4BUIA

Crystal structure of human tankyrase 2 in complex with methyl 4-(4- oxo-3,4-dihydroquinazolin-2-yl)benzoate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
molecule keywords TANKYRASE-2
molecule tags Transferase
source organism Homo sapiens
total genus 66
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buiA00
4UVVA 4F0EA 5ADSA 4BUXA 4L0TA 3CE0A 3HKVA 3SMIA 4W5IA 4PJVA 4UVOA 4BS4A 4AVWA 1UK1A 2X5YA 4K4EA 4UNDA 4R5WA 4AVUA 4UI3A 3UH2A 4L70A 4BUYA 2RCWA 3GEYA 4UHGA 1EFYA 4BUEA 4HLGA 4L33A 4N4TA 5LYHA 4R6EA 4L10A 4LI8A 4BU8A 4PNMA 4L09A 3SE2A 5LX6A 4L34A 4TKIA 4PAXA 4PNNA 2PQFA 3C49A 4GV4A 4UI5A 4UI4A 5AEHA 3U9YA 4F1QA 4TK0A 5ADQA 4J3MA 4HLMA 3P0QA 4L6ZA 4TOSA 4PNSA 3MHKA 4W6EA 4L7PA 4BU7A 4TJYA 4PY4A 2RD6A 3L3LA 4M7BA 4OPXC 4GV2A 3PAXA 4HKIA 4U6AA 5C5QA 4UVWA 4TVJA 4UXBA 4BUTA 4BUWA 5FPFA 4TORA 3GN7A 4UVNA 5EBTA 4UVLA 3L3MA 4UVXA 5LXPA 4J21A 4UI8A 4X52A 1WOKA 4IUEA 4DQYC 5AL5A 4LI7A 4L7OA 3FHBA 4J1ZA 4L0SA 4KRSA 4L2KA 5ECEA 5AKUA 3KCZA 4HLFA 4PNLA 5ADTA 4OA7A 2PAXA 4BU6A 4ZZYA 4L32A 4L0IA 4L7LA 4UFUA 3BLJA 3KJDA 4MSKA 3UDDA 4GV0A 4DVIA 4L7NA 4HMHA 2PAWA 4RV6A 4HLHA 4L7RA 4UVUA 5DCZA 4PMLA 4MT9A 4BJBA 4HLKA 4TJWA 1PAXA 5AL4A 1GS0A 3P0PA 4K4FA 4UVYA 4UVPA 3GOYA 4L0VA 4L6SA 3GJWA 5ETYA 4HYFA 4MSGA 3C4HA 3W51A 4UUHA 4OQAC 5C5RA 4BJ9A 4BFPA 4J22A 5AKWA 4BU3A 4ZZZA 3KR8A 4HKNA 4L2FA 4ZZXA 4L2GA 4XHUA 4UFYA 1UK0A 4BUDA 4UVZA 5A00A 4TKGA 3SMJA 5AL2A 4J3LA 4PNTA 4W5SA 4HKKA 4PJTA 4BUFA 4F1LA 4L0BA 4L7UA 4UW1A 4GV7A 4PNRA 3UH4A 5FPGA 4TK5A 4KZLA 4BJCA 3KR7A 4N3RA 4KZQA 3UA9A 4BUSA 4BU9A 5AL1A 4HHYA 4BUAA 4LI6A 3U9HA 4UI6A 4BUUA 4TJUA 4UVSA 5ADRA 4UI7A 4N4VA 2RF5A 4UX4A 4OQBC 3P0NA 5AL3A 4PNQA 4I9IA 4TKFA 4BUIA 4KZUA 4HHZA 4BUVA 5C5PA 4UVTA 4HL5A 4BU5A 4L31A 3MHJA 1A26A
chains in the Genus database with same CATH superfamily
4UVVA 4F0EA 5ADSA 4BUXA 4L0TA 3CE0A 3HKVA 3SMIA 4W5IA 4PJVA 4UVOA 4BS4A 4AVWA 1UK1A 2X5YA 4K4EA 4UNDA 4R5WA 4AVUA 4UI3A 1KHFA 3UH2A 4L70A 2RKDA 2FAFA 4YWBA 4BUYA 2RCWA 4GMZA 3GEYA 4UHGA 1EFYA 4BUEA 1K3CA 4HLGA 4L33A 4N4TA 4WPUA 4WOUA 4R6EA 5LYHA 4L10A 1KHBA 2FAHA 4LI8A 4BU8A 4PNMA 4L09A 3SE2A 5LX6A 4GMUA 4L34A 4TKIA 4PAXA 4PNNA 2PQFA 3C49A 4GV4A 4UI5A 4UI4A 5FH2A 5AEHA 3U9YA 4GMMA 4F1QA 4TK0A 5ADQA 4J3MA 4HLMA 1OENA 3P0QA 3MOHA 4L6ZA 4YWDA 4TOSA 5FH4A 4PNSA 3MHKA 4W6EA 5FH0A 5I67A 2OLQA 2QF2A 3MOFA 4L7PA 4TJYA 4BU7A 4PY4A 2RD6A 3L3LA 4M7BA 4OPXC 4GV2A 1II2A 2OLRA 3PAXA 4HKIA 2RKEA 4TVJA 4U6AA 4UVWA 4UXBA 5C5QA 4TORA 4BUWA 4BUTA 5FPFA 3GN7A 4GNQA 4UVNA 5EBTA 4UVLA 3L3MA 4UVXA 2RK8A 3DT4A 4J21A 4UI8A 4X52A 5LXPA 1WOKA 4IUEA 4DQYC 4WPTA 5AL5A 4LI7A 2PY7X 4GNOA 3FHBA 4J1ZA 4L0SA 4L7OA 4KRSA 4L2KA 5ECEA 5FH1A 5AKUA 3KCZA 4HLFA 4PNLA 4WIEA 5ADTA 4OA7A 2PAXA 4BU6A 4ZZYA 4L32A 4L0IA 4GNLA 4L7LA 4UFUA 3BLJA 1YLHA 3KJDA 4MSKA 1YVYA 4GV0A 3UDDA 4DVIA 4L7NA 4HMHA 2PAWA 1AYLA 4RV6A 4HLHA 4L7RA 4UVUA 5DCZA 4PMLA 3DTBA 4MT9A 2QEYA 4BJBA 1NHXA 4HLKA 1OS1A 4TJWA 1PAXA 1KHEA 2RK7A 5AL4A 1GS0A 3P0PA 4K4FA 4GNMA 4UVYA 5FH5A 4UVPA 4WPVA 3GOYA 4L0VA 4L6SA 3GJWA 4R43A 5ETYA 1KHGA 4HYFA 4MSGA 3C4HA 3W51A 2RKAA 4UUHA 4OQAC 5C5RA 2PC9A 4BJ9A 4BFPA 4J22A 5AKWA 2QZYA 4BU3A 4ZZZA 1M51A 3KR8A 1XKVA 4HKNA 4L2FA 3MOEA 4ZZXA 1K3DA 4L2GA 4OX2A 4UFYA 4XHUA 1UK0A 4WL8A 4BUDA 4UVZA 5A00A 4TKGA 3SMJA 2QEWA 5AL2A 4GMWA 4J3LA 4PNTA 4W5SA 4HKKA 4PJTA 4YW9A 4BUFA 4L0BA 4L7UA 4UW1A 4F1LA 4GV7A 4PNRA 3UH4A 5FPGA 2ZCIA 4TK5A 1YGGA 4KZLA 4BJCA 3KR7A 4N3RA 2GMVA 3DT7A 4KZQA 1J3BA 3UA9A 4BUSA 4BU9A 5AL1A 4RCGA 4YW8A 4HHYA 4BUAA 4LI6A 3U9HA 1YTMA 4UI6A 4BUUA 4TJUA 4UVSA 5ADRA 4UI7A 4N4VA 2RF5A 4UX4A 4WIUA 1AQ2A 4OQBC 3P0NA 5AL3A 4PNQA 4I9IA 3DT2A 4TKFA 4BUIA 4KZUA 2PXZX 4HHZA 4GNPA 2QF1A 4BUVA 4UVTA 5C5PA 4HL5A 4BU5A 4L31A 3MHJA 5FH3A 1A26A
chains in the Genus database with same CATH topology
4UVVA 4F0EA 5ADSA 4BUXA 4L0TA 3CE0A 3HKVA 3SMIA 4W5IA 4PJVA 4UVOA 4BS4A 4AVWA 1UK1A 2X5YA 4K4EA 4UNDA 4R5WA 4AVUA 4UI3A 1KHFA 3UH2A 4L70A 2RKDA 2FAFA 4YWBA 4BUYA 2RCWA 4GMZA 3GEYA 4UHGA 1EFYA 4BUEA 1K3CA 4HLGA 4L33A 4N4TA 4WPUA 4WOUA 4R6EA 5LYHA 4L10A 1KHBA 2FAHA 4LI8A 4BU8A 4PNMA 4L09A 3SE2A 5LX6A 4GMUA 4L34A 4TKIA 4PAXA 4PNNA 2PQFA 3C49A 4GV4A 4UI5A 4UI4A 5FH2A 5AEHA 3U9YA 4GMMA 4F1QA 4TK0A 5ADQA 4J3MA 4HLMA 1OENA 3P0QA 3MOHA 4L6ZA 4YWDA 4TOSA 5FH4A 4PNSA 3MHKA 4W6EA 5FH0A 5I67A 2OLQA 2QF2A 3MOFA 4L7PA 4TJYA 4BU7A 4PY4A 2RD6A 3L3LA 4M7BA 4OPXC 4GV2A 1II2A 2OLRA 3PAXA 4HKIA 2RKEA 4TVJA 4U6AA 4UVWA 4UXBA 5C5QA 4TORA 4BUWA 4BUTA 5FPFA 3GN7A 4GNQA 4UVNA 5EBTA 4UVLA 3L3MA 4UVXA 2RK8A 3DT4A 4J21A 4UI8A 4X52A 5LXPA 1WOKA 4IUEA 4DQYC 4WPTA 5AL5A 4LI7A 2PY7X 4GNOA 3FHBA 4J1ZA 4L0SA 4L7OA 4KRSA 4L2KA 5ECEA 5FH1A 5AKUA 3KCZA 4HLFA 4PNLA 4WIEA 5ADTA 4OA7A 2PAXA 4BU6A 4ZZYA 4L32A 4L0IA 4GNLA 4L7LA 4UFUA 3BLJA 1YLHA 3KJDA 4MSKA 1YVYA 4GV0A 3UDDA 4DVIA 4L7NA 4HMHA 2PAWA 1AYLA 4RV6A 4HLHA 4L7RA 4UVUA 5DCZA 4PMLA 3DTBA 4MT9A 2QEYA 4BJBA 1NHXA 4HLKA 1OS1A 4TJWA 1PAXA 1KHEA 2RK7A 5AL4A 1GS0A 3P0PA 4K4FA 4GNMA 4UVYA 5FH5A 4UVPA 4WPVA 3GOYA 4L0VA 4L6SA 3GJWA 4R43A 5ETYA 1KHGA 4HYFA 4MSGA 3C4HA 3W51A 2RKAA 4UUHA 4OQAC 5C5RA 2PC9A 4BJ9A 4BFPA 4J22A 5AKWA 2QZYA 4BU3A 4ZZZA 1M51A 3KR8A 1XKVA 4HKNA 4L2FA 3MOEA 4ZZXA 1K3DA 4L2GA 4OX2A 4UFYA 4XHUA 1UK0A 4WL8A 4BUDA 4UVZA 5A00A 4TKGA 3SMJA 2QEWA 5AL2A 4GMWA 4J3LA 4PNTA 4W5SA 4HKKA 4PJTA 4YW9A 4BUFA 4L0BA 4L7UA 4UW1A 4F1LA 4GV7A 4PNRA 3UH4A 5FPGA 2ZCIA 4TK5A 1YGGA 4KZLA 4BJCA 3KR7A 4N3RA 2GMVA 3DT7A 4KZQA 1J3BA 3UA9A 4BUSA 4BU9A 5AL1A 4RCGA 4YW8A 4HHYA 4BUAA 4LI6A 3U9HA 1YTMA 4UI6A 4BUUA 4TJUA 4UVSA 5ADRA 4UI7A 4N4VA 2RF5A 4UX4A 4WIUA 1AQ2A 4OQBC 3P0NA 5AL3A 4PNQA 4I9IA 3DT2A 4TKFA 4BUIA 4KZUA 2PXZX 4HHZA 4GNPA 2QF1A 4BUVA 4UVTA 5C5PA 4HL5A 4BU5A 4L31A 3MHJA 5FH3A 1A26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVV A;  4F0E A;  5ADS A;  4BUX A;  4L0T A;  3CE0 A;  3HKV A;  3SMI A;  4W5I A;  4PJV A;  4UVO A;  4BS4 A;  4AVW A;  1UK1 A;  2X5Y A;  4K4E A;  4UND A;  4R5W A;  4AVU A;  4UI3 A;  3UH2 A;  4L70 A;  4BUY A;  2RCW A;  3GEY A;  4UHG A;  1EFY A;  4BUE A;  4HLG A;  4L33 A;  4N4T A;  5LYH A;  4R6E A;  4L10 A;  4LI8 A;  4BU8 A;  4PNM A;  4L09 A;  3SE2 A;  5LX6 A;  4L34 A;  4TKI A;  4PAX A;  4PNN A;  2PQF A;  3C49 A;  4GV4 A;  4UI5 A;  4UI4 A;  5AEH A;  3U9Y A;  4F1Q A;  4TK0 A;  5ADQ A;  4J3M A;  4HLM A;  3P0Q A;  4L6Z A;  4TOS A;  4PNS A;  3MHK A;  4W6E A;  4L7P A;  4BU7 A;  4TJY A;  4PY4 A;  2RD6 A;  3L3L A;  4M7B A;  4OPX C;  4GV2 A;  3PAX A;  4HKI A;  4U6A A;  5C5Q A;  4UVW A;  4TVJ A;  4UXB A;  4BUT A;  4BUW A;  5FPF A;  4TOR A;  3GN7 A;  4UVN A;  5EBT A;  4UVL A;  3L3M A;  4UVX A;  5LXP A;  4J21 A;  4UI8 A;  4X52 A;  1WOK A;  4IUE A;  4DQY C;  5AL5 A;  4LI7 A;  4L7O A;  3FHB A;  4J1Z A;  4L0S A;  4KRS A;  4L2K A;  5ECE A;  5AKU A;  3KCZ A;  4HLF A;  4PNL A;  5ADT A;  4OA7 A;  2PAX A;  4BU6 A;  4ZZY A;  4L32 A;  4L0I A;  4L7L A;  4UFU A;  3BLJ A;  3KJD A;  4MSK A;  3UDD A;  4GV0 A;  4DVI A;  4L7N A;  4HMH A;  2PAW A;  4RV6 A;  4HLH A;  4L7R A;  4UVU A;  5DCZ A;  4PML A;  4MT9 A;  4BJB A;  4HLK A;  4TJW A;  1PAX A;  5AL4 A;  1GS0 A;  3P0P A;  4K4F A;  4UVY A;  4UVP A;  3GOY A;  4L0V A;  4L6S A;  3GJW A;  5ETY A;  4HYF A;  4MSG A;  3C4H A;  3W51 A;  4UUH A;  4OQA C;  5C5R A;  4BJ9 A;  4BFP A;  4J22 A;  5AKW A;  4BU3 A;  4ZZZ A;  3KR8 A;  4HKN A;  4L2F A;  4ZZX A;  4L2G A;  4XHU A;  4UFY A;  1UK0 A;  4BUD A;  4UVZ A;  5A00 A;  4TKG A;  3SMJ A;  5AL2 A;  4J3L A;  4PNT A;  4W5S A;  4HKK A;  4PJT A;  4BUF A;  4F1L A;  4L0B A;  4L7U A;  4UW1 A;  4GV7 A;  4PNR A;  3UH4 A;  5FPG A;  4TK5 A;  4KZL A;  4BJC A;  3KR7 A;  4N3R A;  4KZQ A;  3UA9 A;  4BUS A;  4BU9 A;  5AL1 A;  4HHY A;  4BUA A;  4LI6 A;  3U9H A;  4UI6 A;  4BUU A;  4TJU A;  4UVS A;  5ADR A;  4UI7 A;  4N4V A;  2RF5 A;  4UX4 A;  4OQB C;  3P0N A;  5AL3 A;  4PNQ A;  4I9I A;  4TKF A;  4BUI A;  4KZU A;  4HHZ A;  4BUV A;  5C5P A;  4UVT A;  4HL5 A;  4BU5 A;  4L31 A;  3MHJ A;  1A26 A; 
#chains in the Genus database with same CATH topology
 4UVV A;  4F0E A;  5ADS A;  4BUX A;  4L0T A;  3CE0 A;  3HKV A;  3SMI A;  4W5I A;  4PJV A;  4UVO A;  4BS4 A;  4AVW A;  1UK1 A;  2X5Y A;  4K4E A;  4UND A;  4R5W A;  4AVU A;  4UI3 A;  1KHF A;  3UH2 A;  4L70 A;  2RKD A;  2FAF A;  4YWB A;  4BUY A;  2RCW A;  4GMZ A;  3GEY A;  4UHG A;  1EFY A;  4BUE A;  1K3C A;  4HLG A;  4L33 A;  4N4T A;  4WPU A;  4WOU A;  4R6E A;  5LYH A;  4L10 A;  1KHB A;  2FAH A;  4LI8 A;  4BU8 A;  4PNM A;  4L09 A;  3SE2 A;  5LX6 A;  4GMU A;  4L34 A;  4TKI A;  4PAX A;  4PNN A;  2PQF A;  3C49 A;  4GV4 A;  4UI5 A;  4UI4 A;  5FH2 A;  5AEH A;  3U9Y A;  4GMM A;  4F1Q A;  4TK0 A;  5ADQ A;  4J3M A;  4HLM A;  1OEN A;  3P0Q A;  3MOH A;  4L6Z A;  4YWD A;  4TOS A;  5FH4 A;  4PNS A;  3MHK A;  4W6E A;  5FH0 A;  5I67 A;  2OLQ A;  2QF2 A;  3MOF A;  4L7P A;  4TJY A;  4BU7 A;  4PY4 A;  2RD6 A;  3L3L A;  4M7B A;  4OPX C;  4GV2 A;  1II2 A;  2OLR A;  3PAX A;  4HKI A;  2RKE A;  4TVJ A;  4U6A A;  4UVW A;  4UXB A;  5C5Q A;  4TOR A;  4BUW A;  4BUT A;  5FPF A;  3GN7 A;  4GNQ A;  4UVN A;  5EBT A;  4UVL A;  3L3M A;  4UVX A;  2RK8 A;  3DT4 A;  4J21 A;  4UI8 A;  4X52 A;  5LXP A;  1WOK A;  4IUE A;  4DQY C;  4WPT A;  5AL5 A;  4LI7 A;  2PY7 X;  4GNO A;  3FHB A;  4J1Z A;  4L0S A;  4L7O A;  4KRS A;  4L2K A;  5ECE A;  5FH1 A;  5AKU A;  3KCZ A;  4HLF A;  4PNL A;  4WIE A;  5ADT A;  4OA7 A;  2PAX A;  4BU6 A;  4ZZY A;  4L32 A;  4L0I A;  4GNL A;  4L7L A;  4UFU A;  3BLJ A;  1YLH A;  3KJD A;  4MSK A;  1YVY A;  4GV0 A;  3UDD A;  4DVI A;  4L7N A;  4HMH A;  2PAW A;  1AYL A;  4RV6 A;  4HLH A;  4L7R A;  4UVU A;  5DCZ A;  4PML A;  3DTB A;  4MT9 A;  2QEY A;  4BJB A;  1NHX A;  4HLK A;  1OS1 A;  4TJW A;  1PAX A;  1KHE A;  2RK7 A;  5AL4 A;  1GS0 A;  3P0P A;  4K4F A;  4GNM A;  4UVY A;  5FH5 A;  4UVP A;  4WPV A;  3GOY A;  4L0V A;  4L6S A;  3GJW A;  4R43 A;  5ETY A;  1KHG A;  4HYF A;  4MSG A;  3C4H A;  3W51 A;  2RKA A;  4UUH A;  4OQA C;  5C5R A;  2PC9 A;  4BJ9 A;  4BFP A;  4J22 A;  5AKW A;  2QZY A;  4BU3 A;  4ZZZ A;  1M51 A;  3KR8 A;  1XKV A;  4HKN A;  4L2F A;  3MOE A;  4ZZX A;  1K3D A;  4L2G A;  4OX2 A;  4UFY A;  4XHU A;  1UK0 A;  4WL8 A;  4BUD A;  4UVZ A;  5A00 A;  4TKG A;  3SMJ A;  2QEW A;  5AL2 A;  4GMW A;  4J3L A;  4PNT A;  4W5S A;  4HKK A;  4PJT A;  4YW9 A;  4BUF A;  4L0B A;  4L7U A;  4UW1 A;  4F1L A;  4GV7 A;  4PNR A;  3UH4 A;  5FPG A;  2ZCI A;  4TK5 A;  1YGG A;  4KZL A;  4BJC A;  3KR7 A;  4N3R A;  2GMV A;  3DT7 A;  4KZQ A;  1J3B A;  3UA9 A;  4BUS A;  4BU9 A;  5AL1 A;  4RCG A;  4YW8 A;  4HHY A;  4BUA A;  4LI6 A;  3U9H A;  1YTM A;  4UI6 A;  4BUU A;  4TJU A;  4UVS A;  5ADR A;  4UI7 A;  4N4V A;  2RF5 A;  4UX4 A;  4WIU A;  1AQ2 A;  4OQB C;  3P0N A;  5AL3 A;  4PNQ A;  4I9I A;  3DT2 A;  4TKF A;  4BUI A;  4KZU A;  2PXZ X;  4HHZ A;  4GNP A;  2QF1 A;  4BUV A;  4UVT A;  5C5P A;  4HL5 A;  4BU5 A;  4L31 A;  3MHJ A;  5FH3 A;  1A26 A; 
#chains in the Genus database with same CATH homology
 4UVV A;  4F0E A;  5ADS A;  4BUX A;  4L0T A;  3CE0 A;  3HKV A;  3SMI A;  4W5I A;  4PJV A;  4UVO A;  4BS4 A;  4AVW A;  1UK1 A;  2X5Y A;  4K4E A;  4UND A;  4R5W A;  4AVU A;  4UI3 A;  1KHF A;  3UH2 A;  4L70 A;  2RKD A;  2FAF A;  4YWB A;  4BUY A;  2RCW A;  4GMZ A;  3GEY A;  4UHG A;  1EFY A;  4BUE A;  1K3C A;  4HLG A;  4L33 A;  4N4T A;  4WPU A;  4WOU A;  4R6E A;  5LYH A;  4L10 A;  1KHB A;  2FAH A;  4LI8 A;  4BU8 A;  4PNM A;  4L09 A;  3SE2 A;  5LX6 A;  4GMU A;  4L34 A;  4TKI A;  4PAX A;  4PNN A;  2PQF A;  3C49 A;  4GV4 A;  4UI5 A;  4UI4 A;  5FH2 A;  5AEH A;  3U9Y A;  4GMM A;  4F1Q A;  4TK0 A;  5ADQ A;  4J3M A;  4HLM A;  1OEN A;  3P0Q A;  3MOH A;  4L6Z A;  4YWD A;  4TOS A;  5FH4 A;  4PNS A;  3MHK A;  4W6E A;  5FH0 A;  5I67 A;  2OLQ A;  2QF2 A;  3MOF A;  4L7P A;  4TJY A;  4BU7 A;  4PY4 A;  2RD6 A;  3L3L A;  4M7B A;  4OPX C;  4GV2 A;  1II2 A;  2OLR A;  3PAX A;  4HKI A;  2RKE A;  4TVJ A;  4U6A A;  4UVW A;  4UXB A;  5C5Q A;  4TOR A;  4BUW A;  4BUT A;  5FPF A;  3GN7 A;  4GNQ A;  4UVN A;  5EBT A;  4UVL A;  3L3M A;  4UVX A;  2RK8 A;  3DT4 A;  4J21 A;  4UI8 A;  4X52 A;  5LXP A;  1WOK A;  4IUE A;  4DQY C;  4WPT A;  5AL5 A;  4LI7 A;  2PY7 X;  4GNO A;  3FHB A;  4J1Z A;  4L0S A;  4L7O A;  4KRS A;  4L2K A;  5ECE A;  5FH1 A;  5AKU A;  3KCZ A;  4HLF A;  4PNL A;  4WIE A;  5ADT A;  4OA7 A;  2PAX A;  4BU6 A;  4ZZY A;  4L32 A;  4L0I A;  4GNL A;  4L7L A;  4UFU A;  3BLJ A;  1YLH A;  3KJD A;  4MSK A;  1YVY A;  4GV0 A;  3UDD A;  4DVI A;  4L7N A;  4HMH A;  2PAW A;  1AYL A;  4RV6 A;  4HLH A;  4L7R A;  4UVU A;  5DCZ A;  4PML A;  3DTB A;  4MT9 A;  2QEY A;  4BJB A;  1NHX A;  4HLK A;  1OS1 A;  4TJW A;  1PAX A;  1KHE A;  2RK7 A;  5AL4 A;  1GS0 A;  3P0P A;  4K4F A;  4GNM A;  4UVY A;  5FH5 A;  4UVP A;  4WPV A;  3GOY A;  4L0V A;  4L6S A;  3GJW A;  4R43 A;  5ETY A;  1KHG A;  4HYF A;  4MSG A;  3C4H A;  3W51 A;  2RKA A;  4UUH A;  4OQA C;  5C5R A;  2PC9 A;  4BJ9 A;  4BFP A;  4J22 A;  5AKW A;  2QZY A;  4BU3 A;  4ZZZ A;  1M51 A;  3KR8 A;  1XKV A;  4HKN A;  4L2F A;  3MOE A;  4ZZX A;  1K3D A;  4L2G A;  4OX2 A;  4UFY A;  4XHU A;  1UK0 A;  4WL8 A;  4BUD A;  4UVZ A;  5A00 A;  4TKG A;  3SMJ A;  2QEW A;  5AL2 A;  4GMW A;  4J3L A;  4PNT A;  4W5S A;  4HKK A;  4PJT A;  4YW9 A;  4BUF A;  4L0B A;  4L7U A;  4UW1 A;  4F1L A;  4GV7 A;  4PNR A;  3UH4 A;  5FPG A;  2ZCI A;  4TK5 A;  1YGG A;  4KZL A;  4BJC A;  3KR7 A;  4N3R A;  2GMV A;  3DT7 A;  4KZQ A;  1J3B A;  3UA9 A;  4BUS A;  4BU9 A;  5AL1 A;  4RCG A;  4YW8 A;  4HHY A;  4BUA A;  4LI6 A;  3U9H A;  1YTM A;  4UI6 A;  4BUU A;  4TJU A;  4UVS A;  5ADR A;  4UI7 A;  4N4V A;  2RF5 A;  4UX4 A;  4WIU A;  1AQ2 A;  4OQB C;  3P0N A;  5AL3 A;  4PNQ A;  4I9I A;  3DT2 A;  4TKF A;  4BUI A;  4KZU A;  2PXZ X;  4HHZ A;  4GNP A;  2QF1 A;  4BUV A;  4UVT A;  5C5P A;  4HL5 A;  4BU5 A;  4L31 A;  3MHJ A;  5FH3 A;  1A26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...