4BTHA

The leua146trp,pheb24tyr double mutant of the quorum quenching n-acyl homoserine lactone acylase pvdq has an altered substrate specificity towards small acyl chains
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
164
structure length
164
Chain Sequence
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRWLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-HOMOSERINE LACTONE ACYLASE PVDQ SUBUNIT ALPHA
publication title Reducing Virulence of the Human Pathogen Burkholderia by Altering the Substrate Specificity of the Quorum-Quenching Acylase Pvdq
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 53
structure length 164
sequence length 164
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4bthA00
1AJQA 1GM7A 1JVZA 4YF9A 1CP9A 4E57A 3L94A 1AJPA 1GK1A 2ADVA 1AI4A 1FM2A 2WYEA 1JW0A 2AE4A 3K3WA 1K7DA 1OR0A 2WYDA 4HSRA 4PELA 4YFAA 3SRCA 1KECA 4E55A 1PNKA 1PNLA 1AI7A 1FXVA 4WKUA 4WKVA 2WYCA 1GM9A 3S8RA 3SRBA 1GM8A 1GKFA 1GHDA 1K5SA 4HSTA 1E3AA 4E56A 4PEMA 3L91A 2WYBA 1PNMA 2AE5A 3JTRA 1AJNA 1KEHA 3JTQA 3SRAA 1K5QA 1GK0A 3ML0A 1GK9A 1FXHA 4K2GA 1AI5A 4WKSA 2AE3A 4K2FA 1JX9A 4BTHA 4YFBA 4WKTA 4M1JA 1H2GA 1AI6A
chains in the Genus database with same CATH superfamily
1AJQA 1GM7A 1JVZA 4YF9A 1CP9A 4E57A 3L94A 1AJPA 1GK1A 2ADVA 1AI4A 1FM2A 2WYEA 1JW0A 2AE4A 3FGTA 1K7DA 1OR0A 2WYDA 3K3WA 4HSRA 4PELA 4YFAA 1KECA 4E55A 1PNKA 1PNLA 3FGRA 1AI7A 1FXVA 4WKUA 4WKVA 3SRCA 2WYCA 1GM9A 3S8RA 3SRBA 1GM8A 1GKFA 1GHDA 1K5SA 4HSTA 1E3AA 4E56A 4PEMA 3L91A 2WYBA 1PNMA 2AE5A 3JTRA 1AJNA 1KEHA 3JTQA 3SRAA 1K5QA 1GK0A 3ML0A 1GK9A 1FXHA 4K2GA 1AI5A 4WKSA 2AE3A 4K2FA 1JX9A 4BTHA 4YFBA 4WKTA 4M1JA 4BWCA 1H2GA 1AI6A
chains in the Genus database with same CATH topology
1AJQA 1GM7A 1JVZA 4YF9A 1CP9A 4E57A 3L94A 1AJPA 1GK1A 2ADVA 1AI4A 1FM2A 2WYEA 1JW0A 2AE4A 3K3WA 1K7DA 1OR0A 2WYDA 4HSRA 4PELA 4YFAA 3SRCA 1KECA 4E55A 1PNKA 1PNLA 1AI7A 1FXVA 4WKUA 4WKVA 2WYCA 1GM9A 3S8RA 3SRBA 1GM8A 1GKFA 1GHDA 1K5SA 4HSTA 1E3AA 4E56A 4PEMA 3L91A 2WYBA 1PNMA 2AE5A 3JTRA 1AJNA 1KEHA 3JTQA 3SRAA 1K5QA 1GK0A 3ML0A 1GK9A 1FXHA 4K2GA 1AI5A 4WKSA 2AE3A 4K2FA 1JX9A 4BTHA 4YFBA 4WKTA 4M1JA 1H2GA 1AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJQ A;  1GM7 A;  1JVZ A;  4YF9 A;  1CP9 A;  4E57 A;  3L94 A;  1AJP A;  1GK1 A;  2ADV A;  1AI4 A;  1FM2 A;  2WYE A;  1JW0 A;  2AE4 A;  3K3W A;  1K7D A;  1OR0 A;  2WYD A;  4HSR A;  4PEL A;  4YFA A;  3SRC A;  1KEC A;  4E55 A;  1PNK A;  1PNL A;  1AI7 A;  1FXV A;  4WKU A;  4WKV A;  2WYC A;  1GM9 A;  3S8R A;  3SRB A;  1GM8 A;  1GKF A;  1GHD A;  1K5S A;  4HST A;  1E3A A;  4E56 A;  4PEM A;  3L91 A;  2WYB A;  1PNM A;  2AE5 A;  3JTR A;  1AJN A;  1KEH A;  3JTQ A;  3SRA A;  1K5Q A;  1GK0 A;  3ML0 A;  1GK9 A;  1FXH A;  4K2G A;  1AI5 A;  4WKS A;  2AE3 A;  4K2F A;  1JX9 A;  4BTH A;  4YFB A;  4WKT A;  4M1J A;  1H2G A;  1AI6 A; 
#chains in the Genus database with same CATH topology
 1AJQ A;  1GM7 A;  1JVZ A;  4YF9 A;  1CP9 A;  4E57 A;  3L94 A;  1AJP A;  1GK1 A;  2ADV A;  1AI4 A;  1FM2 A;  2WYE A;  1JW0 A;  2AE4 A;  3FGT A;  1K7D A;  1OR0 A;  2WYD A;  3K3W A;  4HSR A;  4PEL A;  4YFA A;  1KEC A;  4E55 A;  1PNK A;  1PNL A;  3FGR A;  1AI7 A;  1FXV A;  4WKU A;  4WKV A;  3SRC A;  2WYC A;  1GM9 A;  3S8R A;  3SRB A;  1GM8 A;  1GKF A;  1GHD A;  1K5S A;  4HST A;  1E3A A;  4E56 A;  4PEM A;  3L91 A;  2WYB A;  1PNM A;  2AE5 A;  3JTR A;  1AJN A;  1KEH A;  3JTQ A;  3SRA A;  1K5Q A;  1GK0 A;  3ML0 A;  1GK9 A;  1FXH A;  4K2G A;  1AI5 A;  4WKS A;  2AE3 A;  4K2F A;  1JX9 A;  4BTH A;  4YFB A;  4WKT A;  4M1J A;  4BWC A;  1H2G A;  1AI6 A; 
#chains in the Genus database with same CATH homology
 1AJQ A;  1GM7 A;  1JVZ A;  4YF9 A;  1CP9 A;  4E57 A;  3L94 A;  1AJP A;  1GK1 A;  2ADV A;  1AI4 A;  1FM2 A;  2WYE A;  1JW0 A;  2AE4 A;  3K3W A;  1K7D A;  1OR0 A;  2WYD A;  4HSR A;  4PEL A;  4YFA A;  3SRC A;  1KEC A;  4E55 A;  1PNK A;  1PNL A;  1AI7 A;  1FXV A;  4WKU A;  4WKV A;  2WYC A;  1GM9 A;  3S8R A;  3SRB A;  1GM8 A;  1GKF A;  1GHD A;  1K5S A;  4HST A;  1E3A A;  4E56 A;  4PEM A;  3L91 A;  2WYB A;  1PNM A;  2AE5 A;  3JTR A;  1AJN A;  1KEH A;  3JTQ A;  3SRA A;  1K5Q A;  1GK0 A;  3ML0 A;  1GK9 A;  1FXH A;  4K2G A;  1AI5 A;  4WKS A;  2AE3 A;  4K2F A;  1JX9 A;  4BTH A;  4YFB A;  4WKT A;  4M1J A;  1H2G A;  1AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...