4BSXA

Crystal structure of the n terminal domain of trif (tir-domain- containing adapter-inducing interferon-beta)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
144
structure length
144
Chain Sequence
TGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKMDAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASMRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1
publication title The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 44
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bsxA00
2M63A 4C0MA 4BSXA
chains in the Genus database with same CATH superfamily
3AG2E 2VGEA 3N71A 2JABA 3ZUVB 2XHEA 4HB5A 3FTZA 4JB8P 3QDNA 1PC2A 2CHXA 4KT6B 1HF8A 1IHBA 2Y4TA 1TNOA 1LTXA 2P9NG 5FQ7A 2Y4UA 3DSSA 5BPPA 5C1DA 4B8CB 3ULQA 3PREA 4PH4B 3TWTA 1K1BA 3ZYMA 2AWIA 3UKRG 3FU0A 4DX7D 4O1PA 2BKKB 2XRZA 3PEUB 2KCVA 4B93B 1TNUA 3IHYA 4QFVA 3FTUA 2LUHA 1H6KA 3FH7A 3GW4A 3AG3E 3FUHA 1OWPA 4NURA 3CHSA 3DRAA 3NOGD 3RSEG 3ASHA 3CV0A 3ESKA 5FT9A 3V79K 2QYJA 2UY1B 4GCNA 3G2TA 5KNHD 4BSZB 4I9CA 3DPYA 2CG2A 2WMNA 1E8XA 5G2NA 3G2WA 3CKBA 3Q78A 3RRUA 4BY6A 4B94A 3DEPA 3SBTB 3I5PA 4B8AA 1LF8A 2XPIA 4OVVA 3Q7AA 3ZW3A 3UM2A 3BUAA 2J09A 4PS3A 4GAAA 4IRUA 2X6HA 2YHEA 5AJDA 2P9PG 3KEZA 1HX8A 3TXMA 4MBGA 4EQFA 2RD0A 4HVBA 1IQRA 4C9BB 1NL4A 4A1GA 4FHJA 3SD5A 3LXUX 3FFLA 3DSWA 3ZIMA 2V0PA 1QZ2A 5T3RA 3NF1A 3TWSA 4CDNA 2XPZA 2WXFA 1QNFA 1AP7A 5BXUA 3FUNA 5CMYA 4URKA 1PY1A 3UINC 4KZCA 3FDHA 2EIJE 2LO6A 4DX5D 4D10C 4GA2A 2IFUA 5D0QD 3ZGQA 4M3OA 4APFA 1TN8A 3DSTA 3PNLB 4JEHA 4O1OA 4GTMA 2PZIA 4MRUA 3ASOE 1JWGA 3LY7A 4ILGA 2J4DA 3FTVA 4AP2A 3FWVA 5B3SE 2WB2A 3QOUA 2OCCE 5B1BE 4UUCA 4LUNU 2ILRA 3T9KA 4LEUA 3T5VA 2Y3AA 4F1SA 1N9AA 3UQ3A 5G04C 2X38A 3SI5A 2UY1A 4JHKA 4UI9C 2ZU6B 4Z68A 1BI8B 3SF4A 3G2VA 3AG1E 1HZ4A 1XGWA 5HI7A 4TUUA 2ZISA 4JA9A 3G2SA 4XI0A 3TWQA 2IO3C 3UX4A 1LD7A 1ZBPA 2LSVA 4RG6A 3R9AB 1U2VG 3D9LA 4GMJA 1S70B 4G8LA 3S7FA 1G3NB 4DX6D 3U66A 3CKCA 5HRYA 4DLQA 3IBEA 5B1AE 4FJYA 3HRAA 2M63A 4CDRA 5D2MC 3S7DA 5AYWD 4LNGA 3QK0A 4YNDA 3V2XA 3R7QA 3BEEA 2WQ6A 4DPRA 2EIME 4I1OB 1SZ9A 4DJAA 5BUZA 1ELRA 4G2VA 5ENRD 2XS1A 3UIPC 3ZPJA 3Q15A 1IYGA 5CERB 3CHPA 3L54A 1H2VC 1Z3XA 5ENSD 3WXXA 3NAWA 2IOLA 3MKRA 4LERA 2E2EA 2GRLA 1HS6A 1HH8A 2UWJG 4K0RA 5ANLA 4L7TA 2I1KA 3EHRA 3FEYA 3UPVA 3NOCD 1A5EA 4CRWA 1IQUA 4J6IA 4A3TA 3LKUA 3FU5A 4ZFHA 2XGMA 3L82A 3UM1A 1TJCA 4GMRA 4BTBA 4FP7A 2R03A 3F6QA 4CEMA 2H6GA 2J07A 3QB2A 4GCOA 2WXJA 3UIOC 3RRNB 3PH0C 2C0MA 5D66A 4G8KA 3K9IA 3AAAC 3D9PA 4LNUD 1QBQA 4HOUA 4ANVA 3ASFA 4O60A 2HM8A 3ZU7B 5J90A 3NZSA 1ZB1A 1JPLA 2IO2C 4FC8A 3ZNGA 2AJAA 4JZYA 3L22A 2QZAA 1VDYA 2Y0BG 4I6JA 3QKYA 2CG3A 3EU9A 3UT8A 4U0UA 4GA0A 4XEIG 2CFZA 3E32A 4EECA 4GA1A 3LY9A 3I4GA 1N95A 3DSXA 5EILA 3AG4E 3O48A 1WDYA 3CVWA 3PZ3A 3SBSA 1D9SA 4E85A 2GW1A 3U3WA 4XIFA 4Q94A 3CQGB 3PVLA 3DSUA 4LRZA 4L1BA 4TV3A 5AARA 4RLYA 5DBKA 3ZN3A 3L13A 2PNNA 3ABKE 5KBAA 1JCSA 4FULA 2H6HA 5AAOA 3ZYLA 1E8ZA 5DIZA 4TRQA 2PM6A 4R7LA 5T8IA 2OVBA 3VLEA 4GZ6A 2FO1E 4B0ZA 4E6HA 2WVIA 1V54E 1HG2A 2XEEA 2V8SE 3RO2A 1E7VA 3ZYKA 1S0PA 4G24A 1WY6A 4CGWA 3LS8A 3C98A 3ZVVA 1YMPA 5BNWA 3QC1A 3D9IA 1ELWA 1N54A 2XZTG 3FEXA 5FZQA 5FINA 4GTPA 2F0YA 3LVQE 1O5MA 5CRUA 4GTSA 3ABME 3CHQA 3ZRHA 4JXTA 2V5QC 1H0AA 3B7UX 1E8YA 5EYLA 2DYRE 2VGYA 1MX4A 1TR4A 3IKOB 3CK7A 3LJNA 3EUVA 2XEHA 1HO8A 1HU3A 5HS0A 4AY6A 4GU5A 1JWFA 1IHGA 2IF4A 3E30A 2R5SA 3UM3A 5BT1A 4J8EA 3HXDA 5E76A 1N11A 1A17A 1Y6IA 4ACLA 3HVEB 4UQYA 4BX8A 5KNGA 3CVVA 2ZGDA 3CLJA 2HYZA 2KATA 2I1JA 1BI7B 1S63A 4EZJA 4AM9A 2I6HA 1OWLA 3HYMB 2NSZA 3PE4A 3NBNB 2EQXA 4I17A 2EINE 3SFXA 3L17A 4V3IA 1BU9A 5ENQD 5FIOA 5FWQA 3VTXA 4ILHB 3FUKA 3IEGA 1OCZE 1OCOE 5HKPA 2QYUA 4GTTA 3CVQA 4BWRA 1DNPA 1N4SA 4UQZA 2L0TB 3D9NA 2FULA 2IEJA 3Q9NC 5CRVA 3FTXA 5CBOA 3FTSA 3HDXA 4DK5A 4I2ZA 5ENNA 3ABLE 2R05A 3LYAA 3TG4A 2P9KG 1DVPA 4Y6WA 1BPOA 1H2TC 3UUXA 2XCBA 4FADA 3QWVA 3V31A 3ULEG 5LOZA 3D9KA 4PDXA 4FLHA 5G04J 5J08A 1H6OA 1OY3D 4EBAA 1E96B 4UI9J 2OEVA 4KVMA 3DSVA 2PM7A 3NZUA 2XPYA 2VTBB 5G55A 4PS8A 4F53A 5M72A 5A7DB 4EZLA 1IXVA 2KCLA 3GZSA 1NP7A 3RO3A 5AQ7A 1SVXA 3QARA 4U96D 3E34A 1U3DA 2XEVA 4A3VA 4GPKA 4AEZC 3APCA 2MYOA 3PZDA 4ATGA 4BERA 2KCKA 4ILIA 2XQ0A 3D9MA 4DX2A 4GZ5A 4AV7A 2P9SG 2I9CA 1NI1A 5ENOD 5KWDA 4JVSA 2V5FA 3HVEA 2J08A 3HXFA 4ANXA 4BFRA 4N3BA 1JCQA 3FUJA 2P58C 3MEKA 3LDZA 2A5EA 1X81A 3UMVA 3TJPA 3OXGA 5JJ7A 2Y1LE 1INZA 2VGXB 1Z5SC 3QAQA 4UWFA 2J9QA 2PL2A 4UI9K 5AQBA 2RKKA 2LAHA 3JQ0A 5EKQD 4MLPA 3AJIA 2X6KA 3MV3B 1MJ0A 2L0IA 4ANUA 3FU3A 4JD2G 5JA4D 2IQCA 3Q49B 3FHEA 1W3BA 4N3AA 4YDWA 3UT7A 3PDNA 1H6PA 5CEDB 1UN9A 4LNBA 4GTOA 2CFUA 1N52A 3B7RL 4FHKA 4G26A 3G2UA 3JCKC 3ISMC 3W9FA 2JLBA 3ZKJA 4GZDA 2NXPA 5JHAA 3R7RA 3EHNA 5AJLA 5FZSA 1OCRE 3OTNA 4X8QA 4UWKA 3IV0A 4YDYA 2WXMA 2MHKA 2VTBA 4XI9A 4A63B 4Q69A 3FULA 4GTQA 3QJZA 3MA5A 3T5XA 3C3QA 3LJ3A 5ARFA 3AS5A 4CT4A 3BU8A 2VSYA 3KD7A 1OXJA 2L6BA 1FPPA 4U04A 4HOQA 1Q2ZA 5BXOA 3L9TA 3I4RB 1NA0A 3ESLA 2IY0C 2H6IA 4GB9A 3MGBA 5A23A 1ZU2A 4DI3A 2C0LA 3E4BA 4EPZA 3D3MA 2VJ8A 2F8YA 4YVOA 4XKBA 2L9BA 1EDUA 5AQ9A 4WNDA 3EDTB 2Q7FA 3UXGA 2LAIA 3CHRA 3ML9A 4HOSA 3MZLB 4MKTA 5G05C 1HE8A 3E33A 3I3NA 1SZAA 3CHOA 4WWPA 3CQCB 1SQMA 5ENPD 5FTPA 4HFGA 4I6EA 3RRMB 2MRIA 4CYMD 1K3ZD 3FP3A 2DCPA 3PNTB 1UG3A 5JJTA 2FEZA 3DXMG 3O4ZA 3CHMA 5BV0A 2HR2A 4RVBA 4GPMA 1QQEA 4F6RD 4U8YD 4H7XA 4HLLA 1TJFA 4EZKA 2A5UA 2VQ2A 2WPVA 5KJLA 1LD8A 2FO7A 3QWWA 2ONDA 4U8VD 5A6CA 4K5AB 5C2YA 3KAEA 4OVUA 1V55E 2LXLA 2IOSA 3ONKA 4G23A 3U64A 4AVXA 2GRPB 1E8WA 2WXGA 5FQ8A 3ASNE 4C0EA 4NACA 4L2YA 1NFIE 2WMOA 3EHQA 3MJWA 4AOFA 3C3RA 1S64A 3J5QB 2YQ8A 5BV1A 3VLFA 4O6FA 4EBAG 2A4ZA 3UM0A 1TNYA 1O1TA 2VSOE 1IKND 1TN7A 4KXKB 4HRNA 1HFAA 1OT8A 4U7EB 4G11A 2QC9A 5AN8A 2B6CA 2RFMA 4J8DA 1YYHA 3VLDA 3B95A 3RK6A 2E0IA 2NC9A 2WXOA 4UWLA 4AXHA 4A55A 3LVRE 4N2SA 3D9JA 4HRLA 3RKVA 4I2WA 3SQVA 4Q96A 4DX1A 1TYQG 3S2AA 3KSQA 1JCRA 1KZOA 4OAVB 2B0OE 4RQIA 1SW6A 3HXEA 5HQ8A 2XS8A 1KT0A 3SFYA 1UN8A 1D8EA 4M7CA 3PS6A 3ZXSA 4J8YA 3Q7FA 4J8SA 1WM5A 1Z3YA 2AXVA 4TUMA 4L2LA 4ZHBA 4GZCA 4GTRA 3S7BA 4NQ0A 3URZA 2PQNA 3Q75A 2WXHA 4ABNA 1JUQA 2J4BA 5FZRA 2F37A 4ANWA 1KLXA 3OXFA 5CMWA 2VYIA 4B89A 1N4PA 2QY7A 3CGHA 3B13A 5ENTD 3ZHEB 2KZTB 2VSXE 3D9OA 3ZEFA 3TXNA 3DEOA 3EHMA 4UWGA 4APOA 4U95D 3Q9UC 1L5JA 2PQRA 2IU1A 3LPZA 4ACKA 4BTAA 4GYOA 1OWNA 2ETAA 1EF1C 2XGOA 3FUIA 3PZ4A 4I1MA 5LCWC 4IN3B 3FUDA 2IJGX 2YHCA 2R02A 4JPSA 4YVQC 1GW6A 3AU4A 1XNFA 3RJVA 1U3CA 3P2BA 3U4TA 4GTVA 3TWUA 3SO8A 4C48B 3IXEA 5CHEE 4EHMA 3DWLG 1NZNA 3Q79A 3CK9A 4NRHB 4LG6A 3APFA 2P9LG 5KJKA 3U9WA 1D8DA 1N94A 5E75A 2ETBA 2C2LA 3ENEA 2OV8A 2GROB 3Q5MA 3R9MA 2OOEA 4KYOB 4DRXE 4DUIA 2WXQA 4HORA 2R59A 4H7YA 2RG8A 4HXIA 3ZYQA 2GRMA 2X3MA 5KCMA 1OWOA 1UOHA 5AENA 4KMOA 4F3VA 4N39A 3ML8A 5LX8A 1EPUA 2CHZA 5EX0A 4KZ0A 1SA5A 5D0OD 4F7AA 1TNBA 1MX6A 5JJ6A 4HOTA 4JL0A 2FF4A 3L16A 4JW1A 2XENA 1DC2A 2ETCA 4ME2A 1HG5A 3DXKG 1Y8MA 2DVWA 4CT0A 1RW2A 3PZ2A 2AXUA 2R17C 4U0SA 3SFZA 3ZHEA 2KZTA 2X6IA 3C5RA 4K03A 3JQ1A 3QNKA 3FUEA 3LEWA 5H7PA 1BLXB 3NB2A 2WXNA 4WUYA 1MHQA 4L9PA 4N5CA 1NA3A 2DIWA 4AY5A 3FH8A 3PE3A 3VTYA 3TG5A 3C72A 3B7SA 2GRQB 3CR3A 1E7UA 5G05J 1KZPA 4GMLA 1UW4B 3MKQB 2WXIA 3HXCA 3RU0A 3RIBA 1HXIA 1FT1A 4JHRA 4K5CA 1X5BA 1UJJA 4N5QA 4GYYA 2R2LA 4U63A 4HLEA 4DI4A 5AQAA 5LFAA 4N3CA 4C0MA 4GZ3A 4F1PA 4PS7A 1TNZA 5ANRA 3LY8A 3PUKA 1N4RA 1DCQA 4HRMB 4JC8A 3EJNA 4XKCA 3CVNA 2EILE 4TXPA 1MQSA 3MX3A 4L23A 3JXJA 5IY5E 3TWRA 4WWOA 2AW6A 4TXQA 3CVYA 1N0RA 4Y6CA 3J5PA 3TL5A 2DBAA 2CHWA 3L08A 1MZCA 3AS4A 3GYZA 2X6JA 4FA6A 4LCTA 5EYPF 3OXLA 3MV2B 2OVFA 4BETA 2BEDA 2XZDG 3B7BA 3EIQC 5KJMA 3PEVB 4HS2A 4TXRA 3V30A 4XX5A 2I2OA 4P29A 3X2QE 2XCCA 2ZGGA 4YDEA 2L6JA 3EU5A 3V2OA 2ZIRA 5FQ6A 3MYVA 2WM9A 4XE0A 2KXPC 4U8HA 4K5BA 1N4QA 1OCCE 2DZOA 3EIJA 3CVXA 4I6GA 1SA4A 2GRRB 4AJWA 4BT8A 4CGVA 5CCLA 4U07A 4WNFA 3UKUG 3Q4AB 3CVLA 3PUJA 5ARGA 3ZXPA 5EIDA 4CCAA 1O1SA 4UWHA 1FCHA 4J8FA 5FQ4A 2LSUA 2RFAA 3UT4A 1FT2A 5KJNA 3FH5A 1BD8A 3TGOA 3Q47B 4I9EA 3MCXA 1ELKA 2WXPA 1MYOA 4J7WA 3E37A 4DLOA 2KBXA 3ASDA 2P9IG 3MKQA 5T4YA 5LP0A 1TEZA 2QFCA 3HHMA 2VGXA 5CECB 3HG0D 4HNAD 3JYSA 4U0ZA 4NIKA 3DPDA 1EYHA 4BSXA 1H2UA 2NYJA 3L6AA 3TWXA 3FU6A 2OEWA 3W9GA 1FVFA 4FU3A 1DCEA 3KSLA 3CSTA 2ZXWE 4N2QA 4CDMA 3TWVA 1WAO1 3CEQA 1TN6A 1OWMA 1UJKA 4PUCA 2WQHA 4MS6A 4JEUA 4ATZD 3D9HA 4YDOA 3CSFA 3T8KA 2VSNA 2KM4A 2XRYA 1N0QA 5EN5D 3ULYA 2F8XK 4G1TA 5EDSA 4I1AA 1KT1A 3SGHA 1WG0A 2BTDA 4FLBA 5JMND 5CBNA 3UI2A 3AS8A 5JHBA 4XZ4A 3DBSA 3FY4A 3JXIA 5LCWJ 2BF0X 1E90A 3BG1B 4GYWA 1K1AA 3S7JA 4WAFA 2WXRA 3C3OA 3HXBA 2BKGA 2JEKA 4FJZA 4AIFA 2WXKA 4BEPA 2H6FA 1H19A 1YA0A 4IYPA 2X6FA 3NQPA 3CK8A 4KBQA 4HI9A 2V4HC 4WNEA 3SHFA 2YINA 4OYSA 3UTMA 1PAQA 3AU5A 3GZ1A 5FJYA 3OAWA 4QQIA 1AWCB 4IULA 5BW8C 3GZ2A 3Q73A 3PRZA 3TAXA 5AIJA 2LNIA 2WQ7A 3CVPA 2HE0A 2P9UG 4RSYA 3RAUA 3ONLA 1FVHA 3JUIA 3FUFA 3BQOA 3JUEA 1YCSB 3HIZA 2DWZA 3FTYA 2Y69E 3SZ7A 4BT9A 2J8SD 2FI7A 4JA7A 3BG0B 3ZFWA 2FBNA 2AVPA 4J0UA 4KVOA 3T8MA 4RG9A 4JHJA 3TWWA 3LCAA 5EX3A 2P2CP 3SNXA 4WNGA 2KC7A 4UQXA 3ASGA 2YNQA 2LXMA 2IONA 1RZ4A 3SY2A 3WG7E 2V4LA 2MOWA 4G25A 5EIBE 1Z6TA 3FTWA 3FUMA 4A1SA 4WWNA 3IHVA 2DZNA 1MX2A 3KEAA 4HBDA 4HI8A 2DYSE 3B7TA 1B89A 4BX9A 3APDA 3CIAA 5CCMA 2HO1A 1P5QA 4I43A 4OAUC 2GRNB 4CZ2D 2WXLA 2BUGA 3P1UA 2EIKE 3CVUA 5CEAA 2AXZA 1KPSB 3KS2A 4LSZE 4W9RA 1QYMA 1K8KG 3PZ1A 5ITZF 3QWPA 2XGSA 1O1RA 1OUVA 4HQDA 2J49A 4BESA 2GGFA
chains in the Genus database with same CATH topology
4DI3A 3B7SA 2C0LA 3E4BA 3N71A 3CVWA 3CR3A 1E7UA 3SBSA 4E85A 2GW1A 4EPZA 3U3WA 2XHEA 3D3MA 3FTZA 2VJ8A 3QDNA 5G05J 1PC2A 2CHXA 4KT6B 4YVOA 4GMLA 4XIFA 1UW4B 4XKBA 1HF8A 2L9BA 2Y4TA 1EDUA 3MKQB 2WXIA 4WNDA 4Q94A 3RU0A 3CQGB 3EDTB 5FQ7A 3RIBA 3PVLA 2Y4UA 2Q7FA 2LAIA 4LRZA 3CHRA 4L1BA 3ML9A 1HXIA 4TV3A 4HOSA 3MZLB 4MKTA 5DBKA 4JHRA 1X5BA 3ZN3A 3L13A 5G05C 1UJJA 1HE8A 3I3NA 5BPPA 5C1DA 1SZAA 4GYYA 4FULA 4B8CB 3CHOA 4WWPA 3ULQA 3CQCB 1SQMA 4U63A 4DI4A 3ZYLA 3PREA 4HLEA 1E8ZA 4PH4B 5LFAA 5DIZA 4TRQA 5FTPA 2PM6A 4N3CA 4R7LA 2OVBA 5T8IA 3VLEA 4HFGA 4GZ6A 4C0MA 4GZ3A 3ZYMA 4I6EA 4PS7A 4B0ZA 5ANRA 4E6HA 3LY8A 2AWIA 3RRMB 2WVIA 2MRIA 3PUKA 1HG2A 3FP3A 2DCPA 2V8SE 3FU0A 4JC8A 3RO2A 3EJNA 1E7VA 3CVNA 4XKCA 1S0PA 3PNTB 4G24A 3ZYKA 1UG3A 5JJTA 2FEZA 1WY6A 4CGWA 3LS8A 3C98A 3O4ZA 3ZVVA 2XRZA 3CHMA 1MQSA 2KCVA 3MX3A 3IHYA 3PEUB 3QC1A 4L23A 3D9IA 4QFVA 3FTUA 5BNWA 1ELWA 5BV0A 1H6KA 4WWOA 2HR2A 1N54A 3FEXA 5FZQA 3FH7A 4RVBA 2AW6A 3CVYA 1QQEA 3GW4A 3FUHA 4Y6CA 1OWPA 4NURA 3CHSA 4H7XA 3TL5A 3LVQE 2DBAA 2CHWA 1TJFA 3L08A 3ASHA 3CV0A 4EZKA 3AS4A 3ESKA 2A5UA 2VQ2A 5FT9A 2WPVA 3CHQA 3ZRHA 5KJLA 3GYZA 4JXTA 2X6JA 1H0AA 2UY1B 1E8YA 3B7UX 4GCNA 3G2TA 4FA6A 2FO7A 4LCTA 2VGYA 3QWWA 2ONDA 3OXLA 5A6CA 3MV2B 4I9CA 2OVFA 5C2YA 2CG2A 3IKOB 2WMNA 3EIQC 5KJMA 3KAEA 3PEVB 1E8XA 3CK7A 4HS2A 4OVUA 4G23A 2IOSA 3ONKA 3U64A 5G2NA 4AVXA 1E8WA 2WXGA 3G2WA 4XX5A 5FQ8A 1HO8A 3CKBA 4C0EA 4NACA 1HU3A 4L2YA 2WMOA 2I2OA 4P29A 3MJWA 4AY6A 4AOFA 2XCCA 3RRUA 4BY6A 4GU5A 3SBTB 4B94A 4B8AA 3I5PA 2L6JA 1LF8A 1JWFA 2YQ8A 2XPIA 1IHGA 5BV1A 3VLFA 4O6FA 2IF4A 4OVVA 3MYVA 2WM9A 5FQ6A 4EBAG 4XE0A 4U8HA 2A4ZA 3ZW3A 2R5SA 5BT1A 3EIJA 2VSOE 3CVXA 4J8EA 5E76A 4I6GA 4AJWA 1A17A 2J09A 4BT8A 4CGVA 5CCLA 4PS3A 4KXKB 4U07A 4GAAA 4WNFA 3Q4AB 4IRUA 1HFAA 3CVLA 1Y6IA 4ACLA 2X6HA 3PUJA 2YHEA 3HVEB 5AJDA 5ARGA 3KEZA 4UQYA 4BX8A 3CVVA 1HX8A 3TXMA 4G11A 4EQFA 4CCAA 3CLJA 2HYZA 2KATA 4UWHA 2RD0A 4HVBA 1FCHA 2I1JA 4J8FA 5FQ4A 2LSUA 1IQRA 4J8DA 3UT4A 4C9BB 3VLDA 4EZJA 4AM9A 5KJNA 2I6HA 1OWLA 3FH5A 3HYMB 4A1GA 4FHJA 3RK6A 3LXUX 3SD5A 3FFLA 3TGOA 2E0IA 3Q47B 2NSZA 2V0PA 2NC9A 3PE4A 4I9EA 3MCXA 1ELKA 3ZIMA 2EQXA 1QZ2A 2WXOA 4I17A 5T3RA 4UWLA 3NF1A 3L17A 2WXPA 4V3IA 4AXHA 4DLOA 4CDNA 2XPZA 2WXFA 3ASDA 5FWQA 3VTXA 1QNFA 4A55A 3MKQA 4ILHB 5T4YA 3FUKA 3LVRE 4N2SA 5LP0A 3FUNA 3D9JA 3IEGA 5CMYA 4URKA 1TEZA 1PY1A 3RKVA 2QFCA 3HHMA 2VGXA 4I2WA 4KZCA 3FDHA 4Q96A 2LO6A 3CVQA 3JYSA 4D10C 4GA2A 4U0ZA 3S2AA 3DPDA 4BWRA 1EYHA 1DNPA 2IFUA 5D0QD 3ZGQA 4BSXA 4UQZA 1H2UA 4M3OA 2L0TB 3D9NA 4APFA 3PNLB 4JEHA 2FULA 3L6AA 3FTXA 3FU6A 1FVFA 3FTSA 5HQ8A 3HDXA 4DK5A 2PZIA 4I2ZA 4FU3A 4MRUA 5ENNA 1KT0A 1JWGA 3LY7A 4ILGA 2J4DA 3LYAA 1UN8A 3TG4A 1DVPA 3FTVA 4Y6WA 4AP2A 1BPOA 1H2TC 3CSTA 3FWVA 3PS6A 3ZXSA 3UUXA 2XCBA 4J8SA 4FADA 3QWVA 1WM5A 2WB2A 1Z3YA 2AXVA 3QOUA 4N2QA 4L2LA 4GZCA 5LOZA 4CDMA 3D9KA 4PDXA 4FLHA 5G04J 5J08A 4LUNU 4EBAA 1WAO1 2ILRA 3CEQA 4NQ0A 1E96B 1OWMA 2PQNA 3S7BA 3URZA 2WXHA 4UI9J 4LEUA 4ABNA 3T5VA 1UJKA 2Y3AA 1JUQA 2J4BA 4KVMA 4PUCA 2WQHA 2PM7A 3NZUA 4MS6A 2XPYA 5FZRA 4F1SA 4JEUA 4ANWA 1KLXA 2VTBB 3OXFA 3UQ3A 5CMWA 3CSFA 2VSNA 2KM4A 5G55A 5G04C 2X38A 2XRYA 3SI5A 2VYIA 2UY1A 4PS8A 4B89A 4JHKA 4UI9C 2ZU6B 2QY7A 3CGHA 5A7DB 3B13A 4F53A 5M72A 4EZLA 4G1TA 5EDSA 4I1AA 3SF4A 1KT1A 3SGHA 2KCLA 3GZSA 3ZHEB 2KZTB 2VSXE 3G2VA 3D9OA 3ZEFA 2BTDA 1HZ4A 1XGWA 5HI7A 1NP7A 3RO3A 3TXNA 4FLBA 3EHMA 3QARA 1U3DA 4TUUA 3AS8A 4UWGA 5JHBA 4APOA 4XZ4A 2XEVA 4A3VA 3DBSA 4GPKA 4JA9A 3FY4A 1L5JA 3G2SA 4AEZC 2PQRA 3APCA 5LCWJ 2IU1A 4XI0A 2BF0X 3PZDA 4ATGA 1E90A 3BG1B 3LPZA 4GYWA 2KCKA 4ACKA 3UX4A 4ILIA 4BTAA 2XQ0A 3D9MA 1ZBPA 2LSVA 4RG6A 4GZ5A 3S7JA 3R9AB 4AV7A 4GYOA 3D9LA 4GMJA 1OWNA 4WAFA 1EF1C 3S7FA 2WXRA 2XGOA 3FUIA 2I9CA 3U66A 2JEKA 4FJZA 3CKCA 4I1MA 5LCWC 4DLQA 3IBEA 2WXKA 4AIFA 4IN3B 1H19A 3FUDA 1YA0A 4FJYA 4JVSA 2V5FA 3HVEA 2M63A 2J08A 4CDRA 4IYPA 2IJGX 2YHCA 2X6FA 3NQPA 4JPSA 4YVQC 4ANXA 4BFRA 1GW6A 3AU4A 1XNFA 4N3BA 3RJVA 3S7DA 5AYWD 1U3CA 3FUJA 2P58C 3P2BA 3CK8A 3U4TA 3MEKA 4KBQA 3QK0A 4YNDA 4WNEA 5CHEE 3LDZA 3R7QA 3BEEA 3SHFA 2YINA 4OYSA 2WQ6A 1NZNA 4DPRA 1PAQA 3AU5A 3GZ1A 5FJYA 3CK9A 4I1OB 3UMVA 3OAWA 1SZ9A 4DJAA 3TJPA 3OXGA 5BUZA 1ELRA 4NRHB 3APFA 4G2VA 5JJ7A 1INZA 4IULA 2VGXB 5BW8C 3GZ2A 5KJKA 3QAQA 3U9WA 3PRZA 5E75A 4UWFA 3TAXA 3ZPJA 5AIJA 2LNIA 2J9QA 2C2LA 2PL2A 4UI9K 3Q15A 2WQ7A 3CVPA 3ENEA 2LAHA 1IYGA 3CHPA 3JQ0A 1H2VC 3L54A 4RSYA 5EKQD 3ONLA 1FVHA 1Z3XA 3JUIA 2OV8A 3Q5MA 3WXXA 3FUFA 2OOEA 2IOLA 3HIZA 3MKRA 4MLPA 4LERA 2X6KA 4KYOB 3MV3B 3FTYA 2E2EA 2GRLA 3SZ7A 4BT9A 1HS6A 2L0IA 1HH8A 4ANUA 3FU3A 2UWJG 2WXQA 4K0RA 5ANLA 2R59A 4HORA 4L7TA 2I1KA 4H7YA 3FEYA 2FI7A 2RG8A 4JA7A 3UPVA 2IQCA 4HXIA 3ZYQA 3BG0B 3ZFWA 2FBNA 3Q49B 4CRWA 1IQUA 2GRMA 4J6IA 2AVPA 2X3MA 5KCMA 3FHEA 1OWOA 4A3TA 3LKUA 3FU5A 2XGMA 4J0UA 4KVOA 5AENA 3T8MA 1W3BA 4N3AA 4KMOA 4RG9A 4JHJA 3LCAA 3UT7A 3PDNA 5EX3A 4F3VA 4N39A 3ML8A 1TJCA 5LX8A 4BTBA 1UN9A 1EPUA 4FP7A 2CHZA 3SNXA 2CFUA 1N52A 5EX0A 3B7RL 4KZ0A 4WNGA 4FHKA 4G26A 3G2UA 4CEMA 2KC7A 3JCKC 4UQXA 5D0OD 4F7AA 3ASGA 2YNQA 2JLBA 4GZDA 2NXPA 2J07A 2IONA 5JJ6A 5JHAA 3QB2A 3R7RA 4GCOA 2V4LA 4HOTA 3EHNA 2MOWA 2WXJA 4G25A 4JL0A 5AJLA 5FZSA 3RRNB 2FF4A 3PH0C 2C0MA 3L16A 3OTNA 1Z6TA 3FTWA 3FUMA 4JW1A 4A1SA 4WWNA 3IHVA 4UWKA 3IV0A 3K9IA 2WXMA 2MHKA 3D9PA 2VTBA 3B7TA 4XI9A 4Q69A 1B89A 4BX9A 3APDA 4HOUA 4ANVA 3ASFA 4ME2A 3FULA 2HM8A 5J90A 1HG5A 3CIAA 3NZSA 3QJZA 1Y8MA 3MA5A 1JPLA 4FC8A 4CT0A 3T5XA 5CCMA 2HO1A 1P5QA 2AXUA 4I43A 3L22A 4JZYA 1VDYA 2R17C 2WXLA 3LJ3A 4I6JA 2BUGA 4U0SA 5ARFA 3SFZA 3AS5A 3P1UA 3QKYA 3ZHEA 2KZTA 4CT4A 2VSYA 2X6IA 2CG3A 3KD7A 4K03A 3UT8A 3CVUA 3JQ1A 4U0UA 4GA0A 3QNKA 4U04A 4HOQA 3FUEA 3LEWA 2AXZA 2CFZA 3KS2A 2WXNA 4W9RA 3I4RB 4WUYA 4EECA 1NA0A 1MHQA 3ESLA 3QWPA 2XGSA 4GA1A 1OUVA 4N5CA 1NA3A 2DIWA 3LY9A 3I4GA 3FH8A 4AY5A 4GB9A 3MGBA 2J49A 3PE3A 5A23A 3VTYA 1ZU2A 3TG5A 2GGFA 3O48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M63 A;  4C0M A;  4BSX A; 
#chains in the Genus database with same CATH topology
 3AG2 E;  2VGE A;  3N71 A;  2JAB A;  3ZUV B;  2XHE A;  4HB5 A;  3FTZ A;  4JB8 P;  3QDN A;  1PC2 A;  2CHX A;  4KT6 B;  1HF8 A;  1IHB A;  2Y4T A;  1TNO A;  1LTX A;  2P9N G;  5FQ7 A;  2Y4U A;  3DSS A;  5BPP A;  5C1D A;  4B8C B;  3ULQ A;  3PRE A;  4PH4 B;  3TWT A;  1K1B A;  3ZYM A;  2AWI A;  3UKR G;  3FU0 A;  4DX7 D;  4O1P A;  2BKK B;  2XRZ A;  3PEU B;  2KCV A;  4B93 B;  1TNU A;  3IHY A;  4QFV A;  3FTU A;  2LUH A;  1H6K A;  3FH7 A;  3GW4 A;  3AG3 E;  3FUH A;  1OWP A;  4NUR A;  3CHS A;  3DRA A;  3NOG D;  3RSE G;  3ASH A;  3CV0 A;  3ESK A;  5FT9 A;  3V79 K;  2QYJ A;  2UY1 B;  4GCN A;  3G2T A;  5KNH D;  4BSZ B;  4I9C A;  3DPY A;  2CG2 A;  2WMN A;  1E8X A;  5G2N A;  3G2W A;  3CKB A;  3Q78 A;  3RRU A;  4BY6 A;  4B94 A;  3DEP A;  3SBT B;  3I5P A;  4B8A A;  1LF8 A;  2XPI A;  4OVV A;  3Q7A A;  3ZW3 A;  3UM2 A;  3BUA A;  2J09 A;  4PS3 A;  4GAA A;  4IRU A;  2X6H A;  2YHE A;  5AJD A;  2P9P G;  3KEZ A;  1HX8 A;  3TXM A;  4MBG A;  4EQF A;  2RD0 A;  4HVB A;  1IQR A;  4C9B B;  1NL4 A;  4A1G A;  4FHJ A;  3SD5 A;  3LXU X;  3FFL A;  3DSW A;  3ZIM A;  2V0P A;  1QZ2 A;  5T3R A;  3NF1 A;  3TWS A;  4CDN A;  2XPZ A;  2WXF A;  1QNF A;  1AP7 A;  5BXU A;  3FUN A;  5CMY A;  4URK A;  1PY1 A;  3UIN C;  4KZC A;  3FDH A;  2EIJ E;  2LO6 A;  4DX5 D;  4D10 C;  4GA2 A;  2IFU A;  5D0Q D;  3ZGQ A;  4M3O A;  4APF A;  1TN8 A;  3DST A;  3PNL B;  4JEH A;  4O1O A;  4GTM A;  2PZI A;  4MRU A;  3ASO E;  1JWG A;  3LY7 A;  4ILG A;  2J4D A;  3FTV A;  4AP2 A;  3FWV A;  5B3S E;  2WB2 A;  3QOU A;  2OCC E;  5B1B E;  4UUC A;  4LUN U;  2ILR A;  3T9K A;  4LEU A;  3T5V A;  2Y3A A;  4F1S A;  1N9A A;  3UQ3 A;  5G04 C;  2X38 A;  3SI5 A;  2UY1 A;  4JHK A;  4UI9 C;  2ZU6 B;  4Z68 A;  1BI8 B;  3SF4 A;  3G2V A;  3AG1 E;  1HZ4 A;  1XGW A;  5HI7 A;  4TUU A;  2ZIS A;  4JA9 A;  3G2S A;  4XI0 A;  3TWQ A;  2IO3 C;  3UX4 A;  1LD7 A;  1ZBP A;  2LSV A;  4RG6 A;  3R9A B;  1U2V G;  3D9L A;  4GMJ A;  1S70 B;  4G8L A;  3S7F A;  1G3N B;  4DX6 D;  3U66 A;  3CKC A;  5HRY A;  4DLQ A;  3IBE A;  5B1A E;  4FJY A;  3HRA A;  2M63 A;  4CDR A;  5D2M C;  3S7D A;  5AYW D;  4LNG A;  3QK0 A;  4YND A;  3V2X A;  3R7Q A;  3BEE A;  2WQ6 A;  4DPR A;  2EIM E;  4I1O B;  1SZ9 A;  4DJA A;  5BUZ A;  1ELR A;  4G2V A;  5ENR D;  2XS1 A;  3UIP C;  3ZPJ A;  3Q15 A;  1IYG A;  5CER B;  3CHP A;  3L54 A;  1H2V C;  1Z3X A;  5ENS D;  3WXX A;  3NAW A;  2IOL A;  3MKR A;  4LER A;  2E2E A;  2GRL A;  1HS6 A;  1HH8 A;  2UWJ G;  4K0R A;  5ANL A;  4L7T A;  2I1K A;  3EHR A;  3FEY A;  3UPV A;  3NOC D;  1A5E A;  4CRW A;  1IQU A;  4J6I A;  4A3T A;  3LKU A;  3FU5 A;  4ZFH A;  2XGM A;  3L82 A;  3UM1 A;  1TJC A;  4GMR A;  4BTB A;  4FP7 A;  2R03 A;  3F6Q A;  4CEM A;  2H6G A;  2J07 A;  3QB2 A;  4GCO A;  2WXJ A;  3UIO C;  3RRN B;  3PH0 C;  2C0M A;  5D66 A;  4G8K A;  3K9I A;  3AAA C;  3D9P A;  4LNU D;  1QBQ A;  4HOU A;  4ANV A;  3ASF A;  4O60 A;  2HM8 A;  3ZU7 B;  5J90 A;  3NZS A;  1ZB1 A;  1JPL A;  2IO2 C;  4FC8 A;  3ZNG A;  2AJA A;  4JZY A;  3L22 A;  2QZA A;  1VDY A;  2Y0B G;  4I6J A;  3QKY A;  2CG3 A;  3EU9 A;  3UT8 A;  4U0U A;  4GA0 A;  4XEI G;  2CFZ A;  3E32 A;  4EEC A;  4GA1 A;  3LY9 A;  3I4G A;  1N95 A;  3DSX A;  5EIL A;  3AG4 E;  3O48 A;  1WDY A;  3CVW A;  3PZ3 A;  3SBS A;  1D9S A;  4E85 A;  2GW1 A;  3U3W A;  4XIF A;  4Q94 A;  3CQG B;  3PVL A;  3DSU A;  4LRZ A;  4L1B A;  4TV3 A;  5AAR A;  4RLY A;  5DBK A;  3ZN3 A;  3L13 A;  2PNN A;  3ABK E;  5KBA A;  1JCS A;  4FUL A;  2H6H A;  5AAO A;  3ZYL A;  1E8Z A;  5DIZ A;  4TRQ A;  2PM6 A;  4R7L A;  5T8I A;  2OVB A;  3VLE A;  4GZ6 A;  2FO1 E;  4B0Z A;  4E6H A;  2WVI A;  1V54 E;  1HG2 A;  2XEE A;  2V8S E;  3RO2 A;  1E7V A;  3ZYK A;  1S0P A;  4G24 A;  1WY6 A;  4CGW A;  3LS8 A;  3C98 A;  3ZVV A;  1YMP A;  5BNW A;  3QC1 A;  3D9I A;  1ELW A;  1N54 A;  2XZT G;  3FEX A;  5FZQ A;  5FIN A;  4GTP A;  2F0Y A;  3LVQ E;  1O5M A;  5CRU A;  4GTS A;  3ABM E;  3CHQ A;  3ZRH A;  4JXT A;  2V5Q C;  1H0A A;  3B7U X;  1E8Y A;  5EYL A;  2DYR E;  2VGY A;  1MX4 A;  1TR4 A;  3IKO B;  3CK7 A;  3LJN A;  3EUV A;  2XEH A;  1HO8 A;  1HU3 A;  5HS0 A;  4AY6 A;  4GU5 A;  1JWF A;  1IHG A;  2IF4 A;  3E30 A;  2R5S A;  3UM3 A;  5BT1 A;  4J8E A;  3HXD A;  5E76 A;  1N11 A;  1A17 A;  1Y6I A;  4ACL A;  3HVE B;  4UQY A;  4BX8 A;  5KNG A;  3CVV A;  2ZGD A;  3CLJ A;  2HYZ A;  2KAT A;  2I1J A;  1BI7 B;  1S63 A;  4EZJ A;  4AM9 A;  2I6H A;  1OWL A;  3HYM B;  2NSZ A;  3PE4 A;  3NBN B;  2EQX A;  4I17 A;  2EIN E;  3SFX A;  3L17 A;  4V3I A;  1BU9 A;  5ENQ D;  5FIO A;  5FWQ A;  3VTX A;  4ILH B;  3FUK A;  3IEG A;  1OCZ E;  1OCO E;  5HKP A;  2QYU A;  4GTT A;  3CVQ A;  4BWR A;  1DNP A;  1N4S A;  4UQZ A;  2L0T B;  3D9N A;  2FUL A;  2IEJ A;  3Q9N C;  5CRV A;  3FTX A;  5CBO A;  3FTS A;  3HDX A;  4DK5 A;  4I2Z A;  5ENN A;  3ABL E;  2R05 A;  3LYA A;  3TG4 A;  2P9K G;  1DVP A;  4Y6W A;  1BPO A;  1H2T C;  3UUX A;  2XCB A;  4FAD A;  3QWV A;  3V31 A;  3ULE G;  5LOZ A;  3D9K A;  4PDX A;  4FLH A;  5G04 J;  5J08 A;  1H6O A;  1OY3 D;  4EBA A;  1E96 B;  4UI9 J;  2OEV A;  4KVM A;  3DSV A;  2PM7 A;  3NZU A;  2XPY A;  2VTB B;  5G55 A;  4PS8 A;  4F53 A;  5M72 A;  5A7D B;  4EZL A;  1IXV A;  2KCL A;  3GZS A;  1NP7 A;  3RO3 A;  5AQ7 A;  1SVX A;  3QAR A;  4U96 D;  3E34 A;  1U3D A;  2XEV A;  4A3V A;  4GPK A;  4AEZ C;  3APC A;  2MYO A;  3PZD A;  4ATG A;  4BER A;  2KCK A;  4ILI A;  2XQ0 A;  3D9M A;  4DX2 A;  4GZ5 A;  4AV7 A;  2P9S G;  2I9C A;  1NI1 A;  5ENO D;  5KWD A;  4JVS A;  2V5F A;  3HVE A;  2J08 A;  3HXF A;  4ANX A;  4BFR A;  4N3B A;  1JCQ A;  3FUJ A;  2P58 C;  3MEK A;  3LDZ A;  2A5E A;  1X81 A;  3UMV A;  3TJP A;  3OXG A;  5JJ7 A;  2Y1L E;  1INZ A;  2VGX B;  1Z5S C;  3QAQ A;  4UWF A;  2J9Q A;  2PL2 A;  4UI9 K;  5AQB A;  2RKK A;  2LAH A;  3JQ0 A;  5EKQ D;  4MLP A;  3AJI A;  2X6K A;  3MV3 B;  1MJ0 A;  2L0I A;  4ANU A;  3FU3 A;  4JD2 G;  5JA4 D;  2IQC A;  3Q49 B;  3FHE A;  1W3B A;  4N3A A;  4YDW A;  3UT7 A;  3PDN A;  1H6P A;  5CED B;  1UN9 A;  4LNB A;  4GTO A;  2CFU A;  1N52 A;  3B7R L;  4FHK A;  4G26 A;  3G2U A;  3JCK C;  3ISM C;  3W9F A;  2JLB A;  3ZKJ A;  4GZD A;  2NXP A;  5JHA A;  3R7R A;  3EHN A;  5AJL A;  5FZS A;  1OCR E;  3OTN A;  4X8Q A;  4UWK A;  3IV0 A;  4YDY A;  2WXM A;  2MHK A;  2VTB A;  4XI9 A;  4A63 B;  4Q69 A;  3FUL A;  4GTQ A;  3QJZ A;  3MA5 A;  3T5X A;  3C3Q A;  3LJ3 A;  5ARF A;  3AS5 A;  4CT4 A;  3BU8 A;  2VSY A;  3KD7 A;  1OXJ A;  2L6B A;  1FPP A;  4U04 A;  4HOQ A;  1Q2Z A;  5BXO A;  3L9T A;  3I4R B;  1NA0 A;  3ESL A;  2IY0 C;  2H6I A;  4GB9 A;  3MGB A;  5A23 A;  1ZU2 A;  4DI3 A;  2C0L A;  3E4B A;  4EPZ A;  3D3M A;  2VJ8 A;  2F8Y A;  4YVO A;  4XKB A;  2L9B A;  1EDU A;  5AQ9 A;  4WND A;  3EDT B;  2Q7F A;  3UXG A;  2LAI A;  3CHR A;  3ML9 A;  4HOS A;  3MZL B;  4MKT A;  5G05 C;  1HE8 A;  3E33 A;  3I3N A;  1SZA A;  3CHO A;  4WWP A;  3CQC B;  1SQM A;  5ENP D;  5FTP A;  4HFG A;  4I6E A;  3RRM B;  2MRI A;  4CYM D;  1K3Z D;  3FP3 A;  2DCP A;  3PNT B;  1UG3 A;  5JJT A;  2FEZ A;  3DXM G;  3O4Z A;  3CHM A;  5BV0 A;  2HR2 A;  4RVB A;  4GPM A;  1QQE A;  4F6R D;  4U8Y D;  4H7X A;  4HLL A;  1TJF A;  4EZK A;  2A5U A;  2VQ2 A;  2WPV A;  5KJL A;  1LD8 A;  2FO7 A;  3QWW A;  2OND A;  4U8V D;  5A6C A;  4K5A B;  5C2Y A;  3KAE A;  4OVU A;  1V55 E;  2LXL A;  2IOS A;  3ONK A;  4G23 A;  3U64 A;  4AVX A;  2GRP B;  1E8W A;  2WXG A;  5FQ8 A;  3ASN E;  4C0E A;  4NAC A;  4L2Y A;  1NFI E;  2WMO A;  3EHQ A;  3MJW A;  4AOF A;  3C3R A;  1S64 A;  3J5Q B;  2YQ8 A;  5BV1 A;  3VLF A;  4O6F A;  4EBA G;  2A4Z A;  3UM0 A;  1TNY A;  1O1T A;  2VSO E;  1IKN D;  1TN7 A;  4KXK B;  4HRN A;  1HFA A;  1OT8 A;  4U7E B;  4G11 A;  2QC9 A;  5AN8 A;  2B6C A;  2RFM A;  4J8D A;  1YYH A;  3VLD A;  3B95 A;  3RK6 A;  2E0I A;  2NC9 A;  2WXO A;  4UWL A;  4AXH A;  4A55 A;  3LVR E;  4N2S A;  3D9J A;  4HRL A;  3RKV A;  4I2W A;  3SQV A;  4Q96 A;  4DX1 A;  1TYQ G;  3S2A A;  3KSQ A;  1JCR A;  1KZO A;  4OAV B;  2B0O E;  4RQI A;  1SW6 A;  3HXE A;  5HQ8 A;  2XS8 A;  1KT0 A;  3SFY A;  1UN8 A;  1D8E A;  4M7C A;  3PS6 A;  3ZXS A;  4J8Y A;  3Q7F A;  4J8S A;  1WM5 A;  1Z3Y A;  2AXV A;  4TUM A;  4L2L A;  4ZHB A;  4GZC A;  4GTR A;  3S7B A;  4NQ0 A;  3URZ A;  2PQN A;  3Q75 A;  2WXH A;  4ABN A;  1JUQ A;  2J4B A;  5FZR A;  2F37 A;  4ANW A;  1KLX A;  3OXF A;  5CMW A;  2VYI A;  4B89 A;  1N4P A;  2QY7 A;  3CGH A;  3B13 A;  5ENT D;  3ZHE B;  2KZT B;  2VSX E;  3D9O A;  3ZEF A;  3TXN A;  3DEO A;  3EHM A;  4UWG A;  4APO A;  4U95 D;  3Q9U C;  1L5J A;  2PQR A;  2IU1 A;  3LPZ A;  4ACK A;  4BTA A;  4GYO A;  1OWN A;  2ETA A;  1EF1 C;  2XGO A;  3FUI A;  3PZ4 A;  4I1M A;  5LCW C;  4IN3 B;  3FUD A;  2IJG X;  2YHC A;  2R02 A;  4JPS A;  4YVQ C;  1GW6 A;  3AU4 A;  1XNF A;  3RJV A;  1U3C A;  3P2B A;  3U4T A;  4GTV A;  3TWU A;  3SO8 A;  4C48 B;  3IXE A;  5CHE E;  4EHM A;  3DWL G;  1NZN A;  3Q79 A;  3CK9 A;  4NRH B;  4LG6 A;  3APF A;  2P9L G;  5KJK A;  3U9W A;  1D8D A;  1N94 A;  5E75 A;  2ETB A;  2C2L A;  3ENE A;  2OV8 A;  2GRO B;  3Q5M A;  3R9M A;  2OOE A;  4KYO B;  4DRX E;  4DUI A;  2WXQ A;  4HOR A;  2R59 A;  4H7Y A;  2RG8 A;  4HXI A;  3ZYQ A;  2GRM A;  2X3M A;  5KCM A;  1OWO A;  1UOH A;  5AEN A;  4KMO A;  4F3V A;  4N39 A;  3ML8 A;  5LX8 A;  1EPU A;  2CHZ A;  5EX0 A;  4KZ0 A;  1SA5 A;  5D0O D;  4F7A A;  1TNB A;  1MX6 A;  5JJ6 A;  4HOT A;  4JL0 A;  2FF4 A;  3L16 A;  4JW1 A;  2XEN A;  1DC2 A;  2ETC A;  4ME2 A;  1HG5 A;  3DXK G;  1Y8M A;  2DVW A;  4CT0 A;  1RW2 A;  3PZ2 A;  2AXU A;  2R17 C;  4U0S A;  3SFZ A;  3ZHE A;  2KZT A;  2X6I A;  3C5R A;  4K03 A;  3JQ1 A;  3QNK A;  3FUE A;  3LEW A;  5H7P A;  1BLX B;  3NB2 A;  2WXN A;  4WUY A;  1MHQ A;  4L9P A;  4N5C A;  1NA3 A;  2DIW A;  4AY5 A;  3FH8 A;  3PE3 A;  3VTY A;  3TG5 A;  3C72 A;  3B7S A;  2GRQ B;  3CR3 A;  1E7U A;  5G05 J;  1KZP A;  4GML A;  1UW4 B;  3MKQ B;  2WXI A;  3HXC A;  3RU0 A;  3RIB A;  1HXI A;  1FT1 A;  4JHR A;  4K5C A;  1X5B A;  1UJJ A;  4N5Q A;  4GYY A;  2R2L A;  4U63 A;  4HLE A;  4DI4 A;  5AQA A;  5LFA A;  4N3C A;  4C0M A;  4GZ3 A;  4F1P A;  4PS7 A;  1TNZ A;  5ANR A;  3LY8 A;  3PUK A;  1N4R A;  1DCQ A;  4HRM B;  4JC8 A;  3EJN A;  4XKC A;  3CVN A;  2EIL E;  4TXP A;  1MQS A;  3MX3 A;  4L23 A;  3JXJ A;  5IY5 E;  3TWR A;  4WWO A;  2AW6 A;  4TXQ A;  3CVY A;  1N0R A;  4Y6C A;  3J5P A;  3TL5 A;  2DBA A;  2CHW A;  3L08 A;  1MZC A;  3AS4 A;  3GYZ A;  2X6J A;  4FA6 A;  4LCT A;  5EYP F;  3OXL A;  3MV2 B;  2OVF A;  4BET A;  2BED A;  2XZD G;  3B7B A;  3EIQ C;  5KJM A;  3PEV B;  4HS2 A;  4TXR A;  3V30 A;  4XX5 A;  2I2O A;  4P29 A;  3X2Q E;  2XCC A;  2ZGG A;  4YDE A;  2L6J A;  3EU5 A;  3V2O A;  2ZIR A;  5FQ6 A;  3MYV A;  2WM9 A;  4XE0 A;  2KXP C;  4U8H A;  4K5B A;  1N4Q A;  1OCC E;  2DZO A;  3EIJ A;  3CVX A;  4I6G A;  1SA4 A;  2GRR B;  4AJW A;  4BT8 A;  4CGV A;  5CCL A;  4U07 A;  4WNF A;  3UKU G;  3Q4A B;  3CVL A;  3PUJ A;  5ARG A;  3ZXP A;  5EID A;  4CCA A;  1O1S A;  4UWH A;  1FCH A;  4J8F A;  5FQ4 A;  2LSU A;  2RFA A;  3UT4 A;  1FT2 A;  5KJN A;  3FH5 A;  1BD8 A;  3TGO A;  3Q47 B;  4I9E A;  3MCX A;  1ELK A;  2WXP A;  1MYO A;  4J7W A;  3E37 A;  4DLO A;  2KBX A;  3ASD A;  2P9I G;  3MKQ A;  5T4Y A;  5LP0 A;  1TEZ A;  2QFC A;  3HHM A;  2VGX A;  5CEC B;  3HG0 D;  4HNA D;  3JYS A;  4U0Z A;  4NIK A;  3DPD A;  1EYH A;  4BSX A;  1H2U A;  2NYJ A;  3L6A A;  3TWX A;  3FU6 A;  2OEW A;  3W9G A;  1FVF A;  4FU3 A;  1DCE A;  3KSL A;  3CST A;  2ZXW E;  4N2Q A;  4CDM A;  3TWV A;  1WAO 1;  3CEQ A;  1TN6 A;  1OWM A;  1UJK A;  4PUC A;  2WQH A;  4MS6 A;  4JEU A;  4ATZ D;  3D9H A;  4YDO A;  3CSF A;  3T8K A;  2VSN A;  2KM4 A;  2XRY A;  1N0Q A;  5EN5 D;  3ULY A;  2F8X K;  4G1T A;  5EDS A;  4I1A A;  1KT1 A;  3SGH A;  1WG0 A;  2BTD A;  4FLB A;  5JMN D;  5CBN A;  3UI2 A;  3AS8 A;  5JHB A;  4XZ4 A;  3DBS A;  3FY4 A;  3JXI A;  5LCW J;  2BF0 X;  1E90 A;  3BG1 B;  4GYW A;  1K1A A;  3S7J A;  4WAF A;  2WXR A;  3C3O A;  3HXB A;  2BKG A;  2JEK A;  4FJZ A;  4AIF A;  2WXK A;  4BEP A;  2H6F A;  1H19 A;  1YA0 A;  4IYP A;  2X6F A;  3NQP A;  3CK8 A;  4KBQ A;  4HI9 A;  2V4H C;  4WNE A;  3SHF A;  2YIN A;  4OYS A;  3UTM A;  1PAQ A;  3AU5 A;  3GZ1 A;  5FJY A;  3OAW A;  4QQI A;  1AWC B;  4IUL A;  5BW8 C;  3GZ2 A;  3Q73 A;  3PRZ A;  3TAX A;  5AIJ A;  2LNI A;  2WQ7 A;  3CVP A;  2HE0 A;  2P9U G;  4RSY A;  3RAU A;  3ONL A;  1FVH A;  3JUI A;  3FUF A;  3BQO A;  3JUE A;  1YCS B;  3HIZ A;  2DWZ A;  3FTY A;  2Y69 E;  3SZ7 A;  4BT9 A;  2J8S D;  2FI7 A;  4JA7 A;  3BG0 B;  3ZFW A;  2FBN A;  2AVP A;  4J0U A;  4KVO A;  3T8M A;  4RG9 A;  4JHJ A;  3TWW A;  3LCA A;  5EX3 A;  2P2C P;  3SNX A;  4WNG A;  2KC7 A;  4UQX A;  3ASG A;  2YNQ A;  2LXM A;  2ION A;  1RZ4 A;  3SY2 A;  3WG7 E;  2V4L A;  2MOW A;  4G25 A;  5EIB E;  1Z6T A;  3FTW A;  3FUM A;  4A1S A;  4WWN A;  3IHV A;  2DZN A;  1MX2 A;  3KEA A;  4HBD A;  4HI8 A;  2DYS E;  3B7T A;  1B89 A;  4BX9 A;  3APD A;  3CIA A;  5CCM A;  2HO1 A;  1P5Q A;  4I43 A;  4OAU C;  2GRN B;  4CZ2 D;  2WXL A;  2BUG A;  3P1U A;  2EIK E;  3CVU A;  5CEA A;  2AXZ A;  1KPS B;  3KS2 A;  4LSZ E;  4W9R A;  1QYM A;  1K8K G;  3PZ1 A;  5ITZ F;  3QWP A;  2XGS A;  1O1R A;  1OUV A;  4HQD A;  2J49 A;  4BES A;  2GGF A; 
#chains in the Genus database with same CATH homology
 4DI3 A;  3B7S A;  2C0L A;  3E4B A;  3N71 A;  3CVW A;  3CR3 A;  1E7U A;  3SBS A;  4E85 A;  2GW1 A;  4EPZ A;  3U3W A;  2XHE A;  3D3M A;  3FTZ A;  2VJ8 A;  3QDN A;  5G05 J;  1PC2 A;  2CHX A;  4KT6 B;  4YVO A;  4GML A;  4XIF A;  1UW4 B;  4XKB A;  1HF8 A;  2L9B A;  2Y4T A;  1EDU A;  3MKQ B;  2WXI A;  4WND A;  4Q94 A;  3RU0 A;  3CQG B;  3EDT B;  5FQ7 A;  3RIB A;  3PVL A;  2Y4U A;  2Q7F A;  2LAI A;  4LRZ A;  3CHR A;  4L1B A;  3ML9 A;  1HXI A;  4TV3 A;  4HOS A;  3MZL B;  4MKT A;  5DBK A;  4JHR A;  1X5B A;  3ZN3 A;  3L13 A;  5G05 C;  1UJJ A;  1HE8 A;  3I3N A;  5BPP A;  5C1D A;  1SZA A;  4GYY A;  4FUL A;  4B8C B;  3CHO A;  4WWP A;  3ULQ A;  3CQC B;  1SQM A;  4U63 A;  4DI4 A;  3ZYL A;  3PRE A;  4HLE A;  1E8Z A;  4PH4 B;  5LFA A;  5DIZ A;  4TRQ A;  5FTP A;  2PM6 A;  4N3C A;  4R7L A;  2OVB A;  5T8I A;  3VLE A;  4HFG A;  4GZ6 A;  4C0M A;  4GZ3 A;  3ZYM A;  4I6E A;  4PS7 A;  4B0Z A;  5ANR A;  4E6H A;  3LY8 A;  2AWI A;  3RRM B;  2WVI A;  2MRI A;  3PUK A;  1HG2 A;  3FP3 A;  2DCP A;  2V8S E;  3FU0 A;  4JC8 A;  3RO2 A;  3EJN A;  1E7V A;  3CVN A;  4XKC A;  1S0P A;  3PNT B;  4G24 A;  3ZYK A;  1UG3 A;  5JJT A;  2FEZ A;  1WY6 A;  4CGW A;  3LS8 A;  3C98 A;  3O4Z A;  3ZVV A;  2XRZ A;  3CHM A;  1MQS A;  2KCV A;  3MX3 A;  3IHY A;  3PEU B;  3QC1 A;  4L23 A;  3D9I A;  4QFV A;  3FTU A;  5BNW A;  1ELW A;  5BV0 A;  1H6K A;  4WWO A;  2HR2 A;  1N54 A;  3FEX A;  5FZQ A;  3FH7 A;  4RVB A;  2AW6 A;  3CVY A;  1QQE A;  3GW4 A;  3FUH A;  4Y6C A;  1OWP A;  4NUR A;  3CHS A;  4H7X A;  3TL5 A;  3LVQ E;  2DBA A;  2CHW A;  1TJF A;  3L08 A;  3ASH A;  3CV0 A;  4EZK A;  3AS4 A;  3ESK A;  2A5U A;  2VQ2 A;  5FT9 A;  2WPV A;  3CHQ A;  3ZRH A;  5KJL A;  3GYZ A;  4JXT A;  2X6J A;  1H0A A;  2UY1 B;  1E8Y A;  3B7U X;  4GCN A;  3G2T A;  4FA6 A;  2FO7 A;  4LCT A;  2VGY A;  3QWW A;  2OND A;  3OXL A;  5A6C A;  3MV2 B;  4I9C A;  2OVF A;  5C2Y A;  2CG2 A;  3IKO B;  2WMN A;  3EIQ C;  5KJM A;  3KAE A;  3PEV B;  1E8X A;  3CK7 A;  4HS2 A;  4OVU A;  4G23 A;  2IOS A;  3ONK A;  3U64 A;  5G2N A;  4AVX A;  1E8W A;  2WXG A;  3G2W A;  4XX5 A;  5FQ8 A;  1HO8 A;  3CKB A;  4C0E A;  4NAC A;  1HU3 A;  4L2Y A;  2WMO A;  2I2O A;  4P29 A;  3MJW A;  4AY6 A;  4AOF A;  2XCC A;  3RRU A;  4BY6 A;  4GU5 A;  3SBT B;  4B94 A;  4B8A A;  3I5P A;  2L6J A;  1LF8 A;  1JWF A;  2YQ8 A;  2XPI A;  1IHG A;  5BV1 A;  3VLF A;  4O6F A;  2IF4 A;  4OVV A;  3MYV A;  2WM9 A;  5FQ6 A;  4EBA G;  4XE0 A;  4U8H A;  2A4Z A;  3ZW3 A;  2R5S A;  5BT1 A;  3EIJ A;  2VSO E;  3CVX A;  4J8E A;  5E76 A;  4I6G A;  4AJW A;  1A17 A;  2J09 A;  4BT8 A;  4CGV A;  5CCL A;  4PS3 A;  4KXK B;  4U07 A;  4GAA A;  4WNF A;  3Q4A B;  4IRU A;  1HFA A;  3CVL A;  1Y6I A;  4ACL A;  2X6H A;  3PUJ A;  2YHE A;  3HVE B;  5AJD A;  5ARG A;  3KEZ A;  4UQY A;  4BX8 A;  3CVV A;  1HX8 A;  3TXM A;  4G11 A;  4EQF A;  4CCA A;  3CLJ A;  2HYZ A;  2KAT A;  4UWH A;  2RD0 A;  4HVB A;  1FCH A;  2I1J A;  4J8F A;  5FQ4 A;  2LSU A;  1IQR A;  4J8D A;  3UT4 A;  4C9B B;  3VLD A;  4EZJ A;  4AM9 A;  5KJN A;  2I6H A;  1OWL A;  3FH5 A;  3HYM B;  4A1G A;  4FHJ A;  3RK6 A;  3LXU X;  3SD5 A;  3FFL A;  3TGO A;  2E0I A;  3Q47 B;  2NSZ A;  2V0P A;  2NC9 A;  3PE4 A;  4I9E A;  3MCX A;  1ELK A;  3ZIM A;  2EQX A;  1QZ2 A;  2WXO A;  4I17 A;  5T3R A;  4UWL A;  3NF1 A;  3L17 A;  2WXP A;  4V3I A;  4AXH A;  4DLO A;  4CDN A;  2XPZ A;  2WXF A;  3ASD A;  5FWQ A;  3VTX A;  1QNF A;  4A55 A;  3MKQ A;  4ILH B;  5T4Y A;  3FUK A;  3LVR E;  4N2S A;  5LP0 A;  3FUN A;  3D9J A;  3IEG A;  5CMY A;  4URK A;  1TEZ A;  1PY1 A;  3RKV A;  2QFC A;  3HHM A;  2VGX A;  4I2W A;  4KZC A;  3FDH A;  4Q96 A;  2LO6 A;  3CVQ A;  3JYS A;  4D10 C;  4GA2 A;  4U0Z A;  3S2A A;  3DPD A;  4BWR A;  1EYH A;  1DNP A;  2IFU A;  5D0Q D;  3ZGQ A;  4BSX A;  4UQZ A;  1H2U A;  4M3O A;  2L0T B;  3D9N A;  4APF A;  3PNL B;  4JEH A;  2FUL A;  3L6A A;  3FTX A;  3FU6 A;  1FVF A;  3FTS A;  5HQ8 A;  3HDX A;  4DK5 A;  2PZI A;  4I2Z A;  4FU3 A;  4MRU A;  5ENN A;  1KT0 A;  1JWG A;  3LY7 A;  4ILG A;  2J4D A;  3LYA A;  1UN8 A;  3TG4 A;  1DVP A;  3FTV A;  4Y6W A;  4AP2 A;  1BPO A;  1H2T C;  3CST A;  3FWV A;  3PS6 A;  3ZXS A;  3UUX A;  2XCB A;  4J8S A;  4FAD A;  3QWV A;  1WM5 A;  2WB2 A;  1Z3Y A;  2AXV A;  3QOU A;  4N2Q A;  4L2L A;  4GZC A;  5LOZ A;  4CDM A;  3D9K A;  4PDX A;  4FLH A;  5G04 J;  5J08 A;  4LUN U;  4EBA A;  1WAO 1;  2ILR A;  3CEQ A;  4NQ0 A;  1E96 B;  1OWM A;  2PQN A;  3S7B A;  3URZ A;  2WXH A;  4UI9 J;  4LEU A;  4ABN A;  3T5V A;  1UJK A;  2Y3A A;  1JUQ A;  2J4B A;  4KVM A;  4PUC A;  2WQH A;  2PM7 A;  3NZU A;  4MS6 A;  2XPY A;  5FZR A;  4F1S A;  4JEU A;  4ANW A;  1KLX A;  2VTB B;  3OXF A;  3UQ3 A;  5CMW A;  3CSF A;  2VSN A;  2KM4 A;  5G55 A;  5G04 C;  2X38 A;  2XRY A;  3SI5 A;  2VYI A;  2UY1 A;  4PS8 A;  4B89 A;  4JHK A;  4UI9 C;  2ZU6 B;  2QY7 A;  3CGH A;  5A7D B;  3B13 A;  4F53 A;  5M72 A;  4EZL A;  4G1T A;  5EDS A;  4I1A A;  3SF4 A;  1KT1 A;  3SGH A;  2KCL A;  3GZS A;  3ZHE B;  2KZT B;  2VSX E;  3G2V A;  3D9O A;  3ZEF A;  2BTD A;  1HZ4 A;  1XGW A;  5HI7 A;  1NP7 A;  3RO3 A;  3TXN A;  4FLB A;  3EHM A;  3QAR A;  1U3D A;  4TUU A;  3AS8 A;  4UWG A;  5JHB A;  4APO A;  4XZ4 A;  2XEV A;  4A3V A;  3DBS A;  4GPK A;  4JA9 A;  3FY4 A;  1L5J A;  3G2S A;  4AEZ C;  2PQR A;  3APC A;  5LCW J;  2IU1 A;  4XI0 A;  2BF0 X;  3PZD A;  4ATG A;  1E90 A;  3BG1 B;  3LPZ A;  4GYW A;  2KCK A;  4ACK A;  3UX4 A;  4ILI A;  4BTA A;  2XQ0 A;  3D9M A;  1ZBP A;  2LSV A;  4RG6 A;  4GZ5 A;  3S7J A;  3R9A B;  4AV7 A;  4GYO A;  3D9L A;  4GMJ A;  1OWN A;  4WAF A;  1EF1 C;  3S7F A;  2WXR A;  2XGO A;  3FUI A;  2I9C A;  3U66 A;  2JEK A;  4FJZ A;  3CKC A;  4I1M A;  5LCW C;  4DLQ A;  3IBE A;  2WXK A;  4AIF A;  4IN3 B;  1H19 A;  3FUD A;  1YA0 A;  4FJY A;  4JVS A;  2V5F A;  3HVE A;  2M63 A;  2J08 A;  4CDR A;  4IYP A;  2IJG X;  2YHC A;  2X6F A;  3NQP A;  4JPS A;  4YVQ C;  4ANX A;  4BFR A;  1GW6 A;  3AU4 A;  1XNF A;  4N3B A;  3RJV A;  3S7D A;  5AYW D;  1U3C A;  3FUJ A;  2P58 C;  3P2B A;  3CK8 A;  3U4T A;  3MEK A;  4KBQ A;  3QK0 A;  4YND A;  4WNE A;  5CHE E;  3LDZ A;  3R7Q A;  3BEE A;  3SHF A;  2YIN A;  4OYS A;  2WQ6 A;  1NZN A;  4DPR A;  1PAQ A;  3AU5 A;  3GZ1 A;  5FJY A;  3CK9 A;  4I1O B;  3UMV A;  3OAW A;  1SZ9 A;  4DJA A;  3TJP A;  3OXG A;  5BUZ A;  1ELR A;  4NRH B;  3APF A;  4G2V A;  5JJ7 A;  1INZ A;  4IUL A;  2VGX B;  5BW8 C;  3GZ2 A;  5KJK A;  3QAQ A;  3U9W A;  3PRZ A;  5E75 A;  4UWF A;  3TAX A;  3ZPJ A;  5AIJ A;  2LNI A;  2J9Q A;  2C2L A;  2PL2 A;  4UI9 K;  3Q15 A;  2WQ7 A;  3CVP A;  3ENE A;  2LAH A;  1IYG A;  3CHP A;  3JQ0 A;  1H2V C;  3L54 A;  4RSY A;  5EKQ D;  3ONL A;  1FVH A;  1Z3X A;  3JUI A;  2OV8 A;  3Q5M A;  3WXX A;  3FUF A;  2OOE A;  2IOL A;  3HIZ A;  3MKR A;  4MLP A;  4LER A;  2X6K A;  4KYO B;  3MV3 B;  3FTY A;  2E2E A;  2GRL A;  3SZ7 A;  4BT9 A;  1HS6 A;  2L0I A;  1HH8 A;  4ANU A;  3FU3 A;  2UWJ G;  2WXQ A;  4K0R A;  5ANL A;  2R59 A;  4HOR A;  4L7T A;  2I1K A;  4H7Y A;  3FEY A;  2FI7 A;  2RG8 A;  4JA7 A;  3UPV A;  2IQC A;  4HXI A;  3ZYQ A;  3BG0 B;  3ZFW A;  2FBN A;  3Q49 B;  4CRW A;  1IQU A;  2GRM A;  4J6I A;  2AVP A;  2X3M A;  5KCM A;  3FHE A;  1OWO A;  4A3T A;  3LKU A;  3FU5 A;  2XGM A;  4J0U A;  4KVO A;  5AEN A;  3T8M A;  1W3B A;  4N3A A;  4KMO A;  4RG9 A;  4JHJ A;  3LCA A;  3UT7 A;  3PDN A;  5EX3 A;  4F3V A;  4N39 A;  3ML8 A;  1TJC A;  5LX8 A;  4BTB A;  1UN9 A;  1EPU A;  4FP7 A;  2CHZ A;  3SNX A;  2CFU A;  1N52 A;  5EX0 A;  3B7R L;  4KZ0 A;  4WNG A;  4FHK A;  4G26 A;  3G2U A;  4CEM A;  2KC7 A;  3JCK C;  4UQX A;  5D0O D;  4F7A A;  3ASG A;  2YNQ A;  2JLB A;  4GZD A;  2NXP A;  2J07 A;  2ION A;  5JJ6 A;  5JHA A;  3QB2 A;  3R7R A;  4GCO A;  2V4L A;  4HOT A;  3EHN A;  2MOW A;  2WXJ A;  4G25 A;  4JL0 A;  5AJL A;  5FZS A;  3RRN B;  2FF4 A;  3PH0 C;  2C0M A;  3L16 A;  3OTN A;  1Z6T A;  3FTW A;  3FUM A;  4JW1 A;  4A1S A;  4WWN A;  3IHV A;  4UWK A;  3IV0 A;  3K9I A;  2WXM A;  2MHK A;  3D9P A;  2VTB A;  3B7T A;  4XI9 A;  4Q69 A;  1B89 A;  4BX9 A;  3APD A;  4HOU A;  4ANV A;  3ASF A;  4ME2 A;  3FUL A;  2HM8 A;  5J90 A;  1HG5 A;  3CIA A;  3NZS A;  3QJZ A;  1Y8M A;  3MA5 A;  1JPL A;  4FC8 A;  4CT0 A;  3T5X A;  5CCM A;  2HO1 A;  1P5Q A;  2AXU A;  4I43 A;  3L22 A;  4JZY A;  1VDY A;  2R17 C;  2WXL A;  3LJ3 A;  4I6J A;  2BUG A;  4U0S A;  5ARF A;  3SFZ A;  3AS5 A;  3P1U A;  3QKY A;  3ZHE A;  2KZT A;  4CT4 A;  2VSY A;  2X6I A;  2CG3 A;  3KD7 A;  4K03 A;  3UT8 A;  3CVU A;  3JQ1 A;  4U0U A;  4GA0 A;  3QNK A;  4U04 A;  4HOQ A;  3FUE A;  3LEW A;  2AXZ A;  2CFZ A;  3KS2 A;  2WXN A;  4W9R A;  3I4R B;  4WUY A;  4EEC A;  1NA0 A;  1MHQ A;  3ESL A;  3QWP A;  2XGS A;  4GA1 A;  1OUV A;  4N5C A;  1NA3 A;  2DIW A;  3LY9 A;  3I4G A;  3FH8 A;  4AY5 A;  4GB9 A;  3MGB A;  2J49 A;  3PE3 A;  5A23 A;  3VTY A;  1ZU2 A;  3TG5 A;  2GGF A;  3O48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...