4BS0A

Crystal structure of kemp eliminase hg3.17 e47n,n300d complexed with transition state analog 6-nitrobenzotriazole
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
299
structure length
299
Chain Sequence
QSIDQLIKARGKVYFGVATDQNRLTTGKNAAIIKADFGMVWPENSMQWDATEPSQGNFNFAGADYLVNWAQQNGKLIGAGCLVWHNFLPSWVSSITDKNTLINVMKNHITTLMTRYKGKIRTWDVVGEAFNEDGSLRQNVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQMHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGITVMGVADPDSAFASSTPLLFDGNFNPKPAYNAIVQDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KEMP ELIMINASE HG3.17
publication title Precision is Essential for Efficient Catalysis in an Evolved Kemp Eliminase
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Lyase/lyase inhibitor
total genus 122
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bs0A00
1US3A 4D72A 1KXHA 1E43A 5BXPA 5CJ5A 4L4PA 4QLKA 2ZWZA 1VBRA 3GXDA 1BVNP 1VFFA 3SCUA 3A4XA 2X2YA 2D1ZA 2BY3A 1UQZA 1CPUA 4HOZA 4AZ7A 2J8GA 5ABFA 3CZLA 1GNXA 1QI2A 4X0VA 4HP5A 1CXKA 3VNYA 1B3VA 3K1DA 4TVUA 1J01A 2WHMA 1JD9A 4JCMA 2J4GA 4PTXA 1CXIA 2WNWA 4M81A 1B3ZA 2ZXBA 1UWUA 4LQ1A 1JZ6A 2FGZA 1HF6A 2ZUWA 3B9DA 4PMUA 1JDCA 4HZ8A 1W9BM 3VMOA 4GZIA 1Q6GA 4UFMA 3WQ8A 3PZIA 3GXFA 5JIPA 2J7FA 2YL6A 5BXTA 2J78A 3ZT7A 3AS3A 1VEPA 2VQTA 5I79A 5JBDA 3TOPA 2J7HA 2D0FA 4NSBA 3BC9A 4LYQA 1HL8A 1R87A 4OZOA 4A3YA 2O9PA 3PHAA 2EO7A 3LPGA 1EQCA 1CLVA 2E9MA 5I0DA 5FL1A 1ISXA 1H4PA 1JAEA 2FGLA 2VL4A 1VJSA 1BG4A 1DTUA 1MFUA 1SMAA 4BQ4A 5M17A 3TTYA 1ZS2A 3ECQA 1WZLA 3VKKA 4BQ2A 4AIEA 2OYLA 3AS0A 6TAAA 4ACYA 2A3CA 4BA0A 2VR4A 5CG0A 4AYSA 2PBOA 1RPKA 4S3KA 1HXJA 3VPLA 3WUGA 4TVDA 4GKLA 3AMKA 1FH9A 3A47A 1E6PA 1B30A 1G0CA 1XSIA 3ARSA 1QPKA 3GNOA 3AZSA 1I75A 1W3HA 2Z1SA 5CSYA 3WF3A 2EXOA 2Q8XA 3M46A 4GXPA 3PTQA 2VC9A 2WHKA 3KL0A 3U5UA 3VD9A 1V02A 5E9AA 3CLWA 3D3AA 3WDHA 4WSJA 5BROA 2GVYA 2XSAA 2J7DA 4MJ4A 3AXHA 4MADA 4AW7A 2VRQA 1UWTA 1E6RA 4B3LA 1BHGA 1DWJM 2BVYA 3ARPA 3IAQA 1FHDA 3II1A 1G5AA 1NOFA 3ALFA 4A3HA 2WHJA 4UQEA 1WDQA 1LG1A 1EXPA 4W7WA 1E6NA 1JFXA 1QBAA 2OSXA 1JL8A 2YA2A 3D5HA 1TA3A 2J7GA 3VOCA 3BMWA 1I1XA 3N15A 1TMQA 3OG2A 5E09A 3FAXA 1LL7A 3OLDA 4JHOA 5DFAA 4ZFMA 5A6BA 1Y7VA 3DC0A 2XIIA 5AC5A 3B9EA 2WMJA 1O7AA 4PCSA 3WMBA 1CDGA 4QAWA 4WF7A 2QLYA 1W1PA 2CETA 5DMYA 3VDBA 4KGLA 1BGGA 2DEPA 1UD4A 2XM2A 2XVGA 2ZUVA 1UD2A 4YPJA 5D9OA 4UQDA 4P7NA 4GINA 3ZOAA 4PCTA 1M53A 5I5RA 1FOBA 1CGWA 2D20A 5JBFA 1V02E 3DYMA 1V3JA 2E4TA 1HKIA 2XFFA 4M8UA 3VNZA 2WVTA 4WK9A 2V3EA 1UH2A 2EQDA 3CZGA 5JUVA 1KXTA 3ARUA 1JIBA 2OWWA 1B9ZA 1XCWA 4ZXLA 5CQ1A 4UZUA 5BRQA 1QW9A 1JYVA 1H1NA 1NM9A 1GOIA 4H04A 5DF0A 3WQ6A 3PZGA 3O9NA 1MQRA 4GZEA 3AXIA 2UWFA 1GONA 4C7DA 3O2LA 4B16A 2J77A 2XWDA 3WNPA 4J27A 1OGGA 1OIMA 1RP8A 2CBVA 1HT6A 2XWEA 3SUWA 3ARTA 1PEZA 4XV0A 1TG7A 3VIFA 4CN1A 1SMDA 1V6YA 3CUGA 4U2YA 1GOOA 1VF8A 4HOXA 2A3AA 3F5LA 4JFTA 8A3HA 5ABHA 3N18A 1BLIA 3VIJA 4D6EA 5AC4A 1XH0A 1KCKA 4HMCA 4FK9A 1WPCA 4JL2A 3AXXA 1OSEA 2WM0A 5A1AA 1ZBKA 2YA0A 1LL6A 3SCSA 3W81A 3WIJA 4LX4A 1ODUA 3CHDA 3W26A 1U2YA 3PZMA 1EOKA 4UFIA 3SEPA 1MQQA 3EDKA 3GH7A 4CD6A 3VD5A 1KWKA 1UHVA 2JFEX 3DECA 4CD5A 2WYSA 5HPOA 5E0FA 1PIFA 2A3EA 2Y4SA 4IPNB 5I2UA 3WF1A 2WWDA 3ZT6A 1KGUA 1WCGA 1UR9A 2QHAA 4LXFA 3WQ4A 4EANA 3MV11 2UY2A 3WBAA 2DSWA 1QI4A 1HL9A 1B2YA 1WDRA 1CEOA 1VB9A 4DWSC 4ZEPA 1QNSA 3VDHA 1EHAA 1B3WA 1WZAA 2BY1A 1PBGA 1GQIA 4PTWA 2DPEA 1V0NA 3PZTA 3QR3A 2ZE0A 2X0HA 1UZ1A 1WKYA 2PWDA 2QV4A 4J3SA 3J7HA 1US2A 5ECUA 5A2AA 4DUWA 2VX7A 2BHYA 1OB0A 3WD2A 3QHOA 1C90A 2VX6A 3UERA 1E6SM 1UZ4A 1IZKA 1VFOA 1GOWA 5FCZA 1K9FA 4UZSA 4JKKA 5A6JA 4D6HA 3FNDA 2CNCA 2WVSA 3FY1A 4RE3A 1E6QM 2XVPA 2ZOXA 2GK1B 1FFRA 4QDMA 4GI9A 2OWCA 4AD3A 3ZSTA 2NW0A 3WNNA 4ACZB 2XVKA 5D8ZA 1UKTA 2DSKA 1NWRA 1MXDA 1DWFM 3NCOA 3PBGA 7CGTA 4E2OA 1CGYA 1GZJA 2CBJA 4NI3A 4UOZA 1PIGA 1JDDA 2V5DA 1CXEA 1E4NA 4BCEA 4F79A 2WC3A 4W93A 4J3TA 3ARVA 2NSXA 1GVIA 5GNXA 4TTGA 1DEDA 1UOKA 3BAIA 3N13A 3EBVA 2VT0A 3CUIA 3W0KA 1J0IA 1VRXA 4M1RA 1NWSA 5I3DA 1E5NA 1E72M 1B3YA 1IT0A 1UWRA 4OOUA 3BH4A 1EIBA 1XRVA 1ECEA 3CUFA 1GPFA 1GOQA 4CCEA 4PMNA 3A6OA 3ARZA 3OZPA 5LA2A 1BGAA 1XHGA 3E1F1 1UWQA 4NF7A 3ZM8A 2G3JA 3GM8A 3LPPA 3VIHA 1EO7A 4UOQA 3W82A 1CXFA 4OJYA 3WD0A 5IHSA 2ZX5A 4S3JA 4AISA 1KGXA 1EQPA 3SIMA 4UR9A 2B31A 4H8HA 4UQBA 5EFFA 2WVUA 1VENA 3CTTA 1UR0A 2XFYA 1E6XM 2OLHA 2YBTA 1W9PA 1K9DA 2WC4A 1ISYA 2WPGA 1CXHA 1E55A 1JZ5A 2OYMA 1N82A 5BWFA 4WSKA 3WDIA 2YDSA 3WEMA 1Q6DA 4LYRA 3WENA 1F4AA 3GH5A 3FHQA 3RJXA 5I6SA 4JFWA 1AQ0A 5A6AA 4W7UA 2GJPA 1V0LA 4JIEA 3WBEA 2JALA 1W9UA 2WKLA 4EK7A 4JFVA 1WZMA 3IANA 3VIKA 4Z2GA 2G4FA 1XCXA 1E6ZA 1OD0A 3AHZA 2JF6A 3CMGA 2J47A 1QI5A 2EBNA 1E1FA 1VAHA 1ZBWA 2YL8A 7TAAA 4TX6A 5BXSA 2WVVA 3T2QA 3MMDA 4A4AA 2RGMA 1JD7A 4OUEA 4IPLA 3L4WA 1H5VA 1C91A 4V27A 1JI2A 3CZKA 4W87A 4KMQA 2RGLA 2WK2A 2WZHA 3B8SA 2VOTA 3NDZA 2CKSA 2DDXA 1GQJA 2QMKA 2AAAA 2E40A 4JKMA 4E8CA 3ARRA 1P6WA 3WEZA 4M80A 1LJYA 4AXNA 3WDQA 5D4YA 5C71A 3UCQA 4U5IA 4WKAA 3TTQA 3VM7A 3TTOA 4CN6A 4M82A 3AYSA 2X1IA 3SUVA 3MS8A 5D9MA 4TTUA 3OLIA 4MNKA 4W5UA 1LLOA 4J3WA 4CU7A 3UETA 3QHNA 3G6LA 1MW1A 1JZ2A 1V3MA 2W91A 3T0AA 3AIUA 4FMVA 2YLLA 3MKKA 4IUGA 1ISZA 1ZJBA 4N42A 5CZKA 6A3HA 4AEEA 1BQCA 1GQLA 1MVYA 3A4AA 4ZE4A 3WL0A 2BFGA 2EPKX 2G3MA 2J79A 4P7LA 2GUYA 3TP4A 1QNQA 3QGVA 3UR8A 1NQ6A 3L4YA 3AS2A 1LWHA 4H2CA 4TOQA 4PRWA 3WMSA 1J12A 2CYGA 4Z2JA 1LQ0A 4P7OA 5F7UA 1BG9A 1ZJAA 4GI8A 1TUXA 3PTKA 5EBAA 3N9KA 3AHVA 3MV01 4AZHA 4PYSA 3W4RA 1U33A 2OYKA 3T2PA 2YKKA 2VR5A 3HN3A 5I78A 5CLTA 3TONA 1RD6A 3VTRA 1WDPA 5IDIA 2IXUA 4MDOA 2ZX6A 1PAMA 1V6WA 1OGBA 4RE4A 2DSZA 1HKJA 2WANA 4F9JA 5HBFA 4TVCA 3SUTA 1H0GA 4WKFA 1JNEA 1LG2A 4W8AA 1J0JA 4OKDA 4EE9A 1C92A 2EJ1A 3SUUA 2VVNA 4Z2LA 3RILA 4UQCA 1FFQA 2C0HA 4CGTA 2J8FA 3GYCA 5DO8A 1AQHA 3GTNA 1W3LA 4QP0A 4CU8A 3L4TA 3WNLA 4EKJA 1HJUA 3KWXA 4J3XA 2WCAA 2GSJA 4NRSA 1MW2A 2F61A 2PI6A 3L2LA 4P7QA 1QW8A 4Z2IA 1TZ7A 4HTYA 1JDAA 1GOMA 4U5KA 3RM4A 1JZ8A 4HPHA 3AZTA 4PTVA 1OIFA 2CCRA 1XV8A 2OWXA 1KFWA 4JCLA 4GO9A 4U3CA 4U33A 2J7CA 1S46A 1XH1A 2J62A 1HKMA 3WD4A 4CVWA 4CUCA 2JEPA 4AD0A 1D3CA 5A8OA 5A94A 5A8QA 2ZUSA 1WP6A 4AIOA 4KGJA 2G3NA 1W9VA 2BY0A 3CHEA 3WNOA 2YIHA 1BAGA 1NH6A 2UY5A 1CGTA 2XJ7A 1U30A 4OBRA 4AEFA 3VMPA 1V6XA 4TXEA 1L0PA 1UG6A 3OBAA 2J75A 2ZXAA 3MANA 4U31A 4DWSD 4PSRA 5BXRA 3BSHA 4D6JA 4P8UA 5AY7A 4WIWA 1UWSA 4PMVA 5CPTA 4K68A 2V38A 3THDA 2DT2A 2WMHA 2WKGA 1PZ2A 3AIEA 3QOMA 3N12A 2O9TA 3MU7A 1DP0A 1H0IA 4KH2A 2ZUTA 4FLOA 4D6IA 3N04A 1UD6A 3CZJA 3UR7A 4YN5A 2WMGA 5E6ZA 3B9AA 3ARQA 1O6IA 4KRTA 1OGSA 2ZWYA 4TX8A 2XFRA 2V3FA 3NUKA 4DWSB 1CENA 3TTSA 4BF7A 4V2XA 3F5KA 1C8YA 3MO4A 3GXMA 2XHYA 3ZJKA 4R27A 2VO5A 4D71A 1JZ3A 4W5ZA 1CIUA 2CITA 1EHNA 4J28A 1JFHA 5DEZA 4AC1X 3O6AA 4PN2A 1ZL1A 5A6LA 1G9HA 3CO4A 2VVSA 4HA1A 3WH6A 4IISA 2IUZA 1WDSA 2FH8A 3RO8A 3AOFA 3FN9A 4W88A 3WH7A 4QCFA 1B31A 4NRRA 1ITCA 3AYRA 4MDPA 2WMIB 2DH2A 2XGIA 2XG9A 2D0HA 3BAWA 1GORA 1TFVA 2D24A 1CLXA 1V6UA 4X9YA 1JYWA 1E0WA 1HNYA 5A69A 3VGGA 4AIUA 4XZBA 4XUYA 3PZNA 1JI1A 2VZOA 2WHLA 1X1NA 4GPNA 3VINA 1WAWA 4CVUA 3VX0A 2QMJA 1UD3A 1V3KA 1UH4A 1VBUA 4DM2A 5CLWA 3WDRA 5CGTA 3ZJ8A 1XGZA 2DT1A 3QHMA 3SCQA 2NT0A 3G6MA 1UR8A 1GJUA 2WMKA 1X6NA 1BYBA 2XVNA 3ZMRA 2YOCA 3VIIA 3ZJ7A 3WSUA 2CIPA 4GZJA 3UESA 4YHEA 1OM0A 3SCRA 3WN6A 4BS0A 1J0KA 2GJXB 1ZB5A 2FHCA 1FH7A 4AD4A 2YBUA 1C8QA 1HJSA 3OGSA 3ALGA 3K8KA 3T0BA 1OCQA 1EDTA 2JF7A 3L4UA 1MQPA 3VVGA 5BCAA 4DUVA 4B15A 4LGXA 1ITXA 1W32A 4CCCA 4MB4A 1PJ9A 1XC6A 4V28A 3W6MA 5HPCA 1NARA 2WWCA 3L4VA 2W5FA 3M6DA 1FHLA 1UR1A 2FH6A 4UTFA 1A47A 1OT1A 4AZCB 3WKZA 1KR1A 2GDUA 3SCTA 1L8NA 1V08A 1ZU8A 3VM5A 3EMZA 2J25A 4PEEA 5C70A 1OT2A 2DIEA 2XM1A 1GVYA 3M07A 2HVMA 1R85A 5IFTA 1KQYA 3CZ8A 1XD0A 1UKPA 3NJ3A 1JAKA 2WSKA 3MMUA 1DWAM 3RM8A 4ZE5A 2J7EA 4F8XA 2E9LA 3OLGA 1W2PA 3GZAA 3VGDA 3ZIZA 1BFNA 1GOKA 5JIWA 2E0PA 2VJXA 2DGAA 3ZR6A 2YDQA 3BLKA 3RIKA 1EH9A 3L2MA 3POCA 3MSDA 1JF5A 4FLRA 3FAWA 1UD5A 4W8BA 4M56A 1PZ3A 2WAGA 3IJ8A 2VZVA 1TE1A 3WDPP 1A3HA 3N1AA 2CEQA 2VZSA 4JFSA 3EMQA 1UKOA 3BAYA 3T08A 1MW0A 2JIEA 4PBGA 4D6DA 1HIZA 3VD7A 1VEMA 3MUY1 2OSWA 1VIWA 2VNCA 4UNIA 2A3HA 4FF5A 4E4PA 3PZUA 3WDJA 1JZ4A 1KR0A 2D23A 3THCA 4UFJA 1XSKA 1E4MM 4M29A 1W3JA 1H11A 4HZ7A 1K9EA 1TR1A 2WBGA 3PZOA 3VDAA 2QF8A 3N17A 3T2OA 2XIBA 2BY2A 1UUQA 1EDQA 2QPUA 1RP9A 2W63A 2EPMX 4QCEA 5A2BA 2BXYA 4UFLA 3WQVA 2GK1A 2WLZA 3WH8A 3W37A 1V6VA 5FIPA 1K9TA 5TD4A 4W7VA 2W92A 1OINA 1JGIA 1Q6FA 3AIBA 1RH9A 4URIA 1QNPA 5CGMA 1JG9A 2WC7A 4ACZA 3CUJA 3WNKA 3HMCA 4C7GA 4R5EA 3SURA 1W91A 1GQKA 2WB5A 1GJWA 3AHTA 2XVLA 3SCPA 5LA0A 2W67A 1CWYA 4PMQA 2OSYA 4W85A 5A2CA 1AMYA 3KL3A 3AFBA 4Y7EA 3BMVA 4PMYA 4PMZA 5GQBA 5ABFB 3M7SA 2ZICA 3RMEA 3L4ZA 8CGTA 5CPQA 1KCLA 3OB8A 1W9DM 3VX1A 3DHPA 2C8NA 3W25A 4M24A 1G1YA 3ZT5A 1VFMA 3AMLA 4H8VA 1R8LA 4XZWA 3CUHA 4PUDA 1CGVA 3K8LA 1BPLB 3GDBA 1GCYA 1E40A 1TCMA 5FKYA 1CTNA 2AOSA 3ARXA 2VTFA 1E0XA 4QLJA 3BAKA 2PWGA 3CMJA 4AWEA 3BCFA 2CHNA 1QOXA 1CGUA 1H41A 2WLYA 3AICA 1WE5A 3GBDA 1E15A 4J3VA 2FDMA 5ABGA 4W8LA 3SUSA 5GPRA 1R86A 5IFPA 1TVNA 3ARWA 1FH8A 1QHZA 1M7XA 1PX8A 1WNOA 4Z2HA 2O9OA 2YLAA 1XYZA 1UKSA 2WSPA 4AMCA 1SFSA 4UCFA 1ESWA 1OBAA 3WF4A 1I1WA 1V0KA 1HKKA 3W38A 4ATWA 1DHKA 2WXDM 1FA2A 4F66A 1C7TA 1VFUA 4AD1A 1ZBCA 4CD7A 2C7FA 3IJ7A 3RM9A 1MXGA 4U2ZA 1F4HA 5DT7A 1JXJA 3OIHA 2D3LA 3UG4A 1UWIA 5ABEA 2BHZA 2WZEA 1BVZA 1SR0A 5IXEA 3NYDA 1JYXA 4Z2KA 4KRUA 2A3BA 5CSUA 3T09A 5A95A 1KXQA 1UA3A 1V0MA 1XH2A 3WY1A 1E1EA 1QHPA 3NSMA 3ZQ9A 4CD8A 2XYLA 2VX4A 5CXPA 3AROA 1HVXA 1K6AA 3VD3A 3UEQA 1R7OA 2DT0A 3AHXA 5JBEA 3OGVA 2X09A 3PTMA 3WL1A 3PZ9A 3SCNA 1XSJA 2BXZA 2WW5A 3IJ9A 5A6BD 4B3KA 1JZ7A 3AQUA 4RL3A 2VCCA 2VZUA 3GNPA 2E9BA 2ZXDA 3VIPA 3L4XA 4RE2A 3VIGA 3MUZ1 2XSBA 2CPUA 3W53A 3EMCA 1BYDA 1OWQA 5GNYA 3ARYA 3WUFA 2HISA 4ML4A 1H3GA 2DT3A 2CBIA 4P8VA 1NOUA 1H2JA 3KZSA 3I3BA 3U7VA 2Y5EA 2X8RA 4OOZA 3ZO9A 1CNVA 1E70M 2V3DA 1NWUA 1TA3B 2WBKA 2YJQA 1CECA 3WEOA 3RDKA 4HOWA 3MMWA 1VJZA 1Z32X 2EPOA 2J74A 3OLEA 3PZQA 2W62A 2FHFA 3OA5A 4ZENA 3ZJ6A 3BCDA 4AZ5A 2VCBA 2GDVA 4N0RA 3BLPX 3F4VA 1J10A 2ZXQA 3BAJA 3EDEA 1KGWA 4CU6A 1MFVA 3WF0A 3ZSSA 1WO2A 2VRJA 1JF6A 3CZEA 4PMRA 1J9YA 3KEHA 1UA7A 4HMEA 4MNJA 4CD4A 2PWFA 3W27A 4JAWA 2CESA 4UFHA 1PX3A 3I3DA 1M04A 1W1TA 1Q6CA 1AVAA 2XGBA 1BF2A 3BAXA 1JXKA 1HX0A 2E8YA 4HPGA 1G01A 2E8ZA 4KWUA 1YQ2A 4UFKA 1BYCA 5E6YA 1J0ZA 5A8MA 1B90A 3VIOA 4C7FA 4OBSA 3BSGA 1M03A 2D0GA 3CPUA 9CGTA 2O92A 3RPMA 4H7VA 2EEXA 1EO5A 1V3HA 1HJVA 2G8ZA 5IHRA 3VIMA 2BNJA 1D2KA 3WQWA 3WH9A 1EA9C 3GNRA 1B0IA 1Q6EA 4GO8A 2CXGA 4JKLA 1YHTA 1QI0A 3AJ7A 4B9YA 3BXWA 4AZGA 5D9PA 3VDCA 4MJ2A 4F9DA 2JE8A 4AZ6A 3AZRA 4MB1A 3AIWA 3EDDA 4J7RA 1UR2A 1EDGA 2DH3A 2ZX9A 1IZJA 1J18A 5BRPA 3VU2A 3EDFA 3S2CA 1C3FA 5A6KA 2ZX8A 3AHYA 4AZBA 2JEQA 1PX4A 4GI6A 3K8MA 4XB3A 4YHGA 3SCVA 5HXMA 5BYWA 3NSNA 2GJRA 3PN8A 3LMYA 3LPOA 1B3XA 3VILA 3W28A 5I77A 1DWGM 4MNLA 4JZ5A 4WJXA 2ZUUA 4P8XA 1E71M 1E73M 5DT5A 3GBEA 1E5JA 3A4WA 1KBKA 2YA1A 1LL4A 2PC8A 3HJEA 1MWOA 2ZUNA 5EMYA 2TAAA 3AI0A 1CXLA 2EPLX 5FOOA 4WKHA 2MANA 1GUVA 4X0NA 1H49A 1X6LA 2WZIA 3U5YA 5A3HA 4D6GA 2Y8KA 3MUIA 2CBUA 1BSIA 1LF1A 5CPSA 1W3KA 2ZX7A 2CHOA 4ZXOA 1GW1A 1XD1A 1KB3A 3WMCA 3DYOA 3VGBA 3WQ5A 4B9ZA 1UKQA 3K4AA 1HP4A 2UY4A 2X05A 1VEOA 3QOKA 2Y8VA 1DWHM 2DIJA 3NDYA 3OGRA 1NWTA 2G41A 4UOJA 4CCDA 5A8NA 4AY1A 3CIVA 1E9LA 4JL1A 3AIVA 1KBBA 5KZ6A 3GH4A 4JHZA 3SCWA 4P7RA 1W2VA 3FXYA 4XX6A 5GNZA 2Y2WA 1V3LA 4GQQA 4MTVA 5D8WA 4HA4A 4MPKA 5D9NA 1BTCA 1GHSA 4H8UA 4DWSA 1QHOA 2WCSA 3AMGA 1HN1A 3TA9A 4PMXA 4HA3A 4Q22A 3POHA 1JYNA 4Q7NA 4WLCA 1ISVA 3AIQA 2CKRA 1C8XA 2UY3A 2D22A 4HU0A 2QPSA 3VD4A 3IAPA 1C93A 1R7AA 3PZVA 3VGEA 4UQ9A 4D6CA 1XYFA 2FHBA 4MAVA 3MUAA 2WMIA 2F2HA 4HZ6A 1E56A 3K46A 3LPFA 1QI3A 3KL5A 4PMDA 3N11A 2ESCA 3MSGA 1HJXA 4GIAA 3DYPA 4J3UA 3WD1A 5HDRA 2DQXA 3EYPA 3AISA 2YL5A 4W86A 3HU7A 5I23A 1BYAA 2F8QA 5FL0A 4JFUA 1H09A 4UQAA 2G3IA 2BS9A 1QVBA 5C8BB 3I3EA 4HMDA 2D2OA 4OIFA 1EOMA 4EAMA 1ODZA 2DSUA 4AD5A 2XUCA 2VX5A 4AZIA 1FP9A 3VUPA 3RJYA 2VCAA 4QFUA 2E3ZA 1E4IA 4D1JA 1GHRA 3W29A 3VGHA 2JIWA 3UG3A 2CERA 1E0VA 4QLLA 4PMOA 2W4XA 1DWIM 3OZOA 1HJWA 4W84A 1OD8A 1UR4A 2GJXA 1HJQA 3EDJA 3U57A 3KE0A 2PWHA 2Z1KA 1G94A 1W1VA 1MYRA 3ZR5A 3WD3A 2NT1A 1KXVA 4MNMA 2YL9A 5A6MA 1M01A 3UG5A 4FLSA 3K4DA 3WUEA 1ZBVA 6CGTA 3DHUA 5KEZA 5LYRA 4TUFA 2WCGA 1KWGA 2D3NA 4PTMA 4D1IA 4D6FA 1FP8A 3IK2A 1NOWA 1EGZA 3WH5A 5AYBA 1NP2A 5I24A 3S6TA 4U3AA 2V3GA 5HOSA 2AMGA 1UH3A 2PB1A 2Y24A 3CH9A 1E3ZA 1HP5A 3APGA 5HNNA 3WFLA 2PBGA 4AZCA 1LWJA 1W1YA 1J0HA 3BGAA 1ISWA 2WVVB 5LA1A 1V3IA 3CHCA 3CBWA 4P8WA 3WELA 1QBBA 2ZUMA 3T0DA 5M03A 2VUYA 1IV8A 2V5CA 5E70A 1C7SA 2XTKA 4GQRA 3NSXA 1TVPA 3AIRA 3VMNA 1J0YA 5FD0A 1V03A 4PUEA 2PF0A 5A8PA 3FHAA 5EB8A 4NZCA 3SCOA 2YDRA 5EFDA 2X0YA 3GXIA 1J11A 3RCNA 3U7BA 2J7BA 2O9RA 2W66A 4HU8A 4LYPA 5A6SA 2BVTA 2PWEA 4LPCA 1E3XA 2W61A 3FW6A 5E0CA 5M3WA 4H41A 1Q4NX 3VGFA 1AQMA 4AD2A 2VI0A 1NP0A 3WF2A 3NIYA 4ATDA 2ZIDA 2EPNA 1JNDA 4MB5A 1PPIA 1WB0A 3WNMA 1B1YA 4ATLA 3WFZA 4W89A 2GFTA 2BHUA 2VZTA 1CBGA 1KQZA 1QNOA 2VRKA 4CN4A 1HVQA 4CKQA 2VURA 4MB3A 3CHFA 1UYQA 3W24A 1CZ1A 4DM1A 2WMFA 2XPKA 2IXVA 3VO0A 4MAZA 1SYTA 4L4OA 1UD8A 1CGXA 5AYIA 1W9XA 3F5JA 3A3HA 1CYGA 3CGTA 7A3HA 1QNRA 3W6LA 1WZKA 4BQ3A 2BV9A 1MW3A 3AMDA 4E8DA 4PSPA 2DSVA 4IM4A 5M5DA 2BVDA 3AMCA 1D7FA 1UQYA 3JUGA 4BZYA 3WUBA 4FLQA 4BQ5A 1E4LA 2VMFA 4DUXA 3AS1A 2VQUA
chains in the Genus database with same CATH superfamily
3RRAA 1K6WA 5CAKA 1IEVA 5BXPA 1VBRA 2ADAA 3Q2DA 1R3TA 4GIEA 3TN4A 1UQZA 2HV5A 4HOZA 3CZLA 1W1ZA 2FYMA 2QCCA 3UXIA 4GNJA 3O07A 5TQLA 3CQKA 2WHMA 4LAKA 2J4GA 2FJKA 4O1CA 1B3ZA 2FGZA 1KLYA 1W9BM 1OFPA 3W88A 1VS1A 3B0XA 2J7FA 2F38A 4QTGA 1VEPA 2VQTA 5JBDA 2J7HA 2YSWA 4JYEA 4NSBA 2I14A 2NQLA 4A3YA 2O9PA 4UCGA 3FEMA 4EPDC 3NAVA 2V2DA 4KWSA 4IPPA 3W6YA 1E51A 2REQB 1BG4A 4FX6M 3QV8A 4X3ZA 1SMAA 4BQ4A 4O15A 1ZS2A 1WZLA 3VKKA 4BQ2A 3H2NA 4XZMX 1T8QA 4AIEA 1PTGA 1RK6A 3SJ3A 3GW0A 2V63A 4BA0A 2A3CA 1IE7C 3SFKA 5LNUA 4L9ZA 3VC6A 1CT5A 3PNZA 1RPKA 1WKFA 2EHHA 2C1HA 4GGBA 3AMKA 4R53A 3A47A 1E6PA 1B30A 1XSIA 3ARSA 3ES7A 4E38A 1W3HA 3VZXA 2Q8XA 1SO4A 3M46A 4B92A 4L6DA 2VC9A 3UZXA 5DMLA 1V02A 2HRWA 4J3ZA 2HDJA 5EPDA 3WDHA 3HGJA 4WSJA 4GCXA 3WLRA 5BROA 1NIUA 1SZFA 4A3UA 1TO3A 4XIAA 1FWCC 1TWDA 3NZGA 1UWTA 1E6RA 3INPA 4S3FA 2L5HA 3W7RA 1MEIA 1DWJM 4B3LA 4YCOA 1EEXA 2Z24A 1FHDA 3N29A 1LM1A 3II1A 2FPTA 1SPQA 4W7WA 1GVEA 4N02A 2OSXA 3IK4A 2V0TA 1QW7A 2QGHA 1BWLA 3S6DA 4I7UA 4AAJA 4AY7A 4G7EA 2WJZA 1EL3A 3VCNA 1UW9A 1VRDA 3O63A 4C6OA 4NILA 3E2QA 3HIJA 4JHOA 5LZLA 3H6OA 3CL8A 2Z28A 4G6CA 3REQB 5A6BA 3DC0A 5M1TA 3M43A 1DV7A 3TQKA 4YXGA 3U0HA 1SJAA 2BOEX 1OHLA 4KIRA 4PCSA 1CDGA 4QAWA 2PGFA 3DFOA 3CMFA 3W7KA 5AC6A 3H12A 3GD6A 1UD4A 1A0EA 2ZUVA 2AGTA 3IVSA 2G37A 4GINA 4B90A 1M53A 2DY3A 1GG0A 1CGWA 2D20A 2JBMA 1V02E 2BBFA 1DXEA 3ATYA 3VNZA 4WK9A 1JDFA 3G24A 3CZGA 4KEMA 3UJEA 5JUVA 1KXTA 1UROA 3GR7A 3QFEA 4QQUA 1B9ZA 5BRQA 2I7GA 1JPMA 4Q8NA 5DF0A 1LLZA 3EKLA 1RY0A 2DORA 4B5SA 1X97A 3SRKA 1MUCA 3O2LA 4YS1A 1MZHA 2XWDA 2Y1HA 4LB4A 3SQMA 3WNPA 4UTJA 4J27A 3ZZ1A 3N4EA 3FKRA 1HT6A 2ZZ1A 3PG9A 3ARTA 1TG7A 4W4QA 4CN1A 4O19A 1V6YA 1VF8A 3ONCA 2A3AA 4JFTA 3EGJA 1EJWC 3GHSA 4GVFA 4POCA 1QPQA 2C71A 4JL2A 3AXXA 5A1AA 2YA0A 4H9XA 4NASA 2QEZA 1X7FA 3WIJA 3W26A 1ODUA 4UFIA 3EEZA 3SEPA 3G77A 4Y90A 3KOZA 1B5TA 2PDCA 1XLKA 1M9HA 3EPNA 4GACA 3UD6A 2PRHA 1HW6A 1LOLA 3PULA 5I2UA 3WF1A 3HV8A 3GU9A 3W7EA 2PAJA 3ZT6A 3GAKA 3PFMA 7REQA 2XH4A 4E2VA 1Y8BA 1UR9A 3MVIA 4E3VA 4ORIA 1YDVA 3E5PA 3V5CA 4XZHA 4EANA 3MV11 1QPNA 1RLDA 2NX3A 5GJNA 2DSWA 3E5BA 1B2YA 1CEOA 2YXOA 3A5FA 4ZEPA 3HG2A 1EC9A 1I45A 3W1NA 1WZAA 1PBGA 3SW6A 3VDGA 2DPEA 3PZTA 4YMZA 5E5CA 1UZ1A 4J3SA 5ECUA 4IFRA 5ABTA 3MJMA 4REQA 1OB0A 2VX6A 4RV8A 4GNKB 1FRBA 1VFOA 3DFTA 4D6HA 1X1ZA 1PCKA 3URAA 3FY1A 4C1NA 3MI2A 1IWBA 3CL6A 4YTTA 1J4EA 1K8ZA 3W84A 3ZSTA 4PUJA 1XYBA 3UR5A 2XVKA 4MF4A 2J13A 3ITCA 4KQNA 4XBJA 2PDPA 4ERGA 4HD5A 3NL2A 3M5XA 1CGYA 1W3TA 2CBJA 4NI3A 3HOJA 3CQ0A 3GUWA 2PSNA 4AWSA 1FKXA 4W93A 4J3TA 4R34A 2NSXA 2QCNA 4XKMA 4KCVA 1UOKA 5EGRA 4O0QA 2CLPA 3DFYA 5HQMA 1J0IA 1QR7A 3F2CA 2X1RA 3CO8A 2OQLA 1E5NA 1E72M 2J66A 4OBTA 4OOUA 4HYRA 3S1GA 2NVCA 3ELFA 4WDWA 1XRVA 3APYA 1H1ZA 1GPFA 1VCVA 1GOQA 5BRBA 1LTDA 1O5RA 3EX2A 5GVJA 3ARZA 3M5ZA 6ALDA 1XHGA 2R1LA 3DAQA 3H54A 1U5VA 2PLKA 1FBAA 4Q8VA 4NT0A 3CAQA 1EO7A 3UT0A 3PJTA 4HNOA 3DXIA 2PDFA 4AISA 1KGXA 4UR9A 3PUDA 3NPUA 3S1UA 3VABA 4UQBA 1B3OA 3LRMA 3CTTA 1IEXA 2R94A 3USZA 4JD4A 2ZRYA 1BXBA 1ISYA 2Z2AA 2B7OA 1TV8A 1GTHA 3V16A 3VKDA 1AA1B 5FESA 1XYMA 4L1XA 1RUSA 3CM4A 1Q85A 3DGRA 4Q8MA 2DP3A 2IS7A 4LYRA 4FIRA 4JDBA 1F4AA 1XIEA 1UP3A 2Y61A 4JFWA 3F4CA 4O1BA 3ID7A 3A3WA 4JIEA 2NSOA 3SI9A 3GHTA 2QCHA 1TTQA 2WKLA 5HK4A 4JFVA 4WEVX 3VIKA 4AF0A 2G4FA 4PZVA 3UJ2A 3P7YA 1E6ZA 5C2GA 1A53A 3CTLA 2A5HA 1EZWA 2F6KA 3ANYA 2OXNA 1OEPA 3FJLA 4WDTA 1ONEA 4A4AA 2RGMA 3FYOA 1JD7A 3T6CA 4LV4A 4DJDC 1F07A 4LNCA 3B9OA 4V27A 1O4UA 1JI2A 4ZA0A 2AQVA 4W87A 3NPXA 1VYPX 3B8SA 4OUIA 1FHUA 1KCXA 4JKMA 4E8CA 3W2LA 3UCQA 2I16A 4CEXC 3CQJA 1EKOA 2FMOA 4IIFA 2DW7A 3SUVA 5D9MA 3OLIA 4YTSA 1XRSA 4F48A 3SIZA 2F6XA 4PBFA 3T0AA 3AIUA 3TOYA 3QTPA 4LVGA 5CSSA 1A5AA 5CZKA 5C5YA 4AEEA 2NUXA 2H6RA 3FK4A 3WL0A 1GJPA 1QNQA 1KW1A 2W9MA 4FHAA 5HR6A 2PDHA 4FF7A 1R3VA 4FSAA 3RPDA 1JCJA 4UTMA 3S5YA 1ZJAA 1IIGA 5HWJA 3M4HA 1GWJA 1JQXA 3AHVA 4AZHA 3W00A 2X7WA 4V1XA 2OYKA 3RLGA 5I78A 2Y7FA 3TONA 1RD6A 1G7UA 2IXUA 4MYXA 4KFNA 1K8XA 1VFLA 4AUBA 4ZQNA 5MKGB 4E5TA 4DBUA 2WANA 4QIUA 1C9WA 2VM8A 3KBJA 2QVNA 3CK5A 1JNEA 3T55A 3DIPA 3RITA 2EJ1A 3SUUA 4HNVA 3V75A 5FAJA 2OODA 2PTWA 3GYCA 3GTNA 3H70A 2YR1A 4RV3A 5CC6A 1K3UA 3L2LA 3IGHX 1TZ7A 1GOMA 4LRTA 4L1WA 3RM4A 1Z6KA 4YTRA 4S23A 4O18A 1PL9A 3LZ5A 4HVXA 4U3CA 4U33A 5AHIA 1XH1A 4DB7A 3RU8X 1VPXA 5IRPA 3TWBA 4AD0A 5A8OA 2OKOA 2ZUSA 4TX9A 2G3NA 3CHEA 1OC6A 2YIHA 1A5MC 1XXXA 4ENLA 1U30A 4OBRA 4UTTC 2QDEA 1V6XA 4TXEA 2VFGA 2REQA 1XDJA 1H61A 3ABOA 4PSRA 5BXRA 4C6MA 4A8LA 3DENA 3LCLA 4PMVA 4K68A 1W0MA 3MC5A 3BMXA 3THDA 1ONWA 3V18A 1TMHA 1IWPA 4GUFA 1DJGA 1A5UA 1MMFA 3MWAA 3COTA 3MU7A 1DP0A 1H0IA 3G0SA 3GDRA 1R3QA 3GQYA 4D6IA 1MSSA 4NAFB 3ABQA 4H00A 2BVWA 1QUMA 4C6IA 4UUIA 5KTLA 3ARQA 3DI1A 4KRTA 2ZWYA 4RPQA 4DWSB 4PB5A 1XIHA 3HB9A 4V2XA 3OG3A 3UPBA 5SWUA 2D2GA 4ZO9A 4WVXA 4W5ZA 3M0VA 4H7ZA 1JCXA 4JS3A 1TIMA 5DEZA 1V6TA 2I9EA 3NQCA 3OZMA 1XBYA 3GUGA 2VVSA 2BOFX 1K70A 4L61A 4GY1A 2PDBA 2W27A 5A6TC 2FH8A 3UWZA 3FN9A 1LRTA 2DV0A 4NRRA 4O1EA 3AYRA 1DJWA 4MDPA 1O5KA 1FWNA 2XGIA 2GQ8A 2XG9A 1V5XA 2Z1XA 3BAWA 4NG3A 3NQ7A 1GORA 2D24A 4LOCA 3EPOA 4HK5A 3O0KA 2QJGA 3UR2A 3WQFA 3SRFA 4JNZA 3VNIA 2Z00A 4XVDA 1M3UA 1NTHA 3REQA 1JI1A 3P2VA 1K03A 1WAWA 4CVUA 2KAUC 2FQIA 1H51A 3M5YA 5CGTA 3QHMA 2FB3A 2NT0A 3G6MA 1UR8A 1PWMA 1EF3A 2Q3RA 1RVKA 3S47A 4I5RA 2QF7A 1V51A 2XVNA 3ZMRA 1AH3A 1RXOB 3S2MA 3LHYA 3UESA 1TPC1 1KV8A 4B2DA 1ZB5A 4NI8A 1ITUA 1FH7A 4RXFA 1C8QA 3OGSA 3HQ1A 1VFTA 1D8CA 1OCQA 5T91A 3W7IA 2GQ3A 5BCAA 4O16A 1VBGA 4HA0A 4DUVA 5IM51 1W32A 4CCCA 4AX6A 1KM2A 4MB4A 1FWHC 1XC6A 4C6BA 4PC8A 3W6MA 2WWCA 1XWYA 5DMNA 1OK4A 4TMCA 3MCOA 4N9EA 4AZCB 3M1ZA 3WKZA 4RNHA 2GDUA 5EA9A 4HCHA 1ZU8A 2QS8A 3F7JA 3VM5A 3UG8A 5C70A 3OODA 5EMUA 4RX0A 2HVMA 2HPIA 4GQ0A 5H8PA 3W3OA 1UKPA 3MKCA 1M7PA 3CB3A 3MMUA 2DZAA 3W7NA 4ZE5A 4US5D 2E9LA 5DLCA 3ZIZA 5JIWA 3HURA 3DDMA 3ZR6A 5LKYA 3BLKA 4X61A 2ACSA 3TV8A 4IJRA 2XIJA 1GQNA 3L2MA 3LGGA 2ISVA 3MSDA 4W8BA 1TZ9A 3CV7A 2DZTA 3ZLFA 4JX6A 3AUOA 2VZVA 3AYVA 9XIAA 2DZPA 3FLUA 4I8DA 2VZSA 2C15A 4HN4A 1FDJA 4F0MA 1MW0A 1N8FA 1J5SA 3BV4A 3WQEA 1HIZA 1VEMA 2WSYA 4YL2A 4IMDA 3P0WA 1UP0A 1HTIA 4QE1A 1V7AA 2QYGA 4Z1YA 4IIDA 4TU1A 3M0IA 1Z8AA 3I4KA 1FVPA 1K9EA 1RVGA 4JQ4A 3K1GA 3N17A 1N2VA 4HHHA 2BY2A 4A2SA 2GZXA 1JEZA 1X8FA 3BLLA 1EDQA 1RP9A 4QCEA 4O28A 5TD4A 1TSIA 2PUZA 1Q6FA 3W02A 2KX9A 3STFA 1RH9A 1BWKA 2BB0A 3HM7A 3B40A 1JG9A 2WC7A 2GLKA 4HHMA 4XIMA 3U4AA 4C7GA 4R5EA 3G1XA 3LTSA 2I9UA 2C1GA 2XVLA 2P76A 3TC7A 1US0A 4PMYA 1SZRA 4Q4MA 2QT3A 3M7SA 2ABBA 1XUUA 3VFCA 8CGTA 2BXVA 2YFOA 3ZT5A 4RDVA 4MGGA 3NWRA 2VP8A 3QJAA 2X40A 4PUDA 3A22A 1CGVA 3K8LA 1BPLB 4EVZA 3NQDA 1GCYA 1TPFA 3WYZA 3RK8A 3T78A 1GZ1A 4PH6A 1I8JA 3BAKA 2PWGA 3CMJA 3OHIA 3CT7A 4QS6A 4GCAA 3BCFA 4Z42C 4QE5A 1TPH1 4M7SA 4KFOA 2XIMA 3HQOA 2QXWA 3UYIA 1S5VA 1H41A 3D0CA 2WLYA 3AICA 3GBDA 2WOQA 3LRKA 2ISFA 2DZSA 4J3VA 1M65A 4PTDA 4BY3A 5GPRA 1TVNA 1PYMA 4HK7A 1HL2A 4TV6A 3CV2A 1UKSA 4UCFA 3UWUA 2RDTA 3WF4A 3RFAA 2WXDM 3IGSA 5FJUA 2PD5A 3LCHA 4AD1A 4UMAA 2HXUA 4CD7A 3RM9A 1MXGA 5CAHA 4U2ZA 3PANA 4QG6A 1F4HA 5DT7A 4DO6A 1LOQA 5J5DA 1UWIA 1S3TC 2WZEA 1BVZA 1P4CA 4Z2KA 3CQHA 2G50A 1DIEA 1PZ0A 4MZ1A 4TO8A 3WY1A 1E1EA 2VDGA 4CD8A 3G1VA 3C86A 5CXPA 1O95A 2WQPA 4AMAA 2DT0A 4YWSA 4B91A 3PTMA 3WL1A 5LIWX 3PZ9A 5A6BD 1XSJA 3IJ9A 3UCDA 2VCCA 1KD0A 3RPTA 3KBVA 2E9BA 5K4ZA 5AYZA 5G2HA 4DVOA 1TYGA 3EXRA 5IBXC 2XSBA 3MUZ1 2CPUA 3EMCA 1BYDA 3I65A 3ARYA 3WUFA 1XBZA 4ZOAA 3THUA 3G0UA 2CBIA 3KS6A 1NOUA 4P8VA 1H2JA 3KZSA 4MVAA 5G4EA 4OOZA 3ZO9A 1CNVA 3GG8A 3M0XA 1DORA 1E70M 2YJQA 3ITLA 2AGKA 1CECA 3RDKA 5G2WA 3MMWA 3H55A 1PKMA 3OPSA 3VNKA 3OLEA 3PZQA 2VKZG 4Q3MA 3E3HA 2FHFA 4ZENA 3GAYA 2VCBA 2GDVA 2BSLA 1J10A 2GJLA 3BQ6A 1N8WA 4WSHA 3G8EA 3N14A 3EDEA 5CGQA 3H53A 2GWGA 3OYXA 3MYOA 1JF6A 1VYRA 1UA7A 4MNJA 2PWFA 3UU0A 8XIAA 2X1SA 3L5MA 1F73A 2R8WA 1Q6CA 3WLOA 1VCFA 2E8YA 3DZ1A 2E8ZA 4P61A 2Z26A 1QK2A 1KKOA 4R33A 2D0GA 1AG1O 5CPLA 1HJVA 2VFIA 4ZB2A 1D2KA 3WQWA 4J2MA 3WH9A 4R3UA 3HMJG 3CC1A 4QNEA 3C2EA 4K37A 3TLQA 2CXGA 5FF2A 1ZAJA 1PKLA 1KFLA 2G5WA 4YWIA 1XLIA 1XDMA 3G2GA 2PRMA 5MKGA 1UBSA 1UR2A 4J5NA 1IZCA 1IZJA 2ICSA 1H7XA 3S2CA 2O7SA 3R4IA 1A3WA 3LG3A 3TYCA 3AHYA 1L6FA 2JEQA 1PX4A 4D8LA 4YHGA 1TPUA 1XX1A 3N19B 2ZDSA 3VILA 4F2UA 1VHCA 2XU2A 2ODOA 3TFCA 1B9BA 5DT5A 4GYPA 4YIWA 2VGIA 4WZHA 2PC8A 3HBLA 2ZUNA 5EMYA 4JQAA 3AI0A 4IMAA 3MYPA 2G96A 2C16A 3RNDA 3OIXA 3W7OA 2YCIX 2WZIA 2Y8KA 1HO4A 1KTCA 3FJNA 3NQ2A 2BG5A 1LF1A 1RLCL 1W3KA 4O54A 3WMCA 3VGBA 4KCWA 4GBUA 4LF2A 4IJCA 2Z7GA 1JUKA 3DG7A 3JR2A 1HP4A 2UY4A 1OZQA 1GVOA 3RXZA 2F9RA 4UOJA 3BSMA 2PDWA 3AWNA 5G1YA 1E9LA 1SJDA 4GWEA 2ACQA 5LGXA 5KZ6A 4NX5A 1HKWA 3ABZA 4NAFA 2P50A 4GK8A 3WLMA 2QIIA 4NZ1A 3P5ZA 1NF7A 4GYJA 5GNZA 2NWSA 1A5OC 1OX4B 4MTVA 1N55A 1BTCA 1NJJA 1GHSA 3BLEA 4DWSA 1QHOA 3AMGA 3IACA 3TA9A 1YNYA 4PMXA 3LUTA 4XBKA 5CZSA 1YE4A 3LGEA 5HMFA 3T40A 2HNHA 5J5RA 3VD4A 3IAPA 3DG6A 5KZEA 1MNSA 4D6CA 1PZ1A 5F1UA 3MUAA 2IQDA 3KL5A 4PMDA 3N11A 5D38A 2XINA 2OZ0A 4J3UA 3WD1A 3B04A 2V2CA 4BF5A 2YL5A 4PTNA 2F8QA 4PEKA 1H09A 1UP2A 2G3IA 2BS9A 3I3EA 4HMDA 2OLSA 2D2OA 3H2FA 3SN0A 1R5YA 5K9DA 4DWDA 3W2UA 2DSUA 2Q3OA 2QV5A 1XISA 3Q58A 2VCAA 1EX5A 3KRSA 3KX6A 3QFWA 3RLUA 1ZALA 3NVDA 1E4IA 3B4UA 2A0NA 3VGHA 2HCVA 2O56A 4GQGA 2CERA 4PMOA 2W4XA 3OZOA 1UR4A 1PTAA 3U57A 1YE6A 1VD6A 3U2ZA 4YVXA 1PO9A 1F8IA 3E0VA 7PTDA 3P8IA 5EMKA 5D2XA 4GVIA 1KXVA 3I7RA 5A6MA 2XN2A 2J8TA 1Q66A 4BJHA 1LZOA 5I00A 3NM3A 1F2JA 3DHUA 3KVMA 2WCGA 3SSJA 1KWGA 4C5YA 4D1IA 5B7YA 4GUGA 3WLIA 3N2MA 3EEGA 4H9ZA 1A5NC 1TWZA 3NDOA 2AMGA 5HNUA 2PB1A 4AZCA 1LWJA 1VR6A 1S1RA 1V3IA 3TJIA 4MKNA 3WELA 3KHJA 2ZUMA 4QSFA 5K3VA 2VUYA 1IV8A 2V5CA 3VNMA 3DG3A 3W22A 2XTKA 4GQRA 3EAUA 1OFRA 1V03A 1JCNA 3B8TA 3FHAA 4LNYA 2A85A 3G3MA 1KKRA 3U7BA 3H22A 2J7BA 2O9RA 4MSSA 3E9AA 5LIUX 4LYPA 4J40A 2PEVA 2WKJA 2Z25A 2CLMA 5HWMA 2ZZ6A 5U7SA 1OFEA 5E0CA 3EB2A 3FEQA 1PKNA 1YPXA 1AQMA 1M7OA 3MCNA 4AD2A 1TQXA 3GY1A 2EPNA 3M6YA 4MB5A 1PPIA 1WB0A 4F0KA 1B1YA 1CB7B 3HGOA 3GDMA 2F84A 3WFZA 4W89A 1KQZA 4CN4A 2QDDA 3ABSA 1HVQA 4CKQA 4MB3A 3LQGA 2FZNA 3NXLA 3GKFA 1TQJA 1QMLA 2GVLA 3P8JA 1Q7MA 1SYTA 1ME9A 1UD8A 2AKMA 4O0KA 1W9XA 4JOMA 3KRZA 3G1DA 1CYGA 2W6RA 3W6LA 1XYAA 1SFTA 4E8DA 5K2ZA 4L6OA 3T7VA 3PAOA 4GA8A 1EWEA 3EWUA 4W9TA 4BZYA 2Z29A 5TF0A 1EEPA 4ERIA 3B3DA 5AZ0A 1W1IE 1XLEA 3OHMB 1RJPA 5DCDA 3R79A 1US3A 4D72A 2PDXA 4HK6A 1WDDA 4QGCA 3U48A 1E43A 4L4PA 1VFFA 2QPXA 4AG0A 1RJRA 4UWMA 1CPUA 4R9XA 1DYSA 2H8ZA 1QI2A 3CV1A 1O66A 4OFCA 3W23A 3OYZA 3W70A 3K1DA 3KTXA 2HJPA 1J01A 1TX2A 4JCMA 1TREA 4BWLA 1YNQA 4PTXA 1CXIA 2VEGA 1NEYA 1UB3A 3VKCA 1HF6A 3B9DA 4Z1DA 1EIXA 1TV4A 4RXGA 3OVPA 2QUVA 3DGBA 2I5QA 4GZIA 4IGSA 3GXFA 2FZ9A 3HG5A 4B5XA 3EB4A 2YL6A 4JN6A 3KCJA 4C6QA 1B54A 6REQB 2J78A 2FZDA 5C54A 3TOPA 2D0FA 4JY9A 3EPMA 4G1KA 4LYQA 1R87A 4OZOA 5F4SA 2HVOA 5E0KA 1XL9A 1YXCA 2EO7A 3LPGA 3PHAA 5I0DA 2DZBA 5FL1A 1JAEA 4NJIA 1LWIA 3BWWA 3E02A 4C6FA 4IZGA 3W7QA 3XISA 4DIAA 2QR6A 3S1WA 3AS0A 2PDLA 2CLIA 4RR4A 1SR9A 6TAAA 3GHUA 3UZYA 4AYSA 4MY8A 3HGRA 3KOWA 3VPLA 3WUGA 1KRMA 4GKLA 9XIMA 3NQ6A 2E67A 4BEUA 1I75A 5FF3A 4M19A 4G9PA 2EXOA 4QRNA 4ZO6A 4ZMGA 3KL0A 4RDWA 3TU9A 1FWRA 1GVQA 3D3AA 3CAWA 4M3PA 4B3ZA 1L8PA 2YCLB 5IOBA 4GVHA 1ZRQA 4O1DA 1A0DA 2J7DA 3O05A 4B5NA 3FJ6A 4MADA 2NQ5A 4AW7A 1I2OA 3FV9A 4HHPA 1XP3A 3NA8A 4Q8TA 1UMYA 4H3DA 1G5AA 2BGNE 4A3HA 1WDQA 3STCA 3SZ8A 4ADTA 4DYKA 1JFXA 2Z7KA 1U1UA 1Z41A 4PL1A 5C6MA 2J7GA 3E2RA 5CG7A 4B2DD 1W1A1 2OZTA 1TMQA 3OG2A 3VAVA 4A21A 5E09A 3FAXA 3GTFA 3PPHA 4LCQA 4HYVA 5DFAA 1Y7VA 1XR2A 4M51A 3AALA 3BGGA 3UJSA 4S38A 2V8ZA 3UQNA 2WMJA 3ES8A 1X6UA 1W1PA 3HPSA 3UFYA 2DEPA 4H6KA 3OVRA 1KTNA 2XVGA 4GXWA 5CH9A 4YPJA 5D9OA 3P80A 4P7NA 4PCTA 3KLLA 3H24A 3UXAA 1M1BA 1PHQA 1FOBA 3FCPA 5JBFA 4DI8A 1YTKA 3E6EA 2DVUA 2I1OA 2H3DA 2WVTA 3GHRA 4HNUA 2V3EA 1EYEA 3PBMA 1F6PA 4F2TA 1Q6RA 1G6CA 2OWWA 3PVFA 1XCWA 3PPCA 5CQ1A 4IWWA 3EX6A 5AHFA 1QW9A 1H1NA 2G4JA 1G4PA 3WQ6A 1GOXA 3GRIA 3UGVA 2VFFA 3QSRA 1OFOA 5LNRA 1AD4A 2PDUA 4ALDA 1RP8A 2CBVA 3RUBL 1PEZA 4XV0A 3OP2A 3GIPA 2PDKA 3CUGA 4HOXA 1AJ2A 2NLYA 5ABHA 1YRRA 1BLIA 2R6OA 4D6EA 3F1QA 5AC4A 1XH0A 3N6QA 4HMCA 3IARA 1A5BA 1MDRA 3BJTA 1ZBKA 3P6LA 3SCSA 4WGXA 4LX4A 1U2YA 4N9CA 1EOKA 1S5NA 5BOOA 3QMSA 1YNPA 4CD6A 3VD5A 5AHNA 1UHVA 3PUOA 3DECA 4NJJA 3WQGA 5HPOA 2HNEA 1PIFA 3V36A 4IQJA 1XINA 4IPNB 3BG3A 2PE4A 1NU5A 3I7QA 3KUMA 2VD8A 5FJJA 1KGUA 1Z48A 3ME3A 4Y9AA 5I3GA 3SN1A 1QNVA 2QUTA 3LOTA 1T7LA 1W17A 3N2XA 1EBGA 4GLEA 1IXOA 1KCZA 3WBAA 2YCJA 3TAKA 1B4KA 1QNSA 4HZMA 1B3WA 3FA4A 4KS0A 3UXDA 1V0NA 3TC3A 2X0HA 4DUWA 3KRUA 3WK2A 3VK5A 3NQGA 2HWGA 3KTSA 3QHOA 1E1CB 1UZ4A 1IZKA 3GW3A 1GOWA 3SO7A 3G1FA 1PCWA 5A6JA 2CNCA 3RLHA 1E6QM 4QDMA 1OQFA 4O52A 4DF0A 1X98A 4CQDA 4AHQA 4B5WA 1SFJA 2V68A 4R9OA 3Q94A 3PY2A 2NW0A 1OX4A 2PDQA 2PFHA 3H21A 4UR7A 1H7NA 2ZYFA 4ACZB 1UKTA 3UW6A 1NWRA 3KLKA 1MXDA 1LT8A 5CPOA 3QZ6A 2IPJA 7CGTA 4E2OA 2DVTA 3MJYA 4UOZA 1JDDA 1CXEA 1E4NA 4BCEA 3AWOA 3V1PA 5A5WA 3UNTA 3QGAC 3ARVA 4ICCX 1GVIA 3QKEA 5GNXA 5I3KA 1J5TA 3LLFA 3N13A 2OR2A 4L4LA 4JGDA 1FXPA 3SQSA 1ICQA 3CUIA 4WJEA 4M1RA 1RV8A 4GIYA 1NWSA 1BTMA 1UIOA 1UWRA 3TYUA 3TSBA 1ECEA 3GVQA 1XCFA 2VWSA 2JKEA 1UZHA 2ZC1A 4PMNA 4GJJA 4HQVA 3VNJA 5LA2A 1KFJA 3MDWA 3OZPA 1BGAA 2J9YA 4E6MA 3E1F1 4BKNA 1UWQA 4KEZA 1JRBA 1THFD 4UOQA 1CXFA 5MHBA 4OJYA 2V5BA 4S3JA 3EWBX 3QYQA 3O6DA 1RJQA 2FZ8A 3S9IA 4LEQA 5EFFA 1VENA 1UR0A 3LHVA 5D32A 3W2MA 2YBTA 3Q65A 4PMJA 1XLAA 2NQHA 3FKKA 4JYDA 5BWFA 2RJHA 1Q6DA 4K8GA 3RR1A 4MJMA 4XWUA 5LHFA 1WYIA 3AO0A 4WXZA 4O17A 3FHQA 3RJXA 4XK2A 3O06A 4W7UA 4DZAA 4OT7A 4C5ZA 1W8SA 3WBEA 3UZ5A 3BW2A 3QBUA 1S5TA 1ZAIA 3DN5A 2QAPA 4XTIA 4LC8A 2J47A 1EPVA 4O8AA 1VAHA 4IL2A 2YL8A 4AFYA 4TX6A 3TYBA 3IWPA 1QTWA 4DZ5A 1IT8A 3E38A 3W1TA 3L4WA 3C3UA 3CZKA 3AC0A 4KMQA 3JVAA 2WK2A 1G7VA 2WZHA 4JIPA 2VOTA 1JR1A 2CKSA 2E6FA 5EYWA 2AAAA 2E40A 4LY4A 2NQ9A 4L56A 4F2BA 3TNOA 3QXBA 1K7FA 4M80A 4U5IA 2V30A 3VYLA 3TTQA 2OKTA 3TTOA 3G0XA 4CN6A 4M82A 3AYSA 1X38A 1IEQA 2XISA 4ILSA 4MNKA 4W5UA 4J3WA 4CU7A 2DZXA 3UETA 3QHNA 4C1LA 3G6LA 1POJA 4NL1A 3PB0A 2W91A 1VBJA 4FMVA 3MKKA 3G8RA 1GQLA 2GUYA 3QGVA 1G4SA 1NQ6A 3MDUA 4NXSA 1A4LA 1A5CA 5HUOA 3H7UA 4PRWA 3N4FA 1GVRA 4Z2JA 4P7OA 5DBTA 2ZKMX 2VEFA 3MZ2A 3NQFA 5FI8A 4GI8A 1XRTA 3N2TA 2CLEA 3PTKA 2OU4A 2HS8A 4DZHA 4MLJA 2V6AA 2RDXA 3A64A 1K8YA 4FX8A 2HK1A 2VR5A 3HN3A 4NIRA 1IGSA 3TFXA 5CLTA 4AB4A 2GVEA 3ABXA 3GVRA 4V15A 3JZEA 3R43A 2DSZA 4ZCWA 3S9ZA 1HKJA 3BJFA 3D6NA 5JH2A 4I6VA 3PTDA 1H0GA 1FWWA 3PFRA 2ZRWA 1W5OA 4JY8A 1J0JA 1UUOA 1C92A 3CS2A 3EXTA 1I0BA 3RILA 5M2FX 2C0HA 3MP5A 2J8FA 1EGMA 1AQHA 1POKA 4CU8A 1W56A 3L4TA 1J93A 1Q65A 1YMYA 1HJUA 2GSJA 4NRSA 4N6EA 3FSTA 1MW2A 5E93A 4P7QA 1QW8A 3FVDA 4Z2IA 1TPB1 4HTYA 3SBFA 4YNGA 2PDGA 4KETA 4U5KA 2PPGA 1FCBA 2GSEA 4PTVA 4OQVA 4Y8FA 1KFWA 2GJNA 1Q63A 2TYSA 3TDFA 6REQA 2PDNA 4IQDA 1S46A 2IKGA 1HKMA 3TW9A 3PBVA 3WD4A 2JEPA 3GFYA 3CASA 3BTNA 1W9VA 2BY0A 1V8EA 3ZFHA 1GPWA 1NH6A 4AEFA 5JH1A 1L0PA 1UG6A 2VR2A 2J75A 1SO5A 2ZXAA 3WJWA 3LV5A 4DJFC 4XAGA 3IIOA 3MWCA 4DWSD 3VOHA 3NURA 3QM3A 4IP4A 2EG6A 2V67A 2O0TA 4KCTA 2V38A 3NM1A 3AIEA 3A12A 2O9TA 3O0FA 4ZOBA 3C61A 1JCTA 4KH2A 2ZUTA 3UJRA 2JGYA 5FF7A 2DIKA 4C6KA 3IIXA 1Q2RA 4CNUA 1UD6A 5D2TA 4AXKA 3M44A 1XIFA 3UR7A 2WMGA 5E6ZA 3B9AA 3CPGA 2V3FA 3TTSA 2YCLA 4BF7A 4F0RA 4QDWA 3P5YA 3GXMA 2XHYA 2VO5A 2Y6ZA 4D71A 4EACA 2C3ZA 2CITA 1ICPA 4AC1X 1ZL1A 5A6LA 1G9HA 4HA1A 3WH6A 1WDSA 3AOFA 4W88A 4TMBA 1B31A 2WMIB 2DH2A 3L9CA 3LTYA 2D0HA 4GH3A 1UC4A 4C6CA 1V6UA 4O1FA 1SO6A 1E0WA 3LHTA 1EGVA 5LIYX 3LHWA 1OG6A 4XZBA 3LSBA 3PZNA 4RNIA 3GTHA 2OEMA 1D9EA 4GPNA 1X39A 4ICNA 1ICSA 3IJIA 2G97A 1VBUA 4H8NA 2VDHA 1C8VA 2ALDA 3WDRA 1XGZA 3SCQA 3RHGA 2WMKA 3VA8A 4KWOA 3IV3A 3WSUA 2CIPA 3LXCA 4LU0A 4GUJA 2PP3A 3L65A 4GZJA 3WN6A 2OQYA 3FA5A 4BS0A 1F76A 1EC7A 3LI0A 2FHCA 2BOGX 4AD4A 3C5QA 4CNOA 3K8KA 2OOFA 3PJWA 5D02A 1EDTA 2JF7A 1J8VA 3WJSA 4YYFA 4OV9A 3QR1A 4DQWA 3KDNA 1S2VA 4FNRA 1NARA 4GMEA 3M6DA 4NZ3A 3QGKC 4OU1A 1HGYA 1A47A 5BMWA 1Q3NA 4XBSA 6XIAA 3KHDA 3WQOA 4ICMA 3R0KA 2OEJA 1I2RA 3EWWA 3M07A 3M7WA 1XD0A 2WSKA 4QBXA 4DO7A 3LDVA 3T81A 1G4TA 4DJEA 5EU9A 3MUXA 2OOGA 3OLGA 5FJOA 5G4WA 1BFNA 1GOKA 1AZ1A 1OFQA 3UJFA 2VJXA 3AU6A 1K4GA 3THAA 1TTJA 2R1PA 3POCA 1WXYA 1JF5A 2OX1A 2P53A 3PSWA 3CT2A 3FAWA 7ENLA 4M56A 2WAGA 3TUUA 3R2GA 4QITA 5F1VA 1TE1A 1GT8A 3N1AA 5F2MA 4JTQA 2CEQA 2Y89A 3JW7A 3MBDA 4HGXA 4Q7IA 4PFHA 2JIEA 3EWZA 1Q6QA 2R1MA 3VD7A 4HU3A 3VC5A 1VIWA 4UNIA 1U1JA 1ALDA 3WDJA 1YDYA 1JZ4A 3P0XA 2D23A 2J9XA 4I5UA 3BDKA 1XSKA 3V35A 4MOZA 1E4MM 5I02A 4M29A 1W3JA 3UF9A 1H11A 4RZ4A 3PZOA 3VDAA 2YB4A 3T2OA 4PCPA 2YDAA 3KBWA 4RNJA 1E1CA 1UUQA 3KFTA 2QPUA 4MFEA 1UC5A 4GFIA 4K2SA 1TPVA 4X2RA 2GOKA 3EA1A 2WLZA 4XSMA 3ENLA 3P82A 1V6VA 5FIPA 5HNRA 2W92A 1MEWA 1UR3M 5LXXA 2C14A 4GX8A 4ACZA 2ABAA 3WNKA 1Y5VA 3EA2A 3HMCA 2BGQA 4I9JA 3SURA 1UPPA 1GJWA 3AHTA 3GTIA 2W67A 2OSYA 4NZFA 5A2CA 3KL3A 3AFBA 3BMVA 4PMZA 1FUYA 1PTDA 5GQBA 4BEQA 4QX4A 3GR4A 3BOXA 2ZICA 1LOSA 1FDYA 3B8DA 1AW1A 3S42A 5CPQA 3VX1A 3DHPA 2GSHA 1H7PA 2CLFA 4XZWA 3CUHA 4LYKA 1E40A 1TCMA 5FKYA 2BZNA 3ARXA 1E0XA 3IUIA 2SFPA 2FJUB 1EBHA 1QOXA 1R9YA 1W5PA 2OG9A 5IDZA 4AC7C 2RFGA 5CBBA 5DCBA 3LGDA 3FVMA 5JVLA 1KFKA 3LHUA 4WGHA 2P3EA 5ABGA 4GD0A 2OMAA 1Z69A 5LGZA 1FH8A 1M7XA 1X96A 4JTAA 1QRQA 4AMCA 4D8AA 1W6TA 3EOSA 2TRSA 4O0ZA 2DJXA 1V0KA 1BRLB 1HKKA 3W38A 4ATWA 1DHKA 5BMXA 2HEJA 1FA2A 3C8NA 1EJUC 4MFDA 4AH7A 4CCZA 2C7FA 2VGGA 4O4VA 3A21A 3IV8A 6TIMA 3TZNA 2VELA 4KIEA 1SR0A 4S3AA 1T40A 4JTTA 1FWTA 3EOUA 3NXFA 2CLKA 1UA3A 1V0MA 1XH2A 3BJSA 1QHPA 3NSMA 1Z44A 3T9PA 3ZQ9A 2XYLA 1HVXA 3VD3A 3QR0A 1OFBA 3UEQA 1R7OA 4Q4SA 4DZIA 4EXBA 1Y5XA 5JBEA 3L2IA 2ISDA 2X09A 5EMJA 1VPYA 3SCNA 1EF2A 3AUJA 3E0FA 2J9ZA 4GKTA 2VZUA 4PCFA 4UMBA 1Z42A 3FSUA 4KFPA 2NV1A 1KRBC 4GVGA 2XH0A 4JTIA 1ME7A 4DBDA 2EPHA 3UYCA 2J27A 1TPWA 2DW6A 2UZ9A 4ASTA 4HOWA 4YTQA 2EPOA 2J74A 2A21A 3L0GA 1TB3A 2E6YA 1UJQA 3ZJ6A 3A4JA 3BLPX 3F4VA 3RF9A 1KV5A 3BAJA 4HCLA 1AMKA 1YPFA 2OJPA 3DX5A 4JNYA 4GYKA 4G8TA 1WO2A 4ONVA 3CZEA 1X8CA 4QG9A 2RHGA 3ANVA 2R9RA 4FO4A 3KEHA 1R38A 3W27A 4JAWA 3ZS4A 2E6AA 1S39A 4UFHA 2X2GA 1V4YA 2FIQA 1PX3A 1BF2A 3L23A 3HA1A 1MRAA 2C18A 1TV2A 3QLDA 3DESA 4HPGA 4GBDA 1WAUA 4KWUA 4ZO8A 3GKAA 1J0ZA 2CZEA 3VIOA 4C7FA 1Q5MA 3SQLA 3W7GA 4YVPA 4LBUA 3CPUA 3O6YX 4DJFA 4WOQA 4H7VA 2EEXA 1EO5A 1SO3A 2QDHA 4NNAA 5CPNA 3C56A 2G8ZA 2YYUA 3GE7A 5IHRA 4WJ8A 3VIMA 2BNJA 3WK0A 2FGBA 4FB7A 3UXLA 2P88A 4ZOEA 1D7KA 2ACRA 1VPQA 1Q6EA 1J96A 1YHTA 3JU2A 3M47A 4U10A 1XGDA 4JTSA 1QOPA 4IHCA 3BZJA 4M6QA 4DLMA 2C13A 4XTDA 2X0SA 3VDCA 4MJ2A 5REQA 4F9DA 2JE8A 2GGJA 3O6CA 4MB1A 1EDGA 1RBLA 1NELA 2ZX9A 1J18A 3KBMA 1M41A 1C3FA 4ZQPA 3DEQA 4EP8C 5JXQA 2YBVA 3H23A 4GY0A 4IQEA 5HXMA 3NSNA 2GJRA 3LMYA 3QW4B 1QDSA 1UASA 5C2XA 2EAWA 2ZUUA 1AW5A 1KM0A 3SY1A 3KOFA 2R82A 1SW3A 2ZZ5A 4FA3A 3A4WA 3CHVA 1UUMA 4CNTA 2YA1A 3LCWA 3W7LA 3NGFA 3MI6A 1PDZA 1CXLA 3OTRA 4IFOA 5BOEA 1DQUA 4HTBA 3W7JA 4WX2A 1H49A 1Z89A 3U5YA 5A3HA 4D6GA 3MUIA 2CBUA 4K38A 1NSJA 3FDKA 5CPSA 4I7WA 4KPLA 4Q8WA 3W7DA 2E09A 3PAJA 2CHOA 3PPFA 2GGGA 3H4WA 4O14A 1IF2A 5D30A 3V0SA 4FXSA 3DYOA 4I9MA 3CAKA 1FWFC 1K1DA 2V69A 1KM4A 3P81A 4GUHA 3QOKA 2Y8VA 4PUNA 1RALA 4IGHA 1KC7A 2G41A 3VCCA 5HA7A 5A8NA 4AY1A 3CIVA 3UP8A 1W8GA 3HO8A 4C6NA 2FVMA 1OZMA 4NXKA 1JPIA 1S2UA 1L2UA 5DELA 1KBBA 1EUAA 2NQZA 2P8BA 1RR2A 4DXKA 1VH7A 4IPIA 3VNLA 4YVVA 2XH7A 1XLLA 1V3LA 4GQQA 3VNDA 1OCNA 4HA4A 4MPKA 4O12A 4H8UA 4L6HA 4K8HA 3O1NA 4RDYA 4TR9A 4Q22A 2Z1WA 1JYNA 4JX5A 1UWAA 1IIHA 3GXTA 1TMLA 3KVJA 3AIQA 1K77A 1ZCOA 2D22A 2QPSA 1NY1A 4ZB5A 2QULA 4UQ9A 1XYFA 5BWAA 1MI3A 4IICA 1KO0A 2WMIA 4HZ6A 1E56A 3LPFA 2CFFA 2INZA 5J8LA 1ZNNA 4GIAA 3A13A 2ZRVA 1P6BA 5HDRA 4GC3A 3EYPA 3U3HA 5FL0A 2I56A 2UBPC 5C8BB 1EOMA 2X30A 4K7VA 2QAFA 3GB6A 1ODZA 1IT7A 1TTPA 2VX5A 3H2AA 1FP9A 3TW7A 2DFAA 2R91A 2E3ZA 4EOUA 3B8IA 4D1JA 3HJZA 3VFLA 4DYJA 1RK5A 4IX0A 1JULA 1OD8A 1KRAC 5C9ZA 1H60A 1HJQA 2PWHA 3BICA 2Z1KA 1G94A 3ITVA 3VE9A 3UG5A 1LDCA 3NQAA 6CGTA 3LV6A 1LCOA 5LYRA 4Q33A 5FF4A 3ANUA 2WZMA 3N2BA 4PTMA 2OB3A 3A5VA 3S2NA 3WH5A 5AYBA 5I24A 3S6TA 4U3AA 4HT3A 2Y24A 2PWVA 5LIXX 1ADSA 4DAIA 3UNDA 2PBGA 3OA3A 1F5ZA 3FYPA 4KWWA 2A1YA 3BGAA 2E1WA 3WLTA 3TQPA 4Y9NA 2V81A 1YEYA 1YADA 3W1MA 3CHCA 4RW3A 4QISA 2BMBA 4P8WA 1QBBA 3PUEA 1KBLA 1C7SA 3CWHA 4OVXA 2EG8A 4QHRA 3GG7A 3VMNA 2ZRXA 1XICA 1ZGDA 5A8PA 3SCOA 5EFDA 3ITTA 1J11A 3RCNA 3NPVA 1REQB 2ZFAA 4TV5A 5A6SA 3PUGA 4PUMA 3GU1A 4O10A 4ZQRA 4NYYA 4UTHA 3NG3A 5G5IA 3FW6A 3TTEA 2DJLA 1NFBA 5M3WA 2OCZA 3VGFA 4ORMA 3OVQA 4HJFA 3MTWA 1NP0A 3WF2A 3HQPA 3NIYA 4N6FA 1SVDA 2ZIDA 3WNMA 5HQEA 5KITA 2WSRA 1Q8AA 2E5BA 4ATLA 3PSVA 4HNLA 1QNOA 2VRKA 1WUEA 1XFCA 2W3ZA 3WBWA 4UR8A 3ZWTA 1CI1A 3CHFA 1UYQA 3VZZA 5TBOA 3MY9A 1VC4A 5DY3A 1YXYA 2WMFA 3TKFA 2IXVA 4MAZA 4BR1A 5HANA 1O94A 3GG0A 3F5JA 3W1XA 1QNRA 1WKEA 1YXDA 4BQ3A 2BV9A 3OOQA 4DPPA 3W73A 4PSPA 2DSVA 4R88A 1UQYA 4JPGA 3C2OA 3RYSA 4AWUA 1E4LA 2VMFA 3AXKA 3IS4A 2ZADA 4DUXA 4LBRA 4MWAB 2VQUA 3HPFA 3NZ1A 4JIRA 5HAOA 4XQ6A 1XDLA 3T4CA 4FNUA 2PURA 5CJ5A 1BVNP 3G1RA 1M68A 2BY3A 2D1ZA 4AZ7A 2J8GA 2H9AB 4EF8A 5HMEA 4I9TA 3RLVA 1TR9A 4HP5A 3VNYA 1XBXA 1FXQA 3GVWA 1W1B1 3PPGA 3W7HA 4AVFA 1JD9A 2R14A 2DZVA 4S1FA 2CLLA 2WNWA 4X60A 4LQ1A 1EWDA 1JZ6A 3KVLA 1W3NA 1AUSL 2OQHA 3LBOA 3B0YA 4NZ5A 5LNWA 1JDCA 3P61A 4HZ8A 3NO1A 3QV6A 1P0DA 1Q6GA 3UZZA 4UFMA 4V1YA 3WQ8A 3PZIA 3LERA 3RRXA 4ADSA 3IIVA 5BXTA 3NYZA 3ZT7A 1UPMB 3OZYA 1W5QA 1OFAA 4NKCA 2VFDA 3TQ0A 1I60A 1JCYA 1CLKA 2O55A 3GC5A 3QMTA 4ZTXA 1CLVA 2E9MA 1ISXA 2YB1A 5BNKA 3Q4DA 1DTUA 4AU0A 5DN1A 1BRLA 3ISIX 3TTYA 4NZ4A 3ECQA 4LVAA 1TIWA 1GTEA 3KWSA 4M0XA 3TXVA 4ACYA 4IGNA 1IR1A 2VR4A 2DZUA 5CG0A 5F2LA 3QC0A 1R6WA 3BOLA 2PBOA 4S3KA 1HXJA 2NLIA 3KOYA 1FH9A 1QPKA 3GNOA 3AZSA 4K6AA 5CSYA 3WF3A 4GXPA 2WHKA 4ZR8A 3CEPA 1EFZA 1WUFA 4Z17A 5E9AA 4FR1A 3CLWA 4IIGA 5CC3A 2ATMA 3NZPA 1Q13A 3IPWA 2QGYA 3APTA 1DIOA 5HJYA 1PYFA 3GNXA 3W76A 4MJ4A 3QQ0A 3SDOA 5A8GA 3DFSA 4KBXA 1R30A 3T4WA 3TIMA 1BHGA 2F6UA 2BVYA 3H8AA 3ARPA 3IAQA 3UPWA 1PVNA 1NOFA 4QS5A 2WHJA 4UQEA 1EXPA 1E6NA 3XIMA 2NX9A 1JL8A 2Y7EA 2YA2A 2NUYA 3D5HA 4QM1A 1V77A 4ZSTA 1OYAA 1TE6A 3VOCA 1WBHA 1I1XA 3N15A 1TRIA 4NJHA 4LUJA 3TQVA 4LAOA 3OLDA 4ZFMA 5TIMA 1BEUA 2XIIA 3B9EA 3KXQA 4CNPA 1HGWA 3HZ3A 5CC5A 3M0MA 2QLYA 3F03K 5DMYA 2WNZA 4KGLA 1BGGA 1ZP4A 2XGZA 2XM2A 2X1UA 4N9BA 2Q8LA 1XIBA 1UD2A 1UIPA 4CQBA 1DVJA 3ZOAA 4IG2B 3GFZA 2PCEA 4UTWA 5I5RA 2WO5A 7TIMA 1A49A 2E4TA 2XFFA 1R2SA 4M8UA 1GGOA 2IKIA 5JU6A 3OVGA 4BK9A 3RX2A 2EQDA 1XQKA 3DH7A 1QU4A 4DPQA 5CCZA 1RQEA 3QQ1A 4ZXLA 1PSCA 2J24A 4DJED 1JYVA 1GOIA 4H04A 3KTCA 1TJRA 4LAZA 3PZGA 3O9NA 4GYPC 3E0IA 3AXIA 2UWFA 1GONA 2NV9A 5AHMA 5DXXA 3SECA 2V9DA 1VP5A 1QCWA 1OGGA 1OIMA 3KZPA 1TKKA 2XWEA 2ZRUA 3SUWA 1F3XA 4U2YA 4CLMA 8A3HA 2FZMA 4DI9A 5AECA 3BZGA 3L7RA 1R3SA 1AFSA 3ITYA 1DKWA 5EMLA 3BLDA 1KCKA 4MY1A 3TN5A 4FK9A 1P0NA 3MZNA 1OSEA 1XIIA 2WM0A 2AAMA 1LL6A 4F0HA 4WY0B 2V2HA 1EJSC 1QASA 3CHDA 3BE7A 3KP1A 3PZMA 2ZA3A 1MQQA 5F4XA 1KWKA 1A5KC 4ZGYA 4NQ1A 4CD5A 4DF1A 4FNQA 5E0FA 3WLJA 1S2TA 2WWDA 4HHLA 5EY5A 2ZVRA 1ZAHA 2CW6A 3WX7A 4FXJA 2E77A 1Y65A 4XUGA 2QHAA 4EXQA 1PHWA 3HGSA 2UY2A 1F7BA 3T0CA 1LRQA 3N2CA 1WDRA 4DWSC 3VUSA 2DUXA 3WLQA 3M0YA 4HPXA 4KEUA 1GQIA 3SN4A 2YXXA 4XSLA 2ZE0A 3M0ZA 2QV4A 3Q37A 3J7HA 1US2A 2VX7A 3B03A 3B4YA 4H9MA 3FJ4A 1C90A 3UERA 5L6UA 3WLPA 3IJLA 5LIKX 2NWRA 4JKKA 3FNDA 1IXQA 2XVPA 1H7WA 2ZOXA 2Y63A 2OX4A 3NNTA 1WOBA 1TRDA 3UZJA 3OQEA 4NYUA 3RR4A 4FOJA 3WNNA 5HINA 2QIWA 5D8ZA 3RO6A 1BVWA 1JCMP 3AYTA 4A2RA 3BOFA 3CH0A 3NCOA 3VOGA 3QPEA 1E0UA 1GZJA 4CQ8A 5FJTA 5CKSA 3VZYA 1Z7AA 2WC3A 3TEVA 3S1VA 3MP3A 2GL5A 2MUCA 5F2IA 4TTGA 2ZDRA 3BAIA 3NVTA 1IR2A 1U22A 1MDLA 2VT0A 3WQCA 4S2BA 4NAEB 2FB2A 1VRXA 2Q09A 3ITXA 3PB2A 2PLMA 4IXXA 4XAZA 4QJ3B 1IT0A 5AC8A 3NZQA 1ML1A 1FWDC 3BARA 1EIBA 1H1YA 4LS1A 4LC6A 3CUFA 2QCLA 4KF1A 4S3EA 3WBYA 4NF7A 3ZM8A 2G3JA 3VIHA 3W82A 4MMWA 1EP1A 5IHSA 1RBOB 2RDWA 3IIZA 4H8HA 3SJNA 3W07A 5HR7A 2WVUA 2A2IA 4A3QA 2I17A 1E6XM 1W9PA 4LW7A 1QO5A 1TVLA 1K9DA 3GK0A 4NVTA 2WC4A 2PA6A 4GXMA 1CXHA 1H63A 4CEUC 1E55A 2OYMA 4ZB0A 1N82A 4WSKA 4DRSA 2AQOA 3WDIA 1QAPA 3WEMA 4XO7A 3WENA 1P0EA 3GVGA 3L0KA 3LENA 2WZTA 4PODA 5D37A 4HNTA 2F2KA 2HE8A 3W74A 1F3TA 2GJPA 1QOQA 1V0LA 1DJIA 3UCCA 1W9UA 2XFWA 1JQVA 4EK7A 5CC7A 1WZMA 1S3HA 2WJFA 4Z2GA 3STGA 3AHZA 2B7QA 3CMGA 1ZBWA 4HSOA 4S2CA 7TAAA 3G22A 3T2QA 4JX4A 3MMDA 4IPLA 1DJYA 3R13A 1WBJA 3M64A 1C91A 3TYZA 2ZZ3A 1R47A 1PWLA 2YPIA 1X7IA 3W1QA 3NDZA 4JTDA 1GQJA 2QMKA 3BUVA 4HSNA 1XLMA 3S0CA 1I6NA 1P6WA 3F4DA 1REQA 4AXNA 2OTDA 5D4YA 5C71A 1MNZA 2NXHA 1WXJA 3T07A 3VXGA 4FOUA 1TV5A 1HO1A 1YBQB 1LORA 3MS8A 4TTUA 4DJFD 3U6WA 4ZQOA 1EP3A 1MW1A 1JZ2A 1V3MA 5AN7A 2B7NA 3I10A 4IUGA 3KP0A 1ZJBA 4N42A 3S6OA 1XBVA 3UWEA 3A4AA 1MVYA 4HBKA 4F0SA 4ZE4A 2EPKX 2J79A 3TP4A 1GK8A 3HF3A 4TIMA 3L4YA 4C6EA 1KM1A 4KERA 2XZ9A 1LWHA 3MCMA 1Q45A 2DUAA 1L6GA 5F7UA 5GJMA 1BG9A 5HNTA 2VFHA 1K02A 1TUXA 5EBAA 2OGJA 1R3YA 4A22A 3K5XA 3PJUA 3T8LA 1FWGC 3N9KA 3ITGA 1OJXA 4PYSA 3W4RA 1QATA 1U33A 4HPNA 2PZNA 4EIVA 4AX7A 3T2PA 4BWLC 2YKKA 3WMLA 3AXMA 3LSCA 1HZYA 4MYAA 5IDIA 4MDOA 2ZX6A 1Y5WA 2P8CA 1NFPA 1OGBA 4ZO7A 4S3CA 4CNSA 3R0UA 4DY1A 4EF9A 1XYLA 4MWAA 4E2BA 3ZR4A 4K36A 4NJKA 3A9BA 2PDIA 2XN1A 4UTUA 4QAIA 3SUTA 4WKFA 1SSGA 1LG2A 2H9AA 3SAZA 4W8AA 2R1KA 3QN3A 4Z2LA 1XIDA 4UQCA 3UY8A 1B4EA 1QJWA 5AKQA 5DO8A 3WNLA 2GUUA 4HU4A 4EKJA 3E2SA 4J3XA 2WCAA 3S83A 5AHLA 2YXGA 4S3GA 6ENLA 3NO3A 3NZRA 1JDAA 4LB3A 1XIGA 3PP7A 1JZ8A 3AZTA 4Q8UA 1XLCA 2Y0FA 1OIFA 3BLFA 3QVQA 1XV8A 2OWXA 4UMCA 1TELA 1U5HA 2X41A 4A8RA 2YCEA 2WJEA 1RQBA 2HROA 2QZRA 1D3CA 1XS2A 1K7EA 4GH1A 1WP6A 2JK2A 4AIOA 4KGJA 2VGBA 1RBAA 3PNUA 1VIZA 3WNOA 3M9YA 1FWBC 4G7FA 4O4WA 3NQEA 5FEPA 4BHYA 3ONBA 3B8UA 2GQAA 4LJ3A 4LV9A 4FZIA 5C0QA 3EZ4A 3LQLA 2QUNA 3BSHA 1WOAA 4P8UA 4MWAE 1JGMA 5AY7A 1UWSA 1ENUA 3K30A 3CQIA 3W1PA 2DT2A 2WMHA 1A80A 2WKGA 4EAYA 5HQLA 1EJVC 3HFYA 4FLOA 3N04A 3CAVA 4RUBA 2ANUA 3CWNA 2OT0A 3TR9A 3NQ8A 1O6IA 4HKPA 1EJTC 1OGSA 2XFRA 3NUKA 1CENA 5DX7A 6PTDA 4DO5A 3F5KA 3KBSA 4UIOA 4X63A 3MO4A 2DVXA 3ZJKA 2VEIA 2GWNA 4J35A 1OX5A 4WR3A 1CIUA 4OTKA 3A24A 5I06A 3W75A 4PN2A 4XKYB 4IMFA 3CO4A 2OEKA 1EYWA 2I5GA 4JYFA 4QCFA 4ZZ9A 4H7CA 1ITCA 3UWYA 1RCQA 3H2EA 4G1NA 3FDGA 3TSMA 1TFVA 4KT2A 4OECA 1CLXA 4X9YA 1X1OA 1JYWA 3GWQA 3VGGA 4AIUA 3LN3A 3NEHA 4Q6JA 3KOXA 4XUYA 1XG4A 1RHCA 2VZOA 5DMMA 1X1NA 1DQXA 2INFA 1E9ZB 3UY7A 4N2YA 3VINA 1IEIA 3VX0A 3M0HA 3ZVHB 1UD3A 1UH4A 2P3ZA 4DM2A 5CLWA 3EWDA 3EWYA 1GJUA 3N34A 3TLLA 4HPJA 1BYBA 3DFHA 4H01A 3VIIA 1VKFA 4IG2A 4MZYA 1J79A 1LQ2A 4YHEA 1OM0A 3S46A 4PCNA 3SCRA 3H4XA 1J0KA 5XIAA 1ZENA 2YBUA 1VFSA 5HWNA 4RW5A 5DRIA 3T0BA 4DN1A 2QNEA 3L4UA 3H26A 3VVGA 3ERPA 2Y7DA 1YPIA 3G3DA 1MUWA 4HSHA 3WLKX 2VFEA 3N3TA 4LGXA 3W7MA 3L67A 4M5PA 2Y5SA 1PJ9A 3ITOA 4ADUA 4V28A 1O1HA 1EP2A 5HPCA 4O1AA 5K9XA 3LI1A 1FHLA 3R94A 2A6LA 1OT1A 3IJ6A 4RK8A 4RZ5A 1L8NA 3NQMA 1Q6OA 3W86A 3EMZA 2J25A 3IUDA 3PF3A 1OT2A 2O4MA 2XM1A 1VGAA 5H1WA 4UXDA 1FWSA 1KQYA 3CZ8A 1S38A 3LD5A 1JAKA 4G56A 1DWAM 3KCOA 1UCWA 2OPJA 3RM8A 4WY0A 4E0CA 2HBXA 4F8XA 1OADA 3GZAA 3VGDA 1W54A 2YDQA 2Y62A 2PTXA 4FLRA 4DNHA 5AZ1A 3GTXA 1PZ3A 2IQ0A 4HYWA 1H7RA 3WDPP 3E0LA 1A3HA 2G0WA 3WQPA 4EPKA 3MMTA 1UJPA 1KNWA 4JFSA 3EOLA 1G69A 4FALA 3OJGA 5AHEA 3BAYA 4JN8A 2AL2B 3T08A 1OY0A 3RX3A 3K13A 2FLIA 4D6DA 2OO0A 3RU6A 1XW8A 2OSWA 2VNCA 1ZY9A 1P7TB 3P74A 3WLNA 3PZUA 3BG9A 4JTJA 1JPDX 1J6PA 1KR0A 2IPFA 5EL1A 3THCA 3DCPA