QVF M;  3U8X A;  3BUZ B;  5JLF A;  2FSK A;  3WQU A;  4BR7 A;  1MA9 B;  1YIJ N;  3A0I X;  5M1P A;  5AQF A;  3S41 A;  5BRD A;  4YOU A;  4B1U B;  5C2F A;  4IJA A;  4CD3 A;  1GLF O;  2CH6 A;  2W40 A;  3LM2 A;  3QIC A;  3ZET B;  3H3O B;  2F9T A;  3I8B A;  3N4P A;  3GL1 A;  1RDW X;  3MWP A;  4YOW A;  3LM9 A;  2P9N B;  3P4I A;  4O8U A;  3D7E O;  3H46 O;  1J6Z A;  3FFK B;  4MLE A;  5AZI B;  2KLA A;  2PBD A;  2ZJQ L;  4IJN A;  4MLH A;  4H5R A;  2JWK A;  4DB3 A;  5C15 A;  5EXW A;  3OBW A;  1VAZ A;  2HBK A;  3VTH A;  4WFA L;  2NLX A;  4A2A A;  4IFE A;  4BRM A;  3FE1 A;  4FWP A;  4MO4 A;  3T7Z A;  3ZET A;  1KQS M;  3F2K A;  1VQ7 N;  3LL3 A;  5FPE A;  4XH1 A;  4OPA A;  3A5L C;  2P9N A;  3ENO A;  1MWM A;  5AZI A;  4L3Q A;  4HTL A;  1YVN A;  3PIO L;  4BRA A;  1VQN N;  2WFB A;  2D4W A;  3VES A;  4BGA A;  3C6H A;  1YJ9 N;  4H0T B;  4K43 A;  3W0L A;  1ATN A;  4FOE A;  3CQX A;  2A3Z A;  3U4L A;  1HUX A;  2OAN A;  5LJW A;  4ISF A;  2P9U B;  2NRT A;  4BGB A;  5EOY A;  2NRV A;  1DGK N;  1O13 A;  5FPD A;  3GE1 A;  2QA4 N;  4YOY A;  3W3D A;  2GEL A;  1YJW N;  1ESV A;  1OKJ A;  4A59 A;  1KC8 O;  3GDQ A;  3DXK B;  1DEJ A;  4EHT A;  1C0F A;  3UKR B;  4H0O A;  4H03 B;  4JKH A;  3UKU A;  1NGJ A;  2NNW A;  3CPE A;  2VGN A;  4CZE A;  5KPR A;  4JKD A;  2RHK A;  2GWJ A;  3JXU A;  2V51 B;  2NRZ A;  4RWT A;  3Q7C A;  4ISE A;  4H5T A;  3A8Y A;  2VWB A;  2V7Y A;  3MN5 A;  4IEE A;  4IWV A;  3ULE B;  3ZX0 A;  1MDU B;  2V52 B;  1NGE A;  3RSE B;  3DXK A;  3SAF A;  3CCE N;  1WUA A;  2GTD A;  3FGU A;  2Q97 A;  4H0P A;  4B1Z A;  3CD6 N;  4CBW A;  4BRH A;  2VGM A;  2E1Z A;  4JAX A;  3LDQ A;  4U67 L;  1Z05 A;  1W2B M;  4CBU A;  4EIA A;  3H45 C;  1M90 O;  3O9Q A;  2D1K A;  4QS9 A;  4WF9 L;  2A5X A;  5AQS A;  4AM7 A;  3DJC A;  5GIP A;  3RSE A;  2FXU A;  1VQP N;  1VQ4 N;  3O9T A;  3EE8 A;  1ZC6 A;  5BPL A;  3EE9 A;  5LY3 A;  2YJF A;  4BRN A;  1JJ2 M;  2FF3 B;  4CZL A;  1IJJ A;  4JK7 A;  2PAV A;  4WQ4 A;  4BRQ A;  4FWK A;  3WXI A;  5E84 A;  1RFQ A;  2YJE A;  3VF2 A;  3VEW A;  1Q86 O;  5ELZ A;  1S3X A;  2ASP A;  3H1Q A;  3L4Q A;  3UE5 A;  1CZA N;  4C1N K;  5CHI A;  4GY2 B;  1YI2 N;  3NVK A;  2GEM A;  5HL7 L;  2OTJ N;  1HKC A;  4RCH A;  2YI1 A;  4QS8 A;  5C12 A;  5DM6 L;  4YOX A;  3OHR A;  4NLC A;  3CCV N;  1U2V B;  2YCH A;  3ENB A;  3LDL A;  1NGC A;  1HKB A;  2E88 A;  3MN7 A;  3OA9 A;  4A5A A;  4FWM A;  3BF3 A;  4A61 A;  1VQL N;  5F1X A;  4IZ9 A;  4BC5 A;  4H5V A;  3KZB A;  2HBM A;  5AQR A;  3C65 A;  2AA4 A;  2FF6 A;  2QXL A;  3SAG A;  3CXC M;  2E8A A;  1KAX A;  1U2V A;  5AR0 A;  5AQJ A;  3VEO A;  1NLV A;  5AFU H;  1VQO N;  3K9J A;  1YUW A;  3O8M A;  3H6E A;  4IXC A;  4ILG B;  4BVO A;  5AQY A;  2W41 A;  4BR5 A;  4IO9 L;  3WXM B;  5M1Q A;  2JWL A;  2P9S B;  4BC4 A;  4CZM A;  3EL2 A;  3VF6 A;  2P9K B;  1EQY A;  4BRK A;  5EX5 A;  4FPB A;  2ZGY A;  4JK9 A;  5F2R A;  1Q82 O;  1SS6 A;  4CZH A;  2E2O A;  3IDH A;  4BC3 A;  2NRW A;  3CCQ N;  3HOT A;  2D0P A;  4JEP A;  2HMP A;  4M7X A;  4NO7 A;  5KQ8 A;  3TTC A;  5AQT A;  5BN8 A;  1K8K B;  2OTL N;  4YOV A;  3DAW A;  3R1X A;  4H0V B;  4M7Y A;  1NBW A;  2P9K A;  4B1X B;  5AQW A;  4GV6 A;  2ASO A;  4IDH A;  4CD1 A;  3FZF A;  3F9M A;  3GG4 A;  3QBW A;  4EAH D;  5ADX A;  2QM1 A;  3J8A A;  3VEV A;  4CZK A;  3VEX A;  2QEX N;  3R6M A;  4JK8 A;  4JN4 A;  4KH6 A;  5M1K A;  2E2Q A;  1TYQ B;  3K9K A;  1JCG A;  1K8K A;  3E1Y A;  3QBX A;  3QFU A;  3WQT A;  5JIC A;  4IOA L;  5GAE P;  3WT0 A;  1JCF A;  1X3N A;  4CZI A;  1T6C A;  3C7N B;  3U9D A;  3ENH A;  1BWF O;  3M5R A;  3O4W A;  1BA0 A;  3SJH A;  1MWK A;  5KPZ A;  3H3N O;  1Q7Y O;  2KKZ A;  1HKG A;  1X3M A;  2I7N A;  5BR9 A;  1TYQ A;  3SK3 A;  5AZJ A;  5CE3 A;  1SZ2 A;  2CGL A;  4JKC A;  4JKB A;  1QQM A;  4BRP A;  4BQZ A;  3ZX2 A;  3CCM N;  3C7N A;  3E9L A;  3GOI A;  1BUP A;  3GBT A;  3R3L A;  1Y64 A;  3U9Z A;  4WFB L;  4YDU A;  2RE2 A;  3ID6 A;  1K73 O;  3CC7 N;  3R9P A;  1H1V A;  1KD1 O;  4FPA A;  3CCS N;  2P9P B;  4PHT X;  1VQ5 N;  4FVU A;  2VCP A;  3CJ7 A;  3C0B A;  4BRD A;  3M3Z A;  1S72 N;  3CI5 A;  3BP8 A;  3EO3 A;  4B1W B;  1BG3 A;  1T3V A;  3UKU B;  4IOC L;  1Q81 O;  5M1F A;  4A2B A;  3O9R A;  1HJO A;  4BY9 C;  4R79 A;  3CJ9 A;  1V4S A;  4C1N I;  2BH1 A;  2P9P A;  2QWQ A;  3SMP A;  4FWQ A;  3AAQ A;  5AQU A;  5JLH A;  3MX5 A;  3CCU N;  2QI2 A;  3ZEU B;  5MLC Q;  1T6D A;  4ILJ A;  3WEE B;  1K9M O;  3ZX3 A;  2WUS A;  3M1F A;  5AQV A;  3AAR A;  3AY9 A;  3CCR N;  2HBL A;  2QW9 A;  2BTF A;  3I33 A;  1P8Z A;  2Q36 A;  3ZYY X;  5HOO A;  4CZF A;  1KXP A;  3ZEU A;  3ATV A;  3IUC A;  1ZBS A;  1BOT O;  3WEE A;  3BF1 A;  4BRC A;  2GWK A;  2Q0R A;  2P9L B;  4U7B A;  4WQ4 C;  1KAZ A;  2NZT A;  4FWN A;  3TPQ A;  4DKW A;  3WXJ A;  4BRL A;  1ILY A;  4YOR A;  2YHX A;  1R59 O;  1RDU A;  2BUP A;  3IMX A;  3O6W A;  3CF5 L;  3FR0 A;  4BR0 A;  5FPN A;  5BN9 A;  3VMF B;  4XH4 A;  1E4F T;  2P9L A;  5AQK A;  2F9W A;  4BR9 A;  4PKH A;  3E66 A;  1JCE A;  1W97 L;  4WQ5 A;  4B9Q A;  4H0Y B;  4RTF D;  2HST A;  5TKY A;  1X9J A;  1QZ5 A;  2GX9 A;  4UY8 O;  1GLD G;  3EZW A;  5FPM A;  4BVP A;  1XQS C;  2F7T A;  3P31 A;  3I56 N;  1N8R O;  3A5N C;  3BEX A;  3MCP A;  1VQ8 N;  1NWK A;  2V7Z A;  3UB5 A;  3CC2 N;  2I7P A;  4PL7 A;  5GIN A;  3TSP A;  3AAP A;  1BO5 O;  1Z6R A;  3CJA A;  3MDQ A;  4K25 A;  4B1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...