4BRSA

Structure of wild type phaz7 phb depolymerase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4brsA00
4ZGBA 3V1NA 1BU8A 5ALKA 3W9BA 4B7ZA 1CV2A 2JIDA 3IDAA 2YXPX 1MX5A 3LLCA 1E66A 5CRIA 2GBGA 3WKBA 4NMWA 5K3FB 3WK9A 1YA8A 4BVLA 3DLTA 5ALTA 2OAEA 4UBLA 5HKAA 3C6BA 1TAHA 1ACLA 5ALQA 2NW6A 4XIIA 2VT6A 2QRUA 4BAZA 3FYUB 1RWQA 5JATA 2XUKA 4K2AA 3AILA 1DINA 3I2JA 2XQIA 1J06A 4FKBA 4QDTA 4FLEA 4HAIA 4CCYA 1PV1A 4J03A 4UHBA 4B0PA 1MT3A 4RNCA 3IVMA 2XUPA 3GZJA 4K6HA 1N8SA 4EY4A 2XMBA 1XRLA 4Y2UA 2OGTA 1ZOIA 5HQ3A 5D6OA 1DU4A 3LP5A 4K5QA 3FBWA 4W63A 4WDQA 2ZSHA 7YASA 2AXEA 2B20A 2WIKA 4IH4A 1VXRA 5ALUA 5HF9A 2XLCA 5DYTA 2XLBA 3I1YA 1GXSA 3BF8A 3C5VA 4HXGA 4N8SA 2JGLA 1CQZA 4E46A 4EZIA 4DMCA 1XZGA 1I6WA 2O2GA 4HRXA 5SYNA 2WU3A 1F8UA 3WK8A 5CH5A 2I03A 1AQLA 5ALEA 1QIKA 3A70A 5AK4A 3GUUA 1NU8A 2WSLA 3DJYA 4AMZA 5CMLA 3HACA 2WG2A 5LZ7A 2XUAA 3HC7A 2QOEA 1FFBA 4FBMA 2LIPA 1H2ZA 4BTVA 1VZ2A 5JIBA 3BJRA 3PFBA 2XB6A 5ALVA 4FMPA 5CT9A 2XUGA 3QMMA 1XRRA 4K6GA 5C81A 2RIPA 1ZI6A 1QIMA 2Q0XA 4HXFB 3HABA 2WFLB 2RONA 4H7HA 4AO6A 1LZKA 4JUIA 4HZGA 4DMFA 1VOTA 3WWDA 4LXGA 5JARA 5AIBA 3FYTA 3V9AA 4WY5A 1EXWA 5BV7A 3GELA 5AKYA 4J0GA 5CTAA 2RGUA 5A2GA 2WFMA 3WWCA 3BDVA 1TKRA 3VKFA 5DNUA 1K63A 4GEGA 4QLOA 3SX4A 5J3JA 4EY7A 4L72A 1XLWA 1IVYA 4ZREA 1QIEA 3P2MA 1VZ3A 3WIOA 3WK4A 3WZLA 4B9EA 1UOOA 1THTA 4M0EA 5AM1A 5A6VA 3DKKA 5HF5A 3I2GA 4OB6A 1XLUA 1SCKA 2HM7A 1H22A 4OYYA 3WJ1A 3WWOA 1XZEA 2ZYRA 3YASA 4BVJA 3W05A 4QDOA 5D3ZA 2IIVA 2V97A 3H04A 3C70A 4BRZA 1JJIA 4PW0A 2OLEA 1CLEA 3PI6A 4Q82A 1VLQA 3LCRA 3QH4A 4CI9A 2Y6VA 5H3HA 3V1MA 3ANSA 3R41A 3E0XA 1QIGA 2WILA 5ALMA 2AJCA 2PUHA 2RHTA 2Z3WA 1TK3A 1XRPA 1VKHA 1JKMA 4ZXFA 4IO0A 1AGYA 1UK6A 1WB6A 2XUFA 3D2CA 2WIFA 1EDEA 2GBIA 2PX6A 3E4DA 3O0DA 4RPCA 1JJFA 3ZV7A 1J1IA 4C87A 5CBKA 4MWSA 4FNMA 3OTQA 1L7RA 1QFMA 3LS2A 1SFRA 1Q0ZA 2CZQA 2PSJA 2HRRA 1MAHA 4B82A 2PSEA 1R3DA 5F4ZA 2G63A 3AUKA 4GXNA 3WA6A 4KACA 1LGYA 3DOIA 1QIJA 1DWQA 1YB6A 1LPBB 2VF2A 2GYUA 1XKLA 2OAGA 2DHEA 5HCUA 2GBFA 3HLKA 2VSQA 3ILSA 1CVLA 5AKEA 3SC2A 4LYDA 3VISA 1CUSA 3C8HA 2BUCA 1GZ7A 3H2KA 2OXEA 3AZOA 1LPAB 5LZ2A 1EDBA 1UKCA 4GI1A 5HK8A 3WK6A 4KE6A 1ZIXA 2X76A 4Q05A 5CT6A 1YS2X 5KWJA 3CN7A 5DYWA 5JYCA 3C6ZA 4H35A 2XMRA 3NWOA 1CR6A 1F6WA 5AKJA 1ZICA 4ETWA 4E11A 4U2FA 2ACKA 2OQVA 3D0KA 1GPLA 2HA2A 3O4JA 3G0GA 4KJXA 5FLKA 2WUDA 2J4CA 2WHPB 1RYYA 1XROA 4HRYA 1H2WA 4Y2VA 1GPNA 1BN6A 1R9MA 2PSHA 5AKXA 4PSUA 1MO2A 2AJDA 1OXMA 1JU4A 4FWBA 4AB1A 4G9GA 3WZMA 4O08A 4BC1A 4E15A 4X00A 5A7GA 3R40A 5AI8A 4Y2TA 3WWEA 1CFJA 1JMKC 3BIXA 5JAPA 4HVTA 1AKNA 1K8QA 3G0CA 3ESDA 1B6GA 2HFJA 1CUHA 4N8DA 5K5EA 1H2XA 3FSGA 1Y37A 3GROA 1VE6A 3VJMA 5KBYA 4D9JA 3HXKA 4C4YA 1JT2A 1DWPA 3VJKA 4B83A 3L1IA 2WTNA 2ECFA 2ZJFA 3ED1A 4JNCA 3H17A 5DYYA 2GZRA 1ISPA 2XMDA 5CT8A 5AM4A 3OOSA 2XMGA 1BEEA 3JYHA 2WIGA 2D0DA 3VXKA 1ZD2P 1C4XA 4KRYA 1ODCA 2E3JA 4DIUA 4Y2XA 5DTIA 2OQIA 3DL4A 2JGJA 5EHXA 3QPDA 4LKOA 5ALNA 1L7AA 1WB5A 5A71A 3ICVA 2JGFA 1QZ3A 3RLIA 4EHBA 5JZ9A 5KWIA 1GPKA 3TEJA 1YB7A 1S8OA 4HXEB 5HKBA 1KEZA 4LXIA 4S0XA 2ORYA 3WKCA 4BYMA 5ALLA 2QMQA 5EHQA 1R50A 3WIBA 4U2BA 3R3WA 3WK5A 2HFKA 4UHFA 1UXOA 5CH8A 4BVKA 1XRQA 5AKHA 2Y1KA 3NUZA 4AO7A 4QLAA 2IITA 1GGVA 3CCCA 5ISMA 3IIIA 3D7RA 4X93A 3UMJA 2ONCA 5EIEA 1WPRA 1GKKA 4FLFA 2ZYSA 3STWA 3I6ZA 3BWXA 4F0JA 2JF0A 1UWCA 4X85A 2DHDA 5LYYA 3H2HA 4N5IX 1P0MA 1CUDA 3WYDA 4C6HA 3SWWA 5FKJA 1CQWA 4G8CA 1NX9A 3R3YA 1LNSA 1G4HA 2ZJ6A 4OCZA 1XZLA 4XWGA 4AMYA 4Y2SA 1ZJ5A 2WHPA 4G5XA 4X71A 5AKKA 5EIHA 1UFOA 2C5GA 2FJPA 4ROTA 4KRXA 4TGLA 5AM3A 4P08A 1Y7HA 4IH9A 1YASA 4EA6A 2WQZA 1JJBA 3FSGD 4WFJA 1HDEA 3U0VA 4B85A 5JAHA 5JAUA 4YASA 4MQMA 5I8PA 1EA5A 4QWMA 2FX5A 2QJRA 5HK9A 5C8VA 4NS4A 1Q83A 3DD5A 1ORVA 4UPDA 3W06A 2PBLA 4KR0A 3WKAA 2H9YA 2QS9A 3STXA 2HDWA 3N2ZB 4J3JA 4WFIA 2O7RA 4FFVA 2Y6UA 5AM2A 5EHZA 4KAJA 5ALHA 1CUWA 2BKLA 4LHEA 2BFNA 2PSFA 1SCIA 3AIMA 1MN6A 2BCEA 4LIPD 5CXUA 3GFFA 2HL6A 4KAAA 4QDZA 2HA5A 2RHWA 1QOZA 1AC5A 3IA2A 4EBBA 2GYVA 3O4GA 1NU6A 1ZJ4A 4U2EA 4X90A 1QTIA 5K3BA 4UBKA 2JGEA 2VAVA 1W6RA 1W4LA 5AOCA 1MX1A 4AN0A 2O7VA 4JYMA 4I19A 1QO9A 3DCNA 1FFDA 3ZPXA 4I3FA 4AQDA 3M81A 4FHZA 3WQHA 3R3UA 1ZD4A 5C8ZA 4MQLA 1ODSA 3F98A 2Y2UA 4EUSA 2VATA 3STUA 4W1PA 1QIHA 1XQVA 3ZLTA 5C8XA 2XQJA 2VT7A 2XUDA 4H7FA 1MPXA 3FLBA 4Q3KA 1X2EA 1DT5A 4J0CA 1W76A 2AJBA 1W52X 1DQYA 2Y2VA 1DX4A 1JI3A 4G4GA 5I7UA 1PFQA 1W75A 1WOMA 3F67A 3G02A 4J0IA 3C43A 4KE7A 2HA0A 4H0CA 2YASA 3CN9A 4ZV7A 1FSSA 4Q3OA 1R9NA 4WDRA 2BGNA 4FNGA 1XZJA 2QXTA 3IULA 3HRHA 2XE4A 1VE7A 3FVRA 3PF8A 4UHHA 4FFWA 3SK0A 4MWTA 4P93A 1N1MA 4H7IA 3RKSA 4P9NA 4GW3A 2IX9A 3PDCA 5HFNA 1RP1A 3B3QA 5AI4A 3E1GA 1LLFA 3PFCA 3ZWQA 1E8MA 4GWLA 1JU3A 5AH0A 4AZ3A 2P8SA 3ZLUA 2WUEA 1HBJA 1SCQA 4CCWA 1UK9A 4N5HX 1XZIA 1TIBA 4BAGA 3UUEA 2HA4A 3FWHA 4MEAA 3PE6A 3HJUA 3VJLA 1EX9A 4MYSA 1Z68A 4G4IA 1R4ZA 3EF3A 3MGAA 4DLNA 4BE4A 2QUAA 3G9UA 2C0PA 1J07A 2PPLA 3FYUA 5C7YA 2XUOA 4MXDA 1PJAA 4CIBA 1IUOA 3BE8A 2HRQA 1DTEA 2WUGA 4F60A 2XMSA 5T4BA 4DGQA 3IURA 3WL6A 5DJ5A 2DHCA 3EIOA 2UZ0A 4WJLA 3H18A 3C87A 4NZZA 3O4IA 4GECA 3DDUA 5AM5A 5HQ3B 5K3DA 2ZYIA 4X7BA 5CURA 1LZLA 3EQ7A 3IBTA 4WFKA 1U8EA 4PSCA 1H23A 2FUKA 3LIIA 5ALDA 1OILA 2J3QA 5HF8A 1R88A 2WTMA 4KEAA 1L7QA 5D7BA 1QLWA 3WKEA 1ZGCA 2B61A 1XRMA 4QEKA 5HFAA 5CXXA 4OPMA 4BTLA 1A8SA 3HI4A 1WHTA 2K2QB 4AX4A 1CUBA 5JAOA 1CUJA 2PU5A 3FLAA 1UK8A 2PVSA 3KDAA 1J2EA 1EB8A 1UK7A 3ZI7A 4BCBA 1XZFA 3H19A 3KD2A 1LPSA 4U2DA 1YR2A 3EQ9A 1E8DA 1QGED 4DSAA 3I2HA 4XVCA 3WJ2A 2WHRA 5JALA 3KWFA 1BROA 1K5PA 1XZKA 3G9XA 1VA5A 3HYSA 1BN7A 1UKAA 1DQZA 5DLPA 5EFZA 2J4FA 2Z5GA 5ALGA 3AINA 2W6CX 2JGIA 1MAAA 1HQDA 2I78A 5ALZA 2C0QA 3I2KA 3PICA 4BP9A 1XZAA 5ALSA 1UZAA 4OU5A 5JZSA 2HU8A 3I6MA 5AKGA 1CUXA 1ACJA 1WHSA 4EY6A 1CUEA 1DT3A 1UOQA 4GHWA 1EVQA 1EH5A 4H7DA 1QJ4A 3AIOA 4UUQA 3HSSA 1EDDA 2R8BA 3C6XA 4C89A 1AZWA 5ALPA 3ESBA 2HA6A 1X2BA 3H2JA 3A2NA 1A7UA 1K6EA 3WL8A 1ZD3A 3T4UA 2QT9A 3FYUC 3O4HA 4DNQA 1VA4A 4BB0A 5CH3A 1G42A 2QTBA 3VVMA 1GQSA 2YH2A 5AI6A 4DSZA 5AKZA 2OCGA 4Q34A 4INZA 3RM3A 2CUTA 1MX9A 3AZPA 5A7HA 1XKTA 1ZD5A 3M82A 3G0BA 4NVRA 2OGZA 4BBZA 4JEIA 4OB7A 1WM1A 3HZOA 4CG3A 1P0PA 1QIDA 2AJLI 3GA7A 1YCDA 4BCCA 4X3CA 2XDWA 1BCRA 3ESAA 2EDCA 1VXOA 3R3XA 4U2GA 5FRDA 4M0FA 3STVA 5FPQA 1Q0RA 5AIAA 5E4TA 2VJAA 2QKYA 3WI7A 2PKYX 5E2IA 3FNBA 1HKHA 5E4YA 4BAUA 3QPCA 4BCDA 2VA9A 4UBIA 2V9ZA 3EQ8A 3OURA 4RE6A 2JGMA 4K6KA 3BL8A 3WLAA 4OYLA 2WKWA 5LZ4A 5CW2A 1AX9A 1T4MA 3KOOA 4YX9A 4E14A 4Q1VA 5BWBA 1DWOA 2PSDA 2QXUA 2XMCA 2DR0A 4X92A 4BE9A 2RAUA 1AURA 2HIHA 2QUBA 1TCAA 4Y7DA 1XQXA 1EINA 1GQRA 1F0PA 2XUQA 2H1IA 3L1HA 4QDUA 4Y2YA 2OCLA 1UKBA 3CXUA 2OPHA 1CUIA 3JW8A 1E89A 4CG2A 1FJ2A 4WY8A 1Q84A 5AO9A 5T4FA 3QVMA 5DWDA 1QTRA 3OG9A 5AOBA 2B9VA 1P0IA 1BEZA 1CRLA 4QWWA 1T2NA 1N5MA 2ROQA 4X95A 3Q8WA 2ZVDA 4OUKX 4C88A 2QR5A 2VTVA 4JH0A 3VDXA 4UBMA 2CJPA 4C4ZA 1MU0A 4DNOA 1USWA 1YAHA 3FCXA 2WFZA 3O9VA 4H77A 3O9MA 3D4LA 5EI5A 4G1FA 2GYWA 4J7AA 2G5TA 4DYHA 3I2IA 4HTAA 5JANA 5ALOA 4A5SA 3FCYA 5HF6A 3N0TA 5ESRA 1EVEA 2J3DA 3FAKA 3F96A 4DNPA 1XZCA 5LLSA 4UBJA 2X5XA 3DOHA 1WCYA 4ARAA 2RI6A 2QJWA 4ZRDA 5T4EA 4UFOA 2FJ0A 1ZI8A 5IVIA 1QONA 5FXMA 4DM7A 2D5LA 3DS8A 4QDXA 3F9CA 4Y9SA 1MJ5A 5AKIA 4J0DA 4EY5A 4PF1A 3KWJA 4H7KA 2XUIA 2CEKA 4PNZA 1EK2A 5JD5A 4YPVA 1CUVA 3C45A 1ODTC 4BZZA 2Z8ZA 1E5TA 2WJ3A 4Y2JA 2XUJA 4AZ0A 3QYJA 5KREA 4H18A 2XQKA 2VJDA 4UBNA 1ETHA 1U4NA 1EB9A 4ZV9A 1K4YA 3QPAA 2JEZA 1CUZA 4UFPA 5ALXA 1A8QA 4Z49A 2PL5A 3C8DA 1LBTA 2JEYA 1P0QA 2QZPA 5AK6A 5LZ5A 2WG1A 2JGKA 3AIKA 3S8YA 5JADA 1MTZA 4LYEA 2BGRA 4DNFA 2GZSA 5AM0A 3U1TA 5IVHA 5E4JA 5K3CA 5A7FA 3WYNA 1IMJA 3AZQA 1ORWA 2OGSA 2PUJA 5LIPA 3C5WP 4TVKA 4UBOA 1FFEA 4QZVA 2I3DA 3OC0A 4H7EA 2WJ6A 2ACEA 4C01A 3F97A 4PV7A 4EY8A 1ZIYA 2WIDA 5AJHA 3TGLA 3B12A 1TRHA 2WJ4A 4UHDA 4PSDA 1SOMA 3STYA 4QE3A 1WPXA 3KXPA 1U2EA 3UUFA 5FDFA 1QIFA 3ESCA 2XQGA 1KU6A 4A16A 4OSEA 5DNVA 4LXHA 1BCSA 5FOQA 4BDTA 5YASA 1D07A 1H2YA 4IQ4A 1XQYA 3E3AA 4CG1A 5JD4A 3D2AA 1G5FA 3D2BA 5K3EA 4M0MA 4MYDA 3MVEA 5IKXA 3A6ZA 2C5FA 4FDMA 3H2IA 3BIWA 1XRNA 4CFSA 3WMRA 3NGMA 3BF7A 1UT6A 4L0CA 3AJAA 2BUAA 4JYPA 1TQHA 1YS1X 3AFIA 2CB9A 4BATA 5ALIA 2VJBA 4IHAA 1QO7A 3I28A 4ITVA 3S2ZA 4AN1A 4UHEA 3M3DA 4OD0A 4DTCA 4Y2QA 3RK4A 1O6FA 3WL5A 5LKRA 3DNMA 1CEXA 5AK3A 2BJHA 1THGA 2WIJA 4X94A 1XLVA 2CBGA 3G9TA 2AJ8A 3WL7A 4G4JA 3I6YA 2WUFA 2X8BA 1XQWA 1Y7IA 4WCVA 4EB0A 5ALWA 3V48A 2OCIA 3O95A 3DKRA 3DYVA 3PUHA 2C58A 2WLSA 3M83A 3C6YA 5JASA 4J0HA 4GLBA 1XZMA 2O2IA 3ICWA 2WU4A 5ALJA 3ANTA 5ALFA 5T4HA 3D3NA 5JD6A 3WKDA 1BE0A 1QE3A 3OPMA 2OG1A 1CUAA 5AI9A 2DCMA 5IVKA 1QFSA 2XMQA 2V98A 5K3FA 1W1IA 1GT6A 5IH7A 3R3ZA 2B4KA 4ZWNA 3R3VA 3H1BA 4J0KA 4FLMA 3H1AA 4KE9A 4L3WA 2WFLA 3DL7A 5AHXA 4X6UA 4PO3X 1IUNA 4IH1A 1BRTA 5D3KA 5LZ8A 1ZI9A 2VAXA 5DTJA 5ALRA 2WM2A 4FOLA 2DQYA 3DEAA 4AO8A 3G8YA 5IVDA 1CPYA 5AOAA 1CUFA 3JWEA 4PQEA 5JZBA 1OCEA 3BXPA 4GDMA 3WA7A 3IUNA 1X70A 4DMHA 2G4LA 3STTA 4X6XA 4J0JA 5AI5A 1XZDA 3HEAA 2PM8A 5AI0A 1IUPA 1VJ5A 2XT0A 4W9RA 2WHQA 2G5PA 5K3AA 2ZJ7A 3H2GA 4QNNA 2I3ZA 4W1QA 2DFPA 4GBGA 3QZUA 2H7CA 2C7BA 1A88A 3W2TA 4MJ3A 4V2IA 3FLEA 1AMNA 4XJVA 4MEBA 1XFDA 3IUJA 3QITA 3D5EA 3MUNA 4X97A 4HS9A 3QMVA 1F0NA 3LIPA 3BJMA 2QVBA 3V1LA 5FV4A 1EI9A 1N5RA 1LPOA 2QM0A 1O6GA 3IUQA 2W22A 3W9UA 1LBSA 3FVTA 1E3QA 2R11A 3G7NA 3G0DA 2BUBA 1FFCA 4N8EA 1QIIA 4BZWA 2DQZA 5I9IA 1FFAA 1HL7A 5SYMA 4FTWA 4I4CA 3VVLA 5FUMA 5FPPA 4Q3LA 3RARA 3Q0TA 4B84A 5LZ9A 1UOPA 3DQZA 4W1SA 1YA4A 2ES4A 3G0IA 4CCYB 5AK5A 4AXBA 4RE5A 1IZ7A 3TJMA 1MNAA 4A23A 4BC0A 4B0OA 4OU4A 6YASA 5DNWA 1CUYA 1TCCA 1M33A 3B5EA 4KYVA 1XZBA 4G9EA 4U2CA 3FOBA 3D59A 2ZSIA 2HA7A 3QBJA 4RGYA 1GKLA 2JBWA 2XUHA 2Z3ZA 5AICA 3KSRA 4YK7A 3H0CA 4G8DA 2YYSA 3EBLA 2HA3A 2BAGA 4BRSA 5A62A 5EHNA 2PU7A 1LPPA 5LKAA 3A2MA 5EIAA 1B41A 2HADA 1HPLA 4Y2PA 2H7YA 4FBLA 2HU7A 4KAFA 3V1KA 2ZYHA 5BWCA 2XQFA 2VJCA 1DX6A 4XX1A 4L9AA 1A8UA 1CUGA 5ALYA 3F8SA 3IB3A 1HLGA 2Z8XA 2CKMA 4B80A 1XZHA 4ZI5A 2HU5A 4G8BA 1TCBA 3OM8A 1LPMA 2V96A 1EK1A 1G66A 4CIAA 5LP1A 4B6GA 4UHCA 1CIJA 4UFNA 3A2LA 3ZLVA 1EHYA 2WG0A 4X91A 2XMZA 1C7JA 1ZGBA 3GBSA 5BOVA 3I1IA 2C4HA 2CMFA 1SC9A 1YAJA 1C7IA 3K2IA 3TRDA 2XI4A 2H7XA 2HHAA 1YSCA 5CT4A 4F21A 3DYIA 4BDSA 5CT5A 3G9ZA 3WWPA 3L1JA 4KE8A 3BDIA 3K9BA 1R1DA 5FP0A 5AKLA 4W1RA 3K6KA 2OCKA 4OB8A 3QMWA 1CUUA 1MNQA 1CUCA 1U65A 2DSNA 4P92A 2EEPA 3MUOA 4F5ZA 4TPKA 4BP8A 2EDAA 3I2FA 4QA9A 3WK7A 2GBCA 4X6YA 1AUOA 1E8NA 4B81A 1LPNA 3W04A 3PF9A 3PUIA 4H7JA 5EGNA 2O2HA 4Y2RA 3X3HA 1JMYA 3R0VA 4C4XA 3NOXA 2VQ6A 3IUMA 5HZGA 1JFRA 3CCBA 4ARBA 2VEOA 4B9AA 5AP9A 4DMKA 1BS9A 1KU0A 3QM1A 3T52A 1WB4A 1IZ8A
chains in the Genus database with same CATH superfamily
2I7VA 1GVHA 2RK3A 1U0LA 1HQYE 3R0JA 1NASA 4YO8A 4ZGBA 4WV3A 4A10A 5CYFA 9LDTA 5KU7A 3ROXA 2NU6A 5ALKA 2I33A 4FFOA 4Q9AA 3ZWNA 2JIDA 3OQPA 1ZK1A 3MPOA 5I48A 3AEYA 2O6LA 3EZGA 1GTG1 2B37A 2V6GA 3IDAA 3CS3A 3QJYA 4HYQA 3QBVA 2H85A 2YXPX 4U7GA 1MX5A 2ST1A 2QD3A 1R66A 2P5TB 5J47A 4DLKA 5CRIA 3WKBA 2W2OA 2PGDA 5K3FB 3U3JA 3V4OA 2FY8A 1GGKA 1NMXA 1YA8A 3EVBA 4BVLA 2EBWA 2OAEA 4U7DA 1N2HA 3CNNA 4LWZA 4B7AA 4D0GA 1M72A 1LTHR 4TTJA 3ZDCA 4AJJA 1SNYA 1ACLA 3H2ZA 3OLCX 2H4ZA 3IEIA 1LSOA 2NW6A 4NK4A 2VT6A 4QBKA 1HFEL 1SHJA 3EVFA 3QUTA 1YXMA 4XIIA 4HDKA 4Y7CA 3KETA 2HSWA 2E4VA 2GFHA 5ICFA 4BQQA 2DT8A 5IJAA 3BFJA 4N5MA 3E4CA 2HNKA 1ZONA 2V4UA 3GJTA 3HMQA 4K2AA 2YFQA 1IZZA 3AF1A 1U9YA 2J31A 4ZVVA 3ZNQA 6LDHA 1DFHA 2C1ZA 1F4PA 1J06A 2RBEA 3BFPA 3JQ9A 1GUYA 4QDTA 4R3NA 1I10A 4RK0A 3AUTA 2QP9X 4WBNB 4HAIA 4O4HA 1PV1A 4J03A 4CEHA 1YVDA 1J5XA 2EU8A 2NVUB 1Z6TA 3ICPA 4B0PA 1IK4A 4DR5B 1X1TA 2COKA 4R8RA 3OIWA 3IVMA 1SVOA 1T4CB 2YINC 3NVMB 1D1TA 1EDOA 5A3VA 4K6HA 1PG5A 1N1GA 4HG2A 1Z0IA 1J21A 2C88A 4KMSA 1CHNA 4EY4A 1VJDA 2H4XA 2I71A 1QTQA 4ZKEA 5K05A 2Z6AA 1QYIA 3EG5A 1EMDA 2BFBA 3CH6A 4N01A 2PLWA 2EWWA 3C15C 4B3XA 2YV5A 2RHCA 1W4BA 4E33A 2XAAA 1DC8A 5D6OA 1ULZA 3VJRA 2KJQA 1U6KA 2QB5A 2YHIB 1KFBB 1WCIA 3FBWA 1WDMA 3O83A 2QY6A 4K5QA 4LMBA 4W63A 5LMCA 1F8XA 2ZSHA 1YI0A 2AXEA 7YASA 4P3KA 1L4UA 3HI6A 1OZ0A 2OLKA 5IRCD 1VYTA 3CEMA 3H11B 1H5UA 1Y4UA 4IH4A 3HFGA 2VQFB 4Z1MA 2REOA 1H2FA 3LVFO 2RH5A 4MVYA 3M49A 4ISBA 2WZCA 4JA2A 2ZYAA 3MT0A 4EB8A 2K7FA 3DZGA 1GDTA 4TL8A 1I3KA 1TZMA 4A8JA 4BIIA 3KZ1E 3OX2A 2R2AA 3BK2A 4RF3A 3ZD6A 4GRDA 4IOLA 1NVUQ 4DMCA 2ZIVB 1I6WA 3PVCA 2H1SA 4EMUA 1NBWB 2DPYA 1ECCA 3ACBA 1A9XA 3TQRA 4QYXA 3KL4A 4UEQA 3V2IA 4D5GA 4P7KA 1NOIA 1TD9A 5GQSA 2FMKA 1F8UA 2C7GA 4YREA 4C22A 1K68A 2DECA 3K4HA 3TECE 5CH5A 1X7ZB 4DG8A 1AQLA 3PUKA 4M9UA 2O59A 4LBYA 3G2OA 1J7KA 2C78A 2VNJA 1U9IC 3I1FA 4PU0A 5HMMA 4BVAA 5ADWA 3L0DA 1YJ5A 5BQOA 4C07A 3DJYA 2OFWA 2FCAA 4V0RA 1MC1A 1KTVA 5L51A 3W8DA 2XUAA 1UWLA 3IL2A 1XA3A 3U3OA 5FYDA 1IB0A 1FFBA 2B4YA 2J3EA 4CN8A 1UBMS 1ECGA 4JJ6A 4FXPA 4O4IB 3NWBA 4HL6A 1OT3A 4B6QA 1KDPA 1XN4A 1E1RA 3MMZA 3UHPA 3UKJA 1Z6PA 5JIBA 3UGJA 1W8IA 1T36A 4KR3A 1BOOA 2BRUA 2FR1A 3BHMA 3PFBA 4L4XA 4WESA 2XB6A 2LDBA 4IGAA 5D85A 5CT9A 3LXMA 5ALVA 3D1LA 2HT6A 2WYHA 3MEQA 2DFVA 2JLQA 4K6GA 4LJLA 4ZU6X 1JXMA 4ECEA 1EE9A 4RMIA 4RIIA 4Y6PA 4LRYA 4P3YA 5J63A 1CW2B 4ENPA 1VI2A 1BXGA 5AHOA 2ZXEA 4HXFB 1P5FA 3EG9A 1IM5A 1A72A 1RWNA 1EFKA 2VOEA 3HABA 3HYNA 4X1YB 4YJFA 2FH5B 2VTBA 5IDVA 1NQUA 2BBOA 3EVNA 5C4IA 3COPA 3F2IA 1YRBA 3GK3A 3KM0A 4ZVMA 1AIPA 4WZAA 4E2FA 4YRGA 2OFPA 2AFRA 3A6JA 1MOSA 3R6TA 4TKZA 2B8EA 3KSMA 2P41A 3N28A 4HWOA 4EUFA 3QU7A 3WWDA 4IGIA 4C43A 5IFLA 3ADBA 5JARA 5AIBA 3RNOA 3VR3A 2LIVA 2NZUG 3A9UA 5ITZB 3FYTA 1A95A 1A7KA 3V9AA 4WY5A 5KOYA 5HM6A 3EASA 3D43A 5FTJA 2YXNA 5BVHB 2NZJA 4ONEA 4Y9RA 1Y7PA 5KTTA 2ZROA 1RBZA 5BV7A 3GELA 5AKYA 3M6WA 4N6OA 4IIHA 1YCHA 3R8CA 4OQLA 4CV3A 3HCNA 4ER6A 2DHQA 4J0GA 1Z6AA 4FWIB 1Y0BA 3KSZO 2X1VA 5CJJA 2VG8A 1N4AA 3VRHA 2MU1A 4GOXA 2NU9B 3DV9A 3IAHA 3K8YA 4TLEA 3BDVA 1CJKC 5BXQC 5JBIA 1CQJB 2GN0A 2ZDQA 3DVQX 4MPJA 1Z0JA 4WQMA 4E2ZA 4M99A 3PWZA 4V02A 1K63A 4QLOA 3SX4A 3AOEC 4QAQA 2FI1A 2SHKA 3SG0A 2ENUA 1CP2A 1Y4SA 1WABA 1F8YA 1IVYA 1RKQA 4MWDA 4ZREA 4Z5XA 1TJYA 4GC5A 2XV1A 1K3TA 1SKMA 1A9OA 5JG7A 4GDFA 3P2MA 3R7WA 3ROGA 4DABA 2PZEA 4HNRA 2GAIA 4WZAE 3HUFA 4DN6A 1MGPA 2YN4A 4CRWB 1F7VA 1VHDA 3UA4A 5CCDA 2O52A 3RRFA 5L53A 4GKJB 3UJNA 2MYUA 2HF9A 2PJRA 5SZIA 1ZESA 3IUPA 3J81A 3RYFB 1TIKA 3NP9A 1JSRA 3AERB 4HAUA 5AM1A 4M0EA 1YBVA 1ZJZA 4I3HA 3DZIA 2C9DA 2JFQA 4RPGA 1Q3KA 4H4EA 5HIAA 1UJBA 2WF8A 1XLUA 3BULA 6REQA 1GFSA 3CLUC 4AM8A 1J5EB 2VRNA 4JLAA 5H8WA 4OH1A 2EGHA 4UHKA 4V2UA 4TT3D 1M1ZA 2QG6A 1VMEA 2PZKA 1Z4OA 5COAA 3KVRA 3S2UA 1MP0A 5KMGB 2D59A 3AVWA 1OMOA 4YT8A 2R8RA 1T8TA 4O6VA 3M1LA 4QGFA 2V97A 3C70A 5JLAA 3NHKA 1GO2A 2VWQA 3NAMA 1CLEA 5IDXA 2PMCA 3PI6A 1MVNA 3Q10A 4HGZA 1ZU5A 3KLBA 2JLSA 2IHUA 4MUJA 3RS2A 3KNZA 1BHO1 1C9KA 5D87A 1C8BA 2Q0QA 3K0KA 4IM7A 1EJ2A 3OD1A 3QNUA 4RZHA 3ABZA 2G1JA 1K8XB 4KKVA 3BIFA 4R98A 2Y6VA 5H3HA 1TEHA 4A2PA 4QJ3A 1SVLA 4AUKA 3V1MA 3ANSA 3WGNA 2V4ZA 4IFTA 5B1DA 1VKNA 3CWCA 5FOSA 3SDBA 2EKDA 1R0SA 3B48A 3NYQA 4QSMA 1XU9A 4XB2A 1OBCA 2GZMA 3AC0A 4FIDA 2PUHA 4F6LA 4EAQA 4HI0E 2A57A 2O0MA 5IARA 3FZEA 3MLBA 1OB5A 1ZUNB 2CKDA 2P40A 3GUVA 3Q7RA 4FOSA 1UBGA 3H5LA 4TS3A 2V7TA 3TQHA 3VPXA 4X6LA 3LY9A 5LUAA 3K5PA 2HIGA 2F43A 2XYQA 3LVBA 3GCGA 4HR7A 4KXMA 1JKMA 4XRRA 1GCOA 5LMNB 4ZXFA 3E9MA 4IO0A 3AF2A 2EZUA 2PUDA 1AGYA 3GN2A 3LDUA 3I76A 4O25A 4ZGWA 1KE1A 4R8KA 1QLHA 1I3CA 2R8EA 1WB6A 1EVYA 4BFZA 1L5RA 2ZVPX 3Q8LA 1OBVA 4LZAA 1X80B 2WIFA 1GITA 3LX8A 4BLPA 4YUXA 2QMZA 2PX6A 3M2PA 2A4MA 1T25A 1SU6A 2CXPA 3KJNA 4ID9A 1ZY2A 1NVBA 3O0DA 4LSWA 2FMIA 2PNFA 2H1HA 4RPCA 3RANA 1T4CA 3LBIA 1N2GA 3QGMA 4UTNA 4ZDIA 5CBKA 1V16B 3A1EA 3CLSC 4QATA 1JF8A 1L7RA 4LXTA 2K2WA 3D4IA 1QFMA 4A6EA 3S40A 4Q4AB 4PZUA 4Z9AA 2V0CA 5AW7A 1EE1A 2ACWA 2HJ9A 3HVJA 3TM5A 1HLFA 3ZY4A 6REQB 2EATA 2OBYA 5BO5A 3MS4A 3A1NA 5EXPA 1AT1A 2Q9CA 1G9SA 2G63A 1JHOA 3AUKA 3A4VA 1LLCA 1Z07A 5GJBA 4YAFA 4IJWA 2ZBVA 1JAHA 1N0VC 2ZBQA 4KQXA 1YB6A 3MMSA 3LF1A 1HR0B 2OUIA 5AW1A 5DRYA 1MVLA 1WUJS 3AXSA 3MN1A 3UO8B 4CBVA 3M9XA 3M4JA 4DLSA 1SXHA 1WULS 2PR2A 2VF4X 3GUZA 1JL3A 1RRFA 5I7RA 2OAGA 3OJOA 4JIMA 1RZRD 4ARCA 5IAAA 2OYSA 1YZFA 2GBFA 3HLKA 3K5WA 4P4SB 4EMBA 3D3QA 1M75A 2VSQA 2GR9A 4ERNA 1LLQA 2IS1A 4GL2A 1G60A 1OAAA 3L9XA 4JDUA 1YE5A 2J46A 3QKIA 2C98A 3PYLA 3K70D 3VISA 4I50A 2Q4RA 3RV4A 1DV1A 1F2UB 3G6WA 2IXGA 1CUSA 1SU8A 3C8HA 3FGPA 1YMQA 4G1CA 4WOCA 1KR5A 4GPTA 4IIJF 1DC3A 3RS0A 4J8PA 4DXHA 4ZK6A 1RJ9B 2AMFA 3BJEA 3AZOA 4JQZA 1XVAA 3Q6IA 3N8DA 1CRPA 1LK7A 1BD3A 3ZUPA 3FTCA 2OKGA 3IO5A 1A9SA 5MGBA 2O8DB 2ZS8A 4EMSA 1KS9A 5JAIA 3WK6A 1Y89A 3M2TA 1UJ6A 3BKWA 5JCJD 3U4GA 1C1DA 5E6SA 5HZKA 3L6UA 3TXXA 2XRZA 2X8JA 1P19A 1HETA 1POXA 1NFRA 1QKIA 2J3KA 4ZEOA 4F12A 3Q7EA 1JJAA 2BT4A 2G09A 1B43A 4OMCA 1OFHA 1HDRA 2M9MA 3AY6A 2VSXA 3B38A 3ZU4A 2KQUA 1XYVA 3EEOA 3CLVA 3CUSA 4JVOA 5LDDC 1OU4A 3BXXA 2FVXA 2XMRA 3NWOA 1WW8A 2BMFA 1CR6A 5AKJA 5DSTA 4BKQA 4RY0A 1ORDA 4KYIB 4U2FA 4E11A 3NETA 1U0JA 4XIGS 5TQ0B 4AF7A 4O1IA 1DAPA 1QR2A 3O4JA 1RAIA 1QX4A 4U6QA 4KJXA 3QVSA 5AW8A 3PUYA 2WUDA 4JBYA 4XVUA 1FY2A 2J4CA 2WHPB 1VE3A 1DG9A 1NQAO 1XROA 1N32B 4HRYA 5FOTA 5A06A 3CW8X 4PLCA 1SBIA 4KPGA 2ZSBA 4X1IA 3PD7A 5LDHA 4J7XA 4KODA 1GPNA 2W0MA 3A31A 3GV0A 4ABYA 1OYVA 3N39C 2OECA 4PSUA 2AJDA 2YN2A 1KYWA 2WD7A 4G5SA 1FS4A 4K6OA 1O5OA 4FN4A 3GDWA 1MGOA 4G9GA 4PQFA 4TLCA 1WCV1 2ZKLA 3AVVA 2ZE7A 1WMFA 1YQEA 3NHWA 3BXEA 3QFSA 3WZMA 4YAUA 1NT4A 4MDHA 4X00A 4F6RB 2VP6A 4IIBA 3OEED 3CH7A 5KQSA 2BKEA 1D9ZA 4LDRA 2AEJA 1E0JA 3DL0A 5JO9A 4Z4CA 4K87A 4HVTA 1TKAA 2QRLA 3WGHA 4TLAA 4O4JF 3T41A 4NDZA 2Q2NA 1KMMA 1MC8A 3LSYA 2OWDA 2BEUB 4IKPA 1SB9A 2JLCA 1IY9A 5JNWA 4EJFA 4AYWA 3NIWA 3U3ZA 5LQRA 5K5EA 2OCYC 4L07A 3TRJA 1ST2A 1H2XA 5DM60 3A27A 4UVDA 3FSGA 1JYEA 1FTYA 4BB6A 5IWAB 5KBYA 4D9JA 2JIQA 1Z2EA 3SSNA 4C4YA 1DGQA 5EJAA 4RV9A 1LSSA 2FZEA 3R7NA 2EKZA 3O84A 4B83A 1YQ9A 4EBFA 2JIZA 1CB0A 4BJ1A 5L7WA 2J6HA 1JKIA 3E81A 4P6VF 4Z86A 1GNSA 3WO0A 1Q3HA 4KTTE 4MRAA 4JITA 5BNIA 3ED1A 1ADFA 4HYYA 1Y42X 3GLHA 5D86A 3HG7A 1MB2A 4B2IA 3H17A 4EHAA 4DUGD 1IN4A 3T3OA 4K9PA 1CX9B 1KZ6A 4PYNA 5JW6A 1UPTA 2WMDA 2I8AA 2WMOB 5CT8A 4KREA 2P62A 2XMGA 2J0EA 2RJNA 1EGAA 1ZNZA 3DHWC 2WIGA 2XKJE 2QN1A 3HDVA 4PM4A 4KR7A 2APJA 1Z0AA 1QSGA 4YNBA 2D0DA 3NTUA 4ZVUA 3VZDA 4FSXA 1ZD2P 4KRYA 3PHCA 2GPNA 1ODCA 4IXWA 4QUHA 4RSGA 2OQIA 5JVDF 1K8YB 1N78A 3W2HA 2R97A 1P5JA 1II8A 1Z37A 2BMWA 4ME6A 5KYVA 421PA 1EBBA 1Y5LA 3H6HA 3MFYA 3WSTA 1G3IA 2YICA 1GLNA 3KQYA 1L7AA 4JKIA 1NG1A 1WB5A 4WBXC 2Y99A 3F7NA 3PQ8A 5DGTA 3UJHA 1DAGA 2DBVO 3LCUA 4RPJA 1QZ3A 1WB9A 2W2LA 1Y7LA 2YFHA 2ZPAA 1V5WA 4EHBA 1NMZA 5JZ9A 5G0WA 3KEGA 3WGMA 1UZMA 4U7PB 3MHPA 3TEJA 1VL8A 1SK9A 1HFWA 1YB7A 5H3LA 1S8OA 2YY7A 4QULA 5FULA 1QH8A 5HKBA 1KEZA 1WAMA 4YCMA 4S0XA 4XQGA 4UJ5A 2X6TA 4O29A 4RCYA 2O1EA 4TLBA 4A0HA 3ORQA 1B8PA 2V5VA 3I4CA 3TEFA 2ZI5A 3GJYA 1IPFA 1BJKA 2QMQA 4B7XA 5J2TA 1RZRA 1SAYA 1VJCA 1KAHA 1QCYA 4KO3S 5G3YA 3PD0A 3T3HA 4HWTA 3OUTA 5JXJA 1W88A 2FSSA 3QLUC 4HWKA 5FBZA 2WM3A 1BXKA 2ZIFA 1SURA 3SPXA 4A0FA 1DXOA 2H2IA 2HFKA 2YZMA 3QY9A 1REQA 2GHIA 2EZ4A 1HQKA 1HG0A 4TV9A 3X44A 1PD1A 3ASYA 4K9OA 1YJAA 4PLPA 1KFKB 4FDTA 1B6RA 1JHVA 2PXXA 3QA3E 4BVKA 1XRQA 3EVDA 4IGFA 3RIYA 2MWMA 2ZU6A 2X6QA 3DL2A 2X3UA 4GX5A 3EIFA 4I4TA 2D6FA 3FNRA 3AWDA 3ZD9A 3KUKA 3B7GA 1E5VA 2O1WA 2IVFA 3LUHA 4JASB 4QTTB 4KCGA 3BH7A 1E6MA 1JSLA 1E1QA 1I1QB 3AR6A 3CU5A 3FUCA 4RHEA 1GNTA 5KX5A 3WGQA 3JSAA 3KXIA 4HDOB 3RIMA 3VR4H 3L4JA 2GLTA 3IIIA 2R1VA 2XVMA 4PFKA 3UMJA 1P33A 2ONCA 3VYVA 5ENZA 4M1ZA 2CNOA 4P3OA 4CR7A 5LFAA 3V4FA 3ADPA 1EXMA 2P91A 4FW9A 4IO1A 3PIRA 3D6JA 5ERYA 3E48A 3PX7A 1E2KA 2HR1A 5B3AA 2PGXA 3MERA 4H17A 4LHYA 4LEIA 5JQGA 1RM5A 2BV3A 1PJSA 1MD9A 1LTKA 4I4LA 4OVKA 3DE4X 2DJIA 1DC5A 2GA9A 3GD7A 3LT4A 2QSUA 2VNKA 3BFXA 4JYCA 2XW6A 4Y8VA 1J1ZA 4ND8B 5EWMB 3UEOA 2BFCA 3LWDA 5LDGA 3H84A 2IL1A 3AW8A 2QLTA 3OQIB 4GP7A 4F0JA 3AVPA 1PV4A 5CJPA 4YWJA 3ZWOA 2RGYA 1PBNA 3IVCA 2Q49A 3K20A 5BN4A 1M0EA 1HK7A 3SR4A 4EKIA 4RF2A 3UF0A 2GNPA 4PE5B 4EARA 5ULLA 1P4GA 4X85A 2ZUFA 3VSEA 3EAFA 4HAXA 4D0NA 1TFUA 2X5OA 3B3FA 1TE2A 1ZMBA 4FYHA 3EEBA 3H2HA 3OJFA 4C5BA 2Q3JA 4AQYB 1IU9A 2QMOA 1C1XB 4HAZA 4TYMA 5E7JA 3TZKA 3AR3A 4MQUA 3QP9A 4PZAA 2QPTA 4MKGA 4MRNA 4I1PA 5CA1B 4DKXA 4Y98A 5BRAA 2YXBA 3KKEA 1NX9A 3TIVA 3ILYA 3LDGA 1LNSA 1G4HA 2AC4A 2R25B 3HN7A 3OFVA 4M89A 2XHZA 5F2KA 4AMYA 5FA6A 2IZ6A 4RFLA 1PAUA 4JENA 4TKUB 4HH4A 1PV2A 3GXBA 3KJQA 4C9BA 4G5XA 4INPA 4D4IA 5A0VA 1WMSA 3JZFA 1DBWA 1FUKA 1ZINA 3OEEA 5EXXA 3WBBA 3N6VA 1OKKD 5U1PA 4YI5A 3QTLA 4I66A 5AKKA 5EIHA 4DMRA 4ENQA 1UFOA 2FPOA 3BWDD 4HQNA 3EUEA 2YHSA 3KPUA 2NP6A 4G5HA 2YMMA 1ZNXA 4TGLA 3UMFA 2CYBA 2GJ9A 1NJFA 2J0QA 2HPHA 3Q9SA 2B8TA 4HADA 4WE3A 7REQA 1MQ9A 2I4LA 2WJGA 3BKXA 2CC2A 1SXJA 1YUMA 3H5OA 3WRYA 3LC1O 3QVGB 1PJ8A 1JJBA 3FSGD 4Z54A 1J22A 1O3YA 3MK31 3T0GA 3K9QO 3K9FC 1YDMA 1HDEA 2I3GA 3U0VA 2YYAA 3IRVA 4DLBA 2A58A 1EFRA 1IQ0A 3OZXA 5KTYA 1YQQA 2TECE 4BN5A 5IJ0A 1R6XA 1ID8A 1K6IA 1TM4E 1YO6A 2QHXA 2RH4A 4LXYA 1DOHA 2XF2A 2Q6IA 4HWRA 4QBGB 3R9KA 2P0YA 4FR5A 2V8OA 1T0BA 4I8DA 3T9BA 4BMCA 4DCTA 3PEYA 3CUKA 1ECJA 5JPIA 1VJ1A 4DFDA 3MJVA 3TIIA 1A2QA 3C6QA 2A8YA 4WA8A 4P33A 3KUDA 4G85A 1CE8A 3DD5A 5MN4A 1J5PA 2LP4Y 5C2JB 2GHRA 2ZAOA 1OE0A 4MIEA 5EJ5A 2X13A 5ESXA 4CKCA 1EQUA 1Q44A 1GRQA 1A97A 2HNBA 4KIGA 1JDUA 2XUZA 1VPLA 1FA9A 4EB6B 4U39A 1HX7A 1PLKA 3IUSA 2O4CA 4J3JA 5JAZA 3UK6A 1ZMRA 2Y6UA 1NF3A 1J8QA 1B42A 3O7MA 3OMWA 4RY9A 5DM1A 1X77A 2QYOA 2G06A 4ADSG 2Q7XA 5K0NA 4I46A 1DAIA 1O6BA 2EJBA 4GX2A 1KZYC 3PRKE 3UB4A 5ALHA 4PGHA 5CEJA 1S2NA 4MSUA 2OHGA 3C3AA 3ORYA 1DC7A 1YVPA 1X7WB 1T8RA 5KTMA 4W9NC 3WHPA 4D5EA 4DGSA 7MHTA 2R84A 5I5GA 4L0DA 1JJVA 2IK8A 3GFFA 5TE9A 3ADOA 3PSAA 4YJ2A 5E0KB 1NVFA 2RDMA 4KAAA 2PRJA 3P9IA 3LVRE 1MMFB 2HA5A 2P69A 1YA6A 2NU6B 2H3HA 1XTBA 1RIIA 3NDPA 3P5SA 2AHRA 4HXYA 2HBRA 5LB4A 2ZSAA 4BYGA 2GYVA 2W93A 5DFAA 3TZBA 2GK7A 5FTMA 5BW4A 3E15A 4ESVA 3ET5A 3KT0A 5GAJA 1G59A 3NUGA 1ZJ4A 4X90A 2QLBA 1QTIA 3ZBTA 2Q5CA 5TVGA 1F8GA 1XTZA 3WSWA 1TF7A 2JGEA 2V1XA 4F4UA 4RTLA 5AOCA 1MX1A 1TEZA 5IN4A 2CYCA 2YYZA 1N2JA 1B26A 2Q4DA 1E1KA 2H92A 3T3GA 1DDGA 1W19A 1MO6A 1WW2A 2G8NA 1Y4ZA 2JATA 2Y0CA 1NAHA 5A9SB 7GPBA 4U2KA 4EJ2A 5LP6F 4JV5B 1X80A 1M2NA 1FJGB 1HEIA 4ZZ2A 1BJTA 2NQ2C 4BNWA 3AK4A 4MDYA 1HA3A 3SZUA 3THWB 3HU1A 4KLNA 4KOAA 2BLLA 1I1OA 4AQDA 4FHZA 2JDID 3SAJA 1D4ZA 2OOSA 5DW0A 4CLHA 4AD8A 1N3LA 2IW3A 2O3TA 4AWXA 2GKOA 2J3MA 2ASVA 4QXQA 4CDRA 2QUZA 4IICA 3FPFA 4NFSA 1H8HD 2HK8A 1XXLA 3WGOA 4EQZA 2VATA 3D4PA 1JQLB 3TQTA 3O8QA 1SA0A 5FNVB 4IVPA 1KI9A 1ZD1A 3HZHA 2LPMA 2ZE6A 3KWLA 3EXEA 2ZWPA 2G9NA 3TLJA 1NNI1 1ZNQO 4YFVA 5FQOA 5K03A 1BYIA 1O6CA 4TKVB 3BX1A 2XQJA 2VT7A 3QY0A 4FE4A 4V0LA 5DX8A 2XUDA 3B89A 1MVOA 3HU2A 4IMPA 5DGCA 5K0BA 1A1SA 4FONA 2IHKA 1U5AA 2AJBA 7ADHA 1W52X 3ZJ4A 3DAGA 2L18A 4XYLA 3EWAA 4DC9A 4KN6A 2FR0A 1KC1A 1C29B 1JH8A 3P2EA 1DX4A 1JI3A 2R65A 3PRHA 4IL5A 2JPDA 1WOMA 2TMGA 1H3FA 5KTNA 4DIBA 3TGPA 5DU2A 3IBCA 1XDWA 2R79A 3C4JA 3FXAA 3U4DA 5TB5A 2OTCA 5C32A 1DX9A 3QJ5A 3B1FA 3TINA 1N7GA 4H0CA 4IV0A 3ISJA 1SKYB 1ENYA 4UASA 4EKEA 2VDWB 1P72A 4GZ5A 3KKOA 4L6AA 3SHVA 3E18A 4BX8A 5TQ2A 4KFRA 2CZGA 1WZ2A 3EVCA 4MW4A 1PZEA 4CLOA 1T5TA 2V7EA 3CNEA 3JQ6A 4QFCA 3DF9A 1VRWA 3QXJA 4PZLA 3SIPA 3FDJA 3LHDA 2VHQA 4JUFA 1KPGA 1ABFA 4JZYA 4C03A 1XZJA 3IULA 1R0XA 3KQNA 3GAFA 1LLDA 3HRHA 3QE3A 3EHEA 3ZQKA 4JJZA 4QPCA 3SZRA 1V4VA 2O4UX 1HT0A 3QVTA 3VR2A 2CVHA 4HQ0A 1CS0A 4FHFA 4UHHA 3RYCB 4XWOA 4GR9A 3VBCA 5JWRA 4LZLA 3G8BA 3KFXA 3EZFA 1JU9A 1JPJA 4AWAA 2CHVA 4P9NA 3R0QA 2C7QA 3Q2IA 2PL3A 3I6QA 2ZB8A 5BURA 4PYJA 1Z5OA 4RLFA 1R64A 2BI4A 2EG9A 4NMXB 1Q0HA 4WXPA 4QDKA 4ZOQI 3E1GA 3EA0A 4OXQA 4WLOA 3HWSA 3HXPA 1NBIA 1U28A 5G4LA 2G1PA 1J9GA 3MZ0A 1PWXA 3E27A 3PFCA 3VKVA 3WLPA 1C30B 1N6KA 2QSZA 2XYRA 2Q7DA 3WDSA 3ZWQA 5I7EA 1JU3A 1W5SA 2H4YA 4O2AA 4R41A 3ZLUA 1Q6ZA 2WUEA 3H6GA 1JHZA 3F74A 3CUUA 5FNVA 1SCQA 3ZNPA 2IHTA 4CCWA 5KTOA 4KQ9A 3MWDA 3WVNA 3KPJA 3DZKA 3UUEA 1K6MA 2PR7A 3GRFA 5KYXA 2WVAA 3ANLA 4BEWA 1XAHA 4MEAA 5KSOA 3CSSA 3UGQA 3ESYA 1J00A 1Z68A 4G4IA 2AFVA 3DE6X 1OH6A 1H8ED 3DBHA 4JOQA 3WLQA 3PGVA 3UAOA 1EP9A 3HFSA 1PN3A 1KL7A 1ZK3A 2QUAA 4MUHA 4OHKA 4BMNA 4D9FA 1J07A 1PX0A 2G1AA 2P9HA 2PPLA 3FYUA 3L93A 2AOTA 4FMCB 3R75A 5CLFA 1JLLA 3GG9A 2W43A 3LQRA 2OV1A 2VCEA 2I6SA 4CIBA 1PFVA 2E4WA 1DRJA 3AP3A 3CLTC 4EMTA 3V46A 2Q1YA 1U2QA 2O3JA 1IUOA 2GPAA 5IM4A 5FWYB 5EXDA 3SR0A 4EF4A 3KKZA 2WUGA 2X2EA 4N3BA 3PJFA 3TUIC 1QF6A 2PQ0A 3JVIA 1MA3A 3MMXA 4O1MA 1Y1PA 3BWYA 5T4BA 5CDYA 5IXSA 5L95A 3K16A 1WG8A 2B8NA 3FPAA 4H3SA 3ZDAA 3TPFA 2X7HA 1UC5B 5DJ5A 3JQBC 1L0BA 3N7UA 3EIOA 4MARA 5F7JA 4JUAA 5MDHA 2NUAB 4ABTA 4G89A 1K66A 2ZYDA 4OYRA 2AX3A 3AJRA 4FT2A 3ANXA 1ZH2A 1RWPA 3AETB 4B33A 1NVEA 1O95C 5EZYF 1HE5A 5K4GA 4DV7B 2AKEA 4LX8A 2XOKA 3IQZA 4UNRA 1HE3A 3HO8A 3DDUA 5AM5A 1GGEA 1E96A 5K3DA 3QI7A 1TXGA 1Z33A 3SU8A 1D4AA 1TYZA 4R05A 1J23A 4EVRA 2R60A 4CG0A 2QMUA 3ETEA 5CURA 1HYBA 1U1DA 4JEUA 3EGXB 3KSUA 3JCZA 4Z0PA 5FR2A 4Y1FA 3I30X 1JKXA 3F9IA 1U8EA 3WIVA 5KINB 5KC8A 4Z3OA 5TS2A 5BYKA 3SY8A 2LRHA 4LGMA 4UEKA 4C2AA 4FJ1A 3BMCB 4C4RA 4ZZ0A 3CZ9A 3PEFA 4WLUA 3AFHA 1Q22A 2H1CA 2EJUA 1W29A 1IG0A 1R10A 3UWSA 5BW8A 4DA7A 3OF3A 4M8NE 1AZLA 2RBGA 1KO7A 1T10A 1RYFA 3E2MA 5F5XA 5JJBA 1QCDA 2VRBA 4MW7A 1L7QA 3T7EA 2OY0A 1UC9A 2ZUUA 5WRFA 3V8PA 3FNIA 1N92A 1ZGCA 3OZVA 4I1VA 2RHOA 5F3RA 4DCJA 2ONZA 4ZO4A 2IYLD 4O1HA 1M9NA 1IDN1 2E0IA 4XW2A 5HS4A 5K8JB 3DM9B 2C31A 2JHCA 4OQQA 5EE0A 2G36A 1D2RA 5HFAA 2Z8YM 4CVNA 4OPMA 4Q15A 4L73A 1WHTA 3U56A 1HMYA 4I2VA 1M2JA 1Q11A 1P29A 3FKSA 4YV2A 3S1LA 3VHXB 1V1RA 5C8YF 4M0UA 3O7WA 1QYCA 4TVSA 1LY1A 2GN4A 1UBKS 2ENWA 2LKCA 4GSYA 2PU5A 1O2DA 2WVHA 4LRQA 2QXYA 3EZYA 1UK8A 2QM7A 3URMA 4ZANA 3RU9A 1UK7A 2I1WA 2RH9B 2PVCA 2YWCA 5T57A 3B9BA 1VIYA 3FVVA 2RKBA 4BCBA 1ISRA 2JAOA 3DZ8A 5C46F 1C14A 3WQQA 2ZITA 3H19A 2ZRNA 2QRHA 1TC2A 5CGQB 4A0SA 1LPSA 1G4AE 2AG6A 4R8LA 4DUGA 4DWVA 1QGED 2V7UA 2VSFA 4DSAA 5A05A 3IX7A 3WJ2A 3AEZA 1FMLA 3BSWA 4JWTA 4MIKA 3CZRA 1CHDA 5F64A 1ZJWA 2A14A 2YIVX 2WHRA 5E6UB 4WXRA 2DGDA 2IYYA 1BROA 1K5PA 3BE6A 4TL6A 5EQDA 3HLYA 2H2FA 4LA4A 1KEEA 1XZKA 5JBQA 1Q0TA 2QA5A 2VJOA 5EZ5A 3KPYA 4EX6A 2WKSA 1VJGA 1DHRA 2AH5A 1W48A 4DDVA 4XD7D 4RXTA 2J4FA 4MWOA 3JQ8B 3ZH9B 1V41E 3Q7QA 2EBFX 1MAAA 3BXHA 4I1IA 1BS1A 3CRMA 3BDAA 2I78A 3MCAA 5ADHA 3SJUA 5TT0A 3V7FA 1DO2A 5CDTA 2QP3A 3PICA 5H9WA 1P8JA 1R5JA 1UZAA 2PS0A 5EIXA 5KAPA 1AA9A 3WB0A 2CXUA 5AKGA 4LJYA 1ACJA 1M3SA 1SGWA 2IF2A 2X1MA 2IOHA 3GU3A 4MR7B 4NHEA 1JQ3A 1V45E 3N76A 2W4QA 4NI5A 5F9MA 3WV4A 3OICA 3ZGOA 1UOQA 4QYTA 1TO2E 3CIFA 1LSJA 1N57A 2AOUA 5DNCA 4H7DA 5EWMA 2J0UB 1E77A 1I4LD 1T43A 2Y68A 5FL7A 1QC5B 4TTAA 2GAOA 1SXGA 3HSSA 2WPNA 4L8YA 3EG9B 2Q41A 4MKFA 3A7EA 1SOAA 1A71A 2E2WA 2O19A 2R8BA 5IFKA 4K0KB 1AY0A 2R47A 3UW1A 1DP4A 3TOSA 4UOEA 3FPKA 3OQMA 2P77A 4D6XA 1EFPB 3B6MA 4FQ8A 2B5VA 1WF3A 5JXGA 1JXAA 2VEDA 3OO0A 4YAJA 3ESBA 2HA6A 4OSPA 3UA3A 3VDNB 3U37A 1DEOA 4L85A 2QT0A 5GVSA 3H2JA 5EJFA 1Z3CA 4RD1A 2UYHA 1A7UA 1ORHA 2FMFA 1ZKMA 2HTFA 3AP1A 2F9FA 4HEA6 3JQEA 4HPJB 5CDSA 5B53A 5KYWA 3T4UA 4B2LA 1R12A 2FZKA 2FRXA 4RPLA 3QNWA 4GUAA 5FUVA 1G1MA 1W88B 3BHNA 2ERCA 3QTBA 5B6PA 2G08A 3PXEA 1S7GA 2ZIUB 4ND6A 2I2FA 3JVDA 1YH3A 1X1BA 2QTBA 1SBQA 2W9XA 3SQWA 1D2GA 1P7YA 1JH9A 4AJHA 2EVWX 4A2CA 4B87A 2OCGA 4MUFA 2G7MC 4YQYA 5LQKA 1TMYA 2PXCA 2C57A 4X44A 2XE8A 4QYWA 2A2ZA 3RM3A 3PX2A 1TF2A 2I2WA 3V1UA 4A0QA 4G24A 1YS4A 1T9DA 3ICEA 4EW1A 5EPEA 3ZQ4A 4CF5A 5EE1A 3TMKA 4OB7A 2NTVA 1KOGA 1YZ3A 3HJFA 2CK3A 2XRMA 1MKYA 2FPGA 4RKEA 9MHTA 2ECKA 3H9CA 3C3BA 2D8AA 5D5HA 2IYTA 3CINA 3TQIA 3UB3A 1YULA 5CFMA 1U7TA 4R71A 1YCDA 2CCJA 4BCCA 4EPWA 3W5SA 3B3GA 4X3CA 1FFXA 1SZJG 2FYTA 1HEYA 2P2LA 3NJ4A 1WZEA 4OM7A 4HBGA 4KUHA 3SZ3A 4C0LA 5IJ9A 1QRTA 5DHQA 5A9RA 4Q7LA 2HJGA 4OXIA 2O2CA 3CE6A 2NADA 1VXOA 1CIPA 3R3XA 2GGSA 2PMKA 1K6JA 2Y1XA 4LJAA 5HR5A 4B6OA 2A84A 2VNIA 4XPIB 2H2DA 3OFJA 3ZE9A 1AV6A 4FQ5A 4IJVA 4LOAA 4C4TA 4L6IA 1V9LA 5AIAA 2GPJA 3DH0A 3DHNA 4KXYA 3ZR4B 4V03A 2VJAA 2QKYA 3ROFA 5HOQA 3OSZA 3TMAA 1IHUA 5A0TA 3A9WA 3HHPA 5E4YA 1XJ5A 1G2QA 5M34A 4BAUA 3I3OA 1M6VB 2YS7A 2NSJA 3JQCA 1LF0A 2VA9A 4H6PA 4A6DA 3GGSA 1NG9A 4EUEA 3WLIA 1QFYA 2C2XA 1ZC4A 2W6ZA 3U61B 1YZNA 3EBOA 1ZSNA 3KELA 1SZCA 1BKDR 4XUEA 3SEFA 2CFSA 5L45A 4NCAA 4RPKA 1NJ1A 4K6KA 1OX4A 5KOHA 4UULA 1KYIA 3WDLA 2HMVA 2O8BA 5EE5B 2VPTA 2Z2KA 5DSZA 2N75A 2OCXA 4OYLA 3VKUA 4YAKA 2WKWA 1HM5A 2OPBA 1SD1A 2JI7A 1XEWY 2I1LA 1OYWA 3WADA 2P9CA 1K7YA 1X7YA 1SBYA 3WB9A 2ZIEA 2D7JA 2HQBA 1G7RA 6NULA 1WSBA 3WNZA 3OY7A 1SCUB 4KK4A 2WTBA 4XM1A 4YMWA 2VSOA 1I01A 1VYUA 2VTEA 2YVAA 3INNA 3MAGA 2IU3A 1R2QA 2QMYA 2O2XA 3DXYA 2PSDA 4IXDA 2YKGA 5E1DA 1X1SA 1DTSA 3FMOB 3OECA 3E35A 4DMMA 1N9ZA 1WXDA 3F9RA 5K0FA 3R7AA 4M0PA 1AURA 5JSZA 3ZIAA 5SY6A 3IPXA 2FPRA 2EFYA 2QN3A 3DG9A 3PFGA 1W5EA 3ANNA 1TM7E 3GCDA 3AUAA 4LZPA 4C0JA 4PC6A 1NI4A 4EFNA 5BWOA 2ZRHA 1TCAA 1T91A 3BSSA 3JS5A 5TQ0A 5EWLB 3G2LA 5HTKA 4UW9A 3ASUA 5IAEA 4BLRA 4IDOA 2EWVA 1JWAB 5DNDA 3V80A 1R0KA 3FWKA 4Q7JB 2G88A 5LL6P 1XQXA 3IT3A 3N1UA 4MW2A 4RH1A 3FE2A 4P3XA 1NDQA 4J94A 1ZGZA 1XRJA 5C37A 1PGPA 2XUQA 4LV6A 3PWSA 3S2SA 3D5TA 3EN0A 5FHRA 1GUDA 1EEXB 4B4KA 1REQB 2ZRFA 4FYKA 5C31A 3UTDA 1B2LA 3DSRA 4QDUA 4QOHA 4OA5A 4YCBA 4JT4A 2QW1A 3E7PA 1NPTO 3CXUA 4MWGA 3OOHA 1PUXA 3QQ5A 1CY4A 4ND8A 4Q9LA 5H70A 5LWQA 2I9KA 1UJ4A 1CUIA 3O92A 5KVCA 3ICCA 4K81B 1TTTA 1E98A 3CV3A 3D0RA 1PYDA 4LC0A 5ARDA 3UMYA 4M9QA 4Y1EA 1J2TA 4NYMQ 4RK7A 1NPYA 4E08A 5GONB 1LRJA 2RCYA 4C0SA 2H59A 3IR7A 1OLSA 4D8UA 1ESEA 1GGJA 1Q84A 3A11A 4BO0A 3IE1A 1GNRA 4FYYA 5T4FA 1JLMA 3FZGA 1J0DA 1C1XA 1U2SA 5FTKA 3K0FB 3HK2A 3U7JA 3P2IA 2O2DA 2E21A 4OUDA 3JWJA 3OUZA 3OG9A 4QNRA 2C99A 4P4LA 4AL4A 5BV0A 1NNSA 1VSQA 3CLHA 1JXOA 4QU9A 3NBKA 4GPZA 1CRLA 3C0KA 4PLGA 3UKOA 4BJ3A 3WP1B 2PY6A 2HPVA 4R1NA 3UJPA 3HP4A 4D9KA 1T2NA 1XMQB 1EKXA 2NO1A 2P9ZA 3H8WA 2ROQA 3K4QA 4WOJA 1BE8A 3ZCQA 2WVJA 5LLTA 1PQPA 4AIRA 1QV6A 4NY1A 3NQ41 4U5XA 2GVZC 2ZVQX 1ZU4A 4B3IA 1PJ4A 4QO8A 3RASA 5GADl 3U7GA 2ZVDA 2O8DA 1KAMA 1SUSA 1XHFA 4BVEA 4HN2A 1PDWA 5J4VA 4DIEA 4QEZA 3ZH2A 3I9V6 1JEQB 3D7MA 1NMEA 1QHHA 3UYKA 3AV0B 3LD9A 1QU2A 1ZIPA 1EFCA 2H0RA 4JQYA 4NONA 3DBVO 1VIDA 1V7PC 4NCIA 2IWRA 2G67A 5B4VA 1CEEA 1BWRA 1W96A 1M6NA 3M6MD 3PR3A 3S28A 3UQYS 1XYGA 4IWYA 4F7DA 5BVGA 1CS4C 2WFZA 4C76A 2C4NA 1VKOA 3PFNA 1APBA 4DR7B 1X0VA 1MO5A 2L19A 1QE5A 1RKXA 2MINB 3MINB 3BBLA 3N07A 3ST7A 4C3VA 1E3DA 3FTPA 3SJ7A 2W2KA 5LP6A 2CB0A 2MDTA 4ETNA 4G1FA 2GYWA 4R1MA 3RVKA 3REFA 1GCUA 4J6EA 1Z6QA 3H2BA 4C6TA 4D44A 4ZQGA 4HTAA 1DNPA 3ZHXA 3JQAA 5IDWA 4XXHA 5EYPA 1C3EA 1ISFA 2GTIA 5JPCA 4BO5A 2Q3FA 4LDZA 1COWA 2HQOA 4CT5A 1ZCJA 3O1HB 4ACAA 3K09C 3Q11A 2CNWD 5B1YA 4KV9A 2GN9A 1Z6XA 3Q2OA 3ZNOA 4RJTA 3PC3A 2F1KA 3LK6A 3KFVA 1SKAA 1Z6YA 4RGQA 3UHOA 5EN4A 3BXOA 4W5HA 4GLFA 5KJ6A 3C7CB 3NX4A 4JLKA 1WP4A 2V3VA 2QV7A 3OKCA 4YJ2F 3PL5A 1Z5GA 2XH8A 3C6KA 3DOHA 1WCYA 1GG2A 2BZGA 3HQ4O 3PXXA 3TLZA 1Z63A 3DEKA 3BCUA 1Z4LA 2IXDA 5CX1A 3MTGA 4AJ2A 4ZRDA 1M66A 5FCDA 2PRKA 3I62A 2J59A 1WPGA 1KJZA 2BTOA 1I7PA 2P35A 3L46A 4MV5A 4XDYA 4AW9A 2VK2A 4DG5A 2OVBA 1S3GA 2AYYA 2VN8A 3EOAI 2GBLA 3K1AA 4HMOA 3F90A 1GNPA 4Y9SA 1UF9A 5AKIA 1GZSA 3E8MA 4PF1A 1PS8A 3OA0A 1ICIA 4ALMA 1O89A 3II6X 3EIUA 4H7KA 3DFFA 3BAZA 3GRUA 3NHLA 4O4HF 3UHJA 5JDIC 2AMJA 1V8PA 4DV0B 4I0WB 3KEOA 1NWCA 4D96A 2ZSDA 1DC6A 1LA2A 2X14A 5AHWA 5AXAA 5GIOE 2ERXA 3C45A 3AJEA 1A5ZA 2Q45A 1SC3A 5BY2A 2LCQA 1GCGA 1U1IA 1SXQA 5J2UF 2COUA 1S4MA 1Z0DA 1UC8A 3RODA 2W58A 5KREA 1H1TA 4O33A 3QFFA 4Q93A 1Q50A 3WHKA 1J8DA 4MULA 4UDXX 3HBLA 1E0SA 3ICOA 3P0FA 1MUUA 3JR3A 2AA3A 1FLVA 4ARIA 5IKOA 1RLOA 5BSGA 2BKAA 10MHA 3QU9A 3RHTA 4FEAA 3EOBI 1UDWA 1PFUA 4Z49A 1WV1A 1Z38A 3SP1A 3P9SA 4JJ4A 3R9WA 3SBEA 5AK6A 2WG1A 1HYQA 2JGKA 3GEPA 1HZZA 3S8YA 3H42B 1Y9AA 5CB6A 2EP7A 2REXB 3R4VA 3VPDA 1H0SA 2NYAA 3EFHA 3WJAA 1KRXA 4G1BA 2GXQA 4ZZIA 2HZ7A 4YUAA 3T5BA 2FFJA 5IUKC 3HTXA 2RIRA 4W7HA 4LWPA 5T67A 5TF0A 1N2CB 2NV2B 2PZFA 2QYSA 2X3FA 2N46A 4IGEA 1DL5A 2I7XA 5A7FA 5F3WB 1CNFA 9GPBA 3AZQA 4EG7A 2X58A 2GYYA 3ONVA 4X65B 1AA6A 2C8LA 2PUJA 4ZOLA 5LIPA 4S04A 4UBOA 1YJ8A 3PGXA 5KSYA 2PKQO 3CMMA 3HA7A 4QPJC 1HTTA 2Q07A 4R9RA 5KOHB 1V6SA 1FYVA 3LKDA 5LQJA 3OC0A 1YU6A 4M0CA 3LXUX 1E63A 2WJ6A 2FEAA 3DXFA 1WMDA 1YHYA 2C4WA 4RMJA 1QH1A 4TRMA 3TI7A 5E38A 1AUXA 1U8XX 2GKSA 3VVBA 3RSOA 1X8KA 4PV7A 4F3NA 1PRYA 1ZIYA 4EY8A 4HH3C 2WIDA 5CBPA 2XVYA 2UYOA 2P7HA 1OTYA 4TVBA 1V8ZA 2C4TA 2WJ4A 4NXNB 1NX6A 5IT4A 1DKMA 4DRZA 3D4NA 1J8MF 1UZLA 3C8MA 5K6AC 3IHWA 1WD7A 4I1UA 3MUFA 3ZV5A 3DFMA 5CEEA 3STYA 3F1KA 4KGZA 4KN5A 3E8XA 2OXTA 1WPXA 3DNPA 1D8AA 1C9DB 2Q0SA 2X19A 3HCPA 4QGAA 2UVQA 4WLFA 1FIUA 1XZNA 2FZ5A 5FDFA 4CEIB 1XAJA 3IIJA 1QIFA 1L7EA 3B1KA 2PLAA 3ESCA 4QXRA 1KEEB 3R1IA 2KM1A 1EXDA 1ND6A 3LRPA 4MROA 3C3WA 2FPMA 5DNVA 3KV3O 3O8LA 2Q1UA 4LXHA 4G0PA 4BZPA 4FB4A 4K26A 3OC6A 4PR3A 2H4FA 4BX2A 3TLMA 1B0AA 1X1QA 4C3UA 1DG1G 3D54D 4KSBA 3ZGXA 3N70A 1G6KA 1RC0A 3GIDA 3WGYA 1XXHB 2XQVA 3AG5A 2QIOA 3OY2A 4YRJA 1RWXA 2X5KO 1KNXA 3S68A 3WLNA 4UAJA 1FRVA 2HMSA 2FUNB 5CLJA 1XVLA 1MIOA 1WXIA 3AEQB 5A5EA 4URXR 5TGDA 4CG1A 2IYNA 5JD4A 2QORA 2BD0A 3D2BA 3LJKA 4BFYA 4MYDA 3T5AA 3NNDA 3MVEA 4COOA 4EJ6A 5JQGB 1L4LA 5IKXA 5M3BA 3U4AA 3HKDA 3E22B 4MVXA 4L74A 2C5FA 4NPAA 4YRNA 1WMAA 2RG7A 2WLTA 2BM1A 2GJ4A 3SYMA 3REQA 3HPRA 3H2IA 3NHMA 2RGRA 3FVQA 1XRNA 6Q21A 5AVUA 4YFYA 2C2HA 3TLBA 1TD1A 4YCDA 1US8B 3RRNA 3AJ8A 4E09A 1Y8QB 5I9SA 1UT6A 1I3MA 4L0CA 1ATIA 3UFBA 2BUAA 4UMFA 3FHOA 3HDGA 2PSSA 3OZFA 4DE5A 4ZVSA 1NXVA 3BGVA 4QO7A 3AR7A 1YS1X 1RXEA 1ISIA 2RHRA 4U8HA 1H2BA 3O91A 4Z0TA 2I6XA 1AHIA 1OH8A 3CURA 1OWMA 4BATA 4AVYA 1M8KA 3FCEA 3HP1A 3JRWA 4URUR 1GUZA 5LN1A 3EZ2A 3S7ZA 3UAGA 1MJNA 1S2DA 2WD8A 3DVAA 4FCVA 3D81A 4GPBA 4JC8A 4DVGA 3PE4A 1TTHA 2XADA 1XZPA 1E9DA 3A32A 4FCWA 4LF7B 3HEBA 2R8PA 3NC0C 1FX1A 1XZQA 4X3PA 3LTNC 2FN8A 3M3DA 3CLRC 4OD0A 3ZX4A 2BYTA 4KO1S 3OMLA 4TWJA 2Q9BA 1A9XB 1YC5A 3CUYA 1A96A 3LGXA 4H1TA 1PT5A 2J7PD 2ZDHA 1KK1A 1WQ3A 3R4CA 2AGVA 4WECA 5TPWB 3ZCSA 1DG3A 3TYXA 2C59A 2PLRA 3BS4A 3P9NA 1RT9A 3ZWVA 3IKTA 1JIKA 3AYZB 2OXRA 2XGJA 1F9AA 3HA5A 1LFAA 4XLTA 1Z56C 4PG7A 4QUDA 1RR6A 1XGKA 4R1UA 2AJ8A 2B4QA 2NQTA 3FI9A 4A9AA 4BKUA 4G4JA 2WUFA 2X8BA 5T64A 1Y7IA 3KU4A 3NW9A 4LZOA 3EDRA 3KR0A 3QMPA 3V48A 3VZQA 3DYVA 2PRIA 3M1YA 4ESEA 4F9GA 2C58A 2OCDA 1CF2O 3P4YA 4K9SA 2Y1WA 4IG9A 1FP2A 2B36A 3M83A 3EGWA 2G9ZA 1BD4A 4CR8A 3EXIB 4ICIA 3H13A 1MIOB 3EVTA 3A05A 2DQSA 3JQAB 4GLBA 2AX4A 2PRYA 5E9QA 2QVLA 4Q9JA 5I45A 3HXMA 1DMSA 4BZQA 3DUWA 3OX1A 5LVAA 2O2IA 2WU4A 3DXZA 3M3PA 4FNAA 1PTJC 2OO5A 3W8NA 1LI4A 1PJQA 1Q2UA 1NC1A 1IJFA 2QX9A 2P78A 3AEUB 3D3NA 4HN9A 5C7LO 5FWNA 5JJIA 3NANA 2COEA 5KPJA 4FOPA 2ET6A 3PXBA 1T3HA 3S44A 3OPMA 1VQ1A 2OG1A 2VAWA 4PO9A 4RCZA 2I29A 3H9UA 4YRTA 5JXIA 1E2EA 3IAM1 3VAAA 3GVCA 4ZO9A 2DCMA 3RS7A 3DQPA 1ZUWA 3KB2A 3AVQA 4AF8A 3KU1A 3GFOA 3N2KA 4NCKA 2AVDA 2WE8A 1PDOA 3DP7A 3RRJA 2EOAA 1QPGA 2WSYB 2R8ZA 3VOSA 1CDOA 2A30A 3PNMA 1AQ6A 2VNSA 3CHYA 2O8NA 1GT6A 1D7OA 4ZWNA 2J9FA 4US2R 5I7HA 2PUGA 3AHDA 3OZGA 1O9GA 3GHHA 3I12A 4D2IA 3H1AA 2UZAA 4FGWA 5EJ9A 4K1LA 2P6RA 4GRIA 4TQUS 3S99A 4KLZA 4B3RB 4ZEWA 2IDZA 2WHEA 3V2HA 1QRUA 1QG6A 3D6HA 1U7ZA 2WFLA 3ZVKA 2RBKA 2WKPA 3B1WA 2BHNA 1XQ1A 2CXTA 4NEHB 1KH1A 4C29A 2BHSA 4GWGA 4OQMA 4TV8F 1ESNA 4RMGA 4N6GA 2QE7D 5SV2A 1IUNA 1S5PA 2DE0X 1JEJA 1JP7A 2OV3A 3JATB 4IH1A 4OHWA 3ZE1B 4IYRA 3WNDA 3UBTA 2A5DA 3RREA 3X1XA 2LGJA 4CMAA 2XXBA 5DTRA 1I7NA 4LHXA 1CBUA 4OREX 4ZQIA 2RGEA 4YV1A 4YROA 1G5HA 5K8UA 1OASA 3RD5A 3L7MA 1SELA 3PRYA 1J90A 1OXUA 4I3GA 1KQNA 4FOLA 4DRXB 2Z2JA 3NM4A 3ZI4A 1E4VA 3DEAA 1P31A 2G82A 3GEIA 3MCTA 3WRWA 3HDTA 2R2GA 4NWIA 3R76A 3A25A 3BM5A 3D6MA 3RRYA 4KC0A 1GLGA 4YHBA 3ZJUA 1RWBA 2GVNA 1SCAA 3V4ZA 3PEUA 4PQEA 3FN4A 1PP4A 3ONFA 3RFCA 4GYJA 3M1AA 5EXEA 2PD3A 3HNRA 3BXPA 5EJ2A 2CJYA 3TLYA 3BJZA 3EK2A 4DMHA 2XT6A 1SA0B 3PTZA 1UFVA 3DCJA 1BJRE 1NM5C 2AVNA 5K3SA 1MW8X 2YHAA 1XZDA 3HEAA 1ZL0A 1J0XO 2O0JA 4CV0A 4E2WA 3AEUA 4LZZA 5E1MA 3ODGA 4RYLA 3QLVC 3NCTA 5L3ZA 1UKYA 1VBFA 1KXZA 3I42A 1KGDA 1IUPA 1VJ5A 5LQNA 3HBMA 4QHTA 4OJMX 1WJGA 1M2OA 1RI3A 1RJWA 4PPGA 3GIWA 1C41A 1X15A 1UC4B 4GMDA 4HDQB 5EMKA 1R4NB 2L69A 2ZJ7A 3IEMA 3JQFC 3VPCA 3MB8A 2W8ZA 3NPAA 1Z16A 2C84A 5K0GA 4LHVA 2ORIA 3LWNA 3NT2A 4NU8X 5JU6A 3R3HA 1XPOA 3ADDA 4N5DA 1A76A 3GGCA 4BO8A 1GVNB 5A5DA 1N8TA 3HYRA 3AKYA 2QRGA 2QTAA 1YOVA 2JC3A 2IEGA 1VGVA 2RSLA 3B85A 4BFCA 3JD0A 5CDFE 1DOAA 3OCVA 4LRUA 2ID7A 3TX6A 5HPYB 3ZCXA 4MCJA 5CYGA 3IEXA 4Q6WA 4EHFA 1G18A 4G0QA 2R3SA 2ODWA 3P0EA 4GI7A 1T9HA 1TUIA 1KMHB 1JRLA 1M8JA 3HR7A 1WDWB 1JIVA 3G5AA 3ZW8A 3L8EA 4C6SA 1RCFA 1OT5A 2V74B 3DLPX 3JWPA 3O5AA 5F1KA 5KZMB 1YU9A 1QFXA 1B8NA 1QOPB 1MC5A 1SXIA 1Y1SA 2J9RA 5IBPA 4RAQA 3LE8A 4ENRA 1W0KA 3RU2A 4TTRA 4B79A 3Q3VA 1V3UA 4R8SA 1JQ5A 4DCNA 3WRXC 2QVBA 3SF0A 3HRIA 2D3TA 4H59A 4CIDA 2OORC 3IKVA 1BX0A 1EI9A 3BXZA 3FJOA 1RCUA 3A9RA 4RANA 3LU1A 2FVYA 1GY8A 3DDSA 2B69A 1V26A 2KW5A 5A3QA 1XWWA 3PHHA 4ZIRA 5BUCA 2EFHB 1Z08A 5K0SA 1TZCA 3E0QA 3PPWA 2BELA 1MAWA 3LPDA 4KBGA 1TQ2A 2JKYA 2ETXA 3O1JC 4PXYA 4DMUB 3NP7A 5JCZA 2MINA 2AG0A 2OMEA 3G0DA 3ZHYA 3B1XA 5FD8A 1ODIA 2X8WA 5CCXA 2J9YB 4J7UA 5CYOA 5CCBA 1MFPA 1JA0A 4X1OA 5DTEA 1W85A 2FNAA 5LYJB 4AY5A 1FFXB 1BNCA 4MP3A 3BCHA 1QIIA 2O05A 3VZCA 2FA9A 2HMYB 2W4IA 2YDXA 5I3CA 4XSHA 1KK2A 5HUHA 3C39A 1E59A 3EXG1 2GCPA 3RYHA 4D4HA 2EEZA 1SC6A 4B84A 4A6XA 4GVXA 4D9NA 1Z88A 2A33A 3BOSA 3B2NA 1KIFA 1GV0A 1M2GA 3KTAA 3MB5A 3IAM6 3RVSA 1XLTA 5LZ9A 3CW9A 3GVHA 4HQKA 2XNJA 4AYXA 1TVKB 2GLUA 5LOVA 1M54A 3IP1A 5FOVA 3ZHVA 4AXBA 3ZBUA 2FPPA 3LUAA 1TTPB 3OQ6A 5FA5A 3L7AA 4MV0A 3TVYA 1LS1A 1H5QA 1MNAA 1TK2A 4ACBA 4CL8A 4F1KA 1PJ2A 2A9FA 4OU4A 2VP5A 3I9JA 4UDOA 1DUVG 4HVLA 4LX0A 4G3XA 2Q6VA 4WPGA 6YASA 3U4MA 5HW0A 2Z9DA 1XT6A 3AVXA 4FQ7A 1JDVA 1XCPA 2YJ4A 1IYZA 4UATA 1IK6A 1RHQA 1KYZA 1XDGA 1I9CA 1P2GA 3FOBA 3BZWA 1XMOB 3TK1A 2JBAA 5GTDA 3FWYA 3GFVA 4GH5A 2C1XA 2CMHA 3CX4A 1Q0LA 4AJ1A 4CM4A 4NATA 1GKLA 5BOSB 1EGMB 1QYRA 4TUYB 2WAOA 2R5FA 2XUHA 2Y92A 2Z3ZA 4XA8A 3KSRA 2IRWA 2NO5A 4MHSA 3V6MA 2UYCA 5JJKA 1D1PA 3P9CA 2VKQA 3EXG2 1ESDA 3PC8A 3EBLA 2OYRA 4RVUA 2JRLA 1YBMA 4FT4A 1QWOA 3IELA 5JDCC 3ZK8A 4ZCRA 4RULA 1QX3A 3K2QA 2XF8A 1YB4A 2FR8A 2Z95A 2PU7A 3BZBA 2RKWA 1TZJA 1LPPA 2AOUB 3RR2A 3QELA 1IAQA 3QXXA 1HT3A 2FFRA 1BE1A 3ROKA 1RLJA 5TX7A 1F7UA 1HPLA 4PAWA 4R1QA 3MQ2A 2JLXA 1G8YA 3AUUA 1Q77A 4JMLA 2RK4A 3VPHA 2VRCD 3EXEB 1I7SB 3P26A 2IBSA 5G1PA 4NZNA 4KRFA 1S01A 3ZWXA 3CH5A 2HU7A 4US0R 4E1VA 3RDPA 2ZYHA 3ZXIA 1Q1NA 2XQFA 3G9QA 3N2NA 2H4WA 1EFVA 1DE0A 2OM2A 2BFCB 1AHPA 2X15A 1JHAA 3OLXA 3ZQJA 3WOVA 5JJ5A 2RFLA 2VL7A 4L9AA 1YMVA 4ID3A 1GA4A 4RZUA 1T2EA 4Z4QA 1TYEB 3D7SA 1GM5A 2V9CA 2PEZA 1EIZA 1T9ZA 1NJ2A 3EF0A 1OZHA 4G01B 4WADA 2GEJA 2OK7A 3EDCA 4KPUB 4O3FA 4ESOA 1SM4A 1BW9A 3L4SO 4D02A 4HATA 4B47A 5C34B 2WMYA 2V96A 2IYVA 1EK1A 4R1LA 1G66A 2FFQA 3QEOA 5HVNA 4N3AA 2JIOA 3M4NA 1U8YA 4HLUA 4QAJA 2AWNA 3F4KA 2EBHX 5LP1A 4UHCA 1PF7E 2VYNA 2XJ9A 2DULA 1BFUA 4ZYYA 3OT5A 2AMVA 2ZRIA 4XFKA 2XCSB 5DMXA 1NAIA 4Z7JA 2R48A 4FGUA 4ILKA 1H94A 3W2FA 5KQMA 3TUJC 1W4RA 2VF8A 4XSVA 4XOUA 1WPQA 5IANA 1SCUA 2ZTLA 3HR8A 3JAMA 2PGJA 1J70A 2VJMA 5SY4A 4MW1A 3DTTA 4TMYA 4D92A 1EHYA 2YL2A 4LF6B 2C61A 2MSWA 3B9PA 1EFAA 2XMZA 1XKXA 3OZTA 4NRDA 1O8CA 4TUYA 2ZJBA 3K0AA 1NVWQ 1JNYA 4HY3A 1EP1B 4ZOAA 4U8GA 4ALKA 3MQ4A 3MCZA 4YC7A 1RWKA 4AZTA 4RD4A 2VPQA 1YQUA 5L4LA 2GK3A 1SC9A 2L17A 2MMGA 1C7IA 5K01A 4MVWA 4EVQA 1GAWA 4WUTA 4F2DA 1O1YA 2IDKA 2PGIA 4V1CB 4JHXA 4C4AA 3QBEA 4WCFC 4U0KA 3VO2A 4C7VA 5HZMA 3SHTA 6GPBA 2IBTA 2ODAA 4FP9A 1VSVA 2WT4A 4MOWA 1DJNA 4N40A 1O97C 2BKXA 1M7GA 1MBZA 3MTBA 3WWPA 4CM9A 4MCAA 2R7AA 2AQHA 3L1JA 3OEWA 4G4SP 4PWZA 1F2DA 5C1DA 1P1IA 1EEHA 3VHRA 2B0CA 3M6IA 2FSVC 3FKQA 1U31A 3FFBA 2E5FA 3B8HA 3LLUA 4W1RA 5AKLA 1DJMA 1SY7A 2JZOA 2V1UA 2C92A 3DV0B 3LXXA 1X1DA 2B34A 4NOKA 4PTYA 3QFTA 4PTLA 3WGJA 4D3YA 3DLCA 1CUCA 1G5TA 3I0NA 3NKFA 4N9QA 2L82A 3FM9A 4JYAB 1U1EA 3FRIA 1Y3IA 3KZXA 2ZJYA 1PZNA 2HEGA 2G9UA 1LH0A 1UDXA 3DBLA 3MRXA 5K0EA 3LA8A 1HDCA 4S1NA 3H1GA 1Z0UA 4F5ZA 1N7HA 4P4SA 2EDAA 2HIMA 4WIAA 5IG2A 4DCMA 3E82A 1R9GA 1UQTA 1QH9A 2I87A 2Q99A 2ZIGA 3F47A 1TC1A 4LWOA 4RM3A 1H6DA 3B36A 3O38A 4UD2A 4UM7A 2HMTA 3JASA 4UNNA 2IU0A 2C5AA 4OF4A 3VR6H 3IOEA