4BU3A

Crystal structure of human tankyrase 2 in complex with 2-phenyl-3,4- dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu3A00
4F0EA 4PMLA 4R5WA 1UK1A 3W51A 5AL1A 3SMIA 3GN7A 4OPXC 4HHZA 3P0PA 4BUUA 3L3MA 4UVSA 4PJTA 4KZQA 4BU9A 4BUIA 3U9YA 4OQAC 5DCZA 4BUEA 4J1ZA 5ETYA 3SE2A 4U6AA 3MHKA 4L7OA 4BU7A 4BJCA 4UI6A 4L0IA 4PJVA 4HLFA 4J3LA 4LI7A 4OA7A 4L34A 4PNQA 4UFUA 5AL2A 4K4FA 4L6ZA 5AL5A 4HL5A 4BUAA 3C4HA 4GV7A 3GOYA 5ECEA 4LI6A 4UVVA 4UVZA 1WOKA 3CE0A 4K4EA 4X52A 4AVUA 4IUEA 3FHBA 4N4TA 3BLJA 4TJYA 4UVYA 5C5PA 3UH2A 4PNTA 3UH4A 4TKGA 4UXBA 4AVWA 4LI8A 3C49A 2RD6A 3KR8A 4M7BA 3P0NA 5AKUA 4HKKA 5AL3A 4UUHA 4TK0A 5EBTA 4TORA 4L7PA 4TVJA 4HLGA 3GEYA 3MHJA 4HKIA 4KZUA 4MSKA 5AL4A 5C5RA 4BJ9A 4PNSA 4BUWA 3GJWA 1GS0A 5AKWA 4BUYA 4PAXA 4PNMA 4J22A 4N4VA 5C5QA 4HLHA 2RCWA 3PAXA 4W5SA 5ADSA 3KR7A 4UI3A 4PNRA 4HHYA 5A00A 5LXPA 3L3LA 4HMHA 4N3RA 4UVLA 4UI8A 4L10A 4L2FA 4F1LA 4L33A 4DVIA 1A26A 4L0BA 4L7NA 5AEHA 4BUDA 2RF5A 4J3MA 2PQFA 4L2KA 4UVXA 5FPFA 3HKVA 4TJWA 4UI4A 4L31A 4L0SA 4TOSA 1PAXA 5ADTA 4OQBC 4PY4A 5ADRA 5FPGA 4UVPA 4BUTA 4L09A 1UK0A 3UDDA 4L6SA 4I9IA 4W5IA 4XHUA 3KCZA 4L70A 4PNNA 4TKIA 4BU3A 4UX4A 4TKFA 4GV2A 4KRSA 4UI7A 4J21A 4MSGA 4ZZYA 4HLKA 5LX6A 4MT9A 4R6EA 4UFYA 1EFYA 4ZZXA 5LYHA 4UI5A 4F1QA 3U9HA 4BFPA 4BU6A 4GV4A 4TK5A 4BU5A 2PAWA 3KJDA 4HYFA 4BUSA 4HKNA 4UVTA 4DQYC 4UNDA 4L7RA 5ADQA 4BUXA 4L32A 4UVUA 4UVNA 2X5YA 4UVWA 4L2GA 4BS4A 4UVOA 4GV0A 4BUFA 4BU8A 2PAXA 4TJUA 3UA9A 4W6EA 3P0QA 4PNLA 4L7LA 4HLMA 4UW1A 4KZLA 4L7UA 4ZZZA 4UHGA 4L0TA 3SMJA 4BJBA 4L0VA 4RV6A 4BUVA
chains in the Genus database with same CATH superfamily
4F0EA 4PMLA 4R5WA 4GNLA 4WPTA 1UK1A 3W51A 2OLQA 3DT4A 5AL1A 3GN7A 3SMIA 4OPXC 4HHZA 3P0PA 4BUUA 3L3MA 4UVSA 4PJTA 4KZQA 4BU9A 4WPUA 3U9YA 1YLHA 4BUIA 5DCZA 4OQAC 3MOHA 4GMZA 4J1ZA 5ETYA 4BUEA 2PXZX 3SE2A 4U6AA 3MHKA 4L7OA 5FH5A 4OX2A 4BJCA 4BU7A 4UI6A 4L0IA 4PJVA 4HLFA 4J3LA 1II2A 4LI7A 4OA7A 4L34A 4PNQA 3DT7A 4UFUA 4K4FA 4L6ZA 5AL2A 5AL5A 4GMMA 4HL5A 4BUAA 3C4HA 1AQ2A 3MOFA 4GV7A 1KHEA 3GOYA 5I67A 5ECEA 4LI6A 2QF2A 4UVVA 1WOKA 2PC9A 4UVZA 3CE0A 4K4EA 4X52A 4YWDA 4AVUA 2RKAA 4IUEA 3FHBA 4N4TA 3BLJA 4TJYA 4UVYA 5C5PA 3UH2A 4YW9A 4PNTA 3UH4A 1KHFA 4TKGA 4UXBA 4AVWA 1K3DA 4LI8A 3C49A 2RD6A 4GMWA 3MOEA 3KR8A 2QEYA 3P0NA 4M7BA 4HKKA 5AKUA 4YWBA 5AL3A 4UUHA 4TK0A 5EBTA 1J3BA 4TORA 4L7PA 4TVJA 1AYLA 3GEYA 3MHJA 4HKIA 4HLGA 4KZUA 4MSKA 5AL4A 5C5RA 4BJ9A 4PNSA 4BUWA 3GJWA 1GS0A 5AKWA 4BUYA 4PAXA 1YVYA 4PNMA 4J22A 4N4VA 3DTBA 5C5QA 4HLHA 2RCWA 3PAXA 4W5SA 5ADSA 3KR7A 4UI3A 4PNRA 4HHYA 5A00A 5LXPA 3L3LA 4HMHA 4N3RA 4UVLA 4UI8A 4L10A 4L2FA 4F1LA 4L33A 2RKDA 4DVIA 1A26A 4L0BA 4L7NA 5AEHA 4BUDA 2RF5A 4J3MA 2PQFA 2PY7X 4L2KA 4UVXA 5FPFA 3HKVA 4TJWA 4UI4A 4L31A 4L0SA 4TOSA 1PAXA 5ADTA 4OQBC 4PY4A 2ZCIA 5ADRA 5FH4A 2QEWA 5FPGA 4R43A 4UVPA 4BUTA 1K3CA 4L09A 1UK0A 4WIEA 4L6SA 4I9IA 4W5IA 4XHUA 1OENA 3UDDA 3KCZA 4L70A 4PNNA 4TKIA 4BU3A 4UX4A 2FAHA 5FH1A 4TKFA 4GNMA 4GV2A 4KRSA 4UI7A 4J21A 4MSGA 4WIUA 4ZZYA 4HLKA 4YW8A 5LX6A 1KHGA 4MT9A 4R6EA 4UFYA 1EFYA 4ZZXA 5LYHA 1OS1A 4UI5A 3U9HA 4F1QA 4BFPA 4BU6A 1M51A 4GV4A 4TK5A 4BU5A 2PAWA 3KJDA 2QF1A 4HYFA 4WL8A 4BUSA 4HKNA 4UVTA 4DQYC 4UNDA 4L7RA 5ADQA 4BUXA 3DT2A 4L32A 5FH2A 2FAFA 4UVUA 4UVNA 2X5YA 2QZYA 4L2GA 4UVWA 4BS4A 5FH3A 4UVOA 4GV0A 4WOUA 4BUFA 1NHXA 4BU8A 1XKVA 1YGGA 1KHBA 4WPVA 2GMVA 2PAXA 4TJUA 5FH0A 3UA9A 4RCGA 2RK7A 4W6EA 3P0QA 2RKEA 4PNLA 4L7LA 2OLRA 4HLMA 4UW1A 4KZLA 4GNQA 4GMUA 4L7UA 1YTMA 4ZZZA 4GNOA 4UHGA 4L0TA 3SMJA 4GNPA 4BJBA 4L0VA 4RV6A 4BUVA 2RK8A
chains in the Genus database with same CATH topology
4F0EA 4PMLA 4R5WA 4GNLA 4WPTA 1UK1A 3W51A 2OLQA 3DT4A 5AL1A 3GN7A 3SMIA 4OPXC 4HHZA 3P0PA 4BUUA 3L3MA 4UVSA 4PJTA 4KZQA 4BU9A 4WPUA 3U9YA 1YLHA 4BUIA 5DCZA 4OQAC 3MOHA 4GMZA 4J1ZA 5ETYA 4BUEA 2PXZX 3SE2A 4U6AA 3MHKA 4L7OA 5FH5A 4OX2A 4BJCA 4BU7A 4UI6A 4L0IA 4PJVA 4HLFA 4J3LA 1II2A 4LI7A 4OA7A 4L34A 4PNQA 3DT7A 4UFUA 4K4FA 4L6ZA 5AL2A 5AL5A 4GMMA 4HL5A 4BUAA 3C4HA 1AQ2A 3MOFA 4GV7A 1KHEA 3GOYA 5I67A 5ECEA 4LI6A 2QF2A 4UVVA 1WOKA 2PC9A 4UVZA 3CE0A 4K4EA 4X52A 4YWDA 4AVUA 2RKAA 4IUEA 3FHBA 4N4TA 3BLJA 4TJYA 4UVYA 5C5PA 3UH2A 4YW9A 4PNTA 3UH4A 1KHFA 4TKGA 4UXBA 4AVWA 1K3DA 4LI8A 3C49A 2RD6A 4GMWA 3MOEA 3KR8A 2QEYA 3P0NA 4M7BA 4HKKA 5AKUA 4YWBA 5AL3A 4UUHA 4TK0A 5EBTA 1J3BA 4TORA 4L7PA 4TVJA 1AYLA 3GEYA 3MHJA 4HKIA 4HLGA 4KZUA 4MSKA 5AL4A 5C5RA 4BJ9A 4PNSA 4BUWA 3GJWA 1GS0A 5AKWA 4BUYA 4PAXA 1YVYA 4PNMA 4J22A 4N4VA 3DTBA 5C5QA 4HLHA 2RCWA 3PAXA 4W5SA 5ADSA 3KR7A 4UI3A 4PNRA 4HHYA 5A00A 5LXPA 3L3LA 4HMHA 4N3RA 4UVLA 4UI8A 4L10A 4L2FA 4F1LA 4L33A 2RKDA 4DVIA 1A26A 4L0BA 4L7NA 5AEHA 4BUDA 2RF5A 4J3MA 2PQFA 2PY7X 4L2KA 4UVXA 5FPFA 3HKVA 4TJWA 4UI4A 4L31A 4L0SA 4TOSA 1PAXA 5ADTA 4OQBC 4PY4A 2ZCIA 5ADRA 5FH4A 2QEWA 5FPGA 4R43A 4UVPA 4BUTA 1K3CA 4L09A 1UK0A 4WIEA 4L6SA 4I9IA 4W5IA 4XHUA 1OENA 3UDDA 3KCZA 4L70A 4PNNA 4TKIA 4BU3A 4UX4A 2FAHA 5FH1A 4TKFA 4GNMA 4GV2A 4KRSA 4UI7A 4J21A 4MSGA 4WIUA 4ZZYA 4HLKA 4YW8A 5LX6A 1KHGA 4MT9A 4R6EA 4UFYA 1EFYA 4ZZXA 5LYHA 1OS1A 4UI5A 3U9HA 4F1QA 4BFPA 4BU6A 1M51A 4GV4A 4TK5A 4BU5A 2PAWA 3KJDA 2QF1A 4HYFA 4WL8A 4BUSA 4HKNA 4UVTA 4DQYC 4UNDA 4L7RA 5ADQA 4BUXA 3DT2A 4L32A 5FH2A 2FAFA 4UVUA 4UVNA 2X5YA 2QZYA 4L2GA 4UVWA 4BS4A 5FH3A 4UVOA 4GV0A 4WOUA 4BUFA 1NHXA 4BU8A 1XKVA 1YGGA 1KHBA 4WPVA 2GMVA 2PAXA 4TJUA 5FH0A 3UA9A 4RCGA 2RK7A 4W6EA 3P0QA 2RKEA 4PNLA 4L7LA 2OLRA 4HLMA 4UW1A 4KZLA 4GNQA 4GMUA 4L7UA 1YTMA 4ZZZA 4GNOA 4UHGA 4L0TA 3SMJA 4GNPA 4BJBA 4L0VA 4RV6A 4BUVA 2RK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0E A;  4PML A;  4R5W A;  1UK1 A;  3W51 A;  5AL1 A;  3SMI A;  3GN7 A;  4OPX C;  4HHZ A;  3P0P A;  4BUU A;  3L3M A;  4UVS A;  4PJT A;  4KZQ A;  4BU9 A;  4BUI A;  3U9Y A;  4OQA C;  5DCZ A;  4BUE A;  4J1Z A;  5ETY A;  3SE2 A;  4U6A A;  3MHK A;  4L7O A;  4BU7 A;  4BJC A;  4UI6 A;  4L0I A;  4PJV A;  4HLF A;  4J3L A;  4LI7 A;  4OA7 A;  4L34 A;  4PNQ A;  4UFU A;  5AL2 A;  4K4F A;  4L6Z A;  5AL5 A;  4HL5 A;  4BUA A;  3C4H A;  4GV7 A;  3GOY A;  5ECE A;  4LI6 A;  4UVV A;  4UVZ A;  1WOK A;  3CE0 A;  4K4E A;  4X52 A;  4AVU A;  4IUE A;  3FHB A;  4N4T A;  3BLJ A;  4TJY A;  4UVY A;  5C5P A;  3UH2 A;  4PNT A;  3UH4 A;  4TKG A;  4UXB A;  4AVW A;  4LI8 A;  3C49 A;  2RD6 A;  3KR8 A;  4M7B A;  3P0N A;  5AKU A;  4HKK A;  5AL3 A;  4UUH A;  4TK0 A;  5EBT A;  4TOR A;  4L7P A;  4TVJ A;  4HLG A;  3GEY A;  3MHJ A;  4HKI A;  4KZU A;  4MSK A;  5AL4 A;  5C5R A;  4BJ9 A;  4PNS A;  4BUW A;  3GJW A;  1GS0 A;  5AKW A;  4BUY A;  4PAX A;  4PNM A;  4J22 A;  4N4V A;  5C5Q A;  4HLH A;  2RCW A;  3PAX A;  4W5S A;  5ADS A;  3KR7 A;  4UI3 A;  4PNR A;  4HHY A;  5A00 A;  5LXP A;  3L3L A;  4HMH A;  4N3R A;  4UVL A;  4UI8 A;  4L10 A;  4L2F A;  4F1L A;  4L33 A;  4DVI A;  1A26 A;  4L0B A;  4L7N A;  5AEH A;  4BUD A;  2RF5 A;  4J3M A;  2PQF A;  4L2K A;  4UVX A;  5FPF A;  3HKV A;  4TJW A;  4UI4 A;  4L31 A;  4L0S A;  4TOS A;  1PAX A;  5ADT A;  4OQB C;  4PY4 A;  5ADR A;  5FPG A;  4UVP A;  4BUT A;  4L09 A;  1UK0 A;  3UDD A;  4L6S A;  4I9I A;  4W5I A;  4XHU A;  3KCZ A;  4L70 A;  4PNN A;  4TKI A;  4BU3 A;  4UX4 A;  4TKF A;  4GV2 A;  4KRS A;  4UI7 A;  4J21 A;  4MSG A;  4ZZY A;  4HLK A;  5LX6 A;  4MT9 A;  4R6E A;  4UFY A;  1EFY A;  4ZZX A;  5LYH A;  4UI5 A;  4F1Q A;  3U9H A;  4BFP A;  4BU6 A;  4GV4 A;  4TK5 A;  4BU5 A;  2PAW A;  3KJD A;  4HYF A;  4BUS A;  4HKN A;  4UVT A;  4DQY C;  4UND A;  4L7R A;  5ADQ A;  4BUX A;  4L32 A;  4UVU A;  4UVN A;  2X5Y A;  4UVW A;  4L2G A;  4BS4 A;  4UVO A;  4GV0 A;  4BUF A;  4BU8 A;  2PAX A;  4TJU A;  3UA9 A;  4W6E A;  3P0Q A;  4PNL A;  4L7L A;  4HLM A;  4UW1 A;  4KZL A;  4L7U A;  4ZZZ A;  4UHG A;  4L0T A;  3SMJ A;  4BJB A;  4L0V A;  4RV6 A;  4BUV A; 
#chains in the Genus database with same CATH topology
 4F0E A;  4PML A;  4R5W A;  4GNL A;  4WPT A;  1UK1 A;  3W51 A;  2OLQ A;  3DT4 A;  5AL1 A;  3GN7 A;  3SMI A;  4OPX C;  4HHZ A;  3P0P A;  4BUU A;  3L3M A;  4UVS A;  4PJT A;  4KZQ A;  4BU9 A;  4WPU A;  3U9Y A;  1YLH A;  4BUI A;  5DCZ A;  4OQA C;  3MOH A;  4GMZ A;  4J1Z A;  5ETY A;  4BUE A;  2PXZ X;  3SE2 A;  4U6A A;  3MHK A;  4L7O A;  5FH5 A;  4OX2 A;  4BJC A;  4BU7 A;  4UI6 A;  4L0I A;  4PJV A;  4HLF A;  4J3L A;  1II2 A;  4LI7 A;  4OA7 A;  4L34 A;  4PNQ A;  3DT7 A;  4UFU A;  4K4F A;  4L6Z A;  5AL2 A;  5AL5 A;  4GMM A;  4HL5 A;  4BUA A;  3C4H A;  1AQ2 A;  3MOF A;  4GV7 A;  1KHE A;  3GOY A;  5I67 A;  5ECE A;  4LI6 A;  2QF2 A;  4UVV A;  1WOK A;  2PC9 A;  4UVZ A;  3CE0 A;  4K4E A;  4X52 A;  4YWD A;  4AVU A;  2RKA A;  4IUE A;  3FHB A;  4N4T A;  3BLJ A;  4TJY A;  4UVY A;  5C5P A;  3UH2 A;  4YW9 A;  4PNT A;  3UH4 A;  1KHF A;  4TKG A;  4UXB A;  4AVW A;  1K3D A;  4LI8 A;  3C49 A;  2RD6 A;  4GMW A;  3MOE A;  3KR8 A;  2QEY A;  3P0N A;  4M7B A;  4HKK A;  5AKU A;  4YWB A;  5AL3 A;  4UUH A;  4TK0 A;  5EBT A;  1J3B A;  4TOR A;  4L7P A;  4TVJ A;  1AYL A;  3GEY A;  3MHJ A;  4HKI A;  4HLG A;  4KZU A;  4MSK A;  5AL4 A;  5C5R A;  4BJ9 A;  4PNS A;  4BUW A;  3GJW A;  1GS0 A;  5AKW A;  4BUY A;  4PAX A;  1YVY A;  4PNM A;  4J22 A;  4N4V A;  3DTB A;  5C5Q A;  4HLH A;  2RCW A;  3PAX A;  4W5S A;  5ADS A;  3KR7 A;  4UI3 A;  4PNR A;  4HHY A;  5A00 A;  5LXP A;  3L3L A;  4HMH A;  4N3R A;  4UVL A;  4UI8 A;  4L10 A;  4L2F A;  4F1L A;  4L33 A;  2RKD A;  4DVI A;  1A26 A;  4L0B A;  4L7N A;  5AEH A;  4BUD A;  2RF5 A;  4J3M A;  2PQF A;  2PY7 X;  4L2K A;  4UVX A;  5FPF A;  3HKV A;  4TJW A;  4UI4 A;  4L31 A;  4L0S A;  4TOS A;  1PAX A;  5ADT A;  4OQB C;  4PY4 A;  2ZCI A;  5ADR A;  5FH4 A;  2QEW A;  5FPG A;  4R43 A;  4UVP A;  4BUT A;  1K3C A;  4L09 A;  1UK0 A;  4WIE A;  4L6S A;  4I9I A;  4W5I A;  4XHU A;  1OEN A;  3UDD A;  3KCZ A;  4L70 A;  4PNN A;  4TKI A;  4BU3 A;  4UX4 A;  2FAH A;  5FH1 A;  4TKF A;  4GNM A;  4GV2 A;  4KRS A;  4UI7 A;  4J21 A;  4MSG A;  4WIU A;  4ZZY A;  4HLK A;  4YW8 A;  5LX6 A;  1KHG A;  4MT9 A;  4R6E A;  4UFY A;  1EFY A;  4ZZX A;  5LYH A;  1OS1 A;  4UI5 A;  3U9H A;  4F1Q A;  4BFP A;  4BU6 A;  1M51 A;  4GV4 A;  4TK5 A;  4BU5 A;  2PAW A;  3KJD A;  2QF1 A;  4HYF A;  4WL8 A;  4BUS A;  4HKN A;  4UVT A;  4DQY C;  4UND A;  4L7R A;  5ADQ A;  4BUX A;  3DT2 A;  4L32 A;  5FH2 A;  2FAF A;  4UVU A;  4UVN A;  2X5Y A;  2QZY A;  4L2G A;  4UVW A;  4BS4 A;  5FH3 A;  4UVO A;  4GV0 A;  4WOU A;  4BUF A;  1NHX A;  4BU8 A;  1XKV A;  1YGG A;  1KHB A;  4WPV A;  2GMV A;  2PAX A;  4TJU A;  5FH0 A;  3UA9 A;  4RCG A;  2RK7 A;  4W6E A;  3P0Q A;  2RKE A;  4PNL A;  4L7L A;  2OLR A;  4HLM A;  4UW1 A;  4KZL A;  4GNQ A;  4GMU A;  4L7U A;  1YTM A;  4ZZZ A;  4GNO A;  4UHG A;  4L0T A;  3SMJ A;  4GNP A;  4BJB A;  4L0V A;  4RV6 A;  4BUV A;  2RK8 A; 
#chains in the Genus database with same CATH homology
 4F0E A;  4PML A;  4R5W A;  4GNL A;  4WPT A;  1UK1 A;  3W51 A;  2OLQ A;  3DT4 A;  5AL1 A;  3GN7 A;  3SMI A;  4OPX C;  4HHZ A;  3P0P A;  4BUU A;  3L3M A;  4UVS A;  4PJT A;  4KZQ A;  4BU9 A;  4WPU A;  3U9Y A;  1YLH A;  4BUI A;  5DCZ A;  4OQA C;  3MOH A;  4GMZ A;  4J1Z A;  5ETY A;  4BUE A;  2PXZ X;  3SE2 A;  4U6A A;  3MHK A;  4L7O A;  5FH5 A;  4OX2 A;  4BJC A;  4BU7 A;  4UI6 A;  4L0I A;  4PJV A;  4HLF A;  4J3L A;  1II2 A;  4LI7 A;  4OA7 A;  4L34 A;  4PNQ A;  3DT7 A;  4UFU A;  4K4F A;  4L6Z A;  5AL2 A;  5AL5 A;  4GMM A;  4HL5 A;  4BUA A;  3C4H A;  1AQ2 A;  3MOF A;  4GV7 A;  1KHE A;  3GOY A;  5I67 A;  5ECE A;  4LI6 A;  2QF2 A;  4UVV A;  1WOK A;  2PC9 A;  4UVZ A;  3CE0 A;  4K4E A;  4X52 A;  4YWD A;  4AVU A;  2RKA A;  4IUE A;  3FHB A;  4N4T A;  3BLJ A;  4TJY A;  4UVY A;  5C5P A;  3UH2 A;  4YW9 A;  4PNT A;  3UH4 A;  1KHF A;  4TKG A;  4UXB A;  4AVW A;  1K3D A;  4LI8 A;  3C49 A;  2RD6 A;  4GMW A;  3MOE A;  3KR8 A;  2QEY A;  3P0N A;  4M7B A;  4HKK A;  5AKU A;  4YWB A;  5AL3 A;  4UUH A;  4TK0 A;  5EBT A;  1J3B A;  4TOR A;  4L7P A;  4TVJ A;  1AYL A;  3GEY A;  3MHJ A;  4HKI A;  4HLG A;  4KZU A;  4MSK A;  5AL4 A;  5C5R A;  4BJ9 A;  4PNS A;  4BUW A;  3GJW A;  1GS0 A;  5AKW A;  4BUY A;  4PAX A;  1YVY A;  4PNM A;  4J22 A;  4N4V A;  3DTB A;  5C5Q A;  4HLH A;  2RCW A;  3PAX A;  4W5S A;  5ADS A;  3KR7 A;  4UI3 A;  4PNR A;  4HHY A;  5A00 A;  5LXP A;  3L3L A;  4HMH A;  4N3R A;  4UVL A;  4UI8 A;  4L10 A;  4L2F A;  4F1L A;  4L33 A;  2RKD A;  4DVI A;  1A26 A;  4L0B A;  4L7N A;  5AEH A;  4BUD A;  2RF5 A;  4J3M A;  2PQF A;  2PY7 X;  4L2K A;  4UVX A;  5FPF A;  3HKV A;  4TJW A;  4UI4 A;  4L31 A;  4L0S A;  4TOS A;  1PAX A;  5ADT A;  4OQB C;  4PY4 A;  2ZCI A;  5ADR A;  5FH4 A;  2QEW A;  5FPG A;  4R43 A;  4UVP A;  4BUT A;  1K3C A;  4L09 A;  1UK0 A;  4WIE A;  4L6S A;  4I9I A;  4W5I A;  4XHU A;  1OEN A;  3UDD A;  3KCZ A;  4L70 A;  4PNN A;  4TKI A;  4BU3 A;  4UX4 A;  2FAH A;  5FH1 A;  4TKF A;  4GNM A;  4GV2 A;  4KRS A;  4UI7 A;  4J21 A;  4MSG A;  4WIU A;  4ZZY A;  4HLK A;  4YW8 A;  5LX6 A;  1KHG A;  4MT9 A;  4R6E A;  4UFY A;  1EFY A;  4ZZX A;  5LYH A;  1OS1 A;  4UI5 A;  3U9H A;  4F1Q A;  4BFP A;  4BU6 A;  1M51 A;  4GV4 A;  4TK5 A;  4BU5 A;  2PAW A;  3KJD A;  2QF1 A;  4HYF A;  4WL8 A;  4BUS A;  4HKN A;  4UVT A;  4DQY C;  4UND A;  4L7R A;  5ADQ A;  4BUX A;  3DT2 A;  4L32 A;  5FH2 A;  2FAF A;  4UVU A;  4UVN A;  2X5Y A;  2QZY A;  4L2G A;  4UVW A;  4BS4 A;  5FH3 A;  4UVO A;  4GV0 A;  4WOU A;  4BUF A;  1NHX A;  4BU8 A;  1XKV A;  1YGG A;  1KHB A;  4WPV A;  2GMV A;  2PAX A;  4TJU A;  5FH0 A;  3UA9 A;  4RCG A;  2RK7 A;  4W6E A;  3P0Q A;  2RKE A;  4PNL A;  4L7L A;  2OLR A;  4HLM A;  4UW1 A;  4KZL A;  4GNQ A;  4GMU A;  4L7U A;  1YTM A;  4ZZZ A;  4GNO A;  4UHG A;  4L0T A;  3SMJ A;  4GNP A;  4BJB A;  4L0V A;  4RV6 A;  4BUV A;  2RK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...