4BSXA

Crystal structure of the n terminal domain of trif (tir-domain- containing adapter-inducing interferon-beta)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
144
structure length
144
Chain Sequence
b'TGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKMDAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASMRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1
publication title The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 44
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4bsxA00
2M63A 4BSXA 4C0MA
chains in the Genus database with same CATH superfamily
3ZGQA 4DI4A 3LJ3A 4HB5A 3GW4A 4JB8P 3EHRA 4XE0A 1Z3XA 3D3MA 2WXQA 4JHKA 3L08A 2KCVA 3CK7A 1INZA 1N0RA 3HXBA 4HS2A 1DC2A 2Y1LE 2A5UA 5AYWD 4E6HA 3G2WA 5ENOD 3ONKA 3GZ2A 3ZUVB 3FU3A 3CVLA 2BTDA 3QKYA 2MHKA 4UWKA 5ENRD 4GTPA 4HOSA 1DCQA 3TWWA 4Y6WA 3CVVA 4I1OB 5EX0A 5FQ6A 4BEPA 5JHBA 4A3VA 2KCLA 4K5CA 3EU9A 4GA1A 3ISMC 3Q9NC 2ZGDA 1JPLA 5KWDA 3B7TA 3ONLA 4NQ0A 2XZTG 3MEKA 5KNGA 4FULA 1K3ZD 4GMJA 3EDTB 2LNIA 1XGWA 4BX9A 3D9JA 5B1BE 2AJAA 3TGOA 4WNFA 4GTMA 2Y4UA 4UQZA 2X3MA 3ZVVA 3PZDA 1UW4B 2P9NG 3BEEA 2V5QC 3QB2A 3ZYLA 2WPVA 3UT4A 3L16A 3BQOA 3UX4A 4MS6A 3S2AA 3D9MA 5D66A 3TWSA 5AN8A 4GMLA 4KZ0A 3VTYA 3AG4E 3ASGA 5D0OD 3KSLA 1NL4A 4HRNA 3Q7AA 1U3CA 2PM7A 3IHVA 2FF4A 5C2YA 4TUUA 2WXHA 3CVQA 2MRIA 2WXLA 3FDHA 4C0MA 2C2LA 5CECB 1WG0A 3Q9UC 2OV8A 3T8MA 3QARA 1TNYA 3UTMA 1LTXA 4GTRA 3FTXA 2V5FA 3CSFA 4RG6A 5BW8C 3C3QA 3CHSA 4UQYA 3ML8A 4IYPA 3CK8A 4RG9A 3KEZA 4KT6B 2M63A 3RIBA 2J08A 4YDWA 4O60A 3ZHEB 2YQ8A 3K9IA 1UG3A 4ZHBA 3I5PA 4OAVB 3DXMG 2VJ8A 3NBNB 3UI2A 1TNOA 4DJAA 4U0UA 3AU5A 4ACKA 2J9QA 1K1BA 4E85A 3FUEA 3GZSA 3HG0D 3ZW3A 1O1RA 3FUDA 3Q5MA 4N2QA 5KJNA 1S63A 1TN6A 3JCKC 1JWGA 4PDXA 4GTVA 4MLPA 1OCCE 5A6CA 4Q69A 2QC9A 1BD8A 4I6JA 2XGSA 1TNBA 5BXOA 2ONDA 2VTBB 2VSOE 3IEGA 2H6HA 3SHFA 4GZCA 4IULA 3PE3A 4HI9A 4N39A 3NOCD 3RO3A 2P9LG 1N94A 3TWTA 2DIWA 3PREA 5FQ7A 2F0YA 2IONA 5T8IA 4F3VA 4ANVA 4I2ZA 3HRAA 5BV1A 4HOQA 4XI0A 3ESLA 5ARFA 2GRQB 2WXFA 2X38A 4CRWA 5AARA 4CDNA 3NOGD 3V31A 4XZ4A 1TYQG 4BT8A 4DX7D 3CVWA 3SD5A 3LY9A 4C0EA 3SO8A 3DPYA 4RLYA 1YMPA 2E0IA 4B8CB 4BTAA 1SQMA 3FUHA 5FZQA 3SBSA 4ZFHA 2P9SG 3P1UA 5FINA 2R59A 1BPOA 4HLLA 3D9PA 3EJNA 3FTZA 4UI9C 1E90A 1KLXA 3DSSA 1OUVA 2GRMA 3ZYKA 2F37A 3ASNE 1N4PA 2VSYA 4GCNA 3BU8A 3JYSA 5ENTD 2IO3C 1RZ4A 1N4RA 4FADA 3DEPA 4ILHB 4KZCA 2QFCA 3L6AA 4N5CA 2I6HA 3WXXA 2QZAA 3CK9A 2XEEA 3SFYA 3FH8A 4C9BB 4L1BA 3D9NA 4G11A 3PH0C 4U04A 4GZ6A 3ASDA 5CCMA 4XX5A 5J08A 2J4DA 3FTUA 2P9IG 2IU1A 4XEIG 3PUKA 2LSVA 3ASOE 4KYOB 4G23A 4ILGA 4MRUA 3ZPJA 4P29A 1FT1A 2IEJA 2YHEA 5EIBE 3D9LA 1HG5A 3FTSA 5CEDB 2Y69E 4CYMD 5M72A 1ELRA 3TWXA 4DX5D 4MBGA 1ELKA 2WXJA 2WXOA 3FTWA 4RVBA 3SFZA 3CQGB 3ZN3A 3MV2B 5CMWA 1O1SA 1LD7A 2RFMA 3ZYMA 3HHMA 4ME2A 4ABNA 5CRUA 4FJYA 5CHEE 5G05J 1TNZA 2OEVA 1E7UA 4KVOA 4GYYA 1ZU2A 3UIPC 1U3DA 3CVXA 5KCMA 3SQVA 2V0PA 4JC8A 4OYSA 2FO1E 3CQCB 3RRNB 4CDRA 3KSQA 2OVBA 2PM6A 2IFUA 4JXTA 2XEVA 1WAO1 2L0IA 2ZGGA 1HG2A 2L6BA 1N52A 2VSNA 1BU9A 3U3WA 2HYZA 2HR2A 1RW2A 4L7TA 4B93B 2IJGX 3RSEG 4G1TA 4B8AA 2BKKB 3EIJA 4FA6A 1SA5A 1S0PA 2L9BA 2ZISA 3HXCA 4A1GA 5LCWJ 4EBAA 2HO1A 3CIAA 4B89A 4BSZB 4A63B 2WXIA 4NURA 3OXLA 3APFA 1O5MA 3Q15A 1BI7B 2DWZA 3CR3A 2EIJE 5KJLA 3L54A 1Z5SC 3TWUA 2QYUA 2R5SA 3JUEA 1EDUA 2C0MA 4EPZA 3Q78A 4J6IA 3W9FA 1MX6A 3NF1A 3RK6A 2WVIA 1JCQA 3LY7A 2WXPA 3KAEA 4I17A 2KZTB 3QAQA 4XIFA 3HVEB 4AEZC 3IHYA 4YNDA 2E2EA 4IRUA 4AP2A 1WY6A 2UWJG 4U07A 4M7CA 4A3TA 1S70B 4ILIA 5CBOA 2I1JA 2RKKA 4YVQC 4G24A 3I4RB 2LO6A 3G2TA 1N9AA 4AY6A 2VSXE 4I9EA 3UKRG 3RKVA 3FTVA 3L17A 4DI3A 3E37A 3O48A 1YYHA 2VGYA 3CHOA 3HDXA 3EU5A 4N3BA 2J8SD 2VGEA 1ZB1A 4RSYA 4WNDA 5G04C 4W9RA 5A7DB 2YINA 3S7DA 3G2UA 2C0LA 1P5QA 1V55E 1IHBA 4EHMA 4BETA 3MJWA 4LUNU 2WXGA 3PEUB 2VGXB 1E8WA 4EZLA 4JA9A 3RJVA 4LNBA 2WQ6A 2LXMA 2A5EA 3QWWA 1OCOE 1N54A 4N5QA 3JXIA 1D9SA 1Y8MA 3ZXPA 3DSTA 4LNGA 3AJIA 4O1OA 1E96B 1V54E 4LG6A 2XEHA 2XCCA 4WNEA 3R7QA 1OWMA 2X6FA 5FJYA 1Q2ZA 2KATA 3QJZA 4JA7A 2NSZA 2R02A 4WNGA 3MGBA 4GTSA 1GW6A 5E76A 4GU5A 4G8LA 1HO8A 2EQXA 4I6GA 1E8XA 3UXGA 2Y4TA 4PS3A 1NI1A 3G2SA 2GW1A 1Y6IA 1S64A 5FQ8A 1KT0A 4Z68A 3MKQB 3MYVA 4GAAA 4HNAD 4KVMA 3IV0A 5ENPD 2BF0X 4ANWA 3Q4AB 2KCKA 1MJ0A 2DYSE 3L13A 4PUCA 4FLHA 1QQEA 4FJZA 1TJCA 2L0TB 4GTOA 4K5AB 4M3OA 3OAWA 3V2OA 3TWVA 2R05A 3DSWA 4ANUA 2H6FA 4L2LA 1FT2A 1JUQA 4G2VA 1OY3D 3BG0B 4HI8A 2BEDA 3Q79A 2Y0BG 4X8QA 5ENNA 2GRPB 3AG1E 1HX8A 3NAWA 5JMND 1A5EA 3OTNA 3B7UX 2WMNA 2LSUA 4CGVA 4TXRA 3FUIA 3TL5A 3CVNA 1A17A 2XS8A 4J8DA 5CERB 4O1PA 2V4HC 5DBKA 4UWHA 2IQCA 3UUXA 3VLFA 5AQ9A 2KC7A 2Y3AA 2RFAA 2AVPA 4NIKA 4LEUA 3CKCA 3V2XA 2OEWA 3BG1B 4XKCA 4I9CA 2QY7A 2IO2C 3NB2A 3FFLA 3Q7FA 3AAAC 1DCEA 4J7WA 2Q7FA 1QYMA 4K0RA 4R7LA 4UWGA 4GZ3A 3UM0A 5KJKA 3Q47B 3T8KA 3ZXSA 4RQIA 3QK0A 3UQ3A 3FWVA 2FI7A 4GYWA 4DPRA 3EUVA 2JLBA 1DNPA 5FTPA 2OVFA 5B3SE 5BUZA 3AU4A 2WQHA 1LF8A 3EHMA 5AAOA 4UUCA 5G2NA 1NA3A 2IOLA 4F1PA 3FU5A 5AENA 1K8KG 1TNUA 3UT8A 3FUNA 5FQ4A 3CHMA 1OWOA 2XS1A 3UINC 5HQ8A 2FO7A 2H6IA 1LD8A 4DRXE 5BNWA 3FEXA 2ETCA 1DVPA 5AIJA 4V3IA 4TXQA 3PZ1A 2BUGA 1QZ2A 2IF4A 4AJWA 1JWFA 4B0ZA 2BKGA 3LEWA 1H2TC 4CZ2D 1IKND 1B89A 2YNQA 4YVOA 4DK5A 3DWLG 1N4QA 3CV0A 4QQIA 3SFXA 1IXVA 4BERA 3AS4A 4GTQA 4Q96A 1FCHA 4U0SA 4WAFA 3IXEA 4OAUC 4EZJA 5FWQA 2ZIRA 4ATZD 5T3RA 4AOFA 4N2SA 2QYJA 3KEAA 3TJPA 4CEMA 3FTYA 4URKA 1IYGA 3N71A 2VQ2A 4JEHA 3LCAA 2JABA 1MHQA 1KPSB 2R17C 3VTXA 3B7BA 3TXMA 1PY1A 3ZFWA 5HS0A 1E8YA 1N0QA 3UM1A 5JHAA 4LNUD 4B94A 1HU3A 3MV3B 3HXDA 5CRVA 4H7YA 4I1AA 2MYOA 4UWFA 5LFAA 4KBQA 1FVHA 3ZKJA 3APCA 4G26A 5ENSD 1HF8A 5HI7A 4H7XA 4PS8A 3ZU7B 3LY8A 1UJJA 5ARGA 1KT1A 4L2YA 3I3NA 1BLXB 3ASFA 5CCLA 4BSXA 3C72A 3E4BA 3MCXA 3JQ1A 2ILRA 3LYAA 3UT7A 3ULQA 3F6QA 2R2LA 1L5JA 5D0QD 3ULEG 4EECA 1MX4A 2EINE 3ASHA 2XCBA 3CHRA 4ANXA 3ABLE 4QFVA 4BTBA 3TG5A 2EIME 3DBSA 3NZUA 5FIOA 5BV0A 3PZ2A 1H0AA 4JW1A 2X6HA 3FHEA 3AS5A 2J07A 2YHCA 1OWLA 3DSXA 4IN3B 1SW6A 3DSUA 3D9OA 5C1DA 4FP7A 2OOEA 1Z3YA 3UM2A 2AXVA 3E34A 3PNTB 1WDYA 3GZ1A 1D8DA 3OXFA 5EIDA 1H6OA 3EHQA 4UI9K 5KBAA 4F6RD 5AJDA 4OVVA 2XGMA 3ULYA 4GTTA 3AG2E 2FEZA 2KM4A 3PUJA 4Q94A 3CKBA 4GB9A 3U4TA 1VDYA 2J4BA 3U9WA 4FHJA 4HRMB 4HQDA 5B1AE 3C5RA 3BUAA 5AQAA 2JEKA 4HBDA 4GA0A 1HE8A 2XENA 4PS7A 2V8SE 2KXPC 3CVPA 2ZXWE 3ZHEA 3CGHA 5G04J 4J0UA 1MZCA 2LUHA 1E7VA 1XNFA 4I2WA 2XHEA 1QNFA 3HIZA 3LJNA 3U64A 3ZEFA 4UWLA 3D9IA 3UMVA 2XPZA 3T9KA 4LCTA 5LX8A 3UPVA 2XRZA 2DVWA 3Q49B 5ITZF 2EILE 3RU0A 1WM5A 4EQFA 3TWQA 2B0OE 1OCZE 3SNXA 5LCWC 3FH7A 2P58C 4XI9A 3E30A 2VTBA 4FC8A 4XKBA 5A23A 2CHZA 3FUMA 1TN8A 5LOZA 3S7FA 5ENQD 3RRMB 3SZ7A 3QC1A 1SA4A 4BESA 3R9MA 3G2VA 2WMOA 3FU0A 2FULA 5AQ7A 1JCRA 2IY0C 5FT9A 4LSZE 4YDOA 1MQSA 4CT4A 4U96D 5HKPA 5T4YA 3S7BA 1H19A 3QNKA 3FULA 4HOUA 4AV7A 3CHPA 5LP0A 4ATGA 2HE0A 4GPKA 3I4GA 5KJMA 4G8KA 1U2VG 3TG4A 3Q73A 2L6JA 3LVQE 4N3AA 2LAIA 4U63A 5H7PA 2GGFA 3UM3A 4MKTA 2WXRA 5JJ7A 1N95A 3FU6A 1X5BA 3DXKG 3FY4A 1HS6A 3E32A 1N4SA 2IOSA 4NRHB 3LPZA 2ZU6B 4F53A 2MOWA 4FHKA 2CHWA 2EIKE 4I43A 4YDEA 3FH5A 2GRRB 5ANRA 2J49A 4DX6D 2B6CA 1H6PA 1H6KA 4A55A 3D9KA 3MX3A 3T5VA 1HZ4A 4I6EA 2LAHA 2WXKA 3CEQA 1SVXA 3E33A 3NZSA 3PNLB 4FLBA 4K5BA 2AXZA 2GROB 3CHQA 4HLEA 3GYZA 3FUFA 2H6GA 1YCSB 4OVUA 2WB2A 3PZ4A 3CLJA 4BT9A 4GYOA 2PQRA 5JJ6A 3UKUG 5BPPA 4GCOA 2J09A 4HORA 1K1AA 4BY6A 3QDNA 1FPPA 3J5QB 3PDNA 3ZNGA 1H2UA 4U0ZA 1E8ZA 4AVXA 3VLEA 2KBXA 1W3BA 1FVFA 3SF4A 3ZRHA 1OWPA 1EF1C 5EN5D 1IHGA 3L82A 3HXFA 4I1MA 2P9PG 4GA2A 2GRNB 2P9UG 3JXJA 2XZDG 2XPYA 5FZRA 3RO2A 1HXIA 1ELWA 2CG2A 3T5XA 4DLQA 4TRQA 4D10C 4L23A 2X6JA 1AP7A 3LKUA 3MZLB 3MKRA 2P9KG 1EYHA 4J8SA 1HFAA 3FEYA 2WXMA 5CEAA 5BXUA 3NQPA 4ACLA 5EILA 2ETBA 2OCCE 3JUIA 2I2OA 1JCSA 2DCPA 4HRLA 1UOHA 3KD7A 2CFZA 3LDZA 3PZ3A 1H2VC 1X81A 4BX8A 3X2QE 4UI9J 4WUYA 2ETAA 3PRZA 3B13A 3EHNA 5D2MC 2X6KA 3WG7E 5J90A 3V79K 4DX1A 3C3RA 2NC9A 2XPIA 1HH8A 2LXLA 3RRUA 3URZA 2F8XK 1SZ9A 4L9PA 4K03A 3QWVA 2XQ0A 5EYPF 4JL0A 4KMOA 4N3CA 5JA4D 4CCAA 3FP3A 3TXNA 4PH4B 3ZYQA 2PNNA 3D9HA 4O6FA 2AW6A 3LVRE 2UY1A 3KS2A 4GMRA 1OCRE 3IKOB 4JZYA 3MA5A 4AIFA 4HVBA 4LERA 1AWCB 4GZ5A 2NXPA 1N11A 2HM8A 2PL2A 2RD0A 3HXEA 4HXIA 4U7EB 1MYOA 3B95A 3PEVB 5G55A 2P2CP 3ML9A 5DIZA 1BI8B 1O1TA 4TXPA 4KXKB 1TN7A 4CGWA 4APOA 5E75A 4BWRA 4J8EA 5KNHD 4FU3A 3EIQC 4U8YD 1PC2A 3JQ0A 5FZSA 4AXHA 2KZTA 2WXNA 1OXJA 3FUJA 3HVEA 4HOTA 4JVSA 1NA0A 1G3NB 2DZNA 4JPSA 4NACA 2I9CA 2R03A 3V30A 4JHJA 3Q75A 3SI5A 4A1SA 5IY5E 1EPUA 3CSTA 1ZBPA 4F1SA 4EZKA 3QOUA 3UIOC 3C98A 4WWPA 3LS8A 3LXUX 3IBEA 1TEZA 4BFRA 3CVUA 3QWPA 1OWNA 4J8FA 5AQBA 4J8YA 1D8EA 2PQNA 2CG3A 3DRAA 3B7SA 1IQRA 2XGOA 2GRLA 1SZAA 1NP7A 2V4LA 1MX2A 1OT8A 3W9GA 4CDMA 2VGXA 2AWIA 4YDYA 3ESKA 4JEUA 3U66A 3DPDA 3SGHA 1TR4A 2I1KA 1PAQA 3R9AB 5EX3A 3SBTB 2FBNA 4GPMA 4JHRA 2A4ZA 3CVYA 4U95D 4JD2G 3L22A 1YA0A 3TAXA 2VYIA 3APDA 4LRZA 3C3OA 2WM9A 2DBAA 3TWRA 3AG3E 1UN8A 1UJKA 3VLDA 3PS6A 3ABKE 5JJTA 3J5PA 2CHXA 2F8YA 3PE4A 4F7AA 2RG8A 5BT1A 3MKQA 4Y6CA 3O4ZA 4TV3A 3RAUA 3ZIMA 2WQ7A 3PVLA 3S7JA 4G25A 1TJFA 1QBQA 2NYJA 4WWNA 2XRYA 4APFA 4DUIA 2DZOA 4HFGA 4DX2A 1Z6TA 1KZOA 3DSVA 4GZDA 3OXGA 1KZPA 2PZIA 3SY2A 2DYRE 5G05C 3DEOA 4EBAG 3HYMB 4UQXA 2UY1B 4DLOA 5EYLA 3B7RL 2CFUA 4U8HA 5CBNA 1NFIE 4AM9A 2AXUA 3AS8A 5CMYA 1IQUA 4C48B 3P2BA 1UN9A 5HRYA 1NZNA 5EDSA 4U8VD 2X6IA 5ANLA 4AY5A 4TUMA 3L9TA 4CT0A 3ABME 3FUKA 3R7RA 5AJLA 4WWOA 5EKQD 3ENEA
chains in the Genus database with same CATH topology
3MX3A 3T5VA 3ZGQA 4DI4A 3LJ3A 1ELRA 5HQ8A 3GW4A 1HZ4A 1ELKA 2FO7A 5M72A 2WXJA 4I6EA 2WXOA 2LAHA 2WXKA 3FTWA 5BNWA 4XE0A 3FEXA 3CEQA 1Z3XA 3D3MA 2WXQA 1DVPA 4JHKA 4RVBA 3SFZA 3L08A 5AIJA 2KCVA 3UT8A 4V3IA 3NZSA 3CQGB 3ZN3A 3MV2B 5CMWA 3CK7A 1INZA 3ZYMA 3HHMA 4ME2A 3PNLB 4FLBA 4ABNA 4FJYA 5CHEE 2BUGA 2AXZA 5G05J 1QZ2A 3CHQA 4HLEA 4HS2A 3GYZA 2A5UA 2IF4A 4AJWA 1JWFA 3FUFA 5AYWD 1E7UA 3G2WA 4GYYA 4KVOA 1ZU2A 4OVUA 4B0ZA 4E6HA 2WB2A 3LEWA 1H2TC 3ONKA 3GZ2A 3FU3A 3CVLA 2BTDA 3CLJA 3QKYA 2MHKA 4UWKA 1B89A 2YNQA 1U3DA 4BT9A 4GYOA 3CVXA 2PQRA 4YVOA 5JJ6A 4DK5A 5KCMA 3CV0A 5BPPA 4HOSA 4GCOA 2V0PA 4JC8A 2J09A 4OYSA 4HORA 3CQCB 3RRNB 4BY6A 3AS4A 4Q96A 4CDRA 1FCHA 4U0SA 4WAFA 4Y6WA 3QDNA 5FWQA 4EZJA 3CVVA 3PDNA 2OVBA 4I1OB 1H2UA 4U0ZA 1E8ZA 2PM6A 4AVXA 3VLEA 5EX0A 5T3RA 5FQ6A 4AOFA 4N2SA 2IFUA 4JXTA 5JHBA 1W3BA 2XEVA 1WAO1 1FVFA 4A3VA 2L0IA 3TJPA 3SF4A 4CEMA 3ZRHA 1OWPA 1EF1C 1IHGA 2KCLA 4I1MA 3FTYA 4URKA 4GA2A 4GA1A 1HG2A 1IYGA 3N71A 1N52A 2VQ2A 4JEHA 3LCAA 1JPLA 1MHQA 2VSNA 2XPYA 3U3WA 3B7TA 2HYZA 2HR2A 2R17C 3ONLA 5FZRA 3RO2A 3VTXA 4NQ0A 4L7TA 3TXMA 1HXIA 1ELWA 1PY1A 2CG2A 3MEKA 3T5XA 3ZFWA 4TRQA 4DLQA 1E8YA 2IJGX 4D10C 4FULA 4G1TA 4L23A 4B8AA 2X6JA 3EIJA 4FA6A 3LKUA 1S0PA 5JHAA 4GMJA 2L9BA 3MZLB 3MKRA 4B94A 4A1GA 5LCWJ 4EBAA 1HU3A 3EDTB 2HO1A 3MV3B 2LNIA 1EYHA 4J8SA 3CIAA 1XGWA 1HFAA 3FEYA 2WXMA 4BX9A 3D9JA 3NQPA 4ACLA 4H7YA 4I1AA 4UWFA 4B89A 3JUIA 5LFAA 2I2OA 4KBQA 3TGOA 4WNFA 2WXIA 1FVHA 2Y4UA 4NURA 3OXLA 4UQZA 3APFA 3Q15A 2X3MA 3APCA 4G26A 3ZVVA 1HF8A 3PZDA 2DCPA 1UW4B 3KD7A 5HI7A 2CFZA 3BEEA 4H7XA 3CR3A 3LDZA 5KJLA 3QB2A 3L54A 3ZYLA 4PS8A 1H2VC 2WPVA 3LY8A 3UT4A 1UJJA 5ARGA 4BX8A 4UI9J 1KT1A 4WUYA 3PRZA 2R5SA 3B13A 3L16A 1EDUA 3EHNA 2X6KA 3UX4A 4MS6A 3S2AA 3D9MA 4L2YA 5J90A 2C0MA 4EPZA 3I3NA 2NC9A 2XPIA 1HH8A 3ASFA 4J6IA 5CCLA 4GMLA 3NF1A 4KZ0A 3RRUA 3RK6A 2WVIA 3VTYA 3URZA 4BSXA 3LY7A 3E4BA 3MCXA 3ASGA 1SZ9A 2WXPA 5D0OD 3KAEA 3JQ1A 4I17A 2KZTB 2ILRA 3QAQA 3LYAA 4K03A 3QWVA 2XQ0A 4JL0A 3UT7A 3ULQA 4XIFA 1U3CA 3HVEB 4KMOA 4N3CA 2PM7A 4AEZC 3IHVA 2FF4A 5C2YA 4CCAA 4TUUA 3FP3A 3IHYA 4YNDA 2E2EA 1L5JA 2WXHA 3CVQA 4IRUA 5D0QD 3TXNA 4AP2A 4EECA 4PH4B 1WY6A 2UWJG 4U07A 3ASHA 3ZYQA 4A3TA 2MRIA 2WXLA 2XCBA 3FDHA 4O6FA 3CHRA 2AW6A 2C2LA 3LVRE 4C0MA 2UY1A 3KS2A 4ILIA 2I1JA 4ANXA 4BTBA 4QFVA 4YVQC 4G24A 3IKOB 3I4RB 2LO6A 3G2TA 4JZYA 3TG5A 3MA5A 3DBSA 3NZUA 4AIFA 4HVBA 2OV8A 4LERA 4AY6A 4GZ5A 2NXPA 2VSXE 2HM8A 4I9EA 5BV0A 3RKVA 3T8MA 3FTVA 2PL2A 1H0AA 3QARA 3L17A 2RD0A 4JW1A 4DI3A 4HXIA 3O48A 3PEVB 5G55A 3ML9A 2X6HA 5DIZA 2VGYA 3FHEA 3CHOA 3FTXA 3AS5A 3HDXA 2J07A 2YHCA 1OWLA 2V5FA 3CSFA 4IN3B 4N3BA 4RG6A 5BW8C 4KXKB 3CHSA 4UQYA 3ML8A 4IYPA 4CGWA 4RSYA 3D9OA 4APOA 3CK8A 4RG9A 5E75A 4BWRA 5C1DA 3KEZA 4KT6B 4FP7A 2OOEA 4J8EA 4WNDA 2M63A 3RIBA 5G04C 4FU3A 3EIQC 4W9RA 1Z3YA 2J08A 2YINA 5A7DB 3S7DA 1PC2A 3G2UA 3JQ0A 5FZSA 2KZTA 2WXNA 2AXVA 2C0LA 1P5QA 3ZHEB 4AXHA 3PNTB 3GZ1A 2YQ8A 3K9IA 1UG3A 3MJWA 3FUJA 3HVEA 3OXFA 4LUNU 4JVSA 3I5PA 4HOTA 2WXGA 3PEUB 1NA0A 2VGXB 4JPSA 1E8WA 2VJ8A 4UI9K 4NACA 2I9CA 4DJAA 4EZLA 4U0UA 4JA9A 5AJDA 3AU5A 4OVVA 2XGMA 4ACKA 2J9QA 3RJVA 4E85A 3FUEA 2WQ6A 3GZSA 2FEZA 3ZW3A 3QWWA 1N54A 3FUDA 3Q5MA 2KM4A 4N2QA 5KJNA 4JHJA 3PUJA 1Y8MA 3SI5A 3JCKC 1JWGA 4PDXA 4MLPA 4A1SA 1EPUA 1OWOA 1ZBPA 3CSTA 4Q94A 4F1SA 4EZKA 5A6CA 3CKBA 1E96B 4Q69A 3QOUA 4GB9A 3U4TA 1VDYA 2J4BA 4I6JA 3U9WA 3C98A 4WWPA 2XGSA 3LS8A 3LXUX 3IBEA 2XCCA 4FHJA 1TEZA 4WNEA 4BFRA 3R7QA 1OWMA 2ONDA 3CVUA 2VTBB 2X6FA 3QWPA 2VSOE 5FJYA 3IEGA 1OWNA 3SHFA 4GZCA 4J8FA 4IULA 3PE3A 2KATA 3QJZA 4JA7A 2NSZA 2JEKA 4GA0A 4WNGA 1HE8A 3MGBA 4N39A 1GW6A 2PQNA 4GU5A 2CG3A 4PS7A 3B7SA 5E76A 3RO3A 1IQRA 2V8SE 2DIWA 3CVPA 3PREA 5FQ7A 1HO8A 2EQXA 4I6GA 3CGHA 3ZHEA 1E8XA 2IONA 2Y4TA 5G04J 2XGOA 5T8IA 4F3VA 2GRLA 4J0UA 4PS3A 1SZAA 3G2SA 4ANVA 2GW1A 1NP7A 2V4LA 4I2ZA 1Y6IA 4CDMA 1E7VA 2VGXA 1KT0A 2AWIA 1XNFA 3MKQB 5FQ8A 3MYVA 4GAAA 5BV1A 4KVMA 4I2WA 4HOQA 2XHEA 3ESKA 3IV0A 4JEUA 3U66A 1QNFA 3HIZA 2BF0X 4XI0A 3U64A 3ZEFA 3DPDA 4UWLA 4ANWA 3SGHA 3ESLA 2I1KA 1PAQA 3R9AB 3Q4AB 2KCKA 5ARFA 3D9IA 5EX3A 2WXFA 2X38A 4CRWA 3L13A 3SBTB 3UMVA 2FBNA 2XPZA 4LCTA 4JHRA 4CDNA 5LX8A 2A4ZA 3CVYA 3UPVA 4PUCA 4FLHA 1QQEA 4FJZA 3Q49B 1TJCA 2XRZA 4XZ4A 2L0TB 4BT8A 3CVWA 4M3OA 3RU0A 3OAWA 3SD5A 3L22A 1WM5A 4ANUA 3LY9A 1YA0A 4EQFA 4C0EA 3TAXA 4L2LA 3SNXA 5LCWC 1JUQA 4G2VA 2VYIA 3FH7A 2E0IA 2P58C 3BG0B 4XI9A 3APDA 4B8CB 4BTAA 1SQMA 3FUHA 4LRZA 5FZQA 2VTBA 5ENNA 2WM9A 2DBAA 4FC8A 3SBSA 4XKBA 5A23A 2CHZA 3FUMA 5LOZA 1HX8A 3S7FA 1UN8A 3RRMB 1UJKA 3VLDA 3OTNA 3PS6A 3B7UX 5JJTA 2WMNA 3SZ7A 2LSUA 4CGVA 2CHXA 3QC1A 3P1UA 2R59A 1BPOA 3D9PA 3EJNA 3PE4A 4F7AA 2RG8A 3FTZA 4UI9C 1E90A 1KLXA 5BT1A 1OUVA 3G2VA 3MKQA 2GRMA 3FUIA 3ZYKA 2WMOA 3FU0A 2FULA 4Y6CA 3TL5A 3O4ZA 4TV3A 2VSYA 5FT9A 3CVNA 1A17A 4J8DA 3ZIMA 2WQ7A 3PVLA 1MQSA 4GCNA 3S7JA 4G25A 4CT4A 5DBKA 4UWHA 4A55A 2IQCA 3JYSA 3UUXA 5T4YA 3S7BA 1H19A 1TJFA 3QNKA 3VLFA 4WWNA 2KC7A 2XRYA 2Y3AA 3FULA 4HOUA 2AVPA 3CHPA 4APFA 4AV7A 4LEUA 4FADA 3CKCA 4HFGA 5LP0A 4ATGA 4ILHB 3BG1B 4KZCA 4XKCA 4I9CA 4GPKA 1Z6TA 2QFCA 2QY7A 4GZDA 3OXGA 3I4GA 3L6AA 5KJMA 3FFLA 4N5CA 2I6HA 2PZIA 3WXXA 5G05C 3CK9A 2Q7FA 4K0RA 4R7LA 4UWGA 4EBAG 4GZ3A 3TG4A 3HYMB 5KJKA 3Q47B 4UQXA 2UY1B 3FH8A 4DLOA 4C9BB 3ZXSA 3B7RL 4L1BA 2CFUA 2L6JA 3D9NA 3LVQE 3QK0A 4G11A 4U8HA 3UQ3A 4N3AA 2LAIA 3FWVA 3PH0C 4U63A 4U04A 4GZ6A 2FI7A 3ASDA 5CCMA 4GYWA 4XX5A 4DPRA 2JLBA 5J08A 4AM9A 2GGFA 2J4DA 1DNPA 4MKTA 5FTPA 2AXUA 3AS8A 2OVFA 2WXRA 5CMYA 5JJ7A 5BUZA 1IQUA 3AU4A 3FU6A 3FTUA 2IU1A 3P2BA 3PUKA 2LSVA 1UN9A 1X5BA 2WQHA 4KYOB 3FY4A 1NZNA 4G23A 1LF8A 5EDSA 1HS6A 3EHMA 2X6IA 2IOSA 4ILGA 4MRUA 3ZPJA 4NRHB 3LPZA 4P29A 5ANLA 5G2NA 2YHEA 4AY5A 2ZU6B 1NA3A 4F53A 2IOLA 2MOWA 3FU5A 4FHKA 3D9LA 5AENA 2CHWA 4CT0A 4I43A 1HG5A 3FTSA 3FH5A 3FUKA 3R7RA 5AJLA 5ANRA 2J49A 4WWOA 1H6KA 5EKQD 3FUNA 5FQ4A 3ENEA 3CHMA 3D9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M63 A;  4BSX A;  4C0M A; 
#chains in the Genus database with same CATH topology
 3ZGQ A;  4DI4 A;  3LJ3 A;  4HB5 A;  3GW4 A;  4JB8 P;  3EHR A;  4XE0 A;  1Z3X A;  3D3M A;  2WXQ A;  4JHK A;  3L08 A;  2KCV A;  3CK7 A;  1INZ A;  1N0R A;  3HXB A;  4HS2 A;  1DC2 A;  2Y1L E;  2A5U A;  5AYW D;  4E6H A;  3G2W A;  5ENO D;  3ONK A;  3GZ2 A;  3ZUV B;  3FU3 A;  3CVL A;  2BTD A;  3QKY A;  2MHK A;  4UWK A;  5ENR D;  4GTP A;  4HOS A;  1DCQ A;  3TWW A;  4Y6W A;  3CVV A;  4I1O B;  5EX0 A;  5FQ6 A;  4BEP A;  5JHB A;  4A3V A;  2KCL A;  4K5C A;  3EU9 A;  4GA1 A;  3ISM C;  3Q9N C;  2ZGD A;  1JPL A;  5KWD A;  3B7T A;  3ONL A;  4NQ0 A;  2XZT G;  3MEK A;  5KNG A;  4FUL A;  1K3Z D;  4GMJ A;  3EDT B;  2LNI A;  1XGW A;  4BX9 A;  3D9J A;  5B1B E;  2AJA A;  3TGO A;  4WNF A;  4GTM A;  2Y4U A;  4UQZ A;  2X3M A;  3ZVV A;  3PZD A;  1UW4 B;  2P9N G;  3BEE A;  2V5Q C;  3QB2 A;  3ZYL A;  2WPV A;  3UT4 A;  3L16 A;  3BQO A;  3UX4 A;  4MS6 A;  3S2A A;  3D9M A;  5D66 A;  3TWS A;  5AN8 A;  4GML A;  4KZ0 A;  3VTY A;  3AG4 E;  3ASG A;  5D0O D;  3KSL A;  1NL4 A;  4HRN A;  3Q7A A;  1U3C A;  2PM7 A;  3IHV A;  2FF4 A;  5C2Y A;  4TUU A;  2WXH A;  3CVQ A;  2MRI A;  2WXL A;  3FDH A;  4C0M A;  2C2L A;  5CEC B;  1WG0 A;  3Q9U C;  2OV8 A;  3T8M A;  3QAR A;  1TNY A;  3UTM A;  1LTX A;  4GTR A;  3FTX A;  2V5F A;  3CSF A;  4RG6 A;  5BW8 C;  3C3Q A;  3CHS A;  4UQY A;  3ML8 A;  4IYP A;  3CK8 A;  4RG9 A;  3KEZ A;  4KT6 B;  2M63 A;  3RIB A;  2J08 A;  4YDW A;  4O60 A;  3ZHE B;  2YQ8 A;  3K9I A;  1UG3 A;  4ZHB A;  3I5P A;  4OAV B;  3DXM G;  2VJ8 A;  3NBN B;  3UI2 A;  1TNO A;  4DJA A;  4U0U A;  3AU5 A;  4ACK A;  2J9Q A;  1K1B A;  4E85 A;  3FUE A;  3GZS A;  3HG0 D;  3ZW3 A;  1O1R A;  3FUD A;  3Q5M A;  4N2Q A;  5KJN A;  1S63 A;  1TN6 A;  3JCK C;  1JWG A;  4PDX A;  4GTV A;  4MLP A;  1OCC E;  5A6C A;  4Q69 A;  2QC9 A;  1BD8 A;  4I6J A;  2XGS A;  1TNB A;  5BXO A;  2OND A;  2VTB B;  2VSO E;  3IEG A;  2H6H A;  3SHF A;  4GZC A;  4IUL A;  3PE3 A;  4HI9 A;  4N39 A;  3NOC D;  3RO3 A;  2P9L G;  1N94 A;  3TWT A;  2DIW A;  3PRE A;  5FQ7 A;  2F0Y A;  2ION A;  5T8I A;  4F3V A;  4ANV A;  4I2Z A;  3HRA A;  5BV1 A;  4HOQ A;  4XI0 A;  3ESL A;  5ARF A;  2GRQ B;  2WXF A;  2X38 A;  4CRW A;  5AAR A;  4CDN A;  3NOG D;  3V31 A;  4XZ4 A;  1TYQ G;  4BT8 A;  4DX7 D;  3CVW A;  3SD5 A;  3LY9 A;  4C0E A;  3SO8 A;  3DPY A;  4RLY A;  1YMP A;  2E0I A;  4B8C B;  4BTA A;  1SQM A;  3FUH A;  5FZQ A;  3SBS A;  4ZFH A;  2P9S G;  3P1U A;  5FIN A;  2R59 A;  1BPO A;  4HLL A;  3D9P A;  3EJN A;  3FTZ A;  4UI9 C;  1E90 A;  1KLX A;  3DSS A;  1OUV A;  2GRM A;  3ZYK A;  2F37 A;  3ASN E;  1N4P A;  2VSY A;  4GCN A;  3BU8 A;  3JYS A;  5ENT D;  2IO3 C;  1RZ4 A;  1N4R A;  4FAD A;  3DEP A;  4ILH B;  4KZC A;  2QFC A;  3L6A A;  4N5C A;  2I6H A;  3WXX A;  2QZA A;  3CK9 A;  2XEE A;  3SFY A;  3FH8 A;  4C9B B;  4L1B A;  3D9N A;  4G11 A;  3PH0 C;  4U04 A;  4GZ6 A;  3ASD A;  5CCM A;  4XX5 A;  5J08 A;  2J4D A;  3FTU A;  2P9I G;  2IU1 A;  4XEI G;  3PUK A;  2LSV A;  3ASO E;  4KYO B;  4G23 A;  4ILG A;  4MRU A;  3ZPJ A;  4P29 A;  1FT1 A;  2IEJ A;  2YHE A;  5EIB E;  3D9L A;  1HG5 A;  3FTS A;  5CED B;  2Y69 E;  4CYM D;  5M72 A;  1ELR A;  3TWX A;  4DX5 D;  4MBG A;  1ELK A;  2WXJ A;  2WXO A;  3FTW A;  4RVB A;  3SFZ A;  3CQG B;  3ZN3 A;  3MV2 B;  5CMW A;  1O1S A;  1LD7 A;  2RFM A;  3ZYM A;  3HHM A;  4ME2 A;  4ABN A;  5CRU A;  4FJY A;  5CHE E;  5G05 J;  1TNZ A;  2OEV A;  1E7U A;  4KVO A;  4GYY A;  1ZU2 A;  3UIP C;  1U3D A;  3CVX A;  5KCM A;  3SQV A;  2V0P A;  4JC8 A;  4OYS A;  2FO1 E;  3CQC B;  3RRN B;  4CDR A;  3KSQ A;  2OVB A;  2PM6 A;  2IFU A;  4JXT A;  2XEV A;  1WAO 1;  2L0I A;  2ZGG A;  1HG2 A;  2L6B A;  1N52 A;  2VSN A;  1BU9 A;  3U3W A;  2HYZ A;  2HR2 A;  1RW2 A;  4L7T A;  4B93 B;  2IJG X;  3RSE G;  4G1T A;  4B8A A;  2BKK B;  3EIJ A;  4FA6 A;  1SA5 A;  1S0P A;  2L9B A;  2ZIS A;  3HXC A;  4A1G A;  5LCW J;  4EBA A;  2HO1 A;  3CIA A;  4B89 A;  4BSZ B;  4A63 B;  2WXI A;  4NUR A;  3OXL A;  3APF A;  1O5M A;  3Q15 A;  1BI7 B;  2DWZ A;  3CR3 A;  2EIJ E;  5KJL A;  3L54 A;  1Z5S C;  3TWU A;  2QYU A;  2R5S A;  3JUE A;  1EDU A;  2C0M A;  4EPZ A;  3Q78 A;  4J6I A;  3W9F A;  1MX6 A;  3NF1 A;  3RK6 A;  2WVI A;  1JCQ A;  3LY7 A;  2WXP A;  3KAE A;  4I17 A;  2KZT B;  3QAQ A;  4XIF A;  3HVE B;  4AEZ C;  3IHY A;  4YND A;  2E2E A;  4IRU A;  4AP2 A;  1WY6 A;  2UWJ G;  4U07 A;  4M7C A;  4A3T A;  1S70 B;  4ILI A;  5CBO A;  2I1J A;  2RKK A;  4YVQ C;  4G24 A;  3I4R B;  2LO6 A;  3G2T A;  1N9A A;  4AY6 A;  2VSX E;  4I9E A;  3UKR G;  3RKV A;  3FTV A;  3L17 A;  4DI3 A;  3E37 A;  3O48 A;  1YYH A;  2VGY A;  3CHO A;  3HDX A;  3EU5 A;  4N3B A;  2J8S D;  2VGE A;  1ZB1 A;  4RSY A;  4WND A;  5G04 C;  4W9R A;  5A7D B;  2YIN A;  3S7D A;  3G2U A;  2C0L A;  1P5Q A;  1V55 E;  1IHB A;  4EHM A;  4BET A;  3MJW A;  4LUN U;  2WXG A;  3PEU B;  2VGX B;  1E8W A;  4EZL A;  4JA9 A;  3RJV A;  4LNB A;  2WQ6 A;  2LXM A;  2A5E A;  3QWW A;  1OCO E;  1N54 A;  4N5Q A;  3JXI A;  1D9S A;  1Y8M A;  3ZXP A;  3DST A;  4LNG A;  3AJI A;  4O1O A;  1E96 B;  1V54 E;  4LG6 A;  2XEH A;  2XCC A;  4WNE A;  3R7Q A;  1OWM A;  2X6F A;  5FJY A;  1Q2Z A;  2KAT A;  3QJZ A;  4JA7 A;  2NSZ A;  2R02 A;  4WNG A;  3MGB A;  4GTS A;  1GW6 A;  5E76 A;  4GU5 A;  4G8L A;  1HO8 A;  2EQX A;  4I6G A;  1E8X A;  3UXG A;  2Y4T A;  4PS3 A;  1NI1 A;  3G2S A;  2GW1 A;  1Y6I A;  1S64 A;  5FQ8 A;  1KT0 A;  4Z68 A;  3MKQ B;  3MYV A;  4GAA A;  4HNA D;  4KVM A;  3IV0 A;  5ENP D;  2BF0 X;  4ANW A;  3Q4A B;  2KCK A;  1MJ0 A;  2DYS E;  3L13 A;  4PUC A;  4FLH A;  1QQE A;  4FJZ A;  1TJC A;  2L0T B;  4GTO A;  4K5A B;  4M3O A;  3OAW A;  3V2O A;  3TWV A;  2R05 A;  3DSW A;  4ANU A;  2H6F A;  4L2L A;  1FT2 A;  1JUQ A;  4G2V A;  1OY3 D;  3BG0 B;  4HI8 A;  2BED A;  3Q79 A;  2Y0B G;  4X8Q A;  5ENN A;  2GRP B;  3AG1 E;  1HX8 A;  3NAW A;  5JMN D;  1A5E A;  3OTN A;  3B7U X;  2WMN A;  2LSU A;  4CGV A;  4TXR A;  3FUI A;  3TL5 A;  3CVN A;  1A17 A;  2XS8 A;  4J8D A;  5CER B;  4O1P A;  2V4H C;  5DBK A;  4UWH A;  2IQC A;  3UUX A;  3VLF A;  5AQ9 A;  2KC7 A;  2Y3A A;  2RFA A;  2AVP A;  4NIK A;  4LEU A;  3CKC A;  3V2X A;  2OEW A;  3BG1 B;  4XKC A;  4I9C A;  2QY7 A;  2IO2 C;  3NB2 A;  3FFL A;  3Q7F A;  3AAA C;  1DCE A;  4J7W A;  2Q7F A;  1QYM A;  4K0R A;  4R7L A;  4UWG A;  4GZ3 A;  3UM0 A;  5KJK A;  3Q47 B;  3T8K A;  3ZXS A;  4RQI A;  3QK0 A;  3UQ3 A;  3FWV A;  2FI7 A;  4GYW A;  4DPR A;  3EUV A;  2JLB A;  1DNP A;  5FTP A;  2OVF A;  5B3S E;  5BUZ A;  3AU4 A;  2WQH A;  1LF8 A;  3EHM A;  5AAO A;  4UUC A;  5G2N A;  1NA3 A;  2IOL A;  4F1P A;  3FU5 A;  5AEN A;  1K8K G;  1TNU A;  3UT8 A;  3FUN A;  5FQ4 A;  3CHM A;  1OWO A;  2XS1 A;  3UIN C;  5HQ8 A;  2FO7 A;  2H6I A;  1LD8 A;  4DRX E;  5BNW A;  3FEX A;  2ETC A;  1DVP A;  5AIJ A;  4V3I A;  4TXQ A;  3PZ1 A;  2BUG A;  1QZ2 A;  2IF4 A;  4AJW A;  1JWF A;  4B0Z A;  2BKG A;  3LEW A;  1H2T C;  4CZ2 D;  1IKN D;  1B89 A;  2YNQ A;  4YVO A;  4DK5 A;  3DWL G;  1N4Q A;  3CV0 A;  4QQI A;  3SFX A;  1IXV A;  4BER A;  3AS4 A;  4GTQ A;  4Q96 A;  1FCH A;  4U0S A;  4WAF A;  3IXE A;  4OAU C;  4EZJ A;  5FWQ A;  2ZIR A;  4ATZ D;  5T3R A;  4AOF A;  4N2S A;  2QYJ A;  3KEA A;  3TJP A;  4CEM A;  3FTY A;  4URK A;  1IYG A;  3N71 A;  2VQ2 A;  4JEH A;  3LCA A;  2JAB A;  1MHQ A;  1KPS B;  2R17 C;  3VTX A;  3B7B A;  3TXM A;  1PY1 A;  3ZFW A;  5HS0 A;  1E8Y A;  1N0Q A;  3UM1 A;  5JHA A;  4LNU D;  4B94 A;  1HU3 A;  3MV3 B;  3HXD A;  5CRV A;  4H7Y A;  4I1A A;  2MYO A;  4UWF A;  5LFA A;  4KBQ A;  1FVH A;  3ZKJ A;  3APC A;  4G26 A;  5ENS D;  1HF8 A;  5HI7 A;  4H7X A;  4PS8 A;  3ZU7 B;  3LY8 A;  1UJJ A;  5ARG A;  1KT1 A;  4L2Y A;  3I3N A;  1BLX B;  3ASF A;  5CCL A;  4BSX A;  3C72 A;  3E4B A;  3MCX A;  3JQ1 A;  2ILR A;  3LYA A;  3UT7 A;  3ULQ A;  3F6Q A;  2R2L A;  1L5J A;  5D0Q D;  3ULE G;  4EEC A;  1MX4 A;  2EIN E;  3ASH A;  2XCB A;  3CHR A;  4ANX A;  3ABL E;  4QFV A;  4BTB A;  3TG5 A;  2EIM E;  3DBS A;  3NZU A;  5FIO A;  5BV0 A;  3PZ2 A;  1H0A A;  4JW1 A;  2X6H A;  3FHE A;  3AS5 A;  2J07 A;  2YHC A;  1OWL A;  3DSX A;  4IN3 B;  1SW6 A;  3DSU A;  3D9O A;  5C1D A;  4FP7 A;  2OOE A;  1Z3Y A;  3UM2 A;  2AXV A;  3E34 A;  3PNT B;  1WDY A;  3GZ1 A;  1D8D A;  3OXF A;  5EID A;  1H6O A;  3EHQ A;  4UI9 K;  5KBA A;  4F6R D;  5AJD A;  4OVV A;  2XGM A;  3ULY A;  4GTT A;  3AG2 E;  2FEZ A;  2KM4 A;  3PUJ A;  4Q94 A;  3CKB A;  4GB9 A;  3U4T A;  1VDY A;  2J4B A;  3U9W A;  4FHJ A;  4HRM B;  4HQD A;  5B1A E;  3C5R A;  3BUA A;  5AQA A;  2JEK A;  4HBD A;  4GA0 A;  1HE8 A;  2XEN A;  4PS7 A;  2V8S E;  2KXP C;  3CVP A;  2ZXW E;  3ZHE A;  3CGH A;  5G04 J;  4J0U A;  1MZC A;  2LUH A;  1E7V A;  1XNF A;  4I2W A;  2XHE A;  1QNF A;  3HIZ A;  3LJN A;  3U64 A;  3ZEF A;  4UWL A;  3D9I A;  3UMV A;  2XPZ A;  3T9K A;  4LCT A;  5LX8 A;  3UPV A;  2XRZ A;  2DVW A;  3Q49 B;  5ITZ F;  2EIL E;  3RU0 A;  1WM5 A;  4EQF A;  3TWQ A;  2B0O E;  1OCZ E;  3SNX A;  5LCW C;  3FH7 A;  2P58 C;  4XI9 A;  3E30 A;  2VTB A;  4FC8 A;  4XKB A;  5A23 A;  2CHZ A;  3FUM A;  1TN8 A;  5LOZ A;  3S7F A;  5ENQ D;  3RRM B;  3SZ7 A;  3QC1 A;  1SA4 A;  4BES A;  3R9M A;  3G2V A;  2WMO A;  3FU0 A;  2FUL A;  5AQ7 A;  1JCR A;  2IY0 C;  5FT9 A;  4LSZ E;  4YDO A;  1MQS A;  4CT4 A;  4U96 D;  5HKP A;  5T4Y A;  3S7B A;  1H19 A;  3QNK A;  3FUL A;  4HOU A;  4AV7 A;  3CHP A;  5LP0 A;  4ATG A;  2HE0 A;  4GPK A;  3I4G A;  5KJM A;  4G8K A;  1U2V G;  3TG4 A;  3Q73 A;  2L6J A;  3LVQ E;  4N3A A;  2LAI A;  4U63 A;  5H7P A;  2GGF A;  3UM3 A;  4MKT A;  2WXR A;  5JJ7 A;  1N95 A;  3FU6 A;  1X5B A;  3DXK G;  3FY4 A;  1HS6 A;  3E32 A;  1N4S A;  2IOS A;  4NRH B;  3LPZ A;  2ZU6 B;  4F53 A;  2MOW A;  4FHK A;  2CHW A;  2EIK E;  4I43 A;  4YDE A;  3FH5 A;  2GRR B;  5ANR A;  2J49 A;  4DX6 D;  2B6C A;  1H6P A;  1H6K A;  4A55 A;  3D9K A;  3MX3 A;  3T5V A;  1HZ4 A;  4I6E A;  2LAH A;  2WXK A;  3CEQ A;  1SVX A;  3E33 A;  3NZS A;  3PNL B;  4FLB A;  4K5B A;  2AXZ A;  2GRO B;  3CHQ A;  4HLE A;  3GYZ A;  3FUF A;  2H6G A;  1YCS B;  4OVU A;  2WB2 A;  3PZ4 A;  3CLJ A;  4BT9 A;  4GYO A;  2PQR A;  5JJ6 A;  3UKU G;  5BPP A;  4GCO A;  2J09 A;  4HOR A;  1K1A A;  4BY6 A;  3QDN A;  1FPP A;  3J5Q B;  3PDN A;  3ZNG A;  1H2U A;  4U0Z A;  1E8Z A;  4AVX A;  3VLE A;  2KBX A;  1W3B A;  1FVF A;  3SF4 A;  3ZRH A;  1OWP A;  1EF1 C;  5EN5 D;  1IHG A;  3L82 A;  3HXF A;  4I1M A;  2P9P G;  4GA2 A;  2GRN B;  2P9U G;  3JXJ A;  2XZD G;  2XPY A;  5FZR A;  3RO2 A;  1HXI A;  1ELW A;  2CG2 A;  3T5X A;  4DLQ A;  4TRQ A;  4D10 C;  4L23 A;  2X6J A;  1AP7 A;  3LKU A;  3MZL B;  3MKR A;  2P9K G;  1EYH A;  4J8S A;  1HFA A;  3FEY A;  2WXM A;  5CEA A;  5BXU A;  3NQP A;  4ACL A;  5EIL A;  2ETB A;  2OCC E;  3JUI A;  2I2O A;  1JCS A;  2DCP A;  4HRL A;  1UOH A;  3KD7 A;  2CFZ A;  3LDZ A;  3PZ3 A;  1H2V C;  1X81 A;  4BX8 A;  3X2Q E;  4UI9 J;  4WUY A;  2ETA A;  3PRZ A;  3B13 A;  3EHN A;  5D2M C;  2X6K A;  3WG7 E;  5J90 A;  3V79 K;  4DX1 A;  3C3R A;  2NC9 A;  2XPI A;  1HH8 A;  2LXL A;  3RRU A;  3URZ A;  2F8X K;  1SZ9 A;  4L9P A;  4K03 A;  3QWV A;  2XQ0 A;  5EYP F;  4JL0 A;  4KMO A;  4N3C A;  5JA4 D;  4CCA A;  3FP3 A;  3TXN A;  4PH4 B;  3ZYQ A;  2PNN A;  3D9H A;  4O6F A;  2AW6 A;  3LVR E;  2UY1 A;  3KS2 A;  4GMR A;  1OCR E;  3IKO B;  4JZY A;  3MA5 A;  4AIF A;  4HVB A;  4LER A;  1AWC B;  4GZ5 A;  2NXP A;  1N11 A;  2HM8 A;  2PL2 A;  2RD0 A;  3HXE A;  4HXI A;  4U7E B;  1MYO A;  3B95 A;  3PEV B;  5G55 A;  2P2C P;  3ML9 A;  5DIZ A;  1BI8 B;  1O1T A;  4TXP A;  4KXK B;  1TN7 A;  4CGW A;  4APO A;  5E75 A;  4BWR A;  4J8E A;  5KNH D;  4FU3 A;  3EIQ C;  4U8Y D;  1PC2 A;  3JQ0 A;  5FZS A;  4AXH A;  2KZT A;  2WXN A;  1OXJ A;  3FUJ A;  3HVE A;  4HOT A;  4JVS A;  1NA0 A;  1G3N B;  2DZN A;  4JPS A;  4NAC A;  2I9C A;  2R03 A;  3V30 A;  4JHJ A;  3Q75 A;  3SI5 A;  4A1S A;  5IY5 E;  1EPU A;  3CST A;  1ZBP A;  4F1S A;  4EZK A;  3QOU A;  3UIO C;  3C98 A;  4WWP A;  3LS8 A;  3LXU X;  3IBE A;  1TEZ A;  4BFR A;  3CVU A;  3QWP A;  1OWN A;  4J8F A;  5AQB A;  4J8Y A;  1D8E A;  2PQN A;  2CG3 A;  3DRA A;  3B7S A;  1IQR A;  2XGO A;  2GRL A;  1SZA A;  1NP7 A;  2V4L A;  1MX2 A;  1OT8 A;  3W9G A;  4CDM A;  2VGX A;  2AWI A;  4YDY A;  3ESK A;  4JEU A;  3U66 A;  3DPD A;  3SGH A;  1TR4 A;  2I1K A;  1PAQ A;  3R9A B;  5EX3 A;  3SBT B;  2FBN A;  4GPM A;  4JHR A;  2A4Z A;  3CVY A;  4U95 D;  4JD2 G;  3L22 A;  1YA0 A;  3TAX A;  2VYI A;  3APD A;  4LRZ A;  3C3O A;  2WM9 A;  2DBA A;  3TWR A;  3AG3 E;  1UN8 A;  1UJK A;  3VLD A;  3PS6 A;  3ABK E;  5JJT A;  3J5P A;  2CHX A;  2F8Y A;  3PE4 A;  4F7A A;  2RG8 A;  5BT1 A;  3MKQ A;  4Y6C A;  3O4Z A;  4TV3 A;  3RAU A;  3ZIM A;  2WQ7 A;  3PVL A;  3S7J A;  4G25 A;  1TJF A;  1QBQ A;  2NYJ A;  4WWN A;  2XRY A;  4APF A;  4DUI A;  2DZO A;  4HFG A;  4DX2 A;  1Z6T A;  1KZO A;  3DSV A;  4GZD A;  3OXG A;  1KZP A;  2PZI A;  3SY2 A;  2DYR E;  5G05 C;  3DEO A;  4EBA G;  3HYM B;  4UQX A;  2UY1 B;  4DLO A;  5EYL A;  3B7R L;  2CFU A;  4U8H A;  5CBN A;  1NFI E;  4AM9 A;  2AXU A;  3AS8 A;  5CMY A;  1IQU A;  4C48 B;  3P2B A;  1UN9 A;  5HRY A;  1NZN A;  5EDS A;  4U8V D;  2X6I A;  5ANL A;  4AY5 A;  4TUM A;  3L9T A;  4CT0 A;  3ABM E;  3FUK A;  3R7R A;  5AJL A;  4WWO A;  5EKQ D;  3ENE A; 
#chains in the Genus database with same CATH homology
 3MX3 A;  3T5V A;  3ZGQ A;  4DI4 A;  3LJ3 A;  1ELR A;  5HQ8 A;  3GW4 A;  1HZ4 A;  1ELK A;  2FO7 A;  5M72 A;  2WXJ A;  4I6E A;  2WXO A;  2LAH A;  2WXK A;  3FTW A;  5BNW A;  4XE0 A;  3FEX A;  3CEQ A;  1Z3X A;  3D3M A;  2WXQ A;  1DVP A;  4JHK A;  4RVB A;  3SFZ A;  3L08 A;  5AIJ A;  2KCV A;  3UT8 A;  4V3I A;  3NZS A;  3CQG B;  3ZN3 A;  3MV2 B;  5CMW A;  3CK7 A;  1INZ A;  3ZYM A;  3HHM A;  4ME2 A;  3PNL B;  4FLB A;  4ABN A;  4FJY A;  5CHE E;  2BUG A;  2AXZ A;  5G05 J;  1QZ2 A;  3CHQ A;  4HLE A;  4HS2 A;  3GYZ A;  2A5U A;  2IF4 A;  4AJW A;  1JWF A;  3FUF A;  5AYW D;  1E7U A;  3G2W A;  4GYY A;  4KVO A;  1ZU2 A;  4OVU A;  4B0Z A;  4E6H A;  2WB2 A;  3LEW A;  1H2T C;  3ONK A;  3GZ2 A;  3FU3 A;  3CVL A;  2BTD A;  3CLJ A;  3QKY A;  2MHK A;  4UWK A;  1B89 A;  2YNQ A;  1U3D A;  4BT9 A;  4GYO A;  3CVX A;  2PQR A;  4YVO A;  5JJ6 A;  4DK5 A;  5KCM A;  3CV0 A;  5BPP A;  4HOS A;  4GCO A;  2V0P A;  4JC8 A;  2J09 A;  4OYS A;  4HOR A;  3CQC B;  3RRN B;  4BY6 A;  3AS4 A;  4Q96 A;  4CDR A;  1FCH A;  4U0S A;  4WAF A;  4Y6W A;  3QDN A;  5FWQ A;  4EZJ A;  3CVV A;  3PDN A;  2OVB A;  4I1O B;  1H2U A;  4U0Z A;  1E8Z A;  2PM6 A;  4AVX A;  3VLE A;  5EX0 A;  5T3R A;  5FQ6 A;  4AOF A;  4N2S A;  2IFU A;  4JXT A;  5JHB A;  1W3B A;  2XEV A;  1WAO 1;  1FVF A;  4A3V A;  2L0I A;  3TJP A;  3SF4 A;  4CEM A;  3ZRH A;  1OWP A;  1EF1 C;  1IHG A;  2KCL A;  4I1M A;  3FTY A;  4URK A;  4GA2 A;  4GA1 A;  1HG2 A;  1IYG A;  3N71 A;  1N52 A;  2VQ2 A;  4JEH A;  3LCA A;  1JPL A;  1MHQ A;  2VSN A;  2XPY A;  3U3W A;  3B7T A;  2HYZ A;  2HR2 A;  2R17 C;  3ONL A;  5FZR A;  3RO2 A;  3VTX A;  4NQ0 A;  4L7T A;  3TXM A;  1HXI A;  1ELW A;  1PY1 A;  2CG2 A;  3MEK A;  3T5X A;  3ZFW A;  4TRQ A;  4DLQ A;  1E8Y A;  2IJG X;  4D10 C;  4FUL A;  4G1T A;  4L23 A;  4B8A A;  2X6J A;  3EIJ A;  4FA6 A;  3LKU A;  1S0P A;  5JHA A;  4GMJ A;  2L9B A;  3MZL B;  3MKR A;  4B94 A;  4A1G A;  5LCW J;  4EBA A;  1HU3 A;  3EDT B;  2HO1 A;  3MV3 B;  2LNI A;  1EYH A;  4J8S A;  3CIA A;  1XGW A;  1HFA A;  3FEY A;  2WXM A;  4BX9 A;  3D9J A;  3NQP A;  4ACL A;  4H7Y A;  4I1A A;  4UWF A;  4B89 A;  3JUI A;  5LFA A;  2I2O A;  4KBQ A;  3TGO A;  4WNF A;  2WXI A;  1FVH A;  2Y4U A;  4NUR A;  3OXL A;  4UQZ A;  3APF A;  3Q15 A;  2X3M A;  3APC A;  4G26 A;  3ZVV A;  1HF8 A;  3PZD A;  2DCP A;  1UW4 B;  3KD7 A;  5HI7 A;  2CFZ A;  3BEE A;  4H7X A;  3CR3 A;  3LDZ A;  5KJL A;  3QB2 A;  3L54 A;  3ZYL A;  4PS8 A;  1H2V C;  2WPV A;  3LY8 A;  3UT4 A;  1UJJ A;  5ARG A;  4BX8 A;  4UI9 J;  1KT1 A;  4WUY A;  3PRZ A;  2R5S A;  3B13 A;  3L16 A;  1EDU A;  3EHN A;  2X6K A;  3UX4 A;  4MS6 A;  3S2A A;  3D9M A;  4L2Y A;  5J90 A;  2C0M A;  4EPZ A;  3I3N A;  2NC9 A;  2XPI A;  1HH8 A;  3ASF A;  4J6I A;  5CCL A;  4GML A;  3NF1 A;  4KZ0 A;  3RRU A;  3RK6 A;  2WVI A;  3VTY A;  3URZ A;  4BSX A;  3LY7 A;  3E4B A;  3MCX A;  3ASG A;  1SZ9 A;  2WXP A;  5D0O D;  3KAE A;  3JQ1 A;  4I17 A;  2KZT B;  2ILR A;  3QAQ A;  3LYA A;  4K03 A;  3QWV A;  2XQ0 A;  4JL0 A;  3UT7 A;  3ULQ A;  4XIF A;  1U3C A;  3HVE B;  4KMO A;  4N3C A;  2PM7 A;  4AEZ C;  3IHV A;  2FF4 A;  5C2Y A;  4CCA A;  4TUU A;  3FP3 A;  3IHY A;  4YND A;  2E2E A;  1L5J A;  2WXH A;  3CVQ A;  4IRU A;  5D0Q D;  3TXN A;  4AP2 A;  4EEC A;  4PH4 B;  1WY6 A;  2UWJ G;  4U07 A;  3ASH A;  3ZYQ A;  4A3T A;  2MRI A;  2WXL A;  2XCB A;  3FDH A;  4O6F A;  3CHR A;  2AW6 A;  2C2L A;  3LVR E;  4C0M A;  2UY1 A;  3KS2 A;  4ILI A;  2I1J A;  4ANX A;  4BTB A;  4QFV A;  4YVQ C;  4G24 A;  3IKO B;  3I4R B;  2LO6 A;  3G2T A;  4JZY A;  3TG5 A;  3MA5 A;  3DBS A;  3NZU A;  4AIF A;  4HVB A;  2OV8 A;  4LER A;  4AY6 A;  4GZ5 A;  2NXP A;  2VSX E;  2HM8 A;  4I9E A;  5BV0 A;  3RKV A;  3T8M A;  3FTV A;  2PL2 A;  1H0A A;  3QAR A;  3L17 A;  2RD0 A;  4JW1 A;  4DI3 A;  4HXI A;  3O48 A;  3PEV B;  5G55 A;  3ML9 A;  2X6H A;  5DIZ A;  2VGY A;  3FHE A;  3CHO A;  3FTX A;  3AS5 A;  3HDX A;  2J07 A;  2YHC A;  1OWL A;  2V5F A;  3CSF A;  4IN3 B;  4N3B A;  4RG6 A;  5BW8 C;  4KXK B;  3CHS A;  4UQY A;  3ML8 A;  4IYP A;  4CGW A;  4RSY A;  3D9O A;  4APO A;  3CK8 A;  4RG9 A;  5E75 A;  4BWR A;  5C1D A;  3KEZ A;  4KT6 B;  4FP7 A;  2OOE A;  4J8E A;  4WND A;  2M63 A;  3RIB A;  5G04 C;  4FU3 A;  3EIQ C;  4W9R A;  1Z3Y A;  2J08 A;  2YIN A;  5A7D B;  3S7D A;  1PC2 A;  3G2U A;  3JQ0 A;  5FZS A;  2KZT A;  2WXN A;  2AXV A;  2C0L A;  1P5Q A;  3ZHE B;  4AXH A;  3PNT B;  3GZ1 A;  2YQ8 A;  3K9I A;  1UG3 A;  3MJW A;  3FUJ A;  3HVE A;  3OXF A;  4LUN U;  4JVS A;  3I5P A;  4HOT A;  2WXG A;  3PEU B;  1NA0 A;  2VGX B;  4JPS A;  1E8W A;  2VJ8 A;  4UI9 K;  4NAC A;  2I9C A;  4DJA A;  4EZL A;  4U0U A;  4JA9 A;  5AJD A;  3AU5 A;  4OVV A;  2XGM A;  4ACK A;  2J9Q A;  3RJV A;  4E85 A;  3FUE A;  2WQ6 A;  3GZS A;  2FEZ A;  3ZW3 A;  3QWW A;  1N54 A;  3FUD A;  3Q5M A;  2KM4 A;  4N2Q A;  5KJN A;  4JHJ A;  3PUJ A;  1Y8M A;  3SI5 A;  3JCK C;  1JWG A;  4PDX A;  4MLP A;  4A1S A;  1EPU A;  1OWO A;  1ZBP A;  3CST A;  4Q94 A;  4F1S A;  4EZK A;  5A6C A;  3CKB A;  1E96 B;  4Q69 A;  3QOU A;  4GB9 A;  3U4T A;  1VDY A;  2J4B A;  4I6J A;  3U9W A;  3C98 A;  4WWP A;  2XGS A;  3LS8 A;  3LXU X;  3IBE A;  2XCC A;  4FHJ A;  1TEZ A;  4WNE A;  4BFR A;  3R7Q A;  1OWM A;  2OND A;  3CVU A;  2VTB B;  2X6F A;  3QWP A;  2VSO E;  5FJY A;  3IEG A;  1OWN A;  3SHF A;  4GZC A;  4J8F A;  4IUL A;  3PE3 A;  2KAT A;  3QJZ A;  4JA7 A;  2NSZ A;  2JEK A;  4GA0 A;  4WNG A;  1HE8 A;  3MGB A;  4N39 A;  1GW6 A;  2PQN A;  4GU5 A;  2CG3 A;  4PS7 A;  3B7S A;  5E76 A;  3RO3 A;  1IQR A;  2V8S E;  2DIW A;  3CVP A;  3PRE A;  5FQ7 A;  1HO8 A;  2EQX A;  4I6G A;  3CGH A;  3ZHE A;  1E8X A;  2ION A;  2Y4T A;  5G04 J;  2XGO A;  5T8I A;  4F3V A;  2GRL A;  4J0U A;  4PS3 A;  1SZA A;  3G2S A;  4ANV A;  2GW1 A;  1NP7 A;  2V4L A;  4I2Z A;  1Y6I A;  4CDM A;  1E7V A;  2VGX A;  1KT0 A;  2AWI A;  1XNF A;  3MKQ B;  5FQ8 A;  3MYV A;  4GAA A;  5BV1 A;  4KVM A;  4I2W A;  4HOQ A;  2XHE A;  3ESK A;  3IV0 A;  4JEU A;  3U66 A;  1QNF A;  3HIZ A;  2BF0 X;  4XI0 A;  3U64 A;  3ZEF A;  3DPD A;  4UWL A;  4ANW A;  3SGH A;  3ESL A;  2I1K A;  1PAQ A;  3R9A B;  3Q4A B;  2KCK A;  5ARF A;  3D9I A;  5EX3 A;  2WXF A;  2X38 A;  4CRW A;  3L13 A;  3SBT B;  3UMV A;  2FBN A;  2XPZ A;  4LCT A;  4JHR A;  4CDN A;  5LX8 A;  2A4Z A;  3CVY A;  3UPV A;  4PUC A;  4FLH A;  1QQE A;  4FJZ A;  3Q49 B;  1TJC A;  2XRZ A;  4XZ4 A;  2L0T B;  4BT8 A;  3CVW A;  4M3O A;  3RU0 A;  3OAW A;  3SD5 A;  3L22 A;  1WM5 A;  4ANU A;  3LY9 A;  1YA0 A;  4EQF A;  4C0E A;  3TAX A;  4L2L A;  3SNX A;  5LCW C;  1JUQ A;  4G2V A;  2VYI A;  3FH7 A;  2E0I A;  2P58 C;  3BG0 B;  4XI9 A;  3APD A;  4B8C B;  4BTA A;  1SQM A;  3FUH A;  4LRZ A;  5FZQ A;  2VTB A;  5ENN A;  2WM9 A;  2DBA A;  4FC8 A;  3SBS A;  4XKB A;  5A23 A;  2CHZ A;  3FUM A;  5LOZ A;  1HX8 A;  3S7F A;  1UN8 A;  3RRM B;  1UJK A;  3VLD A;  3OTN A;  3PS6 A;  3B7U X;  5JJT A;  2WMN A;  3SZ7 A;  2LSU A;  4CGV A;  2CHX A;  3QC1 A;  3P1U A;  2R59 A;  1BPO A;  3D9P A;  3EJN A;  3PE4 A;  4F7A A;  2RG8 A;  3FTZ A;  4UI9 C;  1E90 A;  1KLX A;  5BT1 A;  1OUV A;  3G2V A;  3MKQ A;  2GRM A;  3FUI A;  3ZYK A;  2WMO A;  3FU0 A;  2FUL A;  4Y6C A;  3TL5 A;  3O4Z A;  4TV3 A;  2VSY A;  5FT9 A;  3CVN A;  1A17 A;  4J8D A;  3ZIM A;  2WQ7 A;  3PVL A;  1MQS A;  4GCN A;  3S7J A;  4G25 A;  4CT4 A;  5DBK A;  4UWH A;  4A55 A;  2IQC A;  3JYS A;  3UUX A;  5T4Y A;  3S7B A;  1H19 A;  1TJF A;  3QNK A;  3VLF A;  4WWN A;  2KC7 A;  2XRY A;  2Y3A A;  3FUL A;  4HOU A;  2AVP A;  3CHP A;  4APF A;  4AV7 A;  4LEU A;  4FAD A;  3CKC A;  4HFG A;  5LP0 A;  4ATG A;  4ILH B;  3BG1 B;  4KZC A;  4XKC A;  4I9C A;  4GPK A;  1Z6T A;  2QFC A;  2QY7 A;  4GZD A;  3OXG A;  3I4G A;  3L6A A;  5KJM A;  3FFL A;  4N5C A;  2I6H A;  2PZI A;  3WXX A;  5G05 C;  3CK9 A;  2Q7F A;  4K0R A;  4R7L A;  4UWG A;  4EBA G;  4GZ3 A;  3TG4 A;  3HYM B;  5KJK A;  3Q47 B;  4UQX A;  2UY1 B;  3FH8 A;  4DLO A;  4C9B B;  3ZXS A;  3B7R L;  4L1B A;  2CFU A;  2L6J A;  3D9N A;  3LVQ E;  3QK0 A;  4G11 A;  4U8H A;  3UQ3 A;  4N3A A;  2LAI A;  3FWV A;  3PH0 C;  4U63 A;  4U04 A;  4GZ6 A;  2FI7 A;  3ASD A;  5CCM A;  4GYW A;  4XX5 A;  4DPR A;  2JLB A;  5J08 A;  4AM9 A;  2GGF A;  2J4D A;  1DNP A;  4MKT A;  5FTP A;  2AXU A;  3AS8 A;  2OVF A;  2WXR A;  5CMY A;  5JJ7 A;  5BUZ A;  1IQU A;  3AU4 A;  3FU6 A;  3FTU A;  2IU1 A;  3P2B A;  3PUK A;  2LSV A;  1UN9 A;  1X5B A;  2WQH A;  4KYO B;  3FY4 A;  1NZN A;  4G23 A;  1LF8 A;  5EDS A;  1HS6 A;  3EHM A;  2X6I A;  2IOS A;  4ILG A;  4MRU A;  3ZPJ A;  4NRH B;  3LPZ A;  4P29 A;  5ANL A;  5G2N A;  2YHE A;  4AY5 A;  2ZU6 B;  1NA3 A;  4F53 A;  2IOL A;  2MOW A;  3FU5 A;  4FHK A;  3D9L A;  5AEN A;  2CHW A;  4CT0 A;  4I43 A;  1HG5 A;  3FTS A;  3FH5 A;  3FUK A;  3R7R A;  5AJL A;  5ANR A;  2J49 A;  4WWO A;  1H6K A;  5EKQ D;  3FUN A;  5FQ4 A;  3ENE A;  3CHM A;  3D9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...