4BRSA

Structure of wild type phaz7 phb depolymerase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4brsA00
1Q83A 3K6KA 5CTAA 4GWLA 3G0BA 5AKLA 3AIOA 2RIPA 4KE7A 4QZVA 4Q82A 3O4GA 1H2WA 3HACA 5A7FA 1DX6A 1EHYA 4OB8A 4BRSA 2C58A 2PBLA 3A70A 2BUCA 1WOMA 5CT5A 4C01A 5T4EA 3OPMA 4EY6A 3WJ1A 3AIMA 1XZHA 2ACKA 1DX4A 4X85A 1XRNA 5CT8A 1JJBA 1CPYA 4XX1A 5C8ZA 2XMQA 1WHSA 1T4MA 4GW3A 5JALA 2Y2VA 1CUIA 2VF2A 1QTIA 2ZYRA 3DKRA 2XMRA 4H7FA 2JBWA 3GBSA 4BTLA 4BZZA 1BN7A 4BCDA 3V1KA 2WIJA 4DGQA 3YASA 1ZIXA 1WPXA 3STWA 4UFOA 1ACLA 1AKNA 5LKAA 4KAAA 3R3YA 5AOBA 1TK3A 1N8SA 3BDVA 4I4CA 2ACEA 1X2EA 4W9RA 1DINA 2QTBA 1EDBA 2WHQA 5C81A 2ROQA 1N5RA 2BJHA 5HFAA 4G9EA 2AJCA 2HM7A 2XUGA 2XQKA 2YYSA 2ZYIA 1R9NA 3QBJA 4AO7A 2V98A 5H3HA 4K5QA 2RAUA 4QWMA 2AXEA 1CUCA 3H19A 5HF5A 4U2CA 5K3FA 4YPVA 4KAJA 5ALQA 1XRRA 4B82A 5AO9A 4DLNA 5I7UA 3CN7A 3AFIA 1BCSA 2OG1A 4ROTA 4LXIA 5SYMA 3LIIA 3K2IA 4AO8A 2C5GA 5DNUA 1EDEA 1TAHA 4K6KA 4Y2VA 2HA7A 1JU4A 2HA2A 1CUAA 1QO7A 2PUHA 2OXEA 1ZIYA 3LS2A 3AJAA 4H7HA 4QDTA 2B4KA 4DNOA 5AOCA 1W52X 3C70A 3A2NA 4Z49A 2I78A 5ALPA 1LNSA 2DR0A 3C6BA 5CW2A 1WPRA 5AKKA 4ETWA 4AXBA 2J4FA 4IH1A 4EY7A 1Q0RA 3DCNA 1RYYA 3JYHA 3D2AA 1R50A 3H2JA 4J0JA 1G4HA 2XUFA 5ALGA 4HXGA 3VJMA 1OILA 2GBIA 5EHZA 1K5PA 1WB6A 3C6XA 1VZ2A 2JEYA 2XQJA 3O4IA 4B9EA 5D7BA 1DWQA 2J4CA 3SK0A 4CG2A 5CH3A 3LIPA 4U2EA 6YASA 1Y37A 5I9IA 4Q3LA 2FUKA 4UHDA 2JEZA 4QDXA 3WYNA 1XRPA 2WUGA 1MX9A 5D3ZA 1HBJA 4X00A 4DNFA 4E46A 3ICVA 3QH4A 4QEKA 2NW6A 3IDAA 5IH7A 1K8QA 3QVMA 3X3HA 4FFWA 2IITA 3HXKA 1QIGA 1UKCA 4U2FA 5CXXA 3IULA 2C0QA 3WWOA 4CG1A 4FWBA 1LBTA 4LXHA 4P9NA 4ARAA 1MJ5A 3H2KA 4INZA 2XQGA 1BRTA 2HA6A 1RWQA 2B9VA 2WJ4A 1J06A 3T4UA 3QPAA 3DOIA 2I3ZA 1GZ7A 2VJAA 2Y1KA 3KD2A 5A7HA 3C8HA 5JASA 3FVRA 3NGMA 4BE9A 4UHCA 2WKWA 4G8BA 3H2HA 4K2AA 1QGED 5AOAA 3O95A 5F4ZA 5K3AA 1ETHA 1G5FA 3D4LA 5FPPA 1SOMA 3VDXA 2XUDA 4M0MA 5JATA 1MO2A 5E2IA 3V48A 3MVEA 5AK4A 3R3VA 4AZ3A 4BZWA 2HFJA 3CXUA 2R11A 5DTIA 2WHRA 3WL7A 2PVSA 4GBGA 3WLAA 4J0HA 4H7EA 1VJ5A 4AX4A 1CUBA 4CIBA 5AM0A 1X70A 2DQYA 3D2BA 3C6YA 5C8XA 5AICA 2PSDA 4KRYA 1F0NA 2H9YA 4W1QA 1N1MA 1YSCA 3WWCA 5ESRA 4I19A 2EEPA 3LP5A 3WL5A 4B81A 3I2GA 1K6EA 1GPKA 1UKBA 5JARA 1CLEA 2VATA 1Y7IA 1YASA 2DHCA 1XQVA 4KE8A 4X93A 3D0KA 4V2IA 3RKSA 1PFQA 1W75A 1P0PA 4W1PA 4MJ3A 4DM7A 4ZRDA 3VKFA 3EF3A 4EHBA 1UZAA 4FTWA 5T4HA 1IUOA 5AIAA 1U4NA 3FCYA 2XUAA 2PSEA 3R3ZA 2PSHA 3WWDA 2PM8A 4J3JA 4A5SA 3E0XA 4HXEB 3F67A 1CUVA 4OPMA 3QMWA 1CQWA 5DYWA 1XZBA 4DTCA 2XE4A 5ALEA 5K3DA 2J3DA 2XUQA 1DWPA 3M3DA 3RARA 4RE5A 3KWJA 4MWTA 1B41A 1XZCA 4WJLA 1DWOA 3QPCA 5JD6A 2VA9A 3WZLA 4BRZA 5I8PA 1MNQA 3MUOA 4FLFA 4BBZA 3VVMA 4G1FA 4WFKA 3W9UA 4EBBA 1BCRA 4DNQA 4ZV7A 3ZLUA 5HK9A 2PL5A 4X90A 1XZKA 1ODTC 1N5MA 4HZGA 1MT3A 1MX5A 5T4FA 4D9JA 2XUOA 5JIBA 1H22A 1L7QA 1CUEA 2HFKA 5EGNA 4E15A 2Y2UA 2HL6A 3VISA 5AJHA 1J2EA 5AKEA 1YS2X 1QE3A 3DOHA 1CUWA 2H1IA 1VXOA 2WQZA 1R1DA 1WB5A 1QTRA 3B12A 1IUPA 5CT9A 2WHPA 5AKIA 3TRDA 2RHTA 5LZ8A 5AKJA 1IVYA 4U2GA 1ZOIA 3QM1A 4Q34A 4J0IA 1KEZA 1ZGCA 4M0EA 4B80A 4EB0A 1M33A 4Y2XA 5K3FB 4RGYA 4X3CA 4C4XA 1BROA 3IUNA 2I3DA 5AKGA 2HA4A 1JU3A 4Q3OA 1DT3A 3ZWQA 2E3JA 2W6CX 2VSQA 4E14A 1YB7A 1LPNA 4IH4A 1BEZA 2OQVA 3M83A 1S8OA 2DSNA 3FYTA 5ALTA 1UKAA 5IVIA 5AHXA 3DKKA 3S2ZA 5LZ2A 4KAFA 4AMZA 3WL6A 2VQ6A 1BN6A 3W04A 2QVBA 1IZ8A 3BIXA 4FBMA 2P8SA 3KDAA 1O6GA 1YR2A 3G7NA 4FHZA 1XZEA 1XLVA 3IIIA 4L9AA 4J0GA 2VTVA 1FFAA 2WILA 1J07A 4PSDA 3R3UA 2OGZA 1VLQA 3C8DA 1YA8A 3WIBA 2JF0A 4PSCA 4EY8A 2O2HA 2C0PA 3CN9A 3G9TA 3STUA 1E89A 5EIHA 4HRYA 3I2KA 3IVMA 2G5TA 4DIUA 5KBYA 4M0FA 2O2GA 2HDWA 1NU8A 1GPLA 4UBIA 5IVKA 5C7YA 1ORVA 4F60A 2DHDA 2WTNA 3C6ZA 2OLEA 5ALOA 4GEGA 1LGYA 4I3FA 3A2MA 3PDCA 2EDCA 2CUTA 5KREA 1XZLA 4ZREA 1C7IA 3AIKA 4BP8A 4RE6A 4E11A 2ZJ7A 3OOSA 1CUJA 4GDMA 5LZ7A 3FYUA 2XT0A 5AI9A 1MU0A 1QJ4A 4LYDA 4ZWNA 5DNWA 4PO3X 4RPCA 1CUDA 4G9GA 5AKZA 3WZMA 3G02A 7YASA 4FBLA 4JEIA 4DMHA 2PKYX 1SCIA 4JUIA 3VVLA 4HAIA 4KR0A 4ZI5A 1QLWA 5K3CA 5LZ5A 1YB6A 2VT7A 2IX9A 5ALSA 5YASA 2OQIA 2Z8ZA 1TCBA 4UBKA 3K9BA 2QXTA 3PFCA 3I6MA 3EQ9A 1OXMA 1JFRA 1HL7A 2BFNA 3GFFA 4UHFA 4Y2PA 1O6FA 2Q0XA 4A16A 5JZ9A 5ALRA 2WSLA 3DNMA 3KOOA 5CH8A 2G5PA 3B3QA 4G8CA 5BV7A 2JGFA 1B6GA 3ANSA 4KJXA 3PICA 4Q1VA 4YK7A 3WKEA 1EA5A 2GBGA 1Q84A 1XFDA 5JD5A 2CB9A 1ZD4A 2RONA 3H04A 3JW8A 4OD0A 4Y2RA 3H18A 2VEOA 5JAPA 2EDAA 2ZYHA 2HHAA 3RM3A 2WUEA 5ALDA 1EK2A 1XZAA 2PPLA 2XLBA 2BUBA 2IIVA 2V97A 4QDZA 5AKYA 3N2ZB 3WK9A 3PFBA 4OSEA 5BWBA 1QOZA 3Q0TA 4ZV9A 1P0QA 3VJLA 2OCGA 3PF8A 5A6VA 3GROA 1MAAA 1GPNA 3W9BA 1F0PA 4OB6A 4PV7A 5HF9A 1MN6A 1FFDA 4X6UA 3G9ZA 3GA7A 1CQZA 5HF8A 1FFEA 2WU3A 4BAUA 4BAZA 3AZQA 4X95A 5ISMA 1DTEA 3A2LA 4UBNA 1EINA 1T2NA 5HZGA 1XKLA 2ORYA 1QZ3A 4LYEA 1KU6A 5K3BA 2WFLB 3M82A 1ZD5A 2OCKA 4N8EA 3HSSA 5HQ3A 2D0DA 3NWOA 5IKXA 1QIHA 4X94A 4BVKA 4BTVA 4F21A 4J7AA 5D3KA 3WK4A 5LYYA 5JD4A 1HLGA 3R3XA 1QIKA 3PE6A 3ESCA 3WA7A 3ESAA 4UBMA 4Y2JA 3R41A 1W1IA 2UZ0A 2OAEA 5DTJA 4PQEA 1JMYA 1ZI9A 3WK7A 2XMSA 5FV4A 1LPAB 4CG3A 1XRQA 2Z3ZA 1U65A 3ANTA 3ZI7A 1ZGBA 3DLTA 1LLFA 1YS1X 4H7IA 4QDOA 5JANA 1UFOA 3DL7A 2WFLA 3F96A 3DJYA 4PF1A 1VZ3A 1ACJA 2QM0A 1LBSA 4HRXA 1H2ZA 1WB4A 1VOTA 1NU6A 3H1BA 2W22A 2OCLA 3G0DA 1E8MA 4L72A 4TVKA 1MNAA 1WM1A 2ZYSA 4B0PA 3I2JA 2BAGA 3PI6A 3KXPA 5FLKA 1SCKA 1IZ7A 5DLPA 1UK7A 3I1YA 3I2FA 3WYDA 5FP0A 5AIBA 1QO9A 1SFRA 4OCZA 3OURA 3QMMA 5AI4A 3QMVA 5AKXA 3WA6A 3F98A 1HPLA 2QUBA 4AB1A 4FFVA 1HDEA 3ZLVA 1UOPA 2WU4A 3WWEA 5LKRA 2XDWA 4X92A 2XI4A 2G63A 5EIEA 3H2IA 2V96A 2HA0A 2GZSA 5AM1A 2QMQA 1CEXA 2XMDA 2QXUA 1VE7A 3OC0A 2YH2A 4C89A 1CUZA 1ZI8A 4QE3A 2XQIA 2WIKA 4KE6A 2VJBA 3WKCA 3HI4A 2WUDA 4K6GA 3C87A 3O9VA 3LLCA 1L7AA 1ZJ5A 2DFPA 1VE6A 4AQDA 4BVLA 2O7RA 4X71A 1JJFA 4ZGBA 2XLCA 2BCEA 4NS4A 5C8VA 2PU7A 2XQFA 3T52A 3FLBA 1DQZA 5EFZA 4Y7DA 1EVEA 1QFMA 2X76A 5JAOA 5ALJA 1LPBB 4YX9A 3G9XA 3H17A 2G4LA 3AUKA 3STXA 1A8UA 4C4YA 4C6HA 4W1SA 4L0CA 1A88A 4IHAA 2ZJFA 3TGLA 4NMWA 2HU7A 1ODSA 2XMZA 1K63A 1PJAA 1WHTA 3V1MA 2WLSA 1CUFA 2YASA 4BCBA 4MYSA 4AN1A 5HK8A 2O2IA 4LKOA 3HEAA 4QA9A 2QKYA 2OPHA 5AK3A 2CKMA 4XIIA 1BEEA 1XZJA 3BDIA 5CT4A 1K4YA 3BIWA 5DYTA 3GELA 3CCBA 4J0CA 3WKBA 2XMGA 2WM2A 2AJDA 4P08A 4G8DA 5HQ3B 1IUNA 1CUYA 4N5HX 3V9AA 2RHWA 1EDDA 4Y2UA 2VJDA 4QNNA 2WJ3A 3F9CA 4PSUA 4Y9SA 5AM4A 3SX4A 2LIPA 4H77A 3G8YA 3WK5A 1HKHA 4EA6A 4QLOA 3IA2A 1R4ZA 3WK8A 1I6WA 3EBLA 3AZPA 1XZDA 1THGA 3W06A 4N8DA 1A8SA 2H7YA 3UUFA 4WY8A 3N0TA 5EHXA 1THTA 3V1NA 2WG1A 1USWA 2DCMA 1MTZA 2VT6A 5CH5A 5JYCA 2XUHA 3STTA 4J03A 3DEAA 3IUQA 1CUHA 3O4JA 4BVJA 1DU4A 4X7BA 1AUOA 2ZVDA 3WIOA 4LHEA 5K3EA 5LZ4A 4G4JA 3F97A 1EI9A 4BDTA 3C45A 5HCUA 3I6ZA 3LCRA 1XZMA 5ALMA 1A8QA 5LP1A 4LXGA 4P93A 5ALHA 2JGMA 2HA5A 5ALZA 4OU4A 1CUSA 3KWFA 4Q3KA 1H2XA 4KE9A 4Y2TA 2ZSIA 4CCYA 1CV2A 2HRQA 1CUXA 1R88A 1SC9A 4S0XA 1TCCA 2GBCA 4G4GA 5FOQA 4BCCA 5KWJA 4MEBA 1EH5A 5AM5A 3STVA 3ZV7A 5J3JA 1UT6A 3DL4A 3W2TA 4EY4A 4Y2QA 2CEKA 5KWIA 2CBGA 3QITA 1Z68A 1R3DA 1XZFA 2QUAA 2XUJA 5A62A 5ALUA 2XMCA 1XRLA 4OU5A 2XUIA 3O9MA 5AI5A 2X5XA 5EI5A 4G4IA 2WFZA 1P0IA 4CCYB 1XRMA 4X97A 3FBWA 3WQHA 1F6WA 1EB9A 4DSZA 3ED1A 3I28A 3QYJA 3BE8A 3STYA 4EUSA 2JGJA 3HZOA 4AN0A 3HYSA 5JADA 1SCQA 2QR5A 1PV1A 2B61A 3UUEA 4ITVA 5D6OA 5HFNA 4B0OA 1CR6A 4DYHA 2XUPA 2BUAA 4NZZA 4QDUA 3DDUA 5LLSA 2GBFA 4QLAA 5BOVA 4B85A 3L1IA 4U2BA 4B84A 1ORWA 5DYYA 1LPPA 3E1GA 2RI6A 2BGRA 4IH9A 3FYUC 5CXUA 4BP9A 3AZOA 4G5XA 3FAKA 4X91A 2XMBA 4N5IX 3TEJA 1BE0A 2OAGA 4C4ZA 4BE4A 4PNZA 5HF6A 4IQ4A 1ISPA 4BATA 3FLEA 2JGLA 4NVRA 1FJ2A 4UHHA 3HABA 4AZ0A 2JGIA 3ILSA 1E8DA 4PW0A 5AM2A 1GKKA 3BJRA 1A7UA 2DHEA 3D59A 4UPDA 3PUHA 1E5TA 2HADA 3H1AA 2RGUA 1JMKC 4U2DA 4H7KA 3UMJA 1XZIA 1LZLA 3FSGA 3D3NA 4FMPA 5DNVA 2C7BA 2WFMA 1EB8A 1QIJA 5AM3A 4GHWA 2AJBA 3HJUA 5K5EA 1YAJA 2WIGA 4MXDA 1LZKA 1FFCA 1VA5A 2Z5GA 1QIMA 3OTQA 3E4DA 1W6RA 2WG0A 2Z8XA 4UHEA 5JZBA 3E3AA 3C5WP 5ALKA 4H7JA 4WDQA 2QJRA 3FCXA 2WHPB 1UK9A 2FJ0A 1QIEA 5LZ9A 1JT2A 1AC5A 1XQWA 2FX5A 5CURA 1C4XA 1J1IA 3ESDA 5AI0A 4BAGA 5IVHA 3U0VA 1EK1A 4H7DA 2Y6UA 4MQMA 1TRHA 3FLAA 2GYVA 3D7RA 4UBJA 3BF8A 4X6XA 3G0CA 1XZGA 4FOLA 4Y2SA 2QRUA 5A71A 1VKHA 2I03A 5BWCA 1CIJA 4UFNA 4DSAA 1ZI6A 1ZD2P 1CVLA 4XWGA 4MQLA 1CFJA 3G0GA 2C5FA 4B9AA 4KYVA 3WWPA 3OG9A 4YASA 1QONA 3TJMA 3C43A 3FVTA 3G9UA 2AJLI 4FNGA 3H0CA 4EY5A 3IUMA 4K6HA 1JJIA 3L1JA 5ALFA 1GKLA 3L1HA 3WKAA 3WKDA 3BL8A 2ZSHA 1GT6A 1GQSA 3FNBA 4GXNA 3S8YA 3SWWA 3R40A 5A7GA 3WI7A 4CCWA 2HRRA 4XJVA 4F5ZA 2H7XA 4WY5A 1AX9A 1TIBA 1Y7HA 3NUZA 1D07A 3BXPA 1EVQA 1X2BA 1L7RA 3O4HA 4H18A 4WFIA 4FLEA 2J3QA 5ALIA 1XLWA 3FSGD 5ALWA 4OYLA 2VAXA 4GLBA 2ECFA 1U8EA 4UFPA 1KU0A 5ALXA 1VXRA 4A23A 3GUUA 4HXFB 5AH0A 4KRXA 2Y6VA 1CUUA 5ALNA 5HKBA 2HA3A 3ZPXA 1QFSA 4W1RA 3FOBA 4CIAA 3PUIA 4AO6A 3JWEA 1BU8A 2HU8A 4HS9A 1CUGA 4HTAA 5E4YA 5EIAA 3QPDA 3DD5A 2QOEA 3V1LA 3IB3A 1FFBA 5FRDA 4DMCA 4H0CA 4CFSA 1H2YA 1CRLA 4UUQA 2HU5A 1AURA 2HIHA 4BB0A 4Q05A 3ICWA 2JIDA 3D5EA 5ALYA 1UOOA 4HVTA 3WK6A 5AI8A 4WCVA 2WIDA 1UXOA 1VA4A 3EQ8A 4ARBA 5ALVA 4B6GA 4TGLA 2GZRA 3B5EA 1XLUA 4LIPD 4MYDA 2OGTA 2YXPX 4W63A 4BC0A 1U2EA 5FKJA 3R3WA 2VJCA 3MUNA 4J0DA 1E66A 4JYPA 4DMKA 1W4LA 4P92A 1H23A 1R9MA 2QT9A 3R0VA 1YA4A 4FDMA 3VJKA 2WUFA 3RLIA 3H2GA 3I1IA 4BDSA 4DNPA 2WG2A 3BJMA 3EIOA 1ZJ4A 1ZD3A 5DJ5A 4AMYA 3WMRA 3WJ2A 2XUKA 5EHQA 3QZUA 1LPSA 2AJ8A 2ZJ6A 1IMJA 2CJPA 2CZQA 4C87A 5T4BA 1MX1A 3I2IA 5E4JA 4C88A 4B83A 5CT6A 5JZSA 3DQZA 4DMFA 2JGKA 2B20A 1BS9A 4B7ZA 1TKRA 3SC2A 4FNMA 3F8SA 1YAHA 5EHNA 1GQRA 1AQLA 1QIIA 3NOXA 5FDFA 2FJPA 1XQXA 4F0JA 2PU5A 2X8BA 4GECA 2OGSA 2QJWA 1NX9A 3GZJA 3RK4A 4KACA 1OCEA 3U1TA 1MPXA 2WIFA 1ODCA 4MEAA 5AK5A 1C7JA 4X6YA 1W76A 1MAHA 1E8NA 3PF9A 2XB6A 3VXKA 4ZXFA 4Y2YA 2H7CA 4JH0A 4IO0A 1G66A 3FYUB 1EXWA 5DWDA 2BKLA 1XKTA 4WFJA 1GXSA 1GGVA 3DYVA 2JGEA 2PUJA 1JI3A 2ES4A 3IBTA 3IUJA 4UBLA 1XROA 2C4HA 2R8BA 4FKBA 4BYMA 3C5VA 1HQDA 2K2QB 5HKAA 1DT5A 1TQHA 3O0DA 2GYWA 3M81A 4UHBA 4L3WA 3CCCA 3EQ7A 1JKMA 4KEAA 5SYNA 2PSJA 1E3QA 1QIFA 2CMFA 5JAUA 1XQYA 3WL8A 1UWCA 1LPOA 2Z3WA 4CI9A 5JAHA 2QS9A 4WDRA 5A2GA 3A6ZA 5ALLA 1LPMA 1YCDA 2QZPA 1UK8A 3W05A 1DQYA 4O08A 2D5LA 1G42A 1F8UA 1EX9A 3AINA 3BF7A 4OB7A 4TPKA 5FUMA 5AKHA 1QIDA 1Q0ZA 3G0IA 3P2MA 3I2HA 1WCYA 5CRIA 4JNCA 4GI1A 2V9ZA 2GYUA 4H35A 1AMNA 2VAVA 5CMLA 4EZIA 5FPQA 2PX6A 1UK6A 4QWWA 4OYYA 3IURA 5AP9A 3DYIA 1AGYA 3HLKA 1ZICA 3ESBA 3FWHA 5AK6A 2OCIA 4OUKX 4RNCA 3OM8A 1TCAA 5IVDA 4J0KA 3HRHA 5AI6A 3HC7A 4JYMA 4XVCA 3MGAA 3AILA 3KSRA 2DQZA 3D2CA 4UBOA 3BWXA 5LIPA 5E4TA 2ONCA 4FLMA 4MWSA 2O7VA 5FXMA 2BGNA 1P0MA 2WJ6A 1UOQA 5CBKA 2WTMA 1RP1A 1FSSA 3I6YA 3Q8WA 4BC1A 4N8SA 2PSFA 1AZWA 3ZLTA 3DS8A
chains in the Genus database with same CATH superfamily
1Q83A 2FZCA 3P0RA 2A1TR 3SD7A 3GJZA 1NI3A 4GWLA 2CSUA 3G0BA 4ZYYA 3THXA 3T5GA 3MBIA 1JTFA 2QM8A 3TD6A 1PQ4A 3F8TA 4Q82A 1L7OA 1C9DB 1QP8A 2G0AA 3FYSA 3HACA 3LV8A 4RVNA 3V7WA 5AHRA 3QA3E 4RZXA 2A35A 3M6MD 3HCWA 4OB8A 2PO7A 5TJHA 4BRSA 4JSYA 3DAYA 4WRRA 2NXNA 1V8PA 2R8XA 4IDQA 2UYOA 2BUCA 1WOMA 4HPWA 4OI1A 5T4EA 3UOWA 4C01A 1ADYA 4I1IA 4UQLA 5GVSA 1PTJA 3WJ1A 1XZHA 4KLNA 4G0YA 2Y1DA 3GCZA 3TSYA 2RAFA 1CCWA 3BXFA 3FPJA 2X8WA 1E9FA 3ZNNA 5THKA 4BFCA 4D9EA 1JJBA 3CX4A 4XX1A 2HSZA 3K72B 3X43A 4GR4A 2YS6A 4D79A 4DSUA 1M34E 3PC8A 1Z37A 1DEHA 3JVDA 3RWMB 2Y2VA 3CCFA 1S02A 3GVXA 2VF2A 4C78A 1U0FA 3M6AA 3BXZA 4TL6A 1QNLA 2W6QA 2XAUA 2ZYRA 3DKRA 4CTJA 1UPAA 2Q3DA 2XMRA 2DWQA 2JBWA 4QGHA 1XIVA 5DNEA 2PMKA 3TZ6A 4D9BA 3E9QA 5DN6D 2O0MA 1A4RA 4WD3A 2OZLA 1CYEA 3JQAA 2FK7A 3GB9A 2HGSA 3PQ7A 1BN7A 3IDQA 4R1QA 3RQSA 1NVMB 3S2UA 4F3NA 1L8LA 1E2GA 1U6KA 2RH9B 3S2EA 3AR4A 4DGQA 1YC2A 3H86A 3LKDA 3FKJA 4QFBA 3IE0A 2C1EA 3LRPA 3RS8A 3W5DA 3R75A 3DMRA 2IF2A 4NONA 5BR4A 5MHTA 1XMVA 2GS9A 3HBJA 2G8LA 3SI7A 1KPGA 1MT0A 1OU0A 4IIDA 4NOMA 1QGOA 5C31A 5LKAA 3L02A 1VE9A 3FWZA 2FN4A 2P79A 2D00A 4OHCA 5H59A 5IJ9A 2A4MA 2ZZMA 2L17A 1H3NA 1MH1A 2GF0A 2IXDA 4NZNA 3R3YA 4R2KA 2B1JA 1QU2A 3A37A 3LUKA 3VDRA 4CEJA 1N8SA 5E6SA 3QOYA 1UMDB 1Y9AA 2JJ2A 4MYHA 2XCIA 1X2EA 3LO5A 1XTUA 4PX2A 2GQ0A 4CETA 1JWLA 3EG5A 1FVFA 2ZKIA 4ASUD 4IJMA 1UC4B 4TWRA 4B3IA 5C81A 1PDWA 1XJQA 4JIMA 4I1OA 4IQFA 2OFOA 1LK5A 1XEWY 3GZNA 1Q7GA 4UQPA 1RIIA 1ZKDA 1L4HA 3D43A 5HCNA 3CF4A 3TLAA 4M0CA 2ZXFA 3O90A 4QPNA 5I8ZA 1HSOA 3CIOA 1PFYA 2D2VA 4NAUA 1K08A 3Q8LA 3TCNA 4QXQA 2VNSA 5HFAA 3HU3A 1FXWF 1P0FA 1FRFS 3D3WA 3OKAA 2LVBA 2LCQA 3VU8A 1KMIY 1A95A 1H6CA 1YUMA 4MIYA 4XM1A 1FZQA 2XUGA 3N7TA 1HYBA 4U3JB 1E3TA 2FZKA 4IV8A 2IW3A 2WYOA 2FZVA 1YZ3A 5F3RA 2OZEA 2B9EA 3QBJA 2IH5A 1KJQA 3OJLA 5BPFA 3T3EA 3EGCA 3KAJA 2AGVA 1MQ8B 2VTKA 3DOEA 3EY4A 5KZMB 5KKAA 4YTEA 2O2JA 5TVGA 2C98A 1J97A 1KO4A 2A9JA 4MJLA 2ZCVA 2WZCA 2PLRA 2PYDA 1KEVA 1XHLA 1D9XA 2CFTA 2WOOA 3M6UA 1PR0A 4QWMA 4R5MA 2VEDA 4EEZA 5HYVA 4K03A 5JTTA 5ILOA 1TTTA 2AXEA 4XQCA 1SCBA 1ZQ1A 1O87A 2I3GA 3AY7A 4CV2A 1RABA 1ORTA 4U2CA 2IZ5A 1OA1A 1UJ5A 4KBFA 1FUIA 2V7WA 5DM1A 2FCRA 2G28A 2H59A 3IOYA 4P3PA 1EXMA 4HQOA 5CVTA 4G24A 5ALQA 4PEVA 4O29A 3M9LA 4P82A 1VI5A 2CT8A 4XWTA 4N12A 2CHGA 3VUFA 2NO9A 5E9AA 3TL3A 5I7UA 3E5RA 3EC2A 4YMTA 2HPAA 4M8LA 2OLJA 1I7SB 3GNTA 2QAJA 4DUGD 5CIWA 3ZHBA 1DG3A 2MR6A 3KQOA 4GM0A 3T3IA 2XB8A 1DJLA 2AX4A 2W43A 3CT4A 3LIIA 2B83A 1ZIOA 4KFCA 3WLMA 4Y6GB 2BY4A 4M9UA 1W25A 3TQTA 2XGSA 3K6SA 4HV4A 4IDFA 1CWUA 2CDAA 3QU2A 5CDYA 2H1WA 2OBLA 1JLLB 4FDUA 2ECQA 1QK4A 1WEKA 4ED9A 5CDFA 2XVYA 3JVVA 1KTVA 1Y3CE 2CLDX 2HA7A 4RIEA 2BMDA 2FLWA 4AKEA 1NVUQ 2HA2A 1QO7A 2X23A 1I5RA 1JIVA 4BB9A 1VPLA 3G5MA 5GOZA 3QE4A 2QENA 3SZOA 4RPIA 1R18A 2PUHA 4R6WA 1DTSA 2P9YA 4HFNA 2R00A 2B4KA 2P5YA 3HR4A 5EE1A 1W52X 2ASVA 1KH2A 2B2XA 1E98A 2WWHA 4LV5B 4OBBA 1E69A 5CFZA 5CCDA 4QJ4A 4FI3F 3I3OA 2HYIC 2BFBA 4RVGA 1P1FA 2I78A 3R5TA 4H31A 3FUVA 1WB9A 3S6JA 1GT91 3L9WA 3HB5X 2HPVA 4D82A 3ANYB 1WPRA 5D7NA 1H1LB 1RBYA 4EAQA 4MVJA 2XWQA 1J56A 4CDGA 1PR9A 1E1KA 2GJSA 1Q0RA 4LQDA 2XSZD 3F5QA 2ZWOA 4UJ3A 1LRLA 3FFAA 3OX4A 3BORA 4RQUA 3S3TA 1U3FA 1RCFA 2IDZA 3D2AA 3IAM1 1R50A 4I6GA 3H2JA 4JEHA 4K9DA 2CFOA 4MO9A 1IZ0A 1G4HA 1T4BA 3X1KA 1Z4IA 4BKUA 4E33A 3SZ3A 2J41A 3I9MA 3IOBA 4RV5A 1Y6QA 1EFHA 1PJ8A 4REQA 3ZK7A 1ESDA 1FRVA 4G2NA 4GSKA 4TLLB 2XOKA 4FEGA 3T0IA 3VJMA 1P2BA 3GZTB 4EG8A 1RQPA 1WB6A 2V6IA 1SWVA 3V8BA 3OIUA 1SXQA 4JVSB 2AUTA 5AHKA 1ZCFA 2XQJA 5TGTA 5C2JB 3T06B 2IEYA 4L07A 1H5UA 2A0WA 1DWQA 3CH4B 3QKWA 4E4YA 1RPAA 2RAPA 2VRWA 1QG4A 4OLHA 3SK0A 2GMWA 1L1EA 3QTTA 2BR5A 5CH3A 2FPIB 2PWZA 4I4NA 5I51A 3ZKWB 4M54A 5JQGA 2FRDA 5EKDA 2ZUSA 1YJCA 6YASA 3PFGA 3BD8A 5HA5A 3V4SA 4EI8A 4I50F 4K28A 1R9GA 3EIWA 1TYCA 1BMFA 1EA7A 3U56A 3F2VA 1F7VA 3DP9A 3TH5A 3FBGA 3DKPA 4OQFA 4UNIA 4UCWA 3WGHA 1GDHA 3W9SA 2ZJ8A 3CV3A 2RHMA 1N2ZA 1R27A 3V46A 5M04A 4AUMA 1C3OB 3ICVA 3HJRA 3KWLA 5HMLA 1KY2A 4LQLA 4ZD6A 2NW6A 3IDAA 4ZQCB 4BGUA 1K8QA 3HKCB 1C29B 1T5SA 3QVMA 4MV0A 4FFWA 1GTVA 3U3KA 2IITA 1KE1A 3RIMA 3HXKA 3Q6MA 4YQZA 2IY7A 5GY7A 4D8WA 2ZRCA 2IZ7A 3OPXA 1UKCA 4UNQA 4E5YA 5CXXA 3BH0A 3IULA 4FYHA 2Z43A 2P9JA 3JV7A 5DFAA 4CG1A 4N0PA 1B6RA 1S9HA 1RXCA 3CLSD 4YCLA 1QG6A 1K6JA 1R0LA 5IJ9B 4F04A 1M7HA 2IZOA 4FWBA 4K9MA 4RVOA 1ARZA 3T1HB 2AYZA 2E5LB 1J22A 5BNFA 3UKOA 1XYYA 4C05A 1DJQA 2Q8QA 2Z57A 5AHWA 1N2JA 1QLJA 2Z0MA 1O9GA 1HM5A 2C04A 2FA9A 2HA6A 4X1KB 1BD4A 4DADA 3I6QA 2HRBA 2WJ4A 5EJ9A 1G17A 3E8XA 1UMKA 4RKFA 3EE6A 3D4BA 3IR7A 5ER9A 1E32A 3GEMA 3VU1A 2X14A 3BWCA 4DZTA 4LYFA 1Y6FA 1C2TA 5HFJA 5ILQA 3M3PA 1LRJA 5L6MB 2IUTA 3CZPA 2BEWA 3C8HA 1KAGA 5EKTA 1IM2A 2VDJA 5JASA 3K71B 4KXUA 3NDJA 5G0SA 5JPDA 3KJFA 2H4XA 5HIJA 3VYVA 3D7NA 1XU9A 1Z3CA 3WGJA 4BE9A 3EGOA 3GGDA 1ISSA 3BFJA 3WO0A 4UHCA 2ZE6A 3LZCA 3NBFA 1N33B 2H2FA 3S1AA 2FR0A 3GPCA 1HA3A 1KMMA 3L7LA 4A92A 1R0KA 5ECWA 3M89A 3O7MA 4BQFA 3KQLA 2ZIEA 1L8QA 1ZN7A 3F2IA 1HYQA 3O95A 4URVR 3G2KA 5F1PA 3NR2A 5F4ZA 3ZDDA 4DA0A 4F11A 4XD7A 3LL4A 1ETHA 2HK7A 1MVLA 2C2MA 1SOMA 2Z4SA 3PXXA 1RKUA 1Y8RB 2Q5QA 3V34A 3VSBA 1UM9A 2EKQA 3V3TA 2NN3C 2JI6A 2HWKA 4PU0A 2D13A 1IC6A 8GPBA 5LUAA 5E2IA 3F7MA 5G1PA 4EG0A 1XQ9A 1PQYA 2Q99A 5A5EA 4MQ6A 1SIWA 2HQRA 5KTPA 1S2IA 3GPLA 1OHHA 1NDQA 2DQ4A 2G4VA 2HFJA 3VC7A 4LRYA 3FZNA 3ZZUA 1SH7A 4HDNA 4QPJC 4YV2A 5ITWA 4YAKA 5JFTA 2ZZNA 5SICE 3AHGA 2NUTA 3FUWA 1NXWA 4BNMA 2TSYB 3QUAA 1JALA 3RAFC 4M0KA 3H3FA 5DI3A 2HMSA 4J0HA 2CFIA 2GHQA 1Y7PA 5CG2A 4AX4A 3GJRA 2BLNA 3HRIA 1CUBA 1OW3B 1EPUA 2P40A 4INJA 4CIBA 1BS1A 2AR7A 3LFTA 4QUEA 4LZNA 1SHUX 4ID3A 4J8PA 3S27A 2DQYA 3D2BA 3Q5EA 1GUBA 3K2BA 3ZCTA 4A91A 1JNXX 4CM9D 1C2YA 2AOTA 1M7BA 5FO1A 1PVOA 3FG9A 4Q66C 4YR7A 4NYMQ 4KFTA 1U8UA 4MRMA 4WBNA 2SHKA 5B58C 4MO2A 3U6KA 3GYGA 3OY7A 4NX2A 2ZYUX 3EEIA 5HWSA 1FTQA 4DV3B 2OQRA 2R85A 1PI3A 2A7QA 1KC3A 3MWLA 3SXUA 4PC7A 2VPYA 5DIZA 5T6BA 1MVOA 3P32A 4LZWA 4ZAVA 5FFMA 3WWCA 2V6FA 3CNLA 3ZR4B 4CKEB 1E60A 5FYDA 2IUUA 3L7CA 1Q50A 1J1ZA 1TTPB 2X2FA 4IR7A 1G41A 3PD1A 4K8RB 5D5HA 4CM9A 3IV9A 4QUHA 4HWSA 1OVMA 1A0OA 1NP7A 3PLRA 4IIHA 1L8XA 1LQ2A 4WLEA 3SEQA 4ZYWA 1KYXA 1GFIA 1R5JA 3GWGA 3THOA 1PS9A 5I9LA 1Y9JA 4PO9A 3EUEA 2HCJB 1RYEA 2REQA 3A06A 4D6PA 2PFSA 4KE8A 4B5KA 1Z0FA 2DZDA 1C9JA 5CX4A 1RLMA 3VV3A 3GO4A 5T6MA 2HUNA 4D46A 1A9TA 4R4JA 4QNMA 3SHOA 1AB5A 2VLIA 2CCJA 3M6WA 5AVXA 1LSOA 3EDRA 3KQQA 2PJUA 3GJ8A 4K3UA 1P0PA 2I91A 2DBRA 3T1YB 221PA 3WGQA 1NZJA 4LOIA 5HIKA 4ZRDA 3OFNA 2M9MA 3DVQX 1JLSA 3RFXA 5IXSA 2ODBA 4Z99A 1E20A 4EF5A 5TDHA 4RM2A 4LF6B 3GARA 4GXQA 2HO4A 3TSZA 3K15A 3WY9A 3NI2A 5C18A 1UZAA 3O8OB 4FTWA 3PS9A 3GMIA 1OZGA 3ACCA 1IUOA 1IN1A 1T6ZA 1U4NA 2IP1A 1HLPA 3R5KA 3VSCA 1YVDA 4PX5A 4CKCB 1NASA 4U7FA 3R3ZA 3GFVA 1E4VA 1URPA 1KIFA 3O7WA 3WWDA 1NUQA 1TJ5A 4J3JA 3G1TA 5I01A 3E0XA 5F2KA 3RRJA 2WT8A 1QHHA 4OPMA 4RSHA 2DJIA 1P0CA 3QMWA 4YAGA 4BQOA 3ZXIA 3PZBA 1SBYA 4CT5A 2Y1LA 1U2GC 3DGFC 4ND5A 3LC0A 5JH7F 5DYWA 3S81A 1C8LA 1XZBA 3ONVA 2C2GA 3MOIA 5L4NA 1C0KA 2ERXA 2E9SA 3UMYA 1IPEA 5K3DA 4HG2A 3TQRA 2XUQA 4KR9A 1B0ZA 1T4DA 3QGMA 3S70A 2H0AA 3LKVA 4P86A 1NHGA 2ASEA 3CR8A 1UUFA 2CJXA 3KWJA 4WBSA 5KYWB 1KRWA 4DAEA 3WRWA 1NDUA 4BNGA 2BH9A 4AZ3B 1T5BA 1EMDA 4KO4S 2O23A 2O5VA 3OO1A 3QPCA 5BWNA 2HT1A 4AT1A 4J7XA 1K5HA 1TJPB 1V71A 3HR8A 1CRQA 4C3UA 1W4BA 2A30A 3VPHA 1LEHA 5TS2A 3QE9Y 1UMBA 2PAAA 2YN2A 4NENA 4RDCA 1SWWA 1HDCA 1YBHA 2UZAA 4UCQA 2FPKA 3Q88A 3OE4A 1E7WA 1ACMA 4WFKA 2W2XA 3TKYA 3VPSA 4E2YA 2ANCA 2QIPA 1S7CA 4KB5A 2V7QD 1F0YA 3N2NA 4AJNA 5HK9A 1QYCA 3ZTTA 3DFKA 2B1GA 4G0ZA 2WVHA 2MSKA 1T6BY 5IU6A 3RBXA 3B6ZA 4GEKA 3DC7A 3GD5A 1JQKA 3FCCA 5C1DA 4QM6A 1N5MA 2W90A 2V7UA 2VWQA 2G9QA 4ZDIA 3NQ41 1JVNA 1BCRB 1T6NA 2JFXA 3EF1A 5FO0A 3ZGOA 2BGWA 1PF7E 4O2LA 3D4IA 2HU2A 3OE7D 5D1NA 5LBTA 1Z5WA 1F5SA 3LZ6A 3MT9A 3NNSA 5LQCA 1KDYA 2YDYA 1L9XA 2Q28A 1L7QA 2XECA 4RHXA 1T5OA 2C8VA 2YJ3A 4RQTA 5EGNA 4E15A 5F9HA 2Y2UA 4EJ6A 1JZQA 3PE3A 1JHQA 2KMLA 5MN5A 3MA0A 2GLTA 1ONBA 4XJXA 5AJHA 4HNUA 3CLSC 4KGVA 4KN6A 1AT1A 1U8CB 2DOKA 1MG0A 2B37A 1Z45A 3DOHA 4HAZA 4NOLA 2I55A 1EE1A 1JJ7A 4N5NA 2WNSA 4X54A 5JMWA 3UHFA 4MRAA 1POXA 4P0QB 3ILHA 2H2DA 1YOVA 3DNFA 2FQ1A 5IW8A 3IUYA 1AQ6A 1FQJA 4WVLA 2DPGA 2FLKA 5AVJA 5AVQA 1BD3A 1GM5A 1OV4A 4KPGA 4UAUA 1XZNA 5DM2A 5CA0A 2QE7A 1C1DA 2AN4A 3NC0C 2KS6A 3M6VA 4IDNA 4K8OA 1RJ9B 3NT5A 3VPXA 3WO1A 3BHJA 5TXGA 1K75A 3ASYA 3TSWA 3K0SA 1OI7A 2BVNA 4XGRA 3U4QA 4Q34A 2I8LA 3UWSA 2FN8A 2VDWB 1V48A 1ZM7A 3HPQA 3D7KA 1HE1C 3DHYA 2HWYA 1BMQA 5F23A 4JLKA 4G2TA 3PQ5A 2Q29A 4BEVA 3OFSA 2HZBA 3I61A 1JKIA 4X8OA 1L5SA 3EFEA 3V8PA 3P27A 1L7DA 3N3BC 3QLUC 3URKA 4D4MA 2J0EA 1WKBA 1KEZA 1X15A 2HXGA 2XD9A 2YOFA 2JJYA 4M4SA 3D1JA 3I8XA 4O4IF 2IIPA 3OH8A 1N5IA 1Z29A 3EULA 3OCXA 4R51A 1GTL1 3K35A 2WZQA 3IEUA 4KIGA 3CWQA 1XCJA 4LDJA 1Z5PA 3W5SA 1V6CA 3TIIA 1KJIA 3I3SR 4BV3A 1NPYA 5A0TA 1L7XA 4GRAA 4C4XA 3UT6A 1JHYA 4JMLA 4K6OA 4DIFA 2J0QA 4YBZA 1IQUA 4JC0A 4K87A 3CNNA 2ZUUA 2NXWA 3H1TA 2XA2A 4G01B 1T8RA 2P75A 2RJOA 4W7SA 3VPAA 2BL4A 1L4YA 1YL7A 2XD4A 4Q3OA 4HEA6 3ZWQA 4UEKA 3QKTA 5BURA 5L45A 2QZ9A 4WEQA 4IXNA 4DWOA 1K4MA 4S04A 3IE2A 4YCCA 3H84A 3WXBA 2OO5A 2H2IA 5FEMA 3S0JA 3FNIA 4WN9B 3B9RA 3PR2B 1A4UA 2WVAA 3PQCA 1W73A 3GLIA 4K0KB 4QYTA 2WWYA 4YLEA 4HK4A 4WZBA 1HUQA 1OB2A 2D0IA 2RHDA 4NI5A 1RAFA 3RHZA 2O8BB 1U0GA 4JD5A 1M83A 3S2ZA 1UBGA 4DPMA 4E1BA 3LLSA 4EAAA 3E18A 4GI3A 4F97A 2UXBB 4BO9A 4AY6A 4NWIA 3ZLJA 1PAUA 1RDFA 4X7MA 3WMEA 2UYHA 1R8QA 4NYJR 2XOKD 1IZ8A 3JXEA 3OPYB 4IUBS 3KJXA 2I7DA 1IHXA 2F1JA 3CO0S 3FSEA 3T7JA 3TLBA 4OF4A 3CVJA 2LCIA 3HCDA 4R84A 5CFLA 4FFMA 3P9PA 1XLVA 3IUPA 3TZCA 3T6KA 3IMCA 3L93A 5ECDA 5LP6F 4AIIA 2OK7A 5DTRA 3BQNB 3IEXA 4UKDA 3PHIA 5DNDA 2VYCA 4A0HA 3IUSA 3KS9A 3G0HA 1N2XA 1BVHA 1GNLA 3E8SA 1T36A 5DW3A 1I3NA 2A78A 1J07A 3SM9A 4ERNA 4OAQA 5GIPE 3C8UA 3CZ9A 5DP1A 1VDZA 4F46A 4PYIA 3U4AA 2UZ4A 1CJMA 2DM6A 5FOWA 1KYYA 1QZTA 2FMTA 3UAGA 9MHTA 1YA8A 4GGPA 3DTNA 3KFXA 5J2TB 2C57A 5LQJA 5TB5A 5DBEX 3KUDA 3HJBA 4PSCA 1E4OA 4Z8YA 5F77A 4EG4A 5EMLA 4EY8A 4ZKDA 3JVIA 4M88A 3UWPA 4FE3A 3HR7A 3TMAA 4QOIA 2IEGA 5HKKD 3WLIA 4F86A 4HGNA 1OXSC 4BP1A 5EJ7A 3OJWA 2OXRA 2AF3C 5K8JB 4DIUA 5KBYA 4BQRA 1F1BA 3VR5A 3BMNA 3BGDA 3T0FA 2O2GA 2BW0A 4PHHA 3PBKA 4IVRA 3PC8C 3SYRA 3IEVA 2IJGX 4GR9A 3PP8A 5JAZA 3D7LA 2JPDA 3UUGA 4TUYB 1SOWA 3DLAA 1OX4B 1MC5A 1SOVA 2W2KA 5H02A 4ZZ3A 1ORVA 1WXQA 1K66A 2Q0HA 5IKPA 5H8WA 3QLVC 4ZI7A 4GVLA 5IUNC 4WJKB 5ALOA 2GEVA 1PHRA 3AUSA 1LGYA 2Q4RA 1AH2A 3DLIA 1UBTS 4I3FA 3BVPA 3UKDA 1OC2A 3A05A 1KO8A 3LUPA 3ZG6A 2B5OA 4JL6A 5J2UF 2GA8A 2AOUB 2GD6A 3CS3A 3MCUA 4DE5A 2O59A 2WF5A 1DXOA 3LT0A 2P77A 1QHXA 2ANBA 1C7IA 2PFGA 2WYHA 4EVIA 3ZXYA 3MWJA 4RHTA 1FK8A 2FWIA 3KKNA 3EW9A 4ZVRA 4E11A 3NVAA 5A04A 3IERA 1FDUA 2WZBA 4YYZA 3U6BA 1YZNA 3NJRA 5AQEA 1G8GA 1TADA 1HTTA 4LGMA 2EAUA 2HC9A 1FP2A 4EB6B 1EFPB 5CBPB 4KR2A 5C8YF 4F2GA 5SV2A 3ZV5A 3BZBA 1P2UA 2PMCA 4LMPA 2RGBA 1BX3A 3U31A 4AYXA 2Q6LA 5JBQA 3Q7RA 1NYLA 3IXLA 4FEAA 3N7AA 3IMGA 2CVFA 2LZ0A 4Y7CA 4CW7A 1ZR2A 1XF1A 4UNRA 4MIKA 4ZCTA 1FUYB 3OBIA 4RD0A 1KXJA 2FRVA 1IB6A 1SXJC 1TQ4A 2YFKA 3IUBA 3RU2A 4LYDA 3TAUA 2A1UB 1Z63A 3MTDA 4NV3A 5DNWA 4B6SA 3TIVA 1JHRA 3GJXC 4E6PA 1RM5A 3TR6A 4AYWA 3Q7TA 1V16A 4G9GA 4PYQA 5AKZA 5B1SA 3KXKA 3TMKA 1S5PA 3WZMA 3ZHZA 4P4NA 1RKVA 1SEPA 1W87A 2Q4DA 3KJIA 4Q7JB 4BFSA 1D6NA 3GL9A 3ZQUA 4A3SA 7YASA 4FBLA 1B6SA 5CUQA 4KWCA 5FOUA 3UATA 1D8TA 4WV3A 4JUIA 5EYPA 5LL6P 2TYSB 1WSBA 4OJTA 4HAIA 2RD2A 3LWNA 1PFVA 1ND5A 1YRYE 1XE3A 3CGWA 4O4IA 3EXG2 1P62B 1QCDA 3NDIA 4Z2YA 1QLWA 1CZOA 2RHCA 2ZAMA 3FPGA 3PJGA 4K7JA 1Z4NA 1NFQA 4LOJA 3BHMA 5LC1A 2XYPA 4BKPA 4MKFA 3TOVA 2BGKA 4BNFA 4Y6LA 1XLTA 1UJMA 4ZYXA 1KZGB 4EHDA 1C30A 3FW1A 1Y5IA 2H52A 2Q0SA 5E8RA 5HUQA 1IEQA 1U7DA 1DAIA 1JF8A 1YL6A 3KPUA 3SJCA 3IPCA 1GYRA 4JS0A 4ROSA 1N36B 2DMRA 6Q21A 2OB1A 4RHUA 1FQWA 1NZFA 3K9BA 3RAPR 3UJ9A 4ZRNA 3W8NA 3SR3A 2NTEA 1QYWA 4QTXA 2IBTA 2RGNA 1AXGA 3ZW8A 1MB2A 4GMKA 3V9PA 1EX6A 1OXMA 1P4SA 3ZKAA 4OXRA 3DZJA 2Q4EA 3THWB 1LVHA 2Z4RA 1YMUA 1FXUA 3QHQA 2PUEA 2AKYA 2Q0XA 2O06A 5THQA 3SF8B 2QN7A 2VPQA 3TLZA 4KVGA 5JJBA 3K9FC 2Q1YA 2WSLA 4WK6A 5DISB 3DNMA 1Z56C 3IP9A 3KOOA 3SYTA 4EKNB 4OI4A 2EF1A 1J0DA 3B3QA 5LQUA 1JQDA 1QWOA 1YKFA 3QLVA 1YNOA 4RL6A 1T2EA 1R8XA 5LYJB 5LA6A 4HAOA 4KJXA 4BQPA 2A5FA 3ANXA 3GGCA 4BEBA 3MTAA 3ETCA 4N01A 3S5JA 3WNCA 4CV0A 4DA7A 2ONKA 4Q3EA 4Y18A 2X2PA 3JQAD 4B7AA 4O2BF 3T7AA 5JD5A 4MWOA 2BTOA 1ZD4A 2NU6B 2RONA 2W71A 3H04A 2WAOA 4AY5A 3UVEA 3ZWAA 4FHDA 1J33A 3V6MA 4B8YA 1NTRA 4KK3A 4DKXA 1U6IA 4IOLA 1WMFA 3MW8A 1QOPB 1JG2A 1Z28A 1EP1B 5GJCA 1PKXA 3RREA 3UTDA 3GN1A 1RM3A 2H16A 1PL8A 2X3UA 1RKBA 2JKZA 2PBRA 2GPNA 2HLNA 1U9ZA 2HHAA 3TKLA 3WLEA 4LJ5A 4B3JA 3QYFA 1FSFA 5ALDA 3ZXUB 3ZEIA 1P19A 1P39A 3VR6H 2GK7A 3FVWA 821PA 2PQMA 1ZH4A 1C9EA 2AQKA 3DZ8A 4QDZA 2ZBUA 4RIIA 4EMTA 4OSEA 2IPXA 2C94A 3LXUX 4CMHA 3P2IA 1G3IA 3R3SA 1R6VA 4Q7EA 4RZSA 4RTRA 5C1IA 1P0QA 5BR8B 3GRZA 3H83A 4KVZA 2OCGA 3F74A 5CDGA 5K4AA 2I9PA 3BRCA 3VOTA 2VTBA 3HKEA 4BV8A 1JIXA 1L4LA 1K0UA 2H5JA 1JR2A 4M1EA 4P22A 3N0VA 5JPCA 5A6VA 4HQNA 4QEDA 5H16A 2FSHA 4P84A 4A5OA 5CX1B 4JYBA 2GN6A 2BDUA 3O8QA 4KSCA 1N7HA 1LDMA 3GFQA 4I5GA 1EFKA 5DGTA 4D98A 3C3EA 3ZVMA 3U7HB 5JNUA 1XWWA 5HF9A 4A1OA 3U7FB 3IRUA 1Q2UA 4ZZ1A 3G9ZA 2R7AA 2O7NA 2B8TA 1CQZA 2FUEA 4GM4A 1A69A 4G5FA 5HF8A 3QTBA 5FJIA 4F4CA 1TKAA 2J9FB 2LR0A 2IWRA 1KPHA 1XLTC 2FFAA 3CUWA 1E79D 1LS6A 5H3LA 2BH2A 1UQUA 3O1LA 5JZOA 2P8JA 2ZVJA 2WU3A 2JCVA 1IHDA 3ZCRA 5BN4A 2VJKA 1C4OA 3RK1A 1XB2A 1FSZA 2J46A 5EUQB 4E5UA 2NV2B 3UG7A 1T15A 3HNOA 4IUCS 4L0MA 1YRAA 2GHIA 4ATNA 3CVUA 1SC3A 5JNWA 4B4OA 1VG9B 3FPSA 2ZT7A 2MSEB 3MC1A 3WOVA 3IJRA 2ORYA 2O1XA 3NEPX 2GFQA 1WU8A 4LYEA 4B6PA 2Q6VA 5K3BA 4HB3A 4KNVA 4F6RB 1MD9A 2E2WA 1KNQA 4N5MA 2GEFA 2G67A 4HLNA 3NEJA 5F73A 3HSSA 2FSUA 1OWOA 3FR7A 2PUDA 2OXCA 1KY4A 3KZ1E 4MGIR 3B3AA 4R81A 3TQHA 4MWGA 4B4DA 2XKKA 1P2DA 4WKPA 1YQWA 4H6XA 2R6R1 1QKKA 4HTFB 4EIWA 1OJLA 2Q1SA 1A8IA 2AFHE 4F21A 4JSRA 4L50A 1A2BA 4MRVA 3SBEA 1S6YA 2HV9A 4OL0A 3KTDA 4QHSA 5KDLA 4EG6A 4LHYA 3O83A 3WIUA 4CLHA 1RI1A 4E2ZA 1WTAA 1NW3A 3EMVA 1TTHA 4NBVA 4HY3A 1PGJA 4W9NC 4XYMA 1Z16A 4MK4A 1ZG3A 3KXDA 4P53A 1W9HA 3C7CB 2AC4A 2EEZA 5AXDA 3INGA 3UK2A 4E13A 2X1HA 3MD0A 3WGMA 1NT4A 3V3KA 1VSTA 3NOQA 3O26A 1W1IA 3R41A 4RJJA 3I5XA 1XOIA 2UZ0A 5TMBA 2IYUA 3EZ2A 1KMHB 1DOAA 3QLTA 1ZI9A 3EJ6A 4Q02A 2IXBA 2J32A 3PD7A 1M2FA 5FV4A 1DEOA 2YJZA 3PUXA 4W5TA 2HUPA 4U7WA 1JL3A 3KG2A 3BTUA 1XRSB 3ANTA 4HYTA 4YJHB 3ROFA 2CLEB 2C29D 2PEYA 3PRHA 1Q0SA 3Q10A 3RYFB 3T7CA 1IBMB 4RTLA 1LLFA 5FA5A 3WBJA 3OQVA 2HWXA 1U0HC 4WMLA 4JKOA 1YS1X 3NJ8A 2FEOA 5BO5A 2YXNA 4F93B 1SK8A 1UFOA 5CJJA 3MJTA 4XH9B 4CPDA 4GPEA 2E21A 3DL7A 4G5HA 5EPEA 1FU8A 3B60A 3SXPA 1KYVA 1YCGA 3BQ9A 4D7AA 2GYYA 3I30X 3SSMA 4M8SA 1WABA 1ACJA 3NHLA 2H7VA 3PU6A 1ZC4A 1D09A 1LBSA 3ORFA 4G89A 5B4TA 2GPYA 3Q8XB 1N2BA 4AUEA 2AZDA 1G3MA 4CM1A 1ADGA 3A27A 3NT2A 1DFIA 3NNNA 1M6EX 4CNBA 2JATA 1GSOA 2OE2A 2P7IA 2VUTA 1T1EA 2Q3CA 4JHXA 4QOHA 4F1JA 3D2LA 3HMKA 3MK31 4KXNA 4WAUA 4TVKA 3BFXA 2ZWIA 1KGSA 1MNAA 4MR7A 1C30B 2ICAA 3N2KA 2C83A 4LVNA 5CB8A 5CFOA 1CB7A 3SC3A 4K9KA 4B0PA 2DUMA 1DAFA 3AG5A 3FWNA 2BAGA 3K8ZA 5FL3A 2QAGC 5JPIA 1FUKA 3RKRA 1WL8A 2V8OA 3W6UA 1QH0A 3ERCA 1UWVA 2PRJA 2V9CA 4IIGA 5JYDA 4BX2A 4QUKA 4B4UA 2NO4A 1AN9A 16PKA 2VH5R 3PDUA 1NM5A 3I2FA 3I5YA 2IEBA 1PGPA 3WYDA 1XYGA 5E7IA 1SC1A 1ZHOA 3B7GA 2XR1A 5AIBA 1LTQA 4C7OB 3ZGVA 1SFRA 1P5RA 4X0EA 1T6XA 3OURA 5J4VA 3WHKA 2IEZA 3EZ9A 3TL6A 2YNMC 3F6YA 3GLVA 3L6RA 4JKIA 1Y1PA 3WA6A 1HFJA 3F98A 2H9AA 2FR1A 1A8PA 3PXBA 4CQMB 4R2HA 3DBOB 4BNIA 5EJFA 3M9XA 1HPLA 3CG0A 1VKZA 3B9BA 1SIOA 2P65A 3CRW1 4FFVA 4Q4DA 5F5LA 3X1XA 1MOZA 3ZU3A 4AJOA 4UMFA 4XSGA 1W59A 2J6HA 4A2QA 1DAGA 3ZLVA 3NTXA 3RJZA 1EXDA 4J16A 1GQ2A 3JS5A 3LL7A 4HLUC 1OLXA 1V8FA 2ATVA 3PGXA 3V8VA 1P6UA 2QTAA 5LKRA 1BAPA 2BF4A 3RS7A 4D3DA 5J58A 1U81A 2E4ZA 4UAGA 1H65A 4X92A 4F9TA 5JCJD 3FOWA 1CY8A 2BGGA 4YRZA 1N5OX 2Y77A 2AFVA 2JA1A 2QMQA 1CEXA 1KHTA 1GQFA 3GLSA 1PDOA 1BFDA 4TTAA 3HV0A 1ZZEA 1ZMXA 1H6BA 4QE3A 2X9NA 3VQTA 3N0RA 3TWOA 5EMHA 4BO1A 2Z2KA 2R6CA 1X0XA 1Z82A 3W2FA 1CQIA 4K6GA 3P94A 4HMQA 4FGUA 1GZ3A 3TBFA 5BSKA 5JT1A 3AKEA 5DYIA 4G0UA 4INAA 4BLOA 1KI8A 1ULZA 3K0KA 3LLCA 4CIXA 3C4JA 3O73A 3M1IA 1IXSB 2MSDB 3C74A 2Q2WA 4QU5A 3TLXA 3V4FA 1B0AA 3LUDA 3H2SA 2C1XA 3K32A 5GM2A 1ZXLA 3D3JA 3P2KA 3HK2A 3KXLA 1L4KA 2I99A 2PS0A 5ERYA 2PKRA 3GEEA 4ZGBA 2XLCA 4GPIB 3A6LA 4NS4A 1O97D 2RIRA 3DEIA 3H4VA 3U4IA 5DEIA 1CY1A 3GNSA 4NPHA 2PRYA 4ZCMA 5B6JA 1UXKA 5ED4A 1RYNA 3T52A 2P3QA 2W4IA 3FLBA 3KPVA 1TXGA 5AVSA 3SFVA 5I7RA 4ZVQA 3G68A 3PHGA 1YL5A 1X1TA 4M1WA 2WSBA 2O1SA 4ONEA 4Y7DA 4LJ9A 4BQNA 2WMDA 3NIBA 1B1AA 3R0XA 2X76A 3QXXA 3WFJA 3NC1C 4LGVA 4JYAB 3AR5A 3PA6A 2FN3A 3OU2A 2IHZA 3BRSA 4HQLA 3G9XA 4QBTA 3RNLA 2GJAA 1Y4SA 1CZLA 621PA 3V4RA 1G0NA 2J7KA 2QN9A 3DTVB 4YUWA 1M9NA 3OI7A 3P7MA 3PEVA 4P4SA 4UVHA 3EH1A 4P6VF 1UZLA 4DLWA 4QYIA 1VI6A 2ZBGA 4J0QA 5JJCA 4KX5A 1J2YA 1X7XB 4L2IB 3SNKA 1KC1A 3K0HA 4YGXB 4IHAA 1E5LA 2ZJFA 1LTHR 4I55A 1X7YB 2R96A 2E85A 2HU7A 1CU1A 1GNQA 1ODSA 5F7OA 2H51A 4NCAA 1I0LA 4NIMA 3NV9A 1E4EB 1E2EA 3F8WA 3RROA 4DSOA 1KL7A 3B1FA 2AV6A 3EDMA 1W44A 2FQXA 3L8EA 4IF6A 4P4GA 4MYSA 4BCBA 3I04M 4IX1A 4FFSA 2PFKA 4MUKA 1Y8ZA 4Y1RA 4E22A 2OHGA 5FUYA 3A10A 5HK8A 2O2IA 3QI7A 4M83A 4JOQA 3UK7A 1UJCA 5FR2A 4DILA 1Q0TA 2QKYA 4ND4A 1Q3HA 5TARA 1LX6A 5KOJA 3T1OA 3FSRA 4XIIA 3SS7X 1GCOA 3OJOA 4K6FA 3F1KA 3OA2A 2IZZA 1VIDA 1ZN2A 4XOUA 3ITEA 1NRWA 4UATA 1DE0A 1PR1A 1MP0A 1XU4A 1EHCA 3B1KA 3GELA 4ZVVA 4F4IA 3WQRA 3ZJYA 3SYMA 3FLMA 4DQUA 3FFBA 2Q45A 1I8TA 3FUUA 3WKBA 2WM2A 1O9BA 4P08A 4N3GA 4JI7B 1E0JA 1Z07A 2C8KA 4K81B 1HRKA 2FX2A 2RHWA 4GFDA 4MVJD 1YA6A 4CEIA 2HI0A 1UDXA 4I4TF 2XCOA 1GCGA 4Y2UA 2VJDA 1XU7A 4QNNA 4MICA 4TVBA 2XRZA 1LWNA 1K7YA 4P3OA 3SX4A 4X44A 1M5TA 1KO5A 2WHYA 3FH0A 4GBMA 3G8YA 1M2VB 2RHLA 1A50B 2BCGY 4OK5A 4TKUA 4L8VA 4E4TA 4RIFA 5EMJA 5HRAA 1XQ1A 1BDIA 1IIBA 2RDMA 2IEIA 4ABTA 3SS9X 3WK8A 4AWBA 1PJ4A 5LXTA 2ZE5A 2YC2C 4JKYA 5HEKA 4AF6A 1G3QA 4IMIB 4HUQA 2CHVA 4PXSA 2IV2X 2VI5A 4CQNA 1THGA 1VSVA 5EIXA 4JCCA 1TU4A 3BE4A 3E9CA 3TR0A 3F73A 4HWKA 5IH3A 2DKOA 1LSJA 1BC5A 1THTA 2OOSA 3KETA 3C48A 4CKWB 1RRMA 4TKLA 3PDWA 4KODA 1I0IA 1SC4A 3EIUA 2HHCA 3GW8A 2XZPA 4YRGA 4LA4A 5JZMA 3RS0A 2VT6A 4WXYB 1BFUA 5FA8A 1C1DB 3D81A 5JDIA 3ZZNA 3GP8A 1VKNA 2I1WA 1QAMA 1ZUNA 3KUXA 1Y3BE 3GFBA 2I8CA 3SLKA 4EF4A 1M2KA 2O1WA 3HB9A 4UW9A 1CUHA 4IEEA 1W2WB 3DFIA 3O4JA 1PJCA 1N0UA 4R41A 1OFGA 5D2CA 2OV1A 5D8DA 4IXTA 3SYLA 3I62A 4R6XA 2E49A 3LH5A 4A27A 1KKUA 1D5WA 2QN2A 1KFBB 1QQAA 4BMPB 1KYZA 5LZ4A 1M67A 5GPBA 4ZICA 5INTA 1K2WA 3N6RA 4DJJA 4YROA 5I5GA 3R6WA 5BYJA 1XZMA 3DQQA 4XGQA 5PGMA 5CEJA 4A6PA 3IB6A 3OEHD 2ZRDA 3E7FA 5ALHA 5D3MB 1D03A 5BUSA 5KDDA 2WAYA 1S4QA 3DBVO 3ZI4A 4YAEA 1RM0A 1YCFA 2HWUA 5G0UA 4BX9A 5JDCC 1EX1A 2DXIA 1T2UA 3ETDA 2BC9A 2YQ5A 4M6WA 1UR5A 3S1AB 2R6JA 4OU4A 4UDNA 3VO9A 3WLNA 4UTVA 1A5AB 1JE1A 3KX2A 8ABPA 1RI5A 2P2SA 4KE9A 4C4TA 3QG5A 1Z7GA 3CVYA 1CV2A 4RLHA 3NWEA 1WJGA 1X87A 2JK1A 3R2JA 3AI2A 2QLJA 3DF9A 4CKZA 3T5AA 2FFQA 1ZW6A 2FPGA 2IPNA 5COBA 5LIRA 1NAIA 1ZUHA 1MLDA 2ZTHA 4MW9A 4G4GA 3EWNA 3GYBA 3HEBA 4YRRA 1X1AA 2J48A 1HI9A 1SULA 4BCCA 1FNCA 3ASZA 4OHKA 3A36A 1DC7A 1TJ4A 4B3GA 4EYOA 1E0KA 3DTVA 2IOFK 2V1XA 3MINB 5JHHB 2UZ1B 3RV3A 5JC1A 5HM8A 5JZVA 2X5OA 4PO1A 5DX8A 5JSHA 4HQ6A 1Z2AA 2KW5A 5EQFA 2ZP1A 1PR6A 4MLDA 5I4BA 3IAAA 1U0SY 2AHOA 3DDHA 3M6LA 3Q8KA 1U7HA 5KWIA 1RHRA 4CF3A 1IYZA 2XRFA 5JQGF 3VHXA 1WBBA 2CBGA 1QLHA 3G6WA 3MRTA 3QITA 2XNKA 3HJCA 5C4GB 1XZFA 2Z58A 1LU9A 3DDOA 2PJDA 3L1VA 1MC8A 4NZPA 2XMCA 3FPBA 5A62A 3H1PA 4OTZA 4BOYA 1DRVA 2EIHA 1T3HA 1UC8A 1TX4B 2A94A 3H0EA 2QUIA 3QVVA 1JFLA 3O9MA 4G63A 3IQGX 4JLPA 5DPMA 5JWRA 4RNDB 2VOEA 4I3GA 3DBLB 4RIGA 5EQJB 4D4KA 3VNVA 4AW9A 1ZISA 2WFZA 3BYZA 3COYA 1P0IA 4GKVA 4NARA 4CCYB 4PLTA 4UE3S 3IS3A 3IELA 3KVNA 4BFYA 3K0BA 2I54A 3RUDA 3BJIC 2CYCA 2VL7A 3E22A 4QREA 4Z0HO 4KQFA 3WQHA 1IBRA 1NR7A 1F6WA 1C3OA 2WFAA 2YVQA 1Y4DE 1MPTA 1V4VA 2OMEA 3O1IC 2IPOA 2VAWA 3ED1A 2H8GA 4DSZA 5CD1A 3AVWA 4DN6A 2VDUE 3EMDA 4U5QA 3I5UA 3A1WA 2ZG6A 2RHHA 3QF7A 2VQSA 4MI9A 1DFGA 3STYA 3CNQS 1ZJJA 4PAMA 5CB4A 1L0BA 4UUOA 5AW1A 4RZIA 3ZWYA 4TLAA 2FV8A 4GZ6A 3HVUA 3RVRA 4TTTS 4AN0A 5CYPA 5BN4B 2VP9A 4P98A 4YMGA 1FB5A 1P18A 4PRYA 4CN8A 2I7VA 4MGHA 4IHKA 4V0OA 2ZROA 1SCQA 4UXHA 1LC0A 3CX6A 2DFLA 2ZRIA 3FIUA 4GG1A 1GG8A 1NMZA 3QK7A 4FOSA 4EHFA 4XI9A 5HFNA 1XC7A 2OK8A 2XUPA 3I37X 4TZ6A 1MRZA 4PFSA 5DLEA 5BXQC 2BUAA 4NZZA 2WWWA 3JQQA 3S44A 5KSZA 2FH5B 2C5EA 4DWVA 3RVMA 5KC9A 4CXMA 4RZ2A 3UH1A 1QAOA 3QNMA 4FIDA 1EFPA 1YOBA 4QGFA 4MI3A 5DTEA 3UAZA 4ARIA 3ZDZB 1POWA 4QLAA 3BC1A 1NRXA 4LXXA 5DCLA 5IT4A 2AK2A 2WD7A 3GUCA 3LP8A 4IWXA 4RHFA 5ECYA 4JP5A 4JP3A 1KK0A 1S7GA 3TOCA 3VBEA 1AXEA 1QB7A 3GPDG 3QUSA 3RUHA 1U3CA 1U99A 2A84A 3FM9A 3QFTA 4OIMA 1KERA 1ILWA 3KL4A 3ZH2A 4MW0A 1K3FA 3RSLA 2PX3A 4DF3A 4JDUA 3GP5A 1A97A 2KBFA 1MC4A 3E1GA 4EPWA 2AOUA 2O0HA 3GI1A 3UCFA 4ALNA 2O05A 3VH3A 3GD7A 2LNDA 3A3PA 4NS1A 1ZDMA 5FBRB 4ZI7B 1ESNA 1TYEB 2B8JA 1PTKA 3ZIAD 2X2EA 5F78A 4J07A 4PE5B 2BMJA 2BBOA 2IZ0A 3R3HA 4UUPA 3R7BA 1KXZA 3HNRA 1QQBA 3LOUA 4MR7B 4B7CA 3C5EA 1JEJA 4WZAE 1N2CB 1OFIA 1Q1BA 3AZOA 4L0DA 3QXCA 4G5XA 3KYJB 3FAKA 3FX2A 1I2MA 1RIFA 3I6IA 3WDKA 5I7HA 3G2MA 3UUWA 3A26A 1A2OA 4C4ZA 4G5QA 4DDMA 2GCIA 3CWZA 4RHCA 1N6HA 4DHWA 2ZB2A 2FDRA 3I9NA 4N54A 3EYAA 5DI3B 4HEHA 3ZHVA 5BWOA 3Q72A 1FFYA 2X0NA 1KFEB 1WDWB 2CLKB 4MUJA 2Q21A 5FWDA 4UD6A 2Q7XA 3W6OA 3ANMA 4M0LA 2Q9AA 2QTGA 1R6TA 1KYTA 1YDFA 2R6HA 2A58A 2QZ4A 3ILSA 3PEWA 4GR5A 4NZ9A 1NVXQ 4KIUA 3I42A 5KMGA 1T2VA 4YDQA 3RWBA 4UPDA 1UM9B 2CEAA 1H05A 4FQ7A 4WESB 4CT0A 2HADA 1NT2A 1NVWQ 1SVSA 2JNWA 4IINA 4MVWA 3H9EO 3L46A 2FFJA 1BW9A 1JMKC 3GU3A 4IWYA 3MOGA 3WSVA 2Y1CA 3HVRA 1NLZA 1OWLA 3UMJA 2DCUA 4DUGA 1E1QD 2IGTA 3ZCQA 3HFSA 5BY2A 3WB2A 4YFYA 5CDTA 4B6RA 1EB8A 1X39A 1WOYA 5A3RA 4W8HA 1BQEA 2WD8A 4FJ0A 3CF0A 4B43A 3SQOA 1V47A 3M5DA 4GHWA 1P73A 3CFYA 5E3JA 3SU8A 1O4WA 5FQNA 5KNDD 1RADA 3VNRA 1GZ6A 2WIGA 3UAWA 1NBMA 1C8BA 4G81A 2O8BA 3FE2A 4CU5A 2PX2A 3F5MA 1PQUA 1IBCA 5K0ZA 1VA5A 1Z6XA 2W9XA 1U11A 2XTAA 3KRTA 1WS6A 4WZBB 2PWPA 3E4DA 1QP7A 1ISRA 1OR8A 2FDCA 4CFYA 1KMCA 4P5PA 2F8SA 2V5UA 1M2NA 2X13A 1VJ0A 1YJ5A 4UHEA 5K01A 1PWEA 1Y1LA 5B12A 2XODA 3BWEA 3DW3X 3TUZC 4R3WA 2PUFA 3E3AA 4HGRA 1P5HA 3VR5D 3ZDXB 1CY6A 1WSDA 1T9CA 2I4TA 4V0SA 2L2QA 3NETA 1GYPA 5JQWA 3WNQA 3SIWA 2FJ0A 1OGJA 2VUUA 3ZS8A 1L6RA 2FQWA 1S8AA 1ZH6A 2Q50A 4K9SA 5DHFA 5FI5A 4OEHA 2PJZA 5TGDA 3DD1A 4NYIQ 4NF2A 5FBLB 2QRMA 3D1VA 3GDFA 3L06A 1FFGA 4BAGA 4F9GA 1D6SA 2OT3B 4YWHA 1USKA 2Y1OA 1XAHA 2I1QA 1NATA 3A3KA 3II6X 3MT8A 4JNKA 4NE9A 5JXJA 2C03A 3QJGA 2PRKA 121PA 3SVTA 2C84A 3KR9A 4G26A 2J5KA 5GMOA 4Z7JA 1B42A 2RCYA 2VDMB 4TQ9A 3ZVNA 4IJQA 1JZTA 4DSTA 3D7RA 4UBJA 3NIWA 3BF8A 4EDFA 1EJBA 5TMEA 1WMEA 2BGMA 4JLNA 1ZU5A 1AOXA 1Q7BA 3H5VA 4FOLA 2R0QC 1ENYA 1OTYA 2Y05A 5A71A 2ISQA 2CL5A 1I14A 3QSGA 2I03A 4MRSA 3RB8A 3MQFA 3E84A 3Q40A 5BMVA 1CQIB 3RT9A 2JLRA 4ARSA 2Y1XA 3ONWA 1XTIA 3RE1A 1ZI6A 1ZD2P 2R00C 4LJYA 1EDZA 3OZVA 3OEYA 2LDBA 3R6GA 4MQLA 1CFJA 4YCBA 1IOWA 4C04A 2JAUA 2BBSA 4KYVA 3RYHA 1KO1A 4QXPA 3SKXA 3EIXA 4ARUA 3LTNC 2Y76A 4BGEA 3K5PA 3L1UA 1QONA 4KUEA 2VP6A 3TJMA 2W2KB 1ISGA 3B2NA 4L5BA 2C5SA 4P81A 1V7ZA 4N7BA 1GNVA 3C43A 1ZRNA 1G6KA 1RRCA 2HTFA 4XQEA 2HEGA 2Q7DA 5HGXA 3SQXA 3H0CA 4CL2A 3NNDA 2OECA 3CKYA 2GPAA 2PKWA 3LQ2A 3PJFA 2Z2XA 4ZVPA 3TLJA 3I73A 1GAWA 1RE1A 3I5MA 2HD4A 3KLNA 1PYDA 1JSRA 2CNNA 1MRNA 1I2BA 1Q0HA 1QWSA 2VJOA 3TR5A 3WKAA 3REOA 1E18A 1XNGA 1Y4AE 2Y68A 3MGBA 3ADCA 4Y6OA 3E8MA 4LZOA 2YCBA 4PLZA 4M99A 5A7GA 1EP2B 3C6MA 3OCYA 3NZEA 4FZ5A 3WI7A 4Q9LA 1MDFA 4CCWA 1QYDA 3IALA 2LWIA 4GMHA 3H8JA 1HDIA 2ZPTX 4DA8A 3ZBUA 4MHTA 4XB1A 3K9QO 5F3WB 2K2WA 3JQ8A 3ROEA 7ABPA 5BSWA 2D59A 3DHEA 3P9ZA 1RI4A 3V7FA 4EHHA 4F12A 4NMXB 5AVWA 4DV2B 5EP2A 5KOJB 4NENB 2JFYA 2FRDC 2B7CA 2OR3A 4HDCA 3QBTA 4LDZA 3UNXA 3OUZA 1D07A 2YRXA 4Z8XA 1EVQA 4G0MA 2PDAA 4Y8VA 2QX6A 3U5ZB 4JX9A 2P0AA 3C1TA 2WP8J 1JWBB 5COAA 1L4NA 2P1RA 3ITNA 2G0NA 4FLEA 2QGFA 5T41A 1ZOPA 1I3CA 3EVDA 4IIJF 1CJSA 5DX0A 2UYGA 4RHYA 4D3XA 4EJ0A 1GGHA 3FN4A 3FSGD 1LY1A 3RG8A 3AW9A 1XAJA 2NTYC 4JVNA 1SXJD 2ECFA 5K6RA 3QU7A 4PNEA 2AA3A 2F3QA 1M1NB 3L6BA 4M2LA 4O59O 1G8SA 4UVEA 2I2WA 4YMLA 5ALXA 3EPPA 3UV6A 5ITVA 5F7XA 1FVXA 3KQVA 4TSFA 2DFTA 2GPJA 2VNAA 5F33A 1V9CA 2H65A 4TT3A 3UIEA 2I4IA 4KAXA 4HXFB 2SKDA 4BFTA 4KRXA 4UCXA 1AD2A 3PNLA 2Y6VA 3WOHA 2WYVA 2P9BA 4HFJA 2HOQA 4OGLA 4D8TA 3WGTA 1R8JA 4FGZA 5KVVA 3R5JA 1L5GB 1YTUA 3NKVA 1HRDA 4QX6A 3RIXA 5HKBA 1BSVA 4X61A 4D9MA 1RC0A 1SY7A 4JJIA 4TV9A 1WDLA 1WXWA 1XDBA 3O8OA 4N0DA 4W1RA 3C3WA 4QPPA 1SIBE 4MV6A 1H2EA 4BJ3A 2G82A 4DLLA 3JWEA 3IP6A 4HS9A 1SZDA 5BRJA 3PUWA 1ZM3A 4G5SA 3DFZA 3IVAA 3OEEA 2P4UA 4KXFB 4J4BA 3EFHA 3JQRA 3PFKA 3EZGA 4LWQA 3O2JA 3QPDA 3DD5A 4ZOBA 2VQ3A 1Z8HA 2ZYTX 4KREA 3V1LA 3S99A 4D3YA 1RBZA 4EFMA 4FMBB 1T34A 2CN1A 2A1UA 3HL0A 4BNYA 3VR4H 4JR0A 3IB3A 5BV8A 4H0CA 1H3FA 4G0OA 3RS5A 4CFSA 2ZRGA 4TV9F 1CRLA 3UAXA 1SRRA 1VIYA 3HB7A 4BNVA 4GVXA 4Q6BA 3THSA 2PH1A 3VC2A 1CS0A 2JIDA 4J43A 3TW8B 1RWPA 5HNKA 1YI8A 4ACBA 1YIOA 1WPGA 2GJ9A 2Z1MA 4RY8A 2VP2A 4NU0A 2HH9A 1X8XA 3WHPA 2BCJQ 1FS4A 3LQKA 3NBAA 3PFNA 1KOLA 3RH0A 4N3BA 5REQB 2BTQA 4WCVA 3FXAA 2ILTA 2YRFA 3H1EA 2GWRA 1PP4A 2AUMA 2ZB4A 5J5CA 2PUTA 5L51A 3U9LA 4R9VA 1WY7A 3JQCA 3K8OE 1UWLA 1NJ8A 1OVGA 1CS4C 4TGLA 1JG1A 1V37A 2K5UA 2OM6A 2CLOB 4WK0B 3M1AA 5AJXA 4BC0A 1U2EA 4C3OB 2YNMA 5FKJA 5LSAA 4F2WA 4X66B 1W36D 1PL7A 5G4KB 2VHUA 2VJCA 3MWEB 3MUNA 4BO5A 4J0DA 1OGIA 2D1QA 1E66A 1RKXA 3GMTA 2ERYA 1F8YA 1ABBA 5KHOC 1J2UA 5BN5B 3BEOA 1ML4A 3KOYA 1F9AA 2QT9A 1A2QA 2OY0A 2OORA 2W93A 4BJ5A 1V5WA 1NFFA 2EL9A 2WTAA 3AHJA 4LZAA 4Q16A 1YA4A 2IU3A 4RSGA 2C2YA 1VCNA 3PC7A 3VJKA 2O7QA 1V43A 3L49A 2WUFA 2ZZKA 1L4UA 3VHQA 2QRNA 1NTOA 4FS3A 3X1JA 3O8QB 1AKEA 4JL5A 1AQUA 4P54A 2ZIAA 2WKQA 2I33A 1KBZA 1F48A 2WG2A 1X77A 1I3MA 1WA5A 2RK4A 3LX6A 4RZQA 4RY2A 1N57A 1OD6A 4WASA 5B1YA 3U3RA 2PMDA 3C1AA 3G5AA 5DJ5A 5JFOA 1T24A 2NSDA 3E81A 5DNCA 5I9SA 2C4UA 1ST2A 3EEOA 1P4GA 3Q3CA 4X1YA 4PN3A 1C9MA 1NF3A 3QZUA 1NJ1A 1BQ3A 2OBNA 2ZJ6A 1N9KA 4MV7A 1YDHA 4HQKA 1T3ZA 1GOTA 2CJPA 4FFNA 4FHFA 4C87A 4PYKA 2OP0A 3I2IA 2DEUA 3RT1A 2JBAA 3SHQA 2I29A 3SLGA 3UAYA 5JZSA 1ZY2A 3IMEA 2X0DA 1K7FB 4E5VA 5KYKA 3VH4A 4O25A 3ZGZA 1XPJA 3ODGA 4B7ZA 3RRYA 3SC2A 5CB0A 2G9ZA 4M1OA 4IZHA 4RXMA 4CT4B 4HVCA 2NPFA 1ONPA 5EHNA 3KO8A 4BNHA 2ECOA 2LGJA 3EEBA 3RS9A 4UVGA 3S68A 2FUG6 4H6PA 4PM4A 3TRJA 1SQ0A 1ZGHA 1E61A 1J39A 1NSYA 1CY7A 1M8FA 5DHAA 2H6EA 3RTGA 4YP5A 4H27A 3NAZA 1U04A 3B6JA 3C85A 1D1TA 1N9ZA 5FDFA 2VCYA 3LC2O 4O3MA 2FJPA 1DEAA 3DAPA 3IAHA 3KJZA 5F76A 4CMIA 2PU5A 4ZZIA 3NBYC 4HFRA 1RYZA 1GTZA 2ZJOA 4RD3A 4RH0A 2PH5A 3DB2A 1Z4PX 4GECA 3NATA 5BSVA 4H4EA 3LI2A 3I9KA 4GOJA 1U2PA 2OLKA 2QJWA 3AFNA 5LOVB 2QRJA 4XCQA 4D44A 1DKLA 1DKQA 3GZJA 4H1HA 1PJQA 1SBCA 3RK4A 4TL7A 5C8DA 3UW1A 1FDTA 3BXXA 3ORHA 2O9JA 4FW9A 1QU3A 4A8JB 3PHHA 4OJMX 1XVUA 3NVDA 5CDHA 3KYDA 1G1MA 1C7JA 4B31A 2ID9A 4X6YA 5DSTA 1AHIA 2ZQYA 1UFKA 3CH5A 4CDMA 1VGRA 1UBKS 3H5OA 4FIZA 4UU8A 4OQZA 1PWYE 4FYPA 2D62A 5ELLA 2H7CA 4ZXFA 1ZBDA 3ER8A 3AEYA 2B3TA 3HUTA 3T9AA 2P3OA 3Q8MA 2Q5JA 1AGRA 1W36C 4YAOA 5BSEA 1IDN1 1LI7A 2CSXA 2ZWAA 2PH3A 3L7DA 1WUTA 4QATA 5DWDA 3HCNA 2BKLA 1XKTA 1P4AA 2J4DA 4OGFA 3AM1A 5TQ0B 1EXNA 5GONA 4YONB 1KVRA 2CYAA 2QVXX 3HN2A 4ECEA 1YHNA 2XZLA 1Y4ZA 1T9ZA 1EUCA 1Q1ZA 1OWMA 2IODA 2VDRB 3THRA 3GJ7A 4BU0A 2JGEA 5DN9A 3D4PA 1WDKA 4F71A 4YQFA 2X0IA 2IRWA 3T0GA 2QYOA 1J8QA 3TD2A 4UBLA 4N5DA 5ICFA 4MPDA 4GUAA 4FKBA 1YBAA 4OM8A 4CV3A 2H06A 3ZWWA 3LVBA 4E07A 1QVRA 4XCVA 2ENWA 1A77A 1HQDA 3FRHA 1DC6A 1U28A 3AP1A 2ZWVA 4GI2A 4O5OA 2XE8A 3SBXA 4MR8B 2X0FA 4BX3A 5K4GA 3CGGA 4KX3A 2ZYAA 3M81A 5LQSA 4J4HA 2HCFA 4R54A 1DAKA 4LRSB 2ZJ4A 2YV3A 4BNLA 1EVJA 1O08A 2FPUA 3A6EA 1KETA 2WPDA 5SYNA 1NJFA 3CHYA 2AR9A 3NRCA 4Q19A 4WCDA 4X1OA 1SU8A 4IMPA 2YHBA 4KQHA 4UNSA 1A9RA 4ASUA 4EB6A 3V8RA 1H94A 5CBPA 2PKQP 3CUKA 2YJNA 1X80A 1NFRA 2AQIA 3QWFA 1ADBA 3CLRC 2NSYA 5EXXA 1UWCA 3REQB 3UT5B 1OH8A 4NK5A 4D8VA 5JAHA 4FGWA 4AKSA 3IL2A 3EWIA 3HHEA 4Y98A 2F6RA 2AK3A 5ICSA 2Z2IA 1Z0AA 4MCIA 2H4YA 2H2HA 1LPMA 3HCCA 5J2TA 2YZGA 4YCAA 2VHQA 3ZHXA 4E2FA 1T4GA 4IGFA 1YCDA 5M2QA 5FOSA 1Z8NA 1HSZA 2AEFA 2X0RA 2IYWA 3U19A 1Y8RA 4YMSA 4ZQIA 3DTVD 2CWWA 3BD7A 4O08A 1G42A 3MJ4A 4AQYB 5HW0A 4FR0A 1EM8A 4LJKA 2QTHA 4PQGA 4ZA2A 4JI8B 2IVZA 4GZLA 4IDEA 5K7SA 5FUMA 2C5HA 3RVSA 3ZJUA 1EGHA 1PTJC 2CE7A 4N9QA 3TRKA 3MJVA 1NLFA 1WCYA 3B1XA 3S4YA 2I6XA 3ESZA 2JCGA 4PGMA 1BDMA 4N7MA 1MOSA 3U5TA 2V9ZA 5F98A 2GYUA 5BP7A 3AR9A 2DGDA 3PHCA 1PJ3A 1N34B 1DDGA 4EZIA 2XB4A 2XWSA 2GPBA 1N6RA 4OHPA 2REXB 5A4DA 1Q17A 4HJXA 2RI1A 4XFJA 2QAGB 3R8XA 3WRYC 2GN0A 3VZPA 1HOXA 1KDZA 3Q87B 2ZRNA 2VPPA 3K9CA 1DUVG 1EWTA 3IURA 4OYYA 4CL3A 4FXPA 1IVSA 4J7CA 1YJBA 1YR8A 4KVFA 4TKZA 1NF9A 2R9VA 3FVQA 1E1RA 4MKZA 2CW5A 1W85A 4D9HA 1TJ3A 5CD9A 2IE8A 4GOKA 3LGAA 4KKXB 3G85A 3B9QA 3Q5GA 4AS2A 5ARBA 2NU9B 1IOZA 3B8EA 1I2CA 4KQMA 4EKGA 2FMFA 2Q5OA 4Q9DA 5JHGB 2WK1A 4OUKX 4RNCA 4WERA 4CKXA 3NTVA 2IX3A 4ZJPA 2VFAA 1GG5A 1KJJA 2GT1A 1WCWA 1SU6A 1XVTA 4JT4A 3UB4A 1II8A 4L02A 1B14A 3WP0A 3QYAA 3A58B 5JAQA 3SIPA 5CLJA 3SE7A 1N6PA 1V2HE 1G8MA 3CU5A 3AILA 2B35A 2Z09A 2VIIA 1ZLXA 1GPDG 1TCUA 2RFLA 2O2DA 3AY6A 1U63A 1LS1A 3N6XA 4TVOA 1EQ2A 2IOQA 4I1PA 1DSSG 3HKCA 4RTSA 4EARA 1ADFA 1ZD1A 5ULLA 5B2EA 5JY6A 3A04A 3L7AA 1VRVA 2RBKA 3IVGA 4MRNA