4BS0A

Crystal structure of kemp eliminase hg3.17 e47n,n300d complexed with transition state analog 6-nitrobenzotriazole
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
299
structure length
299
Chain Sequence
QSIDQLIKARGKVYFGVATDQNRLTTGKNAAIIKADFGMVWPENSMQWDATEPSQGNFNFAGADYLVNWAQQNGKLIGAGCLVWHNFLPSWVSSITDKNTLINVMKNHITTLMTRYKGKIRTWDVVGEAFNEDGSLRQNVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQMHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGITVMGVADPDSAFASSTPLLFDGNFNPKPAYNAIVQDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Precision is Essential for Efficient Catalysis in an Evolved Kemp Eliminase
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Lyase/lyase inhibitor
molecule keywords KEMP ELIMINASE HG3.17
total genus 122
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bs0A00
3PTMA 1VBUA 4KGJA 3WNPA 2C8NA 4UFKA 1MYRA 1M53A 1W1TA 4TXEA 3K4DA 3RJYA 3RILA 3II1A 3K46A 1SFSA 1LL4A 4HPHA 4LGXA 4AZ7A 1GCYA 4B16A 1UYQA 3ZT7A 5LYRA 4EE9A 1BG4A 3F5KA 4MNKA 2G8ZA 1UH2A 1QPKA 1WP6A 4Q7NA 2E9MA 3AMKA 4W5ZA 3SUSA 3VD9A 3HJEA 1SR0A 4H04A 1H0IA 4W86A 2VQTA 4D6HA 2VRQA 1DP0A 1FP9A 1B2YA 1K9EA 4H2CA 4CD8A 4TVDA 5KEZA 4X9YA 1A47A 2BY0A 2G3NA 3ZT6A 4LXFA 5DT7A 2ESCA 2YL8A 2X0HA 3ARQA 3OLEA 1DEDA 1W9VA 1M03A 3AQUA 2XPKA 5FIPA 3WH9A 1EHNA 4J3VA 4TVCA 5CPQA 4E4PA 1JYNA 3MKKA 5I6SA 3GNRA 4D6FA 2XGBA 3AMLA 2YL9A 1KGWA 2X8RA 1W3HA 4AD4A 5EFDA 4M29A 9CGTA 1V6WA 1MW0A 4ZXLA 4U5KA 1UA3A 1V02E 1PEZA 2WHMA 2GJXB 4P8WA 4U5IA 2YA2A 1R7OA 3N13A 1C7TA 2GK1B 3BGAA 3VOCA 3W6LA 1PIFA 3AISA 1GJWA 4AD3A 3AYRA 1GOMA 4W8AA 4RL3A 5E6YA 4ATLA 4D72A 2BHUA 3AI0A 1V02A 2BVDA 1ZBWA 2WHLA 3WD1A 5KZ6A 2EPMX 1JDCA 4LX4A 3OGRA 4HZ8A 2CNCA 3U57A 4MPKA 1EDQA 1I1XA 2Y4SA 5A6AA 4GINA 3PZGA 4WK9A 4UNIA 2FHCA 3VM5A 5BXSA 4KRTA 3WH8A 4R5EA 2YDSA 3N11A 1KB3A 3WD0A 1ZB5A 2VC9A 4W7WA 3ZQ9A 3L4XA 3F4VA 1BGAA 3AICA 4MAVA 1ISYA 1UZ4A 1GOQA 4HOZA 2WMHA 2YDQA 1KGUA 1W9BM 3ZSTA 5LA1A 2E4TA 1W9PA 3CGTA 3CUJA 3IAPA 5E09A 1AQMA 1CEOA 1HJQA 2WANA 1CGWA 4KMQA 1NM9A 4J3SA 4AMCA 1NP0A 3WEZA 1C8XA 1UKOA 5HPCA 1Q6FA 2C7FA 4AZCB 2CPUA 2E9LA 1CTNA 2DT0A 3WH5A 1RPKA 4XV0A 4J27A 1TFVA 1J0JA 4EAMA 2XIIA 4DWSC 1MQRA 5GNYA 4JHZA 1VEOA 2V3DA 3E1F1 1E6QM 3KZSA 2VVSA 3WH6A 1XGZA 1LWHA 1BVNP 4AIEA 1JZ8A 1TA3A 3WEOA 3TONA 5M5DA 2VZVA 1E9LA 1E15A 4AZ6A 2AMGA 3NCOA 3MANA 2WSPA 3AIWA 5CPTA 5AC5A 8CGTA 1VJSA 3MUAA 2CXGA 3TOPA 3GXFA 1YQ2A 2D20A 2O9PA 2PI6A 3IK2A 3T2QA 1KCKA 5A8QA 3SCNA 1GHSA 3MMDA 1KR1A 2WXDM 4F9DA 1J0HA 2WHJA 4QCEA 2ZUVA 2YBTA 4PCSA 4A4AA 2YDRA 2WZIA 1EO5A 2E9BA 2VCBA 2OWXA 1FH9A 1G94A 2OLHA 1XH2A 1VFFA 3L4YA 5A2CA 2O92A 3PBGA 2RGLA 2XG9A 1K9TA 1QHPA 3L4WA 3W27A 2ZIDA 3U7BA 2FHBA 1WDRA 1ZJAA 1PPIA 5D4YA 4UQBA 1V3JA 4TX6A 2W61A 3VGHA 4IM4A 4UOZA 2WSKA 3SCOA 1B3ZA 3AS2A 4UOQA 4TX8A 2J75A 2WMIA 5JUVA 1KR0A 1C8QA 1OSEA 1DHKA 2VUYA 2TAAA 3NYDA 4UQEA 2FHFA 3WUEA 2BHYA 2F8QA 4Z2KA 1HXJA 1NP2A 1BYAA 1BHGA 1I1WA 3VDHA 4ZXOA 3AIUA 3WMSA 1JNDA 4BS0A 1CGUA 1BAGA 2PWEA 4H8HA 1UZ1A 1EHAA 1QHZA 1V0KA 1LG2A 1H3GA 3IAQA 4PYSA 4W85A 2JEQA 4OOZA 1V0NA 2A3EA 4HOXA 4CU8A 1JI1A 2E3ZA 4FLSA 1FOBA 4AYSA 1HN1A 1HNYA 1V3KA 4AWEA 5CLWA 1LL6A 5HPOA 2V3EA 3VIFA 3CH9A 4BZYA 5M17A 1UUQA 3WBEA 5I24A 1HL8A 1EDGA 3BC9A 1HKKA 1E3ZA 2WVSA 2IUZA 2VT0A 4GZJA 4Z2IA 1NWRA 2XFFA 1XYFA 2CBVA 2X1IA 1F4AA 1OIFA 4UFHA 2J4GA 2QLYA 1ISVA 4D6JA 1MXGA 1E5JA 1V3LA 3GXDA 4HPGA 3W28A 2ZWZA 1B90A 4HU8A 1MQQA 2ZXBA 1UD6A 4D6IA 3NSXA 4PSPA 1C7SA 1LWJA 5ABEA 2PWHA 2WKLA 3SCRA 1DTUA 4QLJA 1PJ9A 2X05A 1JF6A 3AIRA 4DUVA 2Y24A 3FN9A 1E1FA 1QHOA 1VAHA 2BFGA 4ZE4A 1LLOA 2CHOA 1V6UA 4AZ5A 2QMJA 1TCMA 3T2OA 1UD2A 3DYOA 4TTUA 1PZ2A 3WDPP 4PUEA 3DHUA 1BFNA 6TAAA 1XSKA 2ZX9A 4OBSA 4DWSA 5BXPA 1DWJM 1FP8A 4DM1A 5I5RA 3AZTA 3FHQA 3CUIA 2XVLA 4QFUA 1B30A 3N18A 5DMYA 1HVXA 2OWWA 4TTGA 1NOWA 2ZXDA 1NOFA 1K6AA 1HJSA 3VKKA 2GFTA 4V27A 4UFIA 1PZ3A 3FXYA 4QAWA 1UR4A 4HZ7A 4BF7A 3PN8A 2RGMA 3WQ5A 4GXPA 3D5HA 3DHPA 2XM2A 3QHOA 2XWDA 5BXRA 5A69A 5ABFB 1DWGM 4GIAA 3AHTA 3APGA 3WQ8A 2XUCA 4MNJA 2VURA 2A3HA 2CCRA 5D8WA 1Q6CA 3W38A 1J0ZA 3A6OA 1QVBA 2GJRA 2X0YA 3J7HA 5EB8A 5JIPA 4PMYA 5A8MA 3BAYA 2EO7A 4DUWA 1HJWA 1I75A 1E5NA 3CHEA 4CUCA 1UWIA 2PC8A 3WENA 2YIHA 2HISA 5BCAA 5C71A 2XIBA 1EQCA 1UHVA 2CBJA 1E0VA 3WBAA 1BVZA 1DWIM 2DIJA 3VIJA 3WSUA 3PHAA 2XFRA 3UG4A 1NWTA 1RP9A 2GDUA 3ALFA 3AYSA 3F5JA 4JKKA 3WL1A 3CZJA 4FLRA 2W66A 3VD5A 3VD4A 4D6GA 1PAMA 4MNMA 2J7HA 1F4HA 1TMQA 1W2PA 3B8SA 3CUGA 4HMCA 3ZJKA 5A6KA 1HT6A 3EDEA 3VTRA 3MSDA 4W84A 4UQCA 3AXHA 4U31A 4AC1X 1M01A 3WIJA 1UD5A 4X0VA 4E8CA 1W32A 2JFEX 4OKDA 1XSIA 1HL9A 1UD4A 4CN1A 1CENA 4MJ2A 1G0CA 1XD0A 5CZKA 2VMFA 3EMQA 3M7SA 3NJ3A 3VIHA 2BS9A 1ZBKA 3CUFA 3MO4A 5CG0A 2WVVB 4J3UA 3M6DA 1JG9A 2Y2WA 1OGGA 3L4VA 3SUWA 3VIMA 1W9XA 2A3BA 3NSMA 4H8VA 1S46A 5A8NA 2CITA 3ARPA 1CLVA 4AZCA 3TTYA 1PIGA 4E8DA 3VO0A 3ZR6A 2VRKA 4CU6A 1PX8A 2BY2A 3LPOA 1KXHA 1Q4NX 4XZWA 4AD2A 3B9EA 2PWGA 2DT2A 2A3CA 2WVTA 3DC0A 4AD1A 1KFWA 4P8VA 3VGFA 1GVYA 4A3YA 1W9UA 1WE5A 3A47A 4CD5A 3TTSA 1WDQA 1JD7A 2J7DA 1C91A 1VFMA 2W63A 1GZJA 1N82A 3BAKA 1TVNA 1OIMA 1AQHA 3BLKA 2WWDA 3ARSA 1LL7A 2Z1KA 3AMGA 3GTNA 2XTKA 5JBFA 1GORA 3I3BA 5I77A 3NIYA 3SEPA 3WD2A 3UESA 3AIQA 3SCSA 1BSIA 1JZ2A 3THDA 1LQ0A 1EGZA 1VRXA 4MAZA 1CYGA 4HMDA 3VMNA 2ZUTA 4W93A 1C92A 2WC7A 1H11A 3KL3A 2ZUMA 4F66A 1OD0A 3CIVA 3KE0A 1KXVA 2YKKA 5GNZA 4L4OA 4URIA 2VX7A 1E0WA 3GNPA 3MSGA 3CO4A 2Y8VA 4LPCA 5JIWA 3ZMRA 4K68A 3UR7A 1EOKA 1GQLA 1UWUA 2IXUA 4GZEA 1MW2A 2CESA 4B3KA 3LPPA 2EJ1A 3WFZA 1Q6DA 4WLCA 4JHOA 3WDRA 2YJQA 1JYXA 3F5LA 3T0BA 1VF8A 3BAWA 3CZEA 4D71A 1R7AA 4AIOA 4KH2A 4NZCA 3M07A 1AMYA 4Z2JA 3ZJ8A 1E4MM 1PX4A 2J7EA 3K8LA 4NF7A 4JFUA 2B31A 2BY3A 1P6WA 3K4AA 3K8KA 5I78A 3BCFA 4WKAA 5C8BB 3AHXA 1HJUA 5E0CA 1HVQA 1MW3A 2BXYA 4QP0A 3HU7A 1ODUA 2J47A 1OB0A 1E4NA 2O9TA 4MB5A 3PZVA 5DEZA 1TR1A 1TG7A 1WZAA 1J0IA 3WDJA 4AEEA 1VEPA 2D0GA 4M82A 1J01A 1E6PA 3W6MA 4DWSB 3EBVA 4M80A 1G9HA 1HP4A 5I3DA 1E70M 2J79A 3GM8A 2CEQA 1JGIA 4P7LA 2GJPA 1BGGA 2XFYA 1GNXA 2IXVA 1R85A 2WPGA 1WZMA 2VCAA 4N0RA 1MFVA 1UKSA 3BAXA 3O2LA 4BQ3A 5CPSA 4M81A 1KGXA 2E0PA 2F61A 1XV8A 2D3LA 4U2YA 4X0NA 2VTFA 1UR2A 2ZUNA 3VMOA 3VUPA 1H0GA 1W3KA 1CXHA 4GPNA 1D7FA 1E43A 3ECQA 3PZIA 4YN5A 5AY7A 1ZU8A 3I3DA 2WWCA 2DT3A 4GZIA 4J3WA 2NW0A 3VPLA 2ZX7A 1Q6EA 5E9AA 1GOOA 2BV9A 1TZ7A 1B3YA 1KCLA 2WNWA 1WZKA 1CGTA 3GNOA 1K9FA 2VR4A 1A3HA 4W7VA 4U33A 3UR8A 5A3HA 3CPUA 4YPJA 5FOOA 1JZ6A 2FDMA 2D1ZA 4OJYA 4P7RA 3RO8A 1WDSA 4GO9A 4WF7A 5D9OA 1TA3B 1JAEA 3EDJA 3WNOA 1JXKA 4PEEA 1ZJBA 4HU0A 4FK9A 3EMCA 3CUHA 4JFTA 4PN2A 4UQDA 2ZXAA 3AZSA 2WAGA 3KL5A 4HA4A 4P7QA 3B9DA 4HMEA 4KRUA 1UWTA 4PTWA 3N9KA 4GO8A 2XSBA 3W81A 4GI6A 2YA0A 5A95A 2CYGA 4OUEA 2VZSA 3QOMA 2DGAA 3SIMA 3AOFA 2XVNA 5ABFA 4XUYA 4XB3A 3L2MA 3TA9A 3FY1A 4JCMA 2J78A 1R87A 3QR3A 3AHYA 1EXPA 4W5UA 3VILA 1CZ1A 4PMQA 4QLLA 3N15A 4AZHA 5AC4A 4AZIA 4RE4A 2DQXA 3PZTA 1ISXA 1WZLA 1IZKA 1M7XA 3BH4A 3EYPA 3A4XA 1CIUA 4JZ5A 1JIBA 3VD3A 2DDXA 3U5UA 1QNRA 3WF2A 4JIEA 3LPGA 3QHMA 1TE1A 1NARA 5D9MA 2WM0A 4UZSA 3PTKA 3WH7A 3VGGA 3THCA 2ZWYA 4JL1A 4WIWA 5LA2A 5CGMA 2WC3A 5BWFA 2PWDA 4QCFA 1UOKA 5FCZA 2W92A 1X1NA 4TOQA 3RIKA 3WY1A 2F2HA 1VIWA 3WD4A 4C7DA 1CXLA 3KEHA 1MQPA 2XJ7A 3POCA 3EDFA 2VI0A 3GDBA 1B3VA 3WNNA 2PBGA 1DWHM 3ZOAA 4P8XA 3VGBA 1E71M 5BXTA 4NRRA 2DSKA 1W2VA 3RM9A 3KL0A 5HOSA 3OLDA 4ATDA 4EKJA 5IHRA 4AD5A 4ATWA 4OBRA 2VX5A 4PMXA 3K1DA 1UKTA 1BTCA 1GHRA 2JIEA 4J3TA 5D9NA 1UD3A 3WQVA 4MDPA 4U2ZA 3VU2A 1O7AA 5F7UA 1UR1A 2DH3A 3VIGA 4AD0A 4CCDA 4AEFA 1U2YA 1KWKA 4XZBA 3EMZA 1JL8A 2BY1A 2ZUWA 4EANA 3T2PA 5ABHA 1GOIA 3RM8A 4GI9A 1B31A 1V6XA 4UFJA 3ZO9A 4W88A 1BYCA 4U3AA 3IANA 1B1YA 5I79A 2J7GA 3WNLA 3VDBA 2VCCA 1UWSA 2XSAA 3VM7A 1OGBA 2CIPA 3QGVA 4PTMA 8A3HA 2E8YA 3GYCA 3ARXA 4V28A 1VENA 5I23A 1MWOA 2JF7A 3MU7A 4IUGA 4B9ZA 3BAJA 3BCDA 4B9YA 4CKQA 1KXQA 2EEXA 4PMZA 1ZS2A 3GXMA 3WUGA 1EDTA 1EO7A 2QMKA 3ARYA 2NT1A 2VX6A 1W3LA 2WW5A 1C8YA 3T0DA 1CECA 1W91A 5C70A 5JBEA 5A1AA 1ISZA 1FH7A 1UQYA 2QPUA 4JCLA 4F79A 3JUGA 4MADA 5CQ1A 3CMJA 5A94A 2W4XA 1KBKA 2QPSA 2BVTA 1ZL1A 3AHVA 6CGTA 3ARZA 4WSJA 3VGEA 3GH5A 1OGSA 4FF5A 2MANA 4TVUA 3WQ6A 1JD9A 3WKZA 1GOWA 4ML4A 3SUVA 1V08A 3GBDA 1Q6GA 3DECA 3MUIA 3VX1A 4UQ9A 2HVMA 1CNVA 4BCEA 3WDIA 1H41A 2G3MA 6A3HA 3AHZA 4HOWA 2J7CA 7TAAA 2JE8A 1UKQA 3TP4A 1JYWA 1HJVA 2DT1A 5HNNA 1E73M 1JFHA 4CN6A 1QI4A 2PB1A 4W7UA 2JF6A 1CWYA 2DIEA 2CHNA 4JL2A 1E72M 3CZGA 1CXIA 1OT2A 1LF1A 1AVAA 1NOUA 1CBGA 4B15A 2VVNA 1VJZA 4Z2GA 2EPOA 1JYVA 4Y7EA 3AIEA 3W4RA 3N12A 2XVKA 1AQ0A 3RPMA 3VD7A 2ZUUA 1ITCA 1E3XA 1QNOA 4LYRA 4WJXA 4AIUA 2WZEA 1R86A 1NWUA 4OIFA 3ZIZA 2AAAA 5A6SA 3T09A 5GQBA 3NUKA 1FFQA 1JZ3A 2WMFA 3AFBA 2EQDA 3SCWA 1OWQA 3WNKA 3OIHA 1J18A 2Y8KA 3N04A 1W3JA 3WUBA 1RP8A 4HTYA 3VIOA 1VBRA 1BF2A 1HF6A 2JEPA 4DWSD 2VZTA 1V3MA 1J9YA 4W87A 3W37A 2BNJA 3BMWA 3WL0A 1XCXA 2BVYA 1GONA 5EFFA 2ZICA 2J7FA 2WMGA 2VO5A 5DF0A 3N1AA 1UWRA 1E6SM 4QLKA 1B0IA 4V2XA 3WMBA 1KWGA 4OZOA 3DYMA 4J28A 2EPKX 3VIPA 5CLTA 3G6LA 3SUTA 1RD6A 1H1NA 4ZEPA 5ECUA 4W8LA 2J8FA 3AMDA 3WDQA 4ACZA 3ZM8A 2UWFA 3PZOA 4PMDA 3PZQA 1HKJA 4S3KA 1XD1A 4CGTA 3M46A 2XVPA 1UR0A 1LG1A 3L2LA 3VIIA 4GI8A 2OYLA 3BMVA 3MUY1 2D0HA 3FAXA 2GSJA 2OSXA 2V3GA 1G1YA 2O9RA 3MMUA 5FL1A 1JF5A 2V5CA 3AMCA 3WNMA 4ZFMA 2DSWA 1V6YA 1UH3A 5CGTA 1XC6A 5JBDA 4HP5A 3BAIA 1UH4A 1E55A 1WPCA 3VMPA 1QW9A 5CSUA 1XH1A 5BROA 3OB8A 4J3XA 4F9JA 4PTXA 2ZX6A 4OOUA 4C7GA 2D24A 1QOXA 3RDKA 5IHSA 4Q22A 4XX6A 3ZJ7A 1GOKA 2VNCA 4JKMA 4QDMA 1E1EA 2J25A 1EOMA 5FL0A 4ZENA 3VVGA 2WKGA 2VR5A 2O9OA 5FKYA 3GBEA 4H41A 3IJ8A 3IJ9A 3RCNA 3OGVA 3AXXA 1OINA 1VB9A 1GUVA 2D3NA 1ZBVA 2XHYA 2YLLA 3CHCA 2FGLA 3MMWA 5I2UA 4BA0A 1SMDA 1G5AA 1VFOA 1EA9C 2BHZA 3UETA 4JFVA 1B9ZA 1H2JA 3WF0A 2WCAA 2YBUA 2Y5EA 3VINA 3UCQA 1JZ5A 1C90A 5A6LA 4TUFA 3W29A 4P7NA 1HKIA 1NH6A 1V3IA 4AZGA 1DWFM 3DYPA 2X09A 5D9PA 1OBAA 2WB5A 5M3WA 3TTQA 2DSZA 1DWAM 4AY1A 5CXPA 2OSWA 1WNOA 5A6BD 2YLAA 1H4PA 3OZOA 4GQQA 4UCFA 3SCQA 2ZXQA 4YHGA 3WUFA 4PMOA 5HDRA 5D8ZA 1W9DM 5A6BA 1U30A 3ZSSA 3NDZA 1QNPA 1H49A 1IT0A 3WMCA 3BSGA 2VX4A 2BXZA 1H09A 5A6JA 3ZJ6A 2WCSA 2V38A 3AJ7A 1YHTA 3IJ7A 5E6ZA 2Q8XA 4ZE5A 4PSRA 3FHAA 1JXJA 3LMYA 1L8NA 2CKRA 5BRPA 3WF1A 4Z2HA 1ZBCA 2YL5A 3CHDA 4FMVA 3O9NA 1E6ZA 2X2YA 1E0XA 2FGZA 4DM2A 4MB1A 1E6RA 2GK1A 4GKLA 4HA1A 4PMRA 1XRVA 1NWSA 2DEPA 3SCPA 4D1JA 2PBOA 3N17A 2YOCA 4A3HA 4CCCA 3ARWA 1TUXA 3HN3A 3WELA 3U7VA 2EPLX 2D0FA 4NI3A 1KQZA 1QNQA 1PX3A 1X6NA 1V03A 2WLYA 4CVWA 5DT5A 2J8GA 2Z1SA 1CGVA 4KGLA 4F8XA 3WDHA 1UWQA 4AZBA 2OWCA 3OA5A 4WSKA 3VDCA 4FLOA 1G01A 1BLIA 4IPLA 1L0PA 1D2KA 3PZNA 3SCUA 1MVYA 1QI3A 4LQ1A 5EBAA 1W1PA 4PUDA 1UQZA 2A3AA 3PZMA 3WFLA 2UY5A 4U3CA 4LYPA 4M1RA 1HP5A 2OSYA 4PBGA 4H8UA 3OLIA 1BPLB 5DFAA 3VNYA 3I3EA 1M04A 7CGTA 4JKLA 3CHFA 4EK7A 4HA3A 4MB4A 5BYWA 3VGDA 2ZE0A 4UFMA 1O6IA 4D1IA 3ZR5A 1JNEA 1E6XM 1GQJA 1X6LA 2VQUA 1UR8A 2QHAA 4PMUA 3OZPA 4KWUA 5A6MA 5LA0A 3RM4A 2GJXA 2W5FA 1K9DA 1WO2A 3ARUA 1MFUA 5M03A 4R27A 4BQ5A 1J0KA 5AYIA 3FNDA 1VFUA 3W26A 3W25A 1FHLA 7A3HA 3W53A 2XGIA 3WN6A 5FD0A 2J74A 2XVGA 4MDOA 1CXFA 3AS3A 1OM0A 1TVPA 2EXOA 3AS1A 4S3JA 4M8UA 1V6VA 2NSXA 2E40A 1FH8A 1UD8A 2ZX5A 2W67A 1JZ7A 4PMVA 1V0MA 1UA7A 2GUYA 2WYSA 1QBAA 1ECEA 3OLGA 3S6TA 3T0AA 3WQWA 1HJXA 3NDYA 3PZUA 2G3JA 4PTVA 3BLPX 4MB3A 5I0DA 2DSVA 1ISWA 3SUUA 3VX0A 1CXEA 3KWXA 1Z32X 1QBBA 1WCGA 2JALA 2EPNA 1IZJA 4PRWA 3CZ8A 5E0FA 3WF3A 4WKHA 4AW7A 5E70A 3L4ZA 2ZUSA 2YL6A 1UKPA 2PWFA 1JI2A 1US2A 1U33A 2CKSA 4ACZB 1UR9A 4C7FA 2FH8A 1GVIA 3EDDA 2WMIB 1XH0A 1B3WA 3TTOA 1JAKA 4MJ4A 2CBUA 2DPEA 2YA1A 1XYZA 1MXDA 3AZRA 1J12A 2G41A 1QI0A 2G4FA 3CZLA 1E4LA 2UY2A 3UG5A 1CPUA 4NRSA 3VNZA 3CBWA 3B9AA 2WLZA 5HXMA 1GQKA 2WHKA 2XYLA 5IFTA 1GW1A 3WD3A 5A8OA 1VEMA 1E56A 1ODZA 1OD8A 2C0HA 2PF0A 1SMAA 3UG3A 4PMNA 3RMEA 3OGSA 4W89A 1CGXA 3U5YA 1FHDA 4UFLA 3GH4A 4W8BA 1QNSA 1US3A 2QV4A 1BG9A 3BSHA 2WC4A 3ZT5A 4AXNA 3MUZ1 2NT0A 1HX0A 4JFWA 1BQCA 3L4TA 2XM1A 1LJYA 3T08A 1E6NA 4CN4A 1FA2A 1E4IA 4ACYA 2WBGA 1QW8A 1JFXA 4N42A 2WMJA 1CGYA 5CSYA 3W24A 1JDDA 4FLQA 2J77A 4WKFA 3CLWA 3WEMA 1IV8A 2DH2A 2VL4A 1W1YA 3GH7A 1C3FA 5DO8A 1BYBA 3FW6A 4P8UA 2QF8A 3MV01 4MNLA 4JAWA 2VOTA 3S2CA 4CCEA 2FH6A 1QI2A 1WKYA 2CETA 4UR9A 1BYDA 1WAWA 1Y7VA 3UEQA 2OYMA 2VRJA 5BRQA 4H7VA 5TD4A 1PBGA 4D6EA 2V3FA 1V0LA 3WF4A 2E8ZA 1R8LA 2WZHA 3QHNA 3AROA 4GQRA 2D23A 1RH9A 1OCQA 1MW1A 2VZUA 4IPNB 2JIWA 5CJ5A 1QI5A 1ESWA 2G3IA 1GJUA 4UQAA 3W82A 1ITXA 3ALGA 5GPRA 4M24A 3G6MA 3A3HA 3PTQA 5AYBA 1WDPA 3CTTA 4RE2A 1FFRA 3A4WA 2CERA 1V3HA 2CBIA 2WCGA 2UY4A 3MV11 3ARVA 5A2BA 2D22A 3BXWA 3D3AA 2ZX8A 4E2OA 4M56A 1E40A 2WVUA 3NSNA 4L4PA 5HBFA 2EBNA 1OT1A 3PZ9A 3OBAA 3AS0A 4BQ2A 1JZ4A 2WMKA 3RJXA 2W91A 1SYTA 4LYQA 4D6DA 4PCTA 1KQYA 1J11A 3CMGA 3O6AA 3MS8A 4UZUA 2VZOA 1JDAA 2J62A 3EDKA 5IDIA 1D3CA 5IXEA 3SCVA 1CLXA 3W0KA 2GVYA 4HZ6A 4CD7A 4CVUA 5ABGA 1H5VA 2W62A 1WB0A 2J7BA 3A4AA 1CXKA 4J7RA 4YHEA 1XHGA 2ZOXA 4DUXA 2WBKA 1XSJA 5A8PA 3AIVA 3AIBA 5IFPA 3ARRA 5A2AA 3GZAA 1HIZA 4RE3A 4UOJA 2GDVA 4JFSA 2WK2A 2V5DA 1NQ6A 1UG6A 1J10A 1XCWA 1HKMA 2DSUA 2UY3A 4UTFA 1J0YA 1KBBA 1EH9A 3QOKA 4CD4A 3SCTA 1C93A 3LPFA 3HMCA 2WVVA 3CZKA 4D6CA 1KXTA 3FAWA 3L4UA 4B3LA 3K8MA 2D2OA 3SURA 4CD6A 1B3XA 3POHA 3VIKA 4P7OA 1GQIA 3GXIA 4AISA 2XWEA 3AXIA 2VJXA 1W1VA 3UERA 5EMYA 1GPFA 4MTVA 3OG2A 4IISA 3WQ4A 4BQ4A 3VDAA 4Z2LA 2OYKA 4CU7A 1EQPA 1EIBA 2AOSA 1CDGA 3ARTA 5GNXA 4NSBA
chains in the Genus database with same CATH superfamily
1EP3A 2DZPA 3E3HA 3WNPA 2CU0A 2FIQA 1W1TA 4TXEA 4XD4A 3DG6A 3URQA 3KLKA 4S3BA 4BEUA 3TAOA 4NYUA 4I9TA 3FFSA 1JRCA 1GCYA 3ZT7A 2DUZA 3FSTA 5LYRA 1BG4A 3F5KA 2VFHA 1DE6A 2HBVA 4GQ0A 1QT1A 3QY8A 4DELA 3W2MA 2YCKX 3COTA 3U6WA 3VD9A 2QULA 4DIAA 4C1LA 5HUPA 4W86A 4D6HA 1VFLA 4LTSA 1FP9A 4TVDA 4GCAA 5KEZA 3GQYA 2XH2A 4X9YA 5FEPA 3ATZA 4FS9A 1N7KA 3ZVHB 1ZTVA 4YTSA 1S1PA 1QUMA 1I2PA 3ARQA 1UBSA 1W9VA 3AQUA 1X96A 3R7MA 5FIPA 1TYGA 2QKFA 2H6RA 3OVPA 2Z6IA 3AAMA 1SZGA 2ANUA 1MXSA 3L0NA 2XGBA 4AQLA 2VEKA 1KGWA 1W3HA 2FTWA 4AD4A 3B06A 4ZXLA 3DKJA 3CQIA 3T78A 1R2RA 3W7EA 3UJFA 2ZDSA 3WLHA 2VFGA 1R7OA 1GVSA 2FMNA 3W6LA 3VOCA 3WYZA 1PIFA 2HK0A 3AISA 3AYRA 1BEUA 2W9MA 4NNBA 2ZRYA 4RL3A 5E6YA 3AU6A 3FK4A 3UNDA 1V02A 5KZ6A 2EPMX 5J5DA 2HBXA 2CNCA 4MPKA 3EKLA 1S5MA 4WK9A 4UNIA 4EP8C 5BXSA 3CTLA 4KRTA 4R5EA 1NDWA 3N11A 4LFYA 3VA8A 1X38A 3TW9A 3L4XA 4A2SA 6REQA 4CNNA 1W5NA 2J66A 3AICA 1UZ4A 4L56A 3N9RA 3UF9A 1EF2A 3ZS4A 4IMDA 5LA1A 4O14A 1RK5A 1W9PA 3CGTA 1J5TA 1HJQA 4KT2A 3EXSA 3T40A 3IK4A 1PO9A 4B2DA 2PTYA 3L2IA 1EWEA 5AZ1A 4C1NA 1UKOA 4CEUC 5HPCA 1CTNA 1JCTA 5FI8A 4QG9A 4XV0A 4TR9A 4EAMA 1BXBA 7REQA 1MQRA 1XIJA 4Q8UA 2J6XA 3QLLA 4UBPC 5U4NA 3CM4A 1VEOA 2V3DA 3WH6A 1XGZA 1BVNP 4O28A 3MJMA 3TJ4A 5XIAA 1E9LA 4H6RA 1E15A 1ITQA 3B8IA 3REQB 3AJXA 2POTA 2G50A 3NCOA 2WSPA 1POJA 5K9DA 1YQ2A 4AWSA 3DFYA 2PI6A 1OZQA 3UQNA 5LIXX 4XAPA 4LH8A 4NZFA 3Q58A 1V6TA 3W7CA 4LUYA 3GB6A 2ZTKA 3CWOX 1JRBA 5KINA 4A4AA 5LGXA 4V33A 2PCEA 2OWXA 4J1OA 3BLOA 1ZP4A 2HWGA 1AZ2A 2O92A 4IPIA 1Q85A 3IJDA 2PLJA 4EXAA 1SZEA 5EMLA 4KWWA 1W17A 3PJWA 1U83A 3NURA 4R34A 1LOQA 3USBA 3W7IA 3F2DA 4TX8A 1EEPA 1AD4A 1IZCA 3LCIA 2DJXA 1OSEA 4R9XA 5TF0A 5F4XA 4MG4A 4Q4SA 3P67A 3KS6A 1HXJA 3C52A 1BYAA 4IIEA 3DFSA 1BHGA 1HUVA 3AIUA 2ZQ0A 1OZMA 1Z44A 1TRIA 4H8HA 1UZ1A 1V0KA 1LG2A 1H3GA 3HPSA 2J24A 2VXNA 3LK6A 2A3EA 5F2LA 4ZBCA 2G96A 5JH1A 3NPVA 1HNYA 1V3KA 3HO8A 3ZR4A 4XZNX 1FX6A 4DAIA 1T5AA 1TB3A 2PDUA 3HTWA 4GY1A 2F38A 4BZYA 5M17A 3BC9A 5DCBA 4EPKA 1XPYA 3UYCA 5I3FA 2XFFA 4PUUA 2FB3A 2EG6A 1XYFA 2CBVA 8XIAA 4EPDC 3GSMA 4ZO8A 2QLYA 4S3GA 1ISVA 1MXGA 2P5NA 4HPGA 1M9HA 3W28A 5FF4A 1B90A 1CB2A 4JN7A 3GIPA 3GVRA 2W0UA 4R7WA 5LGZA 3W1RA 1O5XA 1JCNA 3QBUA 1LWJA 3WO8A 2NLIA 1JUEA 1TWWA 3B04A 4B5VA 4DJEA 4JQ2A 3FN9A 1VPYA 4ZE4A 4YVVA 4FXSA 1ALDA 3CO8A 2DQWA 3LI1A 2BODX 1XIFA 1UD2A 2FFIA 3WLKX 4N4QA 4LV4A 3DHUA 2OZ0A 3UYIA 4B5UA 2ZX9A 4OBSA 5BXPA 2HSAA 4WZHA 4DM1A 5I5RA 3OYXA 5ECVA 1PKYA 4MFEA 2VP8A 4FAMA 1B30A 2R9RA 5DMYA 3KRZA 2OWWA 1FDYA 1NOWA 2V0TA 3NTYA 2ZXDA 3GZ3A 4Z17A 3A4JA 2GFTA 3VUSA 3P81A 1UR4A 4HZ7A 3VE7A 2RGMA 4HU4A 1O5KA 1ZALA 2YYUA 4DXXA 2PGWA 2D73A 1RCXB 2XM2A 3ICJA 4US5A 1L8PA 2O56A 3QHOA 6TIMA 6ENLA 5BXRA 1OFPA 1IF2A 4GIAA 3AHTA 4UNLA 1AW2A 3WQ8A 3IUDA 2VURA 2CCRA 5LSMA 4E3VA 1XUUA 4AEOA 3A6OA 3NR0A 1QVBA 1AL7A 2X0YA 3J7HA 2Z4GA 3GUWA 3HIJA 3GR8A 1P0NA 3BAYA 2IPFA 4DUWA 2A1YA 3APYA 5EMUA 3KWSA 3UY7A 1HJWA 2QNEA 1NJJA 4WY0F 3VOGA 2PC8A 5BCAA 4FNQA 2XIBA 4G1KA 2CBJA 1E0VA 2ZADA 1M7JA 1QO5A 3UVIA 3O63A 4LF1A 3PHAA 3TJLA 3LSCA 3MW7A 1NWTA 2GDUA 2IKJA 3AYSA 3BJFA 1X39A 3CZJA 1GWJA 4JTRA 3N4FA 1EJUC 3STPA 5BU9A 5I3GA 1EYEA 4AXKA 2PGFA 4HMCA 3UR2A 3V36A 1KKRA 2HK1A 2ZKMX 3N19B 2F9RA 3AXHA 4IMGA 3JZUA 4KETA 4IIDA 1W32A 3W73A 2NQZA 3R94A 4JTAA 3UW6A 1PYMA 3HGJA 1XSIA 3PC0A 4CNPA 1IGWA 1AA1B 3HG2A 2GUBA 3M7SA 3EOLA 3NJ3A 2JBMA 1ZBKA 3MO4A 1TPB1 3WLJA 1BQGA 2EF9A 1JG9A 4HZMA 4ZA0A 3L4VA 3M43A 1N8IA 3HURA 1FKXA 3BV7A 4XWUA 4H8VA 4KERA 1S46A 3N29A 4FNUA 3W7OA 4D8LA 3ARPA 4MWAE 3CV6A 2A7RA 4GOAA 1YBQB 4XISA 3ZR6A 5J8LA 4QHRA 5KETA 2R14A 4XZWA 4AD2A 4D9PA 2Q6ZA 2WVTA 2BGSA 1KFWA 1W3NA 4A3YA 3ATYA 3A47A 1SW7A 4DYEA 4DN1A 1JD7A 1C91A 4MWAD 2W63A 5G2WA 3WLQA 4IFKA 1AQHA 1PZ0A 2PGEA 2PTZA 2Z1KA 3AMGA 4H6EA 3VDGA 1UROA 2XTKA 3V3WA 1C29A 3B9NA 1GORA 3WD2A 3SSJA 3UESA 1BSIA 1ZENA 3PWIA 1VC4A 2J88A 1MNZA 4MAZA 1CYGA 3DX5A 3VMNA 3DG7A 1C92A 3KL3A 4F66A 1OD0A 4JTKA 3C0QA 2R91A 1ZSXA 1J96A 4ROPA 4ES4A 4DBUA 5C0QA 2Z24A 3Q67A 4L65A 1Q7MA 2C71A 5LHEA 4KIRA 3MSGA 3UWYA 4LPCA 2F2KA 2GQAA 3UR7A 4O1BA 1UWUA 4PL2A 4FP1A 1MW2A 1GTEA 3KX6A 4WLCA 1QCWA 2YJQA 3F5LA 3T0BA 1VF8A 5C9UA 3CZEA 4IL2A 1R7AA 2KX9A 2GVGA 4L61A 1AMYA 2HE8A 3ZJ8A 1E4MM 4IICA 2J7EA 4NF7A 1A5KC 4YMZA 5AECA 3K4AA 3U0HA 1DXFA 3GXNA 2GWGA 3K8KA 3V0UA 1G6CA 4E0CA 1OADA 3KBMA 4YYCA 4TO8A 4QP0A 1PIIA 1QPRA 1XM3A 2WZMA 2J47A 4IX2A 1XYMA 1RVKA 2O9TA 3B40A 1ZAIA 1A5NC 2D0GA 1J01A 3W6MA 4DWSB 3OW1A 3SN4A 3EBVA 4GX8A 1V77A 1A3WA 3SSZA 4MY8A 4PUKA 1JR1A 3RO6A 1JGIA 4OQVA 2GJPA 3BL3A 3G22A 4GD0A 5EGRA 3TFXA 1UWAA 2WPGA 1JCMP 2VCAA 1NDVA 2WSRA 3MYPA 4MY1A 4K6AA 2B7QA 4Q8WA 2PU1A 2E0PA 1XV8A 2ZZ2A 3SY8A 1X7IA 1UR2A 3IVUA 3VUPA 4R9OA 1BVWA 5AY7A 4J3WA 3W1QA 1NFGA 3GC2A 3FXGA 2ZX7A 4FEZA 5REQB 5E9AA 4H2HA 1TZ7A 1WZKA 1F6YA 3SGUA 3GNOA 1E9IA 2IW0A 1O5RA 4LCSA 4HSNA 3AYTA 5HJLA 1R3YA 3GVWA 1GKQA 3R1ZA 1NTHA 3UR8A 4WGHA 4PH6A 3T4CA 1JZ6A 2FDMA 2OEJA 2A4AA 1RVGA 4P7RA 3KOFA 5EA9A 5D9OA 4DJDA 2QIIA 2PWUA 1FWEC 2R24A 3MKVA 4IF2A 4C6LA 2HQAA 4GMEA 3P93A 1OX4A 3MY9A 1ZJBA 2V69A 2Z2AA 3EMCA 4MKNA 4JFTA 4Q4KA 4QRNA 3SJNA 3AZSA 3KL5A 3PUDA 1I4NA 3GTXA 2UBPC 4WY0A 5FEWA 3HV9A 5A95A 2CYGA 3HFYA 3SIMA 2ACQA 4H00A 5ABFA 3EPOA 4XUYA 1YEYA 2BDQA 3HMJG 1FDZA 5CBJA 2L5HA 1RCQA 3AHYA 4GJJA 1Y5WA 1FWBC 4W5UA 3C2EA 4AZHA 5AC4A 1H5YA 1ZRQA 4CCZA 3WBYA 2DQXA 4GUJA 1QK2A 4HPNA 2ZDRA 5DANA 3BH4A 3A4XA 1CIUA 3VD3A 2DDXA 4LV9A 2VGBA 4XAYA 1O68A 3LEPA 4MMWA 4MJZA 1QNRA 3RLGA 1F9CA 1B57A 1EIXA 1TE1A 4Q8OA 3B0PA 3QZ6A 2WM0A 2Y63A 3B8VA 2HZGA 3WH7A 4MYXA 3VGGA 1ICQA 2EJAA 1P48A 1BWVA 2AQWA 5BOOA 3RIKA 2OQYA 3HF3A 3WD4A 1N55A 4C7DA 1WKDA 3KEHA 1ZY9A 4A8LA 2HVNA 1LROA 1B3VA 2CZFA 5A6TC 4O8AA 1DWHM 3SW6A 3GHUA 1QJWA 4NXKA 1IXNA 5BXTA 3QF0A 4PUJA 3M0JA 4IUOA 3LSBA 1VBGA 2RAGA 3EOOA 3OLDA 4ATDA 2CXEA 4AD5A 3MP3A 4ATWA 4R3UA 4OBRA 1OCNA 1UKTA 4J3TA 1UD3A 1XIHA 2KAUC 3TC7A 4NX5A 3SN1A 3IGUA 4Z1CA 2GYIA 1GVRA 2YGYA 3W7MA 4FNRA 4UCGA 1AZ1A 4XZBA 3EMZA 2ZUWA 4LS1A 1IYXA 3DOPA 4Z08A 1JCXA 5I02A 3RCYA 2PTDA 4GUIA 2A2IA 3H2FA 4IFKB 3ZO9A 3P60A 4U3AA 2X41A 5I79A 2J7GA 4UTWC 2HNEA 3E96A 4RZ6A 1ZJIA 1UWSA 1L2QA 1WX0A 4QQUA 4Y2WA 4X3ZA 2ALRA 3ARXA 2GUUA 3MU7A 5HMSA 1SPQA 1KXQA 2CLKA 2EEXA 5CAHA 4XIAA 4L5ZA 1RR2A 5CC3A 1P7TA 1D9EA 1H50A 4Q3MA 3G8RA 1CECA 1IIGA 4CQDA 1OK4A 3UNTA 3LLXA 3KVMA 3ZXWA 3JUGA 1HTIA 2C1GA 1QWGA 2C6QA 1KBKA 1ZL1A 3AHVA 4Y9PA 4MWAB 4X9SA 3VGEA 1AH4A 1OGSA 4FF5A 2BBFA 2XGZA 2GVEA 1Q2RA 1AMKA 1GOWA 3NOYA 1HGYA 4FZIA 3M0YA 3GBDA 5LNRA 3MUIA 4UQ9A 4JICA 1EPVA 4X22A 2G3MA 3LV5A 1UKQA 1JYWA 4UTKA 4Q8VA 3PJUA 1IXQA 1E73M 3DGBA 1JFHA 2GJNA 1GZ1A 2PB1A 2V5LA 4W7UA 2CHNA 2DIKA 3CZGA 1CXIA 3D46A 4Q8QA 4W9TA 4ZQPA 3CIWA 3USZA 4B15A 2PZ0A 5AHIA 3S2JA 2E1DA 4XD6A 3HB9A 1CT5A 3W84A 4UNKA 4XBSA 4FXRA 3VNIA 1NWUA 5FJJA 4OIFA 3ZIZA 3GTFA 4MLRA 2AAAA 4LS0A 1GTHA 1O4UA 4H6QA 4LU0A 3V16A 1J18A 2Y8KA 2WZTA 1A53A 4FHAA 4R33A 1XLLA 4WY0B 3MCOA 1FWCC 1VBRA 3KRUA 1V3MA 1MMFA 2ABBA 5FJTA 2BNJA 2VEIA 5I3KA 5EFFA 2ZICA 2J7FA 1XS2A 5AYXA 5DF0A 3M47A 1UWRA 1E6SM 2B4GA 5AZ0A 3WMBA 1AG1O 2EPKX 4MGGA 3QPEA 1H1NA 1LRQA 3GWQA 4UIOA 4C60A 1R2TA 4ACZA 1M1BA 3PZQA 5LNVA 4CGTA 1UR0A 1O1HA 3A3WA 1VHNA 1DQXA 4AFYA 3FAXA 2QCMA 1UJPA 2O9RA 3TQVA 3A9IA 3LXBA 2E1WA 5HNTA 1XC6A 4AC7C 5JBDA 3LGEA 1E55A 4GX9A 1TIWA 3NQVA 1BRLA 3R0UA 3HGOA 4OOUA 3DG3A 2D24A 4S1FA 4CNSA 4JIPA 3B4UA 3T6CA 4IGMA 4JQ3A 5FL0A 4ZENA 1Z41A 2WKGA 4HT3A 4KW2A 5C9XA 3GBEA 1OF8A 3IJ8A 3P5ZA 2FB2A 4GYFA 3CHCA 2FGLA 2GGGA 2ISVA 3MMWA 5I2UA 1SMDA 4WXZA 4DPPA 1G5AA 4IMCA 1T8QA 1XRSA 1SO6A 4JFVA 1K8YA 2WCAA 2YBUA 3LCXA 5EKYA 4N9EA 4WCJA 1TPUA 4TUFA 3W29A 1NAL1 2W3ZA 3F03K 1K1DA 2X0SA 3UZXA 4DVOA 3CYJA 4ZSTA 5D32A 1QK0A 5D9PA 1L6FA 2DSZA 1DWAM 1XLAA 2OSWA 2YLAA 4GQQA 3GFYA 3LM3A 3WUFA 3H4XA 2VFFA 5D8ZA 1U30A 1H7XA 3NL6A 4KFNA 2QUNA 3HQNA 3WMCA 5I09A 2WCSA 4S38A 4J2MA 3AJ7A 4WR3A 4GZ7A 5D37A 3P7YA 2Q8XA 2OO6A 2FJKA 2QUVA 3LMYA 1IT7A 3R5EA 3GW3A 3CHDA 4LUSB 3O9NA 4S3CA 4Q4QA 3LG3A 1M7PA 4FOKA 3G1AA 4PMRA 1XRVA 1NWSA 5HULA 2EPLX 1QNQA 1X6NA 2E7FA 2HE5A 2TPSA 2VOMA 5BMWA 2Z1SA 2IQDA 4M5PA 3OA5A 2V81A 3VDCA 3S2LA 4QEHA 1SW3A 3M0KA 1G01A 2Z7KA 2Z29A 1L0PA 3PZNA 4QISA 4BWLA 1AL8A 3FEMA 4JTDA 4E2DA 5EBAA 1W1PA 1UQZA 2F84A 3GE7A 3WFLA 4U3CA 3S5SA 1VLIA 4JN6A 4H8UA 3OP2A 1XIIA 3D3FA 1XDJA 3I3EA 3CC1A 1C9DA 3TYZA 7CGTA 1NFBA 4EK7A 3LOTA 4KS0A 5BYWA 1GOXA 2ZE0A 1XICA 4D1IA 3GS6A 4YU1A 1I0DA 1GQJA 3FA3A 2VQUA 1OFOA 1UR8A 4PMUA 4QE5A 5LA0A 3EA2A 2GVLA 4HGXA 1CCWB 5C9RA 4BQ5A 1A49A 1MZHA 3ABRA 1FHLA 7A3HA 3GXPA 2R1MA 4Q8NA 1R3QA 3GLCA 1WYIA 2XVGA 1CXFA 1W0MA 2EXOA 4S3JA 3GAKA 4NL1A 3FDKA 1FH8A 2VGIA 5EMMA 4H4IA 2ATSA 1JZ7A 2PTXA 1YNQA 3CEPA 3PUEA 3O15A 1SFLA 2GUYA 4U28A 1QBAA 1XYCA 2OELA 3T0AA 3R8RA 3DCPA 1Q2SA 2BOFX 3TW7A 4RZ4A 1IWPA 3U4FA 4EACA 2X1RA 2DSVA 1PXGA 3BJTA 3VX0A 3KWXA 3AWNA 1QBBA 3CQHA 4EPBC 2EPNA 3RX3A 4O1DA 5E0FA 4DO5A 3T81A 2FZNA 4PODA 3L4ZA 2QR6A 3VNKA 1US2A 1FXQA 4DHGA 2TSYA 1U33A 4KPLA 2CKSA 3S2NA 1XRFA 3CJPA 2FH8A 4LVBA 2Z0IA 1MZRA 1OC7A 3C3NA 2Q01A 3EDDA 4J2PA 3TTOA 4ZFCA 1LZOA 4MJ4A 2YXGA 3DEQA 3RUBL 3PY2A 4JOMA 3OVGA 2G4FA 1A0CA 4XVEA 4PGLA 1XLFA 4K3ZA 2FQIA 4NRSA 1JQVA 4C6KA 1CX9A 3CBWA 3FYYA 5CPNA 4DX3A 3M0XA 5HXMA 1ZUAX 2A3LA 4WVXA 2C18A 5A8OA 2NUXA 2TYSA 1M3UA 3V1HA 1SMAA 3UG3A 3NPWA 3SRHA 3N3TA 1SM9A 3CWNA 2FZBA 3BE7A 4WXYA 1V7AA 4I9AA 2DVTA 3PUGA 3S42A 4M19A 4F48A 3BLEA 3KXQA 5LZLA 1T99A 4JTEA 4HB7A 5HNUA 5FF0A 4NIRA 2FDSA 5DRCA 1E6NA 4V1XA 3G1YA 5D2YA 4WX2A 4L9ZA 4HMNA 3BV4A 3JZEA 3VCRA 1PDYA 1QW8A 1GYNA 4GWEA 2GVJA 2WMJA 4N42A 4QDPA 3UVAA 4E2BA 4DBEA 4C6IA 2RH9A 4BWLC 2Y7DA 1OHLA 3TXVA 2PLCA 2J77A 5FJUA 4CNUA 3THAA 3KBSA 3L5LA 3WEMA 3EWZA 2AQOA 3GTHA 3CIXA 4PC8A 2FMOA 3VAVA 2PP0A 2QF8A 4JAWA 2FH6A 4LF2A 1QI2A 4F2UA 1WAWA 4ERAA 1Y7VA 1DJHA 3PB0A 3UEQA 4G7EB 4LUSA 4YWSA 2AMXA 2PEVA 3BMXA 1DOSA 3PAJA 5D33A 3R0DA 3QPYA 3NVDA 1OCQA 1MW1A 2QIWA 1DORA 2AGTA 1XBYA 3FGCB 4FNTA 1ESWA 1C9WA 3W82A 1ITXA 4AU0A 4O4WA 1UPPA 5AYBA 3A9BA 4JNZA 3UGVA 1R3SA 2CLOA 3A4WA 4Z1DA 1GKRA 3RAOA 3ONBA 4DI8A 2QDGA 2NV1A 3H21A 4FXJA 2WCGA 1ADDA 4KEZA 2JKAA 2NXHA 4M51A 4IIGA 2D22A 1ZAHA 1NY1A 2EAWA 2EHHA 4JY8A 1E40A 4L4PA 1HW6A 4O0ZA 1VHCA 3PZ9A 3ENLA 3OBAA 4RLIA 3W87A 5F2IA 4D6DA 2XIMA 2Z00A 3PULA 3O6AA 4GY0A 3MS8A 4UZUA 4BKNA 3OZMA 4MZ8A 1PWMA 2DZSA 4WSHA 3GG0A 1RJRA 4LUJA 1DPMA 4C1KA 1TPDA 2V6AA 4CVUA 3WJYA 1H5VA 4OECA 3A4AA 3FJLA 1QMLA 3D6NA 1RJQA 1EX1A 2PLMA 3GW0A 3H55A 3AIBA 5A2AA 1HIZA 2GZXA 4RE3A 1PKLA 4QS5A 4UOJA 2QAPA 1F7BA 2GDVA 3F4WA 1FY6A 3NM1A 4C6QA 3GDTA 3TDFA 2UY3A 2I14A 2Z6JA 3SCTA 1EUNA 3H53A 3TQKA 3EWDA 3QGKC 3UY8A 4D6CA 1B9BA 3L4UA 4KCUA 3M5XA 2D2OA 1EJSC 3RLHA 1TTQA 3V7PA 1U22A 3POHA 2NWRA 1YPIA 3CS2A 5AKQA 1GQIA 2P0OA 2VGFA 2X7VA 3P62A 1L9WA 3O06A 3OG2A 3WQ4A 3STGA 4BQ4A 1H1YA 1TV2A 5CSRA 4PE8A 4YTTA 1KA9F 4CU7A 5DXXA 5FESA 2CC0A 4N7QA 1KC7A 1KRMA 1CDGA 4QSHA 3T05A 3H4GA 3KBWA 5GNXA 4NSBA 3PTMA 2ZA3A 3W7PA 3BPWA 3UJ2A 2C8NA 1ZHAA 5CJNA 1M53A 1J2BA 3N4EA 5T91A 1NDYA 3A64A 4ROQA 2EGZA 3K46A 1SFSA 1LL4A 2GGIA 4HNOA 4LGXA 3OYZA 4XTIA 4F0KA 1RSCA 5HJYA 4JTLA 4MNKA 2GOUA 2OGJA 1QPKA 2Q09A 4Q7NA 2E9MA 1TV8A 3GVQA 3G1VA 3HJEA 3VCNA 3TTEA 1IHIA 5TQLA 4H04A 3BWWA 5HANA 1QR7A 1C8VA 2VQTA 1WOAA 1TELA 1DP0A 3SFWA 1JJKA 2BG5A 3A24A 3UT0A 4KFPA 1A47A 2BY0A 5JXQA 5KZMA 3HG5A 3EKZA 1YBQA 1KTNA 4NHVA 3ZT6A 1TPC1 4XZIA 2A79A 2YL8A 3EX1A 4UMAA 3KP0A 4RNJA 2WJDA 1R3WA 3PFMA 3WH9A 1P1XA 4E4PA 3S46A 1W1A1 1JPIA 1LUCA 2PDJA 3UA3A 3AMLA 1AODA 2PSNA 1UP3A 5KZEA 1V6WA 1MW0A 4MPQA 2ZRUA 3N6QA 4HD5A 3C86A 2WHMA 1OYBA 2YA2A 4FI4A 4MFDA 4G6CA 2GK1B 3VKDA 1VGAA 4NUWA 4HN4A 1A0EA 4ATLA 3HQ1A 2NQJA 3M4HA 1ZBWA 2GLKA 4LX4A 1EB3A 3M9YA 4HZ8A 2OMAA 3CV2A 1EDQA 1LBLA 1I1XA 2Y4SA 3S5NA 2ICSA 3V5FA 3C0JA 4F2TA 2FHCA 3VM5A 2YFNA 3WH8A 1KB3A 1ZB5A 3F4VA 4MAVA 1ISYA 5D38A 4NKCA 4A2RA 4C6DA 3LU2A 4I8YA 4NJGA 4A35A 1KGUA 4XO6A 1W9BM 4DUOA 5IOBA 2Z28A 4KCWA 2E4TA 5E09A 1Q6QA 4TV6A 4DJFC 3WEZA 1X6UA 5AFDA 3LQLA 1G67A 2CPUA 2E9LA 3ZVIA 3L12A 5G1YA 1RPKA 1A4LA 4J27A 4NG3A 2XIIA 4DWSC 3W75A 4UTTC 3IARA 4ZZ9A 3MA8A 3ITLA 1JCLA 4GYJA 1TREA 2CLHA 4QTGA 2QEZA 3VZZA 3TC6A 3B0YA 5HJXA 1TA3A 3WEOA 3T7VA 3R8HA 3FOKA 3MT1A 4PCFA 3HPFA 3LRMA 4QAIA 2PS2A 5AB3A 1UCWA 3S1XA 3AIWA 1LBFA 1QATA 5AC5A 8CGTA 5EMJA 1VJSA 1XRTA 2CXGA 3GXFA 1OFDA 2ZZ3A 2D20A 3IK2A 4FO4A 5A8QA 3PVFA 1KR1A 4NJHA 3GFZA 1TUFA 4F9DA 4DWDA 3VOIA 1ONWA 2ZUVA 3O1NA 1VD6A 3DIPA 2OZ8A 2PDXA 3I4KA 1SO4A 1EO5A 2VCBA 4BY3A 2VELA 1FH9A 2XH0A 1XH2A 5REQA 2XG9A 3CH0A 1VFTA 1B4EA 3SN0A 1QHPA 3W27A 2ZIDA 2YCEA 1PPIA 1RZMA 3O3RA 3V5OA 3BK0A 4UOZA 3SCOA 1B3ZA 4UOQA 2QJHA 3RLUA 3TNBA 2J75A 2WMIA 5JUVA 3NQDA 2VGGA 1DHKA 3NYDA 3W22A 4WHBA 2FGBA 2R8WA 3LQGA 3QKEA 4Z2KA 3XIMA 1F3TA 2NVCA 3BJSA 1I1WA 1F3EA 3QJAA 4K8HA 2DUAA 1BAGA 1EHAA 1I2RA 4Q4OA 4QDWA 2PLKA 2RKXA 4A22A 4EPEC 1WQ5A 4JTSA 2V68A 4OOZA 1V0NA 5F4WA 4CU8A 1LM1A 4ZODA 1JI1A 2XZ7A 3VKJA 1FOBA 2TRSA 1HN1A 4JYFA 4AWEA 3FX4A 1LL6A 1TV7A 4JX4A 5HPOA 4DF2A 2ISDA 3W70A 2YCIX 5I3IA 3R10A 1W56A 1W54A 1LT7A 3IIOA 1TWZA 1UUQA 3W2NA 4RZBA 2HVOA 3S0CA 2ZC1A 1Y65A 2IUZA 2VT0A 4O53A 1NWRA 2GSHA 4REQA 4O19A 1RHCA 1V5XA 2I17A 3H22A 2X1IA 3BGJA 3G1SA 1HG3A 4EXQA 1QNVA 4D6JA 3GXDA 4D8AA 3WK1A 2QCCA 3PJXA 2ZWZA 1MQQA 2ZXBA 2WNZA 3KHDA 1GYLA 3UPMA 1Q4WA 4ORIA 1ECQA 4ZTYA 1Z89A 2X42A 2PWHA 4HN8A 1W5QA 2WKLA 4GGHA 4C90A 4QLJA 2X05A 1JF6A 3AIRA 3MI6A 4PA8A 4CNTA 4YYFA 2CHOA 4AZ5A 2QMJA 5CKSA 1FCVA 3K5XA 5BOEA 4TTUA 1X98A 4PUEA 3N2CA 3TX9A 3VNJA 4DWSA 1DWJM 1K70A 2C1IA 3RPDA 3MYOA 3BTNA 3AZTA 1UR3M 4QROA 1OX4B 4PB3A 2J9ZA 1M7OA 1ZQ5A 2J9XA 2QVNA 1DKWA 1HJSA 3VKKA 4V27A 4UFIA 2CZVA 4NASA 2VC5A 1RV8A 5EBUA 3D5HA 3D47A 3KDOA 4Q4RA 1EC9A 2HNHA 2XWDA 5A69A 3AWOA 4X2PA 2YFOA 3DERA 5ABFB 2V82A 1DWGM 2R82A 3V4BA 3VOJA 1M5WA 5D8WA 2A3HA 3TR9A 4LAMA 3WLTA 4Y96A 1J0ZA 2HRWA 4DZIA 4RPQA 2GJRA 3R11A 4DF1A 2C1HA 1OVDA 2WNNA 5A8MA 3PJTA 1XINA 4JIHA 4ZO6A 1PV8A 1E5NA 2HISA 1TX0A 2DIJA 4GFSA 4NAFA 4PUNA 3K30A 1W1ZA 3UG4A 1RP9A 3RR4A 3BOXA 3F5JA 3VNDA 2RUSA 1M65A 3LD5A 3VD4A 2Y89A 2J7HA 4QITA 1F4HA 3B8SA 3CUGA 3ZJKA 4XD5A 1H62A 3VTRA 3MSDA 4U31A 4L9XA 4X0VA 4E8CA 4WDUA 1MUMA 4OKDA 2BB0A 2QUMA 2UZ9A 2YCLB 4MJ2A 5CZKA 1XD0A 4GE8A 2XN0A 2QJNA 2BS9A 5CG0A 4J3UA 1PCKA 3SUWA 3VIMA 3OIXA 3NSMA 4M3PA 3S1GA 3QQWA 4O11A 4GNKB 4MUPA 4AZCA 4LRTA 3R2GA 1VFSA 1T6MA 1J4EA 1XPGA 2AL2A 3GO2A 1VPXA 5JH2A 1PX8A 3LPOA 1KXHA 3S5OA 2PWGA 4JTFA 2DT2A 5I07A 2A3CA 3DC0A 4WRHA 4AD1A 4B4FA 4P8VA 4LEQA 5EPDA 1OYAA 1W9UA 4RV8A 1S2UA 2VEMA 4I5XA 3TTSA 1Q63A 1VFMA 1DJGA 2J6VA 4ZOCA 1TVNA 4HNCA 3EOSA 3EX4A 3SR7A 1LL7A 1ZNNA 3GTNA 2NUWA 5JBFA 4CLMA 3I3BA 2DVUA 1XC4A 4MZ1A 2QDDA 2ZE3A 3SCSA 1TQXA 4GYPA 2CLIA 1F6PA 3UWUA 4W93A 3JU2A 4PCNA 2WC7A 1H11A 1BKSA 3W2LA 1NF0A 1RLDA 2I56A 2Z1XA 3CIVA 3B9OA 5DN1A 4GH1A 1PKMA 5GNZA 1G69A 4URIA 4IQEA 2HV5A 4GBDA 3EA1A 1YMYA 3DZ1A 1YDVA 1EOKA 1GQLA 2BOEX 2IXUA 3ISIX 1Q6DA 3TZFA 1QAPA 3F4DA 1JYXA 4GABA 4EX4A 1FBAA 2POZA 5AYYA 1O5QA 4RV3A 4JTJA 4D8ZA 2VEFA 3K8LA 4JFUA 5C6MA 3C8NA 2B31A 2BY3A 3MHGA 3AXKA 4FOJA 2ATMA 4LNCA 5I78A 4FIQA 1YX1A 2WSYA 1HJUA 1BRLB 1UOZA 2DU2A 4FA3A 1IQ8A 1RAKA 4IJCA 1KM2A 3LDVA 4K36A 1DJWA 2IKHA 1V51A 1VEPA 2PCQA 4M82A 1E6PA 1KKOA 3FIGA 5I3DA 1P7TB 2J79A 3RRAA 4XKYA 2R1PA 2NXIA 3SQLA 4P7LA 4O1CA 1GNXA 1J93A 2OG9A 1S2TA 4N0RA 1UKSA 3BAXA 4H7CA 2QGHA 5CPSA 1B3OA 3DENA 1W5OA 5L6UA 2PPGA 3BLFA 4X0NA 4FX8A 3FEQA 3VMOA 3UR5A 4S3EA 1U1UA 4K8GA 1H0GA 4ZQMA 1CXHA 5CEWA 1E43A 3ECQA 3PZIA 5H8MA 2FZ8A 5LIYX 3GVGA 1NFPA 1Q6EA 1TJRA 4AVFA 4C1NB 1K9FA 4W7VA 3MKCA 3XISA 3WX7A 3M44A 3T4WA 2ACRA 2D1ZA 3TOYA 8TIMA 3NQFA 3RO8A 3WLSA 4GO9A 3ONCA 3N3MA 4GJ1A 1SU5A 4PEEA 1K3UA 5EL1A 3CUHA 4UQDA 3TE9A 2ZXAA 4LYKA 1QTWA 4MOZA 5DX7A 1K8XA 1VYPX 4O13A 1NSJA 1XBXA 1ICPA 4KRUA 4WGXA 3ITYA 4GI6A 4RNIA 4OUEA 2VZSA 2DGAA 1P43A 1DQUA 2YPIA 1F73A 2QPXA 4JCMA 4AF0B 4CEXC 3C4UA 3EPMA 3KM8A 3MVIA 4AZIA 4RE4A 3OQEA 3BO9A 1ISXA 1KO0A 1IZKA 3FA4A 1S39A 4B5WA 1M7XA 4ECLA 1JIBA 3BCJA 3CEUA 1JCYA 3OHMB 4JTUA 4JIEA 3UWQA 3L68A 3IRSA 1HKVA 3S9YA 4XSMA 4UZSA 3OODA 2INZA 3THCA 3TJXA 4JL1A 4WIWA 5LA2A 2RHGA 2QV5A 4QXIA 4LALA 1NVMA 5CGMA 3EKGA 2JGQA 5BWFA 2PWDA 2QYGA 1UOKA 3NEVA 5FCZA 4OWGA 4TOQA 2FYMA 3IPWA 3OO2A 1Z6KA 2GDQA 4IT1A 1VIWA 3BGGA 3VCCA 1CXLA 3A22A 1YADA 1H60A 1KM3A 1WOBA 3C2FA 1MQPA 3POCA 2VI0A 2VWSA 3GDBA 3ITCA 3VFLA 3VYLA 3KRSA 2PDPA 4YVXA 3QQ1A 2YCLA 1S5WA 2DSKA 4C6NA 3SY5A 4JHMA 2ODOA 3O16A 1LDCA 2NSOA 5IHRA 1S2AA 3BW3A 1PUDA 5BW6A 3K1DA 5D9NA 1GHRA 1G7UA 3URAA 1Q13A 3C56A 4YTRA 3VU2A 3A21A 2H9AB 2VDGA 1O7AA 2OTDA 1A5CA 3QMTA 4AEFA 1W6TA 2I5QA 1JL8A 2P8BA 4LBSA 3T2PA 4N6EA 4CNOA 4QJ4B 4GI9A 1DXEA 1RBOB 1WKEA 2PRHA 4JN8A 3THQA 1V6XA 2ISSA 3BQ5A 3GG8A 5CH9A 4Y9AA 1B1YA 3MZNA 5TBOA 2VCCA 3W86A 1TJ0A 4OHQA 4D2JA 4JDYA 1R5YA 4PTMA 8A3HA 4OGZA 2E8YA 3R43A 4L1XA 4H9XA 5I23A 2VC6A 3BAJA 3BCDA 1M68A 3E49A 3I7SA 4PMZA 1TZZA 3GXMA 4H9MA 2KZHA 3H70A 1AJ2A 3ARYA 2QMKA 1SJBA 3BQ6A 3DHDA 5IBXA 3LA4A 4TV5A 4KFOA 1DJQA 3TCEA 5JBEA 4ZL1A 1EJTC 4MADA 5XINA 5CQ1A 2GQ8A 2W4XA 4C6OA 4OV4A 4AB4A 4WSJA 5G4HC 1JD9A 4US5D 3GC4A 4ML4A 3VOFA 4DZAA 3SUVA 1V08A 1Z42A 3VX1A 2PRMA 2WV8A 1H7OA 2VEPA 1OFRA 5K7JA 1Z8AA 6A3HA 3AHZA 4HOWA 2J7CA 4MUZA 5FACA 2JE8A 3TP4A 1RK6A 1VKFA 5HNNA 1EC8A 2XH7A 1QI4A 1IGSA 1CWYA 2DIEA 4AHPA 5LIWX 4IWWA 1E1CB 2PDFA 5I3HA 5FJRA 1UIPA 1K7FA 3LRKA 4JYEA 2Y5JA 4GK8A 1LCOA 1VJZA 3M7WA 4O1AA 4Z2GA 2GPTA 1O95A 4Y7EA 3UJRA 2CLEA 4ZQCA 4ZQRA 1I45A 2ZUUA 1QNOA 4LYRA 1X1OA 3NQ2A 3EWUA 3NUKA 1FFQA 1DQWA 2WMFA 3SCWA 3WNKA 3OIHA 3CAQA 3N04A 7TIMA 1W3JA 3WUBA 1H7NA 1PB0A 4KKXA 2JEPA 1TJ2A 1J9YA 1SO5A 1OK6A 1XCXA 1I9CB 4TMBA 1WKFA 4POCA 1TPWA 3CQKA 2VO5A 4AHQA 1Q45A 1AH3A 1B0IA 4V2XA 4I9JA 3N2XA 3CAVA 2VM8A 3DFQA 2NWSA 1RD6A 3EGJA 4ZEPA 3N34A 4W8LA 3AMDA 2UWFA 4PMDA 8XIMA 4GCXA 2ZZ5A 3TC3A 3THUA 1YTEA 3M46A 3NOEA 4F4RA 5M1TA 4GI8A 1KV5A 1Y0EA 4GACA 2OSXA 2V3GA 1G1YA 1XLGA 5FL1A 2CLLA 2LLEA 5CC7A 1FTXA 4BR1A 5CZTA 3W2KA 2OOGA 1QW9A 2WQDA 5CSUA 1OFEA 3MBFA 1IEXA 3OB8A 1TTPA 4PTXA 2ZX6A 4C7GA 1JPMA 1KBLA 3RDKA 1QOPA 3ZJ7A 2NQ9A 2B7OA 4JKMA 5D09A 1XWYA 4UTIA 2B7NA 2D2JA 2QJMA 2P50A 3NQ8A 4ZOEA 3VVGA 3H26A 1W8SA 4H41A 2DV0A 1ADSA 1OINA 1VB9A 1GUVA 3EWBX 2AKMA 4K37A 1F05A 1ZBVA 2YLLA 1PTAA 4IG2A 3OBEA 1R46A 4XTDA 1W3TA 2QQ6A 3UETA 5D2WA 1K4HA 1Q3NA 1B9ZA 4O15A 1H2JA 3WF0A 4OT7A 1KFJA 6XIAA 4NJKA 3UCQA 1EL3A 3LZ3A 4M6PA 5MKGA 4IHCA 4ZB5A 1HKIA 5IBXC 3DFOA 3ZVHA 2HROA 3QR1A 5D02A 1OBAA 5M3WA 1FWFC 5CXPA 4P2VA 4IP7A 3LLFA 4UCFA 3B0VC 2ZXQA 1MDRA 2E67A 3W1XA 1GPWA 1D3HA 1TE6A 2ONEA 5A6BA 3B97A 4WEVX 1IT0A 4GY7A 5I06A 2BXZA 5I03A 3ZJ6A 3W1TA 4HPXA 3KBJA 1F3XA 5E6ZA 4Q6XA 1EXBA 3ZLHA 4PRRA 4ZE5A 3FHAA 1JXJA 3LYEA 4YLWA 3WF1A 4LAKA 3TSMA 4PEKA 4FR6A 1E6RA 3GNXA 3UXKA 5HA7A 3VE9A 3V35A 3SCPA 5K9XA 2YOCA 3WELA 3U7VA 1PX3A 5DLCA 1V03A 2DZWA 5DT5A 1XIBA 4KGLA 3STEA 4F8XA 1DJYA 4AZBA 2OWCA 4WSKA 2GGEA 5BOFA 4FLOA 3WLPA 3H6OA 4GJIA 1MVYA 2G5WA 6REQB 1A5OC 5U7SA 5HMFA 2VHLA 1A5MC 3WLLA 1DJXA 3SAZA 3LHTA 1DIDA 4LYPA 4PBGA 2IQ0A 2MUCA 1BPLB 1MI3A 4X60A 5DFAA 3CXOA 1KW1A 3VNYA 3G5EA 1NEYA 2X30A 1P0DA 3CHFA 2HMCA 4MB4A 1YKWA 3C2VA 3ZR5A 1JNEA 1VH7A 4L4LA 3OZPA 5A6MA 3RM4A 1OYCA 1WO2A 4O0KA 3PBWA 1VFUA 1R3VA 4LVAA 2XGIA 1FRBA 4V15A 5I7GA 4HU3A 2P76A 4MDOA 3AS3A 1TVPA 4M8UA 2EKGA 2NSXA 1LYXA 1NIUA 1YDYA 5GJNA 3IACA 3IRDA 2BX7A 3W1UA 2E6DA 1V0MA 4GIRA 2OX1A 1TX2A 1HKWA 1UA7A 2RDUA 2CZEA 2WYSA 1OFAA 1UW9A 4ZQOA 3S6TA 1YPXA 4RDZA 4PTVA 4M6VA 2V2HA 4MB3A 2V2CA 1UB3A 3SUUA 1CXEA 1Z32X 3NQ7A 4Z0JA 1WCGA 3PM6A 1EYWA 4PRWA 3TAKA 4LUTA 1XIDA 4WKHA 4R53A 1S2VA 4AW7A 1GYMA 2ZUSA 4PTNA 2VKZG 2ZZ6A 2OB3A 2H3BA 4P5UA 1SR9A 2H8XA 3UP8A 1UR9A 4L4MA 1G7VA 1GVIA 4Z42C 1SZNA 4B91A 3IIVA 4RXFA 3NXLA 2DPEA 2ZRWA 3AZRA 1XL9A 4QBXA 2OOFA 3G8EA 4W4QA 5C9WA 3CZLA 1T40A 1TV4A 5FSDC 2NXGA 1LTDA 1RPXA 4IIFA 5DBUA 2YYTA 3VNZA 4C5YA 2WLZA 1GQKA 1OCBA 2R94A 1THFD 4RDYA 2C14A 5KSWA 3PPCA 3TLLA 4X61A 3QH2A 4GHRA 2V5JA 3RMEA 3QTPA 4W89A 1UP0A 3A3XA 1P5BA 1OFBA 1ONEA 4WOZA 2BASA 1DXIA 1QNSA 4YIWA 1US3A 2QV4A 4L9YA 4HIBA 3MCNA 2XSXA 9XIMA 4FNSA 3ZT5A 1FWGC 4JTIA 3LM7A 2NT0A 1HX0A 2VD8A 2XM1A 3TVAA 3T08A 1MDLA 1XLCA 2G4JA 1E4IA 2WBGA 1F74A 4I8DA 1JFXA 3PWGA 1IEVA 5G4WA 2X1TA 2NQ5A 2OR2A 4R7OA 3C0SA 5CSYA 4F0MA 3V18A 4FLQA 2INFA 2RDTA 3CLWA 2OKOA 2X2GA 1IV8A 1XKJA 2VL4A 4ZOBA 3RK8A 2XN2A 2F7FA 3GH7A 1BYBA 3MUXA 3OTRA 2AAMA 4ICNA 3RRXA 1WKYA 2CETA 1BYDA 3GDRA 4JX6A 3SRFA 4ADSA 4GH3A 4IX0A 5TD4A 1U5VA 3GIQA 1R9XA 3ZZ1A 3BARA 5HAOA 4KRZA 3AALA 3FYOA 4QNWA 2E8ZA 4KWOA 4IMEA 3CAKA 3AROA 4Y6GA 1WUEA 3SGZA 4IG2B 2PDQA 2PDBA 1FHVA 1O94A 3ALGA 5GPRA 4ONVA 3PTQA 1WDPA 4RE2A 2GGHA 5BZAA 4HPJA 4JTTA 4MZYA 5J04A 3CL6A 4G7FA 5CGQA 4DI9A 1RUSA 4RUBA 5A2BA 3MO7A 5DBTA 3ELFA 3KZPA 1OX5A 1R9ZA 4MY9A 4M56A 1OY0A 4Y9MA 2EKCA 5HUOA 3M5YA 2BLEA 1OT1A 3SQMA 4BQ2A 2WMKA 3UZ5A 1ICSA 1EP2A 2XZ9A 1VFHA 1B4KA 3CMGA 1R3RA 3MZ2A 2QCLA 1D3CA 3O6CA 5IXEA 3SCVA 3O07A 3W0KA 1SFTA 1O12A 4HZ6A 3K1GA 4Y8FA 1WB0A 4DJFD 1FWWA 5G5IA 1CXKA 4J7RA 4YHEA 4XAFA 2PRLA 2ZOXA 3IJ6A 4ZO7A 3NWRA 1XSJA 5A8PA 4AUBA 5IFPA 4ALDA 1ZGDA 4HYRA 2G0WA 3S1VA 1NQ6A 1P0BA 3MUCA 2DSUA 3ABXA 4CD4A 3LPFA 4YL2A 3NQ6A 2WVVA 3LBOA 5H2ZA 1L6YA 3IWPA 2CLMA 3QYSA 1A5LC 1KXTA 3N14A 3H8AA 4B3LA 2V5KA 3K8MA 1WDWA 3SURA 4DZHA 3QZEA 1B3XA 4ZB0A 4AX6A 4Q8TA 1KTBA 4AISA 1R6WA 5RUBA 2XWEA 3WLRA 1EC7A 3V0TA 1GPFA 4C6JA 1QFEA 2D69A 4IISA 2YXXA 3SRKA 3EB3A 4ML9A 5LIUX 1K7EA 3I6RA 5ABTA 3HGSA 3ARTA 1O60A 3RPTA 5FA5A 1R38A 4ZB2A 1VBUA 4KGJA 4N02A 3G1RA 4B3ZA 4PFHA 1F8MA 1MYRA 3TCSA 4GISA 4HPHA 3WLNA 4AZ7A 4EE9A 5T9CE 5HMDA 2JQXA 1M6JA 2PDKA 4W5ZA 3SUSA 4GC3A 4GC4A 3GR7A 2PD5A 1SR0A 1DJNA 1H0IA 1TJPA 1XDMA 3UA4A 3S1WA 2QS8A 5CZJA 4CD8A 5BU6A 1EX5A 1Q8JA 2ZZ4A 5HK4A 2G3NA 3E6EA 3T0TA 5DT7A 3DI0A 3W7LA 2ALDA 1DEDA 4PBEA 2XPKA 3B05A 3QRHA 4JIQA 4J3VA 5CPQA 1XLMA 1ENUA 1JYNA 4DAFA 2HXTA 4D6FA 2GJLA 2JKPA 3W1PA 2YL9A 2X8RA 1ZZMA 1VYRA 4IGSA 9XIAA 3P80A 5EFDA 3A23A 1L6WA 3ITTA 3TSDA 9CGTA 3HFTA 1XQKA 4DRSA 1XJBA 1V02E 3RX4A 4P8WA 3RFAA 2Z1VA 5D2XA 3N13A 1C7TA 1W3IA 3FKKA 3BGAA 3EEGA 1UJQA 2E25A 3LHYA 4ILSA 1VR6A 1GOMA 4ADTA 4W8AA 2MNRA 4O52A 1K03A 1GK8A 2BHUA 3AI0A 2WHLA 3WD1A 1JDCA 1TR9A 1KM1A 5F4SA 2OLSA 3PZGA 4IP5A 5K2ZA 1H7RA 4WJEA 5C7VA 3GKAA 1SJAA 3M5ZA 3CQ0A 4IFRA 4KF1A 3MWCA 2PDIA 4W7WA 2VC9A 3ZQ9A 1GOQA 5EMKA 2WMHA 4AX7A 4NP7A 3PTDA 5D04C 5T8GA 3KRBA 4HHPA 3ZSTA 3IAPA 3WBWA 1AQMA 1CEOA 1PSCA 1CGWA 4LVDA 1NM9A 4K7VA 1LORA 1EJ7L 3KVJA 2CWXA 3FVDA 4AZCB 2DT0A 1KCXA 1S5TA 1HO1A 1A5SA 3WH5A 4C5ZA 1TFVA 3QM3A 4C6PA 4IJRA 2ZC8A 1K7XA 3C5QA 1LP6A 1Q7ZA 5CC5A 1MNSA 1TRDA 3NL3A 3H12A 3E1F1 1E6QM 3KZSA 2QDHA 3FJ6A 3TONA 5M5DA 2VZVA 5A5WA 5C7HA 5T9BG 2JKEA 4AZ6A 2AMGA 3QC3A 5F2GA 1S5VA 4JQ4A 4CQ9A 3TOPA 3HPAA 5C5YA 2WXDM 4DPQA 5AHNA 1J0HA 3K2GA 4J40A 2DZVA 3PAOA 1Z9AA 2YBTA 1RBLA 4PCSA 2WZIA 4Q7IA 4M7SA 3I65A 1G94A 2OLHA 3L4YA 2E09A 3PK7A 3WQEA 1GGOA 3L4WA 1V8EA 5DCEA 2QJGA 5HATA 3U2CA 4EWND 3R58A 1WDRA 4GNVA 4I3GA 4Q6JA 4UQBA 4A3RA 5LNWA 3UWEA 1V3JA 5AHLA 2W61A 3VGHA 3ZWTA 4HHMA 2H3DA 2WSKA 3W7JA 1XBZA 1W8GA 1SO3A 4LWWA 1J6PA 4LBUA 4QG8A 3L65A 1I2OA 1JGMA 5K4XA 1NP2A 3LY0A 3VDHA 3RITA 4DJEC 5E93A 4XD3A 3EWWA 2PWEA 1QHZA 2PA6A 3IAQA 2JEQA 2IKIA 1VCGA 3NO3A 3W6YA 4UTMA 2E3ZA 3KUMA 4FLSA 5KITA 3INPA 4NX0A 3FJ4A 4AYSA 3APTA 4H6KA 2C0AA 4JD4A 4H19A 4DJED 5DMLA 1DE5A 1GJPA 4LBRA 3DC8A 3CH9A 1Q6LA 1VLWA 2NV2A 3B8DA 3LMZA 3WBEA 1HL8A 1EDGA 1HKKA 1E3ZA 4NZ3A 2OX4A 1UC4A 4GZJA 2HDJA 4Z2IA 4H83A 1P4CA 4QM1A 1F4AA 1OIFA 2J4GA 3I7RA 1XKYA 1E5JA 1V3LA 1SQ7A 9RUBA 4YTQA 1B54A 3HG4A 4HU8A 3TUUA 1WUFA 4RW5A 1LOLA 3H2CA 1UD6A 3NSXA 4PSPA 1VS1A 3DESA 3GD6A 5CG7A 3SCRA 1GZGA 4DBSA 2O4QA 3TEVA 4DUVA 1E1FA 3ES8A 1A3XA 4CQAA 1LLOA 1OFQA 1V6UA 1G4SA 4O4VA 4NYYA 1WBJA 1TCMA 3DYOA 2DZTA 4G7EA 3WDPP 3P14A 3TKFA 3UPWA 3CPRA 1EJVC 3FHQA 4GYKA 1Z3NA 4QFUA 3N18A 4TTGA 1R47A 2ZBTA 1K6AA 1KRBC 3KTSA 3ES7A 4JXCA 1PZ3A 3BG5A 3FXYA 4QAWA 3GHRA 2WPBA 4LY8A 3NZGA 4BF7A 4C6BA 1PTDA 3VFCA 4AG0A 3DHPA 1KCZA 1US0A 3SM0A 3RMJA 4NILA 2FVKA 1GVEA 3NZ1A 1OEPA 3CPGA 5HR6A 3APGA 3SIZA 1K77A 1BKHA 2Y5SA 1Q6CA 4BI6A 5BWAA 3H7VA 3A5FA 3G1HA 3EEZA 1J6OA 5EB8A 5H8UA 3LUTA 4CQ8A 5SWUA 2B81A 3N2OA 3S2MA 4PB4A 4PB5A 3BICA 3GIYA 1TO3A 3NQGA 1I75A 3LXCA 5A8GA 2IS7A 5IM51 3M0MA 3CHEA 1UWIA 2YIHA 3DFHA 1EQCA 1UHVA 2R1LA 4IXHA 1BVZA 1FQ0A 1QW7A 3VIJA 4RDWA 3WSUA 2XFRA 3B0UX 4LVFA 3ALFA 5CBIA 5G2IA 4JKKA 1UP2A 4FLRA 3VD5A 5B80A 1PAMA 4MNMA 2ZVRA 1W2PA 4BK9A 3M1ZA 3U9IA 3P2VA 3P5YA 1HT6A 5AVNA 5DXYA 3NEHA 4W84A 4E6MA 4UQCA 4AC1X 1M01A 1A5UA 3GAYA 3NQMA 4RCXA 3Q2DA 2GL5A 4NQ1A 4CN1A 4MWAA 4IMFA 1G0CA 3IGHX 1KBIA 3E02A 1YIXA 2VMFA 1EGMA 3VIHA 2X1SA 4KEUA 3CUFA 3EX2A 1F8IA 3M6DA 3GX9A 2UV8G 2A3BA 2CFFA 3BURA 2FZ9A 1ZCCA 4H9ZA 6PTDA 5A8NA 5MF5A 3WJSA 2CITA 4QGCA 2PUZA 3TTYA 1PIGA 4AMAA 3VO0A 1DV7A 1S3TC 2VRKA 2ZA1A 3U8GA 1TTIA 3SECA 4CU6A 3NAVA 2BY2A 2Z1BA 3QV8A 3PPHA 3B9EA 1E1CA 2Z1WA 4DZ5A 1GVYA 4KBXA 1E9YB 2OT1A 2OXNA 3EOUA 1DYSA 1XLHA 1FWRA 1XG3A 2AGKA 1BXCA 2YW3A 1HQTA 4LJ3A 1IR1A 1OIMA 3ARSA 4KQNA 3QYQA 3L23A 3G18A 3QPZA 5HQEA 3HJZA 2NVDA 3AIQA 1LQ0A 1EGZA 3W7RA 1CB7B 4HMDA 3OVRA 2ZUTA 2QT3A 3OOQA 2QUTA 1MRQA 2XDFA 2I1OA 3IVSA 3KE0A 5AC8A 3H54A 2YKKA 3OZYA 4QSFA 3HM7A 1Z7AA 5GJPA 1FCBA 3N2TA 2CW6A 4GA8A 2VX7A 1E0WA 1D8CA 4XZMX 3DU0A 4PMJA 3WK2A 1MUCA 3SDOA 4GZEA 4HK5A 2CESA 3ZLFA 1I0BA 3LPPA 2EJ1A 1YTKA 4XO7A 3WDRA 2P1FA 3TZNA 1I2QA 2R6OA 1UBPC 4AIOA 3NO5A 2VFEA 2C15A 4NZCA 3TMQA 3AUOA 3A12A 1GG1A 2DY3A 3HOJA 3Q94A 3N2BA 4BF5A 1XP3A 3QMSA 1KRAC 3FCPA 1P6WA 4KCVA 3WLOA 3CASA 2PZNA 3BCFA 4WKAA 3KHJA 2OJPA 5E0CA 1HVQA 2BXYA 2XN1A 3A13A 3MP5A 3HU7A 2G37A 2OO0A 1ODUA 4HCDA 4ENLA 1EJXC 4MB5A 3PZVA 1LBMA 1TG7A 1W5PA 1WZAA 3KCJA 3WDJA 4AEEA 5J5RA 1XX1A 5FAJA 4M80A 1HP4A 1E70M 3GM8A 3LBCA 2CEQA 5BRBA 3U2EA 4NAEA 3RXZA 2V8ZA 1ME9A 5T26A 1BGGA 2XFYA 4LAOA 4MLJA 2IXVA 1R85A 1WZMA 4RR4A 2R1KA 4BQ3A 3KAOA 5K9CA 4M81A 1KGXA 2F61A 3WFAA 2D3LA 3DGRA 3G3DA 3W74A 3W76A 4LUIA 3PB2A 4IPPA 1W3KA 4GPNA 1ZU8A 3I3DA 2WWCA 2DT3A 2NW0A 1GOOA 2BV9A 1B3YA 1KCLA 1RY8A 1AUSL 3RCMA 4G8TA 1Z69A 2VR4A 1FWSA 3R8GA 3ABQA 1G4EA 3HZ3A 4N9BA 2HTMA 5FOOA 4O18A 2ZRXA 1UPMB 1UUMA 7XIMA 2PODA 3DHFA 1ONRA 3L7RA 5AYZA 1S5NA 1TA3B 3WNOA 4UTLA 1JXKA 3C3UA 2X40A 4FK9A 3TNOA 3HPXA 4PN2A 1YW1A 4UTHA 2WAGA 4HA4A 1AQFA 3U2ZA 4RX0A 1K8ZA 3BG9A 3W3OA 3HV8A 3HQPA 2VFDA 4GO8A 5C55A 3E74A 3TYUA 2H8ZA 2YA0A 2YXOA 3QOMA 4NNAA 1ZPTA 2XVNA 3TIMA 4GKTA 3TA9A 1P1MA 2J78A 1R87A 1N8FA 2YW4A 3SGGA 1FCQA 3QR3A 1LRNA 3R13A 3LCHA 4UC5A 3S47A 3DH7A 1EXPA 2FVMA 3VILA 4B2DD 1MEHA 3NPXA 4PMQA 4QLLA 3N15A 5F1VA 4FX6M 4HYVA 1YNPA 3TV8A 3CT7A 1EZWA 1KBJA 3URBA 2HXUA 4AVOA 1P6BA 3EYPA 4GUFA 1NELA 1AFSA 4JBRA 4AY7A 3TK7A 3U5UA 2XISA 5G1MA 2PTWA 5D9MA 5EU9A 2PDMA 2O7QA 2A6LA 1IEIA 3PTKA 4EF8A 1ELSA 4YCOA 3KDNA 3UU0A 4XZLX 3TSBA 1WBHA 3CNYA 3B8WA 4OFCA 5FF3A 2XU2A 3FA5A 4IGHA 2Y70A 4LB3A 3S6OA 1FCUA 1SUXA 2V30A 4RW3A 5KMYA 3WY1A 3G3MA 1FWTA 4H8NA 1KM0A 3MQTA 2E6YA 2F2HA 3N25A 1GVOA 3CL8A 3FDGA 4YXGA 2ISFA 3EDFA 3WNNA 2PBGA 2BGNE 4P8XA 1FDJA 1SVDA 1E71M 3GVVA 3IUIA 4NRRA 3MDUA 3C6CA 3GG1A 4GUGA 5HOSA 3MVTA 3DDMA 2D2HA 4GVFA 2VX5A 1BTCA 2JIEA 1AJ0A 4LUTB 3WQVA 5MKGB 3NQEA 1A5AA 3G0XA 4A05A 3T42A 5F7UA 3QVQA 3DN5A 3WQFA 3HGRA 4AD0A 1KWKA 1H61A 4TQTA 2VDIA 2BY1A 2O7SA 3CV7A 5ABHA 4ICMA 1GOIA 3RM8A 3UZYA 1FXPA 3NQBA 1B31A 4M6UA 4UFJA 2ASHA 3VNLA 1W31A 4W88A 1NDZA 1BYCA 4EF9A 4JYDA 2XSAA 3VM7A 1OGBA 2CIPA 3QGVA 5D05A 1QXLA 1VENA 1MWOA 2JF7A 4B9ZA 3WZ0E 4CKQA 4JDBA 3SZ8A 1ZS2A 2PDGA 3KLLA 1EO7A 1KFEA 1EUAA 2XIJA