4BU8A

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-1,4- dihydroquinazolin-2-yl)benzonitrile
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu8A00
4HHZA 4W6EA 4L10A 4UUHA 4UX4A 4PNRA 3C4HA 2RCWA 4L7UA 4BJBA 4UI7A 5ADSA 4DQYC 4L2KA 4UVPA 4BU9A 4UVVA 4UVOA 5AKWA 3FHBA 4HMHA 4KRSA 4UI5A 4UXBA 4BUUA 1PAXA 3KR7A 4PNTA 5AL4A 3GEYA 4UVSA 4W5IA 4ZZZA 4L0IA 5LYHA 4L33A 4PNMA 4F1QA 4IUEA 4L7OA 4PNSA 4UVZA 4R5WA 4UFUA 4XHUA 4L0SA 5AL5A 5AEHA 4L2GA 3L3MA 4TKIA 5FPGA 3UDDA 4GV0A 4KZLA 5ADTA 4DVIA 5EBTA 3GJWA 5C5PA 4GV2A 4MT9A 4LI8A 4N4VA 4LI6A 4UVLA 4HL5A 4PMLA 4UVXA 1UK0A 4PNNA 4BU3A 4GV4A 4PAXA 5ETYA 3SMJA 4L34A 4TJWA 3PAXA 4TOSA 3CE0A 4UVWA 3GOYA 4OQBC 4ZZXA 4TK0A 4J21A 4AVUA 4BU6A 4HYFA 4TORA 4BUXA 4J1ZA 5LXPA 4BUFA 5ADQA 3P0PA 4TJYA 4PY4A 4HLMA 4PNLA 4TK5A 5AL3A 4L31A 4J22A 4BUIA 4HLKA 4L0TA 4J3LA 4KZQA 3GN7A 4PNQA 4X52A 4UI8A 4L09A 4HLHA 4F0EA 4R6EA 4BUDA 4I9IA 3UH4A 5FPFA 4BUWA 4UI6A 4N4TA 5AL2A 4GV7A 4BJCA 4BUYA 2RD6A 5A00A 4ZZYA 4L7NA 4W5SA 3C49A 5LX6A 4L7RA 4PJTA 3SMIA 4HLFA 3UH2A 4UFYA 4F1LA 4L6SA 4UVYA 3MHJA 4M7BA 4UVTA 5C5RA 4KZUA 4N3RA 4K4FA 4TVJA 3MHKA 4BU8A 1WOKA 1GS0A 4UI3A 3U9YA 4OA7A 4HKNA 4L32A 4BFPA 4UVUA 4K4EA 4UI4A 5C5QA 4BUTA 4BUEA 3KJDA 4HHYA 5AL1A 4UHGA 3BLJA 4MSGA 3P0QA 4MSKA 3P0NA 4BUVA 5ECEA 5AKUA 4J3MA 1EFYA 4U6AA 4HKIA 3U9HA 4L70A 4BUAA 4LI7A 4BU5A 2RF5A 3KCZA 5ADRA 4TKGA 4BU7A 4RV6A 2PAXA 1A26A 3L3LA 3W51A 4PJVA 4L0VA 4L6ZA 4BS4A 4L2FA 4UNDA 4UW1A 3UA9A 4BUSA 4HKKA 4UVNA 4OPXC 2PAWA 4L7LA 2PQFA 4BJ9A 5DCZA 4TJUA 4L7PA 4HLGA 3KR8A 4L0BA 4TKFA 4OQAC 4AVWA 1UK1A 2X5YA 3SE2A 3HKVA
chains in the Genus database with same CATH superfamily
2PC9A 4HHZA 4W6EA 4L10A 1KHBA 4UUHA 2RK7A 1K3CA 4UX4A 4PNRA 3C4HA 2RCWA 4L7UA 4BJBA 4UI7A 5ADSA 4DQYC 3MOHA 4L2KA 4UVPA 4BU9A 4UVVA 4UVOA 5AKWA 3FHBA 2OLQA 4HMHA 4KRSA 4UI5A 1J3BA 4UXBA 4WPUA 4BUUA 1PAXA 3KR7A 4PNTA 5AL4A 1XKVA 3GEYA 4UVSA 4W5IA 4WPVA 4L0IA 4ZZZA 5FH3A 5LYHA 4L33A 4PNMA 4F1QA 4GMZA 4IUEA 4L7OA 4PNSA 4UVZA 4R5WA 4GNOA 4UFUA 4XHUA 4L0SA 5AL5A 1M51A 5AEHA 4YWDA 4L2GA 2FAFA 3L3MA 4TKIA 5FPGA 2PXZX 4GV0A 4KZLA 4YW8A 3UDDA 5ADTA 4DVIA 5EBTA 3GJWA 5FH1A 5C5PA 4GV2A 1YTMA 1KHEA 4LI8A 4MT9A 4N4VA 4LI6A 4UVLA 4HL5A 5FH2A 4PMLA 4UVXA 1UK0A 4PNNA 1OENA 4BU3A 2RK8A 4GV4A 4PAXA 5ETYA 3MOFA 3SMJA 1KHFA 4L34A 4TJWA 5I67A 3PAXA 4TOSA 5FH4A 3CE0A 4UVWA 3GOYA 4OQBC 4ZZXA 4TK0A 4J21A 4AVUA 4BU6A 4HYFA 4TORA 4BUXA 2QZYA 4J1ZA 5LXPA 4YW9A 4WPTA 4OX2A 3DT4A 4BUFA 5ADQA 3P0PA 1YGGA 4PY4A 4TJYA 4HLMA 4PNLA 4TK5A 5AL3A 4L31A 4J22A 4BUIA 4HLKA 2QEYA 2OLRA 4L0TA 4J3LA 4KZQA 3GN7A 2QF2A 4PNQA 4UI8A 4WOUA 4L09A 4WL8A 4X52A 4HLHA 4F0EA 4R6EA 4BUDA 4GNPA 4I9IA 3UH4A 3DT2A 5FPFA 4BUWA 4UI6A 4N4TA 5AL2A 4GV7A 4BJCA 4BUYA 5FH5A 1NHXA 2RD6A 5A00A 4ZZYA 1II2A 4L7NA 4W5SA 3MOEA 4WIEA 3C49A 4GMWA 5LX6A 4L7RA 4GNQA 4PJTA 3SMIA 4HLFA 2RKAA 4UFYA 3UH2A 4F1LA 4RCGA 4L6SA 4UVYA 3MHJA 4M7BA 4UVTA 5C5RA 4KZUA 1AQ2A 4N3RA 4K4FA 4TVJA 3MHKA 4BU8A 1WOKA 1GS0A 4UI3A 3U9YA 4OA7A 4HKNA 4L32A 1OS1A 4UVUA 4K4EA 4UI4A 5C5QA 2RKDA 4BFPA 4BUTA 4BUEA 4GMUA 3KJDA 4HHYA 4GMMA 5AL1A 4UHGA 3BLJA 4MSGA 2ZCIA 3DTBA 1AYLA 3P0QA 4MSKA 3P0NA 4BUVA 4WIUA 5ECEA 5AKUA 4J3MA 1EFYA 4U6AA 4HKIA 3U9HA 4L70A 4BUAA 2QEWA 4GNMA 2RF5A 4GNLA 4LI7A 4BU5A 2RKEA 3KCZA 5ADRA 2GMVA 2PY7X 2FAHA 4TKGA 4YWBA 4BU7A 4RV6A 2PAXA 1A26A 3L3LA 5FH0A 3W51A 4PJVA 4L0VA 1YLHA 4L6ZA 4BS4A 4L2FA 4UNDA 4UW1A 3UA9A 4BUSA 4HKKA 4UVNA 4OPXC 1YVYA 2PAWA 4L7LA 2PQFA 4BJ9A 5DCZA 3DT7A 1KHGA 4TJUA 4L7PA 4R43A 4HLGA 2QF1A 3KR8A 4L0BA 1K3DA 4TKFA 4OQAC 4AVWA 1UK1A 2X5YA 3SE2A 3HKVA
chains in the Genus database with same CATH topology
2PC9A 4HHZA 4W6EA 4L10A 1KHBA 4UUHA 2RK7A 1K3CA 4UX4A 4PNRA 3C4HA 2RCWA 4L7UA 4BJBA 4UI7A 5ADSA 4DQYC 3MOHA 4L2KA 4UVPA 4BU9A 4UVVA 4UVOA 5AKWA 3FHBA 2OLQA 4HMHA 4KRSA 4UI5A 1J3BA 4UXBA 4WPUA 4BUUA 1PAXA 3KR7A 4PNTA 5AL4A 1XKVA 3GEYA 4UVSA 4W5IA 4WPVA 4L0IA 4ZZZA 5FH3A 5LYHA 4L33A 4PNMA 4F1QA 4GMZA 4IUEA 4L7OA 4PNSA 4UVZA 4R5WA 4GNOA 4UFUA 4XHUA 4L0SA 5AL5A 1M51A 5AEHA 4YWDA 4L2GA 2FAFA 3L3MA 4TKIA 5FPGA 2PXZX 4GV0A 4KZLA 4YW8A 3UDDA 5ADTA 4DVIA 5EBTA 3GJWA 5FH1A 5C5PA 4GV2A 1YTMA 1KHEA 4LI8A 4MT9A 4N4VA 4LI6A 4UVLA 4HL5A 5FH2A 4PMLA 4UVXA 1UK0A 4PNNA 1OENA 4BU3A 2RK8A 4GV4A 4PAXA 5ETYA 3MOFA 3SMJA 1KHFA 4L34A 4TJWA 5I67A 3PAXA 4TOSA 5FH4A 3CE0A 4UVWA 3GOYA 4OQBC 4ZZXA 4TK0A 4J21A 4AVUA 4BU6A 4HYFA 4TORA 4BUXA 2QZYA 4J1ZA 5LXPA 4YW9A 4WPTA 4OX2A 3DT4A 4BUFA 5ADQA 3P0PA 1YGGA 4PY4A 4TJYA 4HLMA 4PNLA 4TK5A 5AL3A 4L31A 4J22A 4BUIA 4HLKA 2QEYA 2OLRA 4L0TA 4J3LA 4KZQA 3GN7A 2QF2A 4PNQA 4UI8A 4WOUA 4L09A 4WL8A 4X52A 4HLHA 4F0EA 4R6EA 4BUDA 4GNPA 4I9IA 3UH4A 3DT2A 5FPFA 4BUWA 4UI6A 4N4TA 5AL2A 4GV7A 4BJCA 4BUYA 5FH5A 1NHXA 2RD6A 5A00A 4ZZYA 1II2A 4L7NA 4W5SA 3MOEA 4WIEA 3C49A 4GMWA 5LX6A 4L7RA 4GNQA 4PJTA 3SMIA 4HLFA 2RKAA 4UFYA 3UH2A 4F1LA 4RCGA 4L6SA 4UVYA 3MHJA 4M7BA 4UVTA 5C5RA 4KZUA 1AQ2A 4N3RA 4K4FA 4TVJA 3MHKA 4BU8A 1WOKA 1GS0A 4UI3A 3U9YA 4OA7A 4HKNA 4L32A 1OS1A 4UVUA 4K4EA 4UI4A 5C5QA 2RKDA 4BFPA 4BUTA 4BUEA 4GMUA 3KJDA 4HHYA 4GMMA 5AL1A 4UHGA 3BLJA 4MSGA 2ZCIA 3DTBA 1AYLA 3P0QA 4MSKA 3P0NA 4BUVA 4WIUA 5ECEA 5AKUA 4J3MA 1EFYA 4U6AA 4HKIA 3U9HA 4L70A 4BUAA 2QEWA 4GNMA 2RF5A 4GNLA 4LI7A 4BU5A 2RKEA 3KCZA 5ADRA 2GMVA 2PY7X 2FAHA 4TKGA 4YWBA 4BU7A 4RV6A 2PAXA 1A26A 3L3LA 5FH0A 3W51A 4PJVA 4L0VA 1YLHA 4L6ZA 4BS4A 4L2FA 4UNDA 4UW1A 3UA9A 4BUSA 4HKKA 4UVNA 4OPXC 1YVYA 2PAWA 4L7LA 2PQFA 4BJ9A 5DCZA 3DT7A 1KHGA 4TJUA 4L7PA 4R43A 4HLGA 2QF1A 3KR8A 4L0BA 1K3DA 4TKFA 4OQAC 4AVWA 1UK1A 2X5YA 3SE2A 3HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHZ A;  4W6E A;  4L10 A;  4UUH A;  4UX4 A;  4PNR A;  3C4H A;  2RCW A;  4L7U A;  4BJB A;  4UI7 A;  5ADS A;  4DQY C;  4L2K A;  4UVP A;  4BU9 A;  4UVV A;  4UVO A;  5AKW A;  3FHB A;  4HMH A;  4KRS A;  4UI5 A;  4UXB A;  4BUU A;  1PAX A;  3KR7 A;  4PNT A;  5AL4 A;  3GEY A;  4UVS A;  4W5I A;  4ZZZ A;  4L0I A;  5LYH A;  4L33 A;  4PNM A;  4F1Q A;  4IUE A;  4L7O A;  4PNS A;  4UVZ A;  4R5W A;  4UFU A;  4XHU A;  4L0S A;  5AL5 A;  5AEH A;  4L2G A;  3L3M A;  4TKI A;  5FPG A;  3UDD A;  4GV0 A;  4KZL A;  5ADT A;  4DVI A;  5EBT A;  3GJW A;  5C5P A;  4GV2 A;  4MT9 A;  4LI8 A;  4N4V A;  4LI6 A;  4UVL A;  4HL5 A;  4PML A;  4UVX A;  1UK0 A;  4PNN A;  4BU3 A;  4GV4 A;  4PAX A;  5ETY A;  3SMJ A;  4L34 A;  4TJW A;  3PAX A;  4TOS A;  3CE0 A;  4UVW A;  3GOY A;  4OQB C;  4ZZX A;  4TK0 A;  4J21 A;  4AVU A;  4BU6 A;  4HYF A;  4TOR A;  4BUX A;  4J1Z A;  5LXP A;  4BUF A;  5ADQ A;  3P0P A;  4TJY A;  4PY4 A;  4HLM A;  4PNL A;  4TK5 A;  5AL3 A;  4L31 A;  4J22 A;  4BUI A;  4HLK A;  4L0T A;  4J3L A;  4KZQ A;  3GN7 A;  4PNQ A;  4X52 A;  4UI8 A;  4L09 A;  4HLH A;  4F0E A;  4R6E A;  4BUD A;  4I9I A;  3UH4 A;  5FPF A;  4BUW A;  4UI6 A;  4N4T A;  5AL2 A;  4GV7 A;  4BJC A;  4BUY A;  2RD6 A;  5A00 A;  4ZZY A;  4L7N A;  4W5S A;  3C49 A;  5LX6 A;  4L7R A;  4PJT A;  3SMI A;  4HLF A;  3UH2 A;  4UFY A;  4F1L A;  4L6S A;  4UVY A;  3MHJ A;  4M7B A;  4UVT A;  5C5R A;  4KZU A;  4N3R A;  4K4F A;  4TVJ A;  3MHK A;  4BU8 A;  1WOK A;  1GS0 A;  4UI3 A;  3U9Y A;  4OA7 A;  4HKN A;  4L32 A;  4BFP A;  4UVU A;  4K4E A;  4UI4 A;  5C5Q A;  4BUT A;  4BUE A;  3KJD A;  4HHY A;  5AL1 A;  4UHG A;  3BLJ A;  4MSG A;  3P0Q A;  4MSK A;  3P0N A;  4BUV A;  5ECE A;  5AKU A;  4J3M A;  1EFY A;  4U6A A;  4HKI A;  3U9H A;  4L70 A;  4BUA A;  4LI7 A;  4BU5 A;  2RF5 A;  3KCZ A;  5ADR A;  4TKG A;  4BU7 A;  4RV6 A;  2PAX A;  1A26 A;  3L3L A;  3W51 A;  4PJV A;  4L0V A;  4L6Z A;  4BS4 A;  4L2F A;  4UND A;  4UW1 A;  3UA9 A;  4BUS A;  4HKK A;  4UVN A;  4OPX C;  2PAW A;  4L7L A;  2PQF A;  4BJ9 A;  5DCZ A;  4TJU A;  4L7P A;  4HLG A;  3KR8 A;  4L0B A;  4TKF A;  4OQA C;  4AVW A;  1UK1 A;  2X5Y A;  3SE2 A;  3HKV A; 
#chains in the Genus database with same CATH topology
 2PC9 A;  4HHZ A;  4W6E A;  4L10 A;  1KHB A;  4UUH A;  2RK7 A;  1K3C A;  4UX4 A;  4PNR A;  3C4H A;  2RCW A;  4L7U A;  4BJB A;  4UI7 A;  5ADS A;  4DQY C;  3MOH A;  4L2K A;  4UVP A;  4BU9 A;  4UVV A;  4UVO A;  5AKW A;  3FHB A;  2OLQ A;  4HMH A;  4KRS A;  4UI5 A;  1J3B A;  4UXB A;  4WPU A;  4BUU A;  1PAX A;  3KR7 A;  4PNT A;  5AL4 A;  1XKV A;  3GEY A;  4UVS A;  4W5I A;  4WPV A;  4L0I A;  4ZZZ A;  5FH3 A;  5LYH A;  4L33 A;  4PNM A;  4F1Q A;  4GMZ A;  4IUE A;  4L7O A;  4PNS A;  4UVZ A;  4R5W A;  4GNO A;  4UFU A;  4XHU A;  4L0S A;  5AL5 A;  1M51 A;  5AEH A;  4YWD A;  4L2G A;  2FAF A;  3L3M A;  4TKI A;  5FPG A;  2PXZ X;  4GV0 A;  4KZL A;  4YW8 A;  3UDD A;  5ADT A;  4DVI A;  5EBT A;  3GJW A;  5FH1 A;  5C5P A;  4GV2 A;  1YTM A;  1KHE A;  4LI8 A;  4MT9 A;  4N4V A;  4LI6 A;  4UVL A;  4HL5 A;  5FH2 A;  4PML A;  4UVX A;  1UK0 A;  4PNN A;  1OEN A;  4BU3 A;  2RK8 A;  4GV4 A;  4PAX A;  5ETY A;  3MOF A;  3SMJ A;  1KHF A;  4L34 A;  4TJW A;  5I67 A;  3PAX A;  4TOS A;  5FH4 A;  3CE0 A;  4UVW A;  3GOY A;  4OQB C;  4ZZX A;  4TK0 A;  4J21 A;  4AVU A;  4BU6 A;  4HYF A;  4TOR A;  4BUX A;  2QZY A;  4J1Z A;  5LXP A;  4YW9 A;  4WPT A;  4OX2 A;  3DT4 A;  4BUF A;  5ADQ A;  3P0P A;  1YGG A;  4PY4 A;  4TJY A;  4HLM A;  4PNL A;  4TK5 A;  5AL3 A;  4L31 A;  4J22 A;  4BUI A;  4HLK A;  2QEY A;  2OLR A;  4L0T A;  4J3L A;  4KZQ A;  3GN7 A;  2QF2 A;  4PNQ A;  4UI8 A;  4WOU A;  4L09 A;  4WL8 A;  4X52 A;  4HLH A;  4F0E A;  4R6E A;  4BUD A;  4GNP A;  4I9I A;  3UH4 A;  3DT2 A;  5FPF A;  4BUW A;  4UI6 A;  4N4T A;  5AL2 A;  4GV7 A;  4BJC A;  4BUY A;  5FH5 A;  1NHX A;  2RD6 A;  5A00 A;  4ZZY A;  1II2 A;  4L7N A;  4W5S A;  3MOE A;  4WIE A;  3C49 A;  4GMW A;  5LX6 A;  4L7R A;  4GNQ A;  4PJT A;  3SMI A;  4HLF A;  2RKA A;  4UFY A;  3UH2 A;  4F1L A;  4RCG A;  4L6S A;  4UVY A;  3MHJ A;  4M7B A;  4UVT A;  5C5R A;  4KZU A;  1AQ2 A;  4N3R A;  4K4F A;  4TVJ A;  3MHK A;  4BU8 A;  1WOK A;  1GS0 A;  4UI3 A;  3U9Y A;  4OA7 A;  4HKN A;  4L32 A;  1OS1 A;  4UVU A;  4K4E A;  4UI4 A;  5C5Q A;  2RKD A;  4BFP A;  4BUT A;  4BUE A;  4GMU A;  3KJD A;  4HHY A;  4GMM A;  5AL1 A;  4UHG A;  3BLJ A;  4MSG A;  2ZCI A;  3DTB A;  1AYL A;  3P0Q A;  4MSK A;  3P0N A;  4BUV A;  4WIU A;  5ECE A;  5AKU A;  4J3M A;  1EFY A;  4U6A A;  4HKI A;  3U9H A;  4L70 A;  4BUA A;  2QEW A;  4GNM A;  2RF5 A;  4GNL A;  4LI7 A;  4BU5 A;  2RKE A;  3KCZ A;  5ADR A;  2GMV A;  2PY7 X;  2FAH A;  4TKG A;  4YWB A;  4BU7 A;  4RV6 A;  2PAX A;  1A26 A;  3L3L A;  5FH0 A;  3W51 A;  4PJV A;  4L0V A;  1YLH A;  4L6Z A;  4BS4 A;  4L2F A;  4UND A;  4UW1 A;  3UA9 A;  4BUS A;  4HKK A;  4UVN A;  4OPX C;  1YVY A;  2PAW A;  4L7L A;  2PQF A;  4BJ9 A;  5DCZ A;  3DT7 A;  1KHG A;  4TJU A;  4L7P A;  4R43 A;  4HLG A;  2QF1 A;  3KR8 A;  4L0B A;  1K3D A;  4TKF A;  4OQA C;  4AVW A;  1UK1 A;  2X5Y A;  3SE2 A;  3HKV A; 
#chains in the Genus database with same CATH homology
 2PC9 A;  4HHZ A;  4W6E A;  4L10 A;  1KHB A;  4UUH A;  2RK7 A;  1K3C A;  4UX4 A;  4PNR A;  3C4H A;  2RCW A;  4L7U A;  4BJB A;  4UI7 A;  5ADS A;  4DQY C;  3MOH A;  4L2K A;  4UVP A;  4BU9 A;  4UVV A;  4UVO A;  5AKW A;  3FHB A;  2OLQ A;  4HMH A;  4KRS A;  4UI5 A;  1J3B A;  4UXB A;  4WPU A;  4BUU A;  1PAX A;  3KR7 A;  4PNT A;  5AL4 A;  1XKV A;  3GEY A;  4UVS A;  4W5I A;  4WPV A;  4L0I A;  4ZZZ A;  5FH3 A;  5LYH A;  4L33 A;  4PNM A;  4F1Q A;  4GMZ A;  4IUE A;  4L7O A;  4PNS A;  4UVZ A;  4R5W A;  4GNO A;  4UFU A;  4XHU A;  4L0S A;  5AL5 A;  1M51 A;  5AEH A;  4YWD A;  4L2G A;  2FAF A;  3L3M A;  4TKI A;  5FPG A;  2PXZ X;  4GV0 A;  4KZL A;  4YW8 A;  3UDD A;  5ADT A;  4DVI A;  5EBT A;  3GJW A;  5FH1 A;  5C5P A;  4GV2 A;  1YTM A;  1KHE A;  4LI8 A;  4MT9 A;  4N4V A;  4LI6 A;  4UVL A;  4HL5 A;  5FH2 A;  4PML A;  4UVX A;  1UK0 A;  4PNN A;  1OEN A;  4BU3 A;  2RK8 A;  4GV4 A;  4PAX A;  5ETY A;  3MOF A;  3SMJ A;  1KHF A;  4L34 A;  4TJW A;  5I67 A;  3PAX A;  4TOS A;  5FH4 A;  3CE0 A;  4UVW A;  3GOY A;  4OQB C;  4ZZX A;  4TK0 A;  4J21 A;  4AVU A;  4BU6 A;  4HYF A;  4TOR A;  4BUX A;  2QZY A;  4J1Z A;  5LXP A;  4YW9 A;  4WPT A;  4OX2 A;  3DT4 A;  4BUF A;  5ADQ A;  3P0P A;  1YGG A;  4PY4 A;  4TJY A;  4HLM A;  4PNL A;  4TK5 A;  5AL3 A;  4L31 A;  4J22 A;  4BUI A;  4HLK A;  2QEY A;  2OLR A;  4L0T A;  4J3L A;  4KZQ A;  3GN7 A;  2QF2 A;  4PNQ A;  4UI8 A;  4WOU A;  4L09 A;  4WL8 A;  4X52 A;  4HLH A;  4F0E A;  4R6E A;  4BUD A;  4GNP A;  4I9I A;  3UH4 A;  3DT2 A;  5FPF A;  4BUW A;  4UI6 A;  4N4T A;  5AL2 A;  4GV7 A;  4BJC A;  4BUY A;  5FH5 A;  1NHX A;  2RD6 A;  5A00 A;  4ZZY A;  1II2 A;  4L7N A;  4W5S A;  3MOE A;  4WIE A;  3C49 A;  4GMW A;  5LX6 A;  4L7R A;  4GNQ A;  4PJT A;  3SMI A;  4HLF A;  2RKA A;  4UFY A;  3UH2 A;  4F1L A;  4RCG A;  4L6S A;  4UVY A;  3MHJ A;  4M7B A;  4UVT A;  5C5R A;  4KZU A;  1AQ2 A;  4N3R A;  4K4F A;  4TVJ A;  3MHK A;  4BU8 A;  1WOK A;  1GS0 A;  4UI3 A;  3U9Y A;  4OA7 A;  4HKN A;  4L32 A;  1OS1 A;  4UVU A;  4K4E A;  4UI4 A;  5C5Q A;  2RKD A;  4BFP A;  4BUT A;  4BUE A;  4GMU A;  3KJD A;  4HHY A;  4GMM A;  5AL1 A;  4UHG A;  3BLJ A;  4MSG A;  2ZCI A;  3DTB A;  1AYL A;  3P0Q A;  4MSK A;  3P0N A;  4BUV A;  4WIU A;  5ECE A;  5AKU A;  4J3M A;  1EFY A;  4U6A A;  4HKI A;  3U9H A;  4L70 A;  4BUA A;  2QEW A;  4GNM A;  2RF5 A;  4GNL A;  4LI7 A;  4BU5 A;  2RKE A;  3KCZ A;  5ADR A;  2GMV A;  2PY7 X;  2FAH A;  4TKG A;  4YWB A;  4BU7 A;  4RV6 A;  2PAX A;  1A26 A;  3L3L A;  5FH0 A;  3W51 A;  4PJV A;  4L0V A;  1YLH A;  4L6Z A;  4BS4 A;  4L2F A;  4UND A;  4UW1 A;  3UA9 A;  4BUS A;  4HKK A;  4UVN A;  4OPX C;  1YVY A;  2PAW A;  4L7L A;  2PQF A;  4BJ9 A;  5DCZ A;  3DT7 A;  1KHG A;  4TJU A;  4L7P A;  4R43 A;  4HLG A;  2QF1 A;  3KR8 A;  4L0B A;  1K3D A;  4TKF A;  4OQA C;  4AVW A;  1UK1 A;  2X5Y A;  3SE2 A;  3HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...