4BUMX

Crystal structure of the voltage dependant anion channel 2 from zebrafish.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
283
Chain Sequence
MAVPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKYKRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structure and Double Electron-Electron Resonance of the Zebrafish Voltage Dependent Anion Channel 2 Reveal an Oligomeric Population.
pubmed doi rcsb
source organism Danio rerio
molecule tags Membrane protein
molecule keywords VOLTAGE-DEPENDENT ANION CHANNEL 2
total genus 63
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01459 Porin_3 Eukaryotic porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4bumX00
3UU2A 1OPFA 2ZFGA 3VY9X 4D64A 3JTYA 3VZUX 5DL8A 4FRTA 3FYXA 2ZLDA 3UPGA 5JDPA 4D5UA 4C69X 2XE1A 4LSEA 5DL6A 3T24A 3POUA 2Y0HA 1E54A 3EMNX 3HWBA 4LSFA 4LSIA 3PORA 1BT9A 1GFOA 4RJWA 1HXUA 5FVNA 1BH3A 1GFPA 1PHOA 4FOZA 4FT6A 3POQA 2QTKA 2PORA 2XE3A 4KR4A 2XG6A 2O4VA 2Y2XA 4GCSA 3VZTX 1GFMA 3A2SX 2Y0LA 4D65A 3VZWX 3SYBA 2FGRA 3K19A 2FGQX 3T0SA 4FSOA 4LSHA 4JFBA 7PRNA 8PRNA 1MPFA 5DL5A 3WI4A 2XE2A 4BUMX 3POXA 4AUIA 1PRNA 4FMSA 2ODJA 4GCPA 3T20A 2PRNA 3O0EA 2OMFA 1H6S1 3SZDA 3HW9A 3VY8X 5DL7A 4RJXA 4GCQA 2J1NA 1GFQA 1HXXA 4KRAA 3NSGA 3SY7A 1HXTA 4FRXA 4FSPA 4KR8A 3SZVA 1OSMA 3SYSA 2XE5A 5PRNA 1GFNA 2Y0KA 3SY9A 2J4UP 3PRNA 6PRNA 2K4TA 3WI5A
chains in the Genus database with same CATH superfamily
2KXPA 3UU2A 4PUXA 4AYMC 1OPFA 2ZFGA 4GHBA 5T5FA 3VY9X 3DWNA 1T16A 4D64A 3JTYA 4K3BA 3NJTA 2XTQA 3AA6B 3BRYA 4AZLA 3PGUA 3VZUX 5ADXK 3KZIO 5GTIO 3HOEA 5DL8A 5AFUL 4FRTA 4XNKA 5H2FO 3FYXA 4AKMA 2N2MA 4B61A 4N74A 4O4XA 2N2LA 3LK3B 4N75A 5KAIO 2ZLDA 4GF4A 2JQYA 4FQEA 3V8UA 3AA6A 4FUVA 3UPGA 2F1CX 5JDPA 4G75A 4C00A 2IWWA 4AFKA 6PRNA 4D5UA 3G7GA 4C69X 2R4NA 4UB8O 2WJRA 2XE1A 3LK2B 4LSEA 2R4LA 2Y7SA 5DL6A 2K0LA 3AAEA 2M07A 3KVDD 3T24A 3LK42 2KZ7A 3POUA 4C4VA 2Y0HA 3A0HO 1E54A 3PGRA 3EMNX 3HWBA 1Q9GA 3PQSA 4LSFA 1P4TA 4RL9A 4LSIA 3PORA 3AA0B 3LK41 5AFUK 1ZHWA 1BT9A 1GFOA 2LFUA 4RJWA 2JMMA 2X9KA 3AAAA 4RLCA 1ZHTA 1S5LO 2R89A 1HXUA 5FVNA 1IZNA 2KDYA 2KC0A 1ZHZA 1BH3A 1GFPA 1PHOA 4FZNA 4F4BA 4PJ0O 1THQA 4FOZA 4FT6A 4Z3TA 4FESA 4XNLA 4O3WA 3C5OA 3POQA 2WJQA 2QTKA 3BRZA 4O4UA 2PORA 1MM5A 2XE3A 2XTRA 4G76A 4KR4A 4K3CA 3AA7B 2M06A 3AA0A 2F1TA 2XG6A 2O4VA 3WI5A 2Y2XA 4GCSA 3VZTX 2W81C 4O3YA 1GFMA 3A2SX 2YPVA 4E1SA 1T1LA 2R4PA 2Y0LA 2ERVA 3AA7A 4D65A 1Q9FA 2XMXA 3VZWX 3SYBA 1YS5A 2W80C 1QJPA 2FGRA 5E79O 3K19A 5EE2A 2FGQX 2R88A 3T0SA 4C4VB 4AKRA 4FSOA 4E1TA 4LSHA 5G39A 4AYDC 2IWVA 4JFBA 5GTHO 4U9CA 7PRNA 4CTDA 8PRNA 1MPFA 5DL5A 3WI4A 2XE2A 4BUMX 3POXA 5G38A 3UAQA 4AUIA 1PRNA 5B66O 4FZMA 4FMSA 2ODJA 4FZLA 2GE4A 4GCPA 1BXWA 4O49A 3PF1A 3T20A 4O3XB 2PRNA 2YNKA 3O0EA 5B5EO 2OMFA 1H6S1 1MM4A 3SZDA 4AYEC 3AA1A 3QRAA 2LHFA 3DA4A 3HW9A 3VY8X 1ZHXA 5DL7A 3PGSA 5TISO 1ORMA 3HOLA 4O3ZA 2X27X 4RJXA 4N59A 5KAFO 2WVPA 3AA1B 3AAEB 3DA3A 4GCQA 2J1NA 2MNHA 2KXPB 5IYUA 2R4OA 1QJ8A 4QQ1A 3RBHA 1GFQA 5G3AA 1HXXA 2AXTO 4PR7A 4KRAA 4AKRB 3BS0A 3NSGA 3SY7A 1HXTA 4FRXA 3VE2A 4AYID 2R8AA 3AAAB 1G90A 3JCUO 4FSPA 4KR8A 3SZVA 5GV0A 3LK2A 3DWOX 5ADXL 1OSMA 2F1VA 4RLBA 3SYSA 3LK3A 1ZHYA 4UB6O 3QRCA 1QJ9A 2XE5A 4IL6O 5PRNA 3VE1A 1GFNA 2KZ7B 2Y0KA 3GP6A 4AYNA 1IZNB 4N58A 3SY9A 3A0BO 3TZGA 5G26A 5D5DA 3PRNA 2J4UP 3PQUA 3WU2O 2K4TA 3DZMA 4JCHA 2MHLA
chains in the Genus database with same CATH topology
2KXPA 3UU2A 4PUXA 4AYMC 1OPFA 2ZFGA 4GHBA 5T5FA 3VY9X 4D64A 3JTYA 4AZLA 2XTQA 3AA6B 3VZUX 5ADXK 3HOEA 5DL8A 5AFUL 4FRTA 4XNKA 3FYXA 4AKMA 2N2MA 4B61A 4O4XA 2N2LA 3LK3B 2ZLDA 4GF4A 3V8UA 3AA6A 4FUVA 3UPGA 5JDPA 4G75A 4AFKA 4D5UA 3G7GA 4C69X 2XE1A 3LK2B 4LSEA 2Y7SA 5DL6A 2K0LA 3AAEA 2M07A 3KVDD 3T24A 3LK42 2KZ7A 3POUA 2Y0HA 1E54A 3EMNX 3HWBA 1Q9GA 3PQSA 4LSFA 1P4TA 4RL9A 4LSIA 3PORA 3AA0B 3LK41 1ZHWA 1BT9A 1GFOA 2LFUA 4RJWA 2JMMA 3AAAA 4RLCA 1ZHTA 1HXUA 5FVNA 1IZNA 2KDYA 2KC0A 1ZHZA 1BH3A 1GFPA 1PHOA 4FZNA 4F4BA 1THQA 4FOZA 4FT6A 4Z3TA 4FESA 4XNLA 4O3WA 3C5OA 3POQA 2QTKA 4O4UA 2PORA 1MM5A 2XE3A 2XTRA 4G76A 4KR4A 3AA7B 2M06A 3AA0A 2F1TA 2XG6A 2O4VA 2Y2XA 4GCSA 3VZTX 2W81C 4O3YA 1GFMA 3A2SX 2YPVA 4E1SA 2Y0LA 2ERVA 3AA7A 4D65A 2XMXA 1Q9FA 3VZWX 3SYBA 1YS5A 2W80C 1QJPA 2FGRA 3K19A 5EE2A 2FGQX 3T0SA 4AKRA 4FSOA 4E1TA 4LSHA 4AYDC 4JFBA 4U9CA 7PRNA 8PRNA 1MPFA 5DL5A 3WI4A 2XE2A 4BUMX 3POXA 4AUIA 3UAQA 1PRNA 4FZMA 4FMSA 2ODJA 4FZLA 2GE4A 4GCPA 1BXWA 4O49A 3T20A 4O3XB 2PRNA 2YNKA 3O0EA 2OMFA 1H6S1 1MM4A 3SZDA 4AYEC 3AA1A 3QRAA 2LHFA 3DA4A 3HW9A 3VY8X 1ZHXA 5DL7A 1ORMA 3HOLA 4O3ZA 2X27X 4RJXA 4N59A 3AA1B 3AAEB 3DA3A 4GCQA 2J1NA 2MNHA 2KXPB 5IYUA 1QJ8A 4QQ1A 3RBHA 1GFQA 1HXXA 4AKRB 4KRAA 4AYID 3NSGA 1G90A 3SY7A 1HXTA 4FRXA 3VE2A 3AAAB 4FSPA 4KR8A 3SZVA 5GV0A 3LK2A 5ADXL 1OSMA 2F1VA 4RLBA 3SYSA 3LK3A 1ZHYA 3QRCA 1QJ9A 2XE5A 5AFUK 5PRNA 3VE1A 1GFNA 2KZ7B 2Y0KA 3GP6A 4AYNA 1IZNB 4N58A 3SY9A 3TZGA 6PRNA 5G26A 5D5DA 3PRNA 2J4UP 3PQUA 2K4TA 3WI5A 4JCHA 2MHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU2 A;  1OPF A;  2ZFG A;  3VY9 X;  4D64 A;  3JTY A;  3VZU X;  5DL8 A;  4FRT A;  3FYX A;  2ZLD A;  3UPG A;  5JDP A;  4D5U A;  4C69 X;  2XE1 A;  4LSE A;  5DL6 A;  3T24 A;  3POU A;  2Y0H A;  1E54 A;  3EMN X;  3HWB A;  4LSF A;  4LSI A;  3POR A;  1BT9 A;  1GFO A;  4RJW A;  1HXU A;  5FVN A;  1BH3 A;  1GFP A;  1PHO A;  4FOZ A;  4FT6 A;  3POQ A;  2QTK A;  2POR A;  2XE3 A;  4KR4 A;  2XG6 A;  2O4V A;  2Y2X A;  4GCS A;  3VZT X;  1GFM A;  3A2S X;  2Y0L A;  4D65 A;  3VZW X;  3SYB A;  2FGR A;  3K19 A;  2FGQ X;  3T0S A;  4FSO A;  4LSH A;  4JFB A;  7PRN A;  8PRN A;  1MPF A;  5DL5 A;  3WI4 A;  2XE2 A;  4BUM X;  3POX A;  4AUI A;  1PRN A;  4FMS A;  2ODJ A;  4GCP A;  3T20 A;  2PRN A;  3O0E A;  2OMF A;  1H6S 1;  3SZD A;  3HW9 A;  3VY8 X;  5DL7 A;  4RJX A;  4GCQ A;  2J1N A;  1GFQ A;  1HXX A;  4KRA A;  3NSG A;  3SY7 A;  1HXT A;  4FRX A;  4FSP A;  4KR8 A;  3SZV A;  1OSM A;  3SYS A;  2XE5 A;  5PRN A;  1GFN A;  2Y0K A;  3SY9 A;  2J4U P;  3PRN A;  6PRN A;  2K4T A;  3WI5 A; 
#chains in the Genus database with same CATH topology
 2KXP A;  3UU2 A;  4PUX A;  4AYM C;  1OPF A;  2ZFG A;  4GHB A;  5T5F A;  3VY9 X;  3DWN A;  1T16 A;  4D64 A;  3JTY A;  4K3B A;  3NJT A;  2XTQ A;  3AA6 B;  3BRY A;  4AZL A;  3PGU A;  3VZU X;  5ADX K;  3KZI O;  5GTI O;  3HOE A;  5DL8 A;  5AFU L;  4FRT A;  4XNK A;  5H2F O;  3FYX A;  4AKM A;  2N2M A;  4B61 A;  4N74 A;  4O4X A;  2N2L A;  3LK3 B;  4N75 A;  5KAI O;  2ZLD A;  4GF4 A;  2JQY A;  4FQE A;  3V8U A;  3AA6 A;  4FUV A;  3UPG A;  2F1C X;  5JDP A;  4G75 A;  4C00 A;  2IWW A;  4AFK A;  6PRN A;  4D5U A;  3G7G A;  4C69 X;  2R4N A;  4UB8 O;  2WJR A;  2XE1 A;  3LK2 B;  4LSE A;  2R4L A;  2Y7S A;  5DL6 A;  2K0L A;  3AAE A;  2M07 A;  3KVD D;  3T24 A;  3LK4 2;  2KZ7 A;  3POU A;  4C4V A;  2Y0H A;  3A0H O;  1E54 A;  3PGR A;  3EMN X;  3HWB A;  1Q9G A;  3PQS A;  4LSF A;  1P4T A;  4RL9 A;  4LSI A;  3POR A;  3AA0 B;  3LK4 1;  5AFU K;  1ZHW A;  1BT9 A;  1GFO A;  2LFU A;  4RJW A;  2JMM A;  2X9K A;  3AAA A;  4RLC A;  1ZHT A;  1S5L O;  2R89 A;  1HXU A;  5FVN A;  1IZN A;  2KDY A;  2KC0 A;  1ZHZ A;  1BH3 A;  1GFP A;  1PHO A;  4FZN A;  4F4B A;  4PJ0 O;  1THQ A;  4FOZ A;  4FT6 A;  4Z3T A;  4FES A;  4XNL A;  4O3W A;  3C5O A;  3POQ A;  2WJQ A;  2QTK A;  3BRZ A;  4O4U A;  2POR A;  1MM5 A;  2XE3 A;  2XTR A;  4G76 A;  4KR4 A;  4K3C A;  3AA7 B;  2M06 A;  3AA0 A;  2F1T A;  2XG6 A;  2O4V A;  3WI5 A;  2Y2X A;  4GCS A;  3VZT X;  2W81 C;  4O3Y A;  1GFM A;  3A2S X;  2YPV A;  4E1S A;  1T1L A;  2R4P A;  2Y0L A;  2ERV A;  3AA7 A;  4D65 A;  1Q9F A;  2XMX A;  3VZW X;  3SYB A;  1YS5 A;  2W80 C;  1QJP A;  2FGR A;  5E79 O;  3K19 A;  5EE2 A;  2FGQ X;  2R88 A;  3T0S A;  4C4V B;  4AKR A;  4FSO A;  4E1T A;  4LSH A;  5G39 A;  4AYD C;  2IWV A;  4JFB A;  5GTH O;  4U9C A;  7PRN A;  4CTD A;  8PRN A;  1MPF A;  5DL5 A;  3WI4 A;  2XE2 A;  4BUM X;  3POX A;  5G38 A;  3UAQ A;  4AUI A;  1PRN A;  5B66 O;  4FZM A;  4FMS A;  2ODJ A;  4FZL A;  2GE4 A;  4GCP A;  1BXW A;  4O49 A;  3PF1 A;  3T20 A;  4O3X B;  2PRN A;  2YNK A;  3O0E A;  5B5E O;  2OMF A;  1H6S 1;  1MM4 A;  3SZD A;  4AYE C;  3AA1 A;  3QRA A;  2LHF A;  3DA4 A;  3HW9 A;  3VY8 X;  1ZHX A;  5DL7 A;  3PGS A;  5TIS O;  1ORM A;  3HOL A;  4O3Z A;  2X27 X;  4RJX A;  4N59 A;  5KAF O;  2WVP A;  3AA1 B;  3AAE B;  3DA3 A;  4GCQ A;  2J1N A;  2MNH A;  2KXP B;  5IYU A;  2R4O A;  1QJ8 A;  4QQ1 A;  3RBH A;  1GFQ A;  5G3A A;  1HXX A;  2AXT O;  4PR7 A;  4KRA A;  4AKR B;  3BS0 A;  3NSG A;  3SY7 A;  1HXT A;  4FRX A;  3VE2 A;  4AYI D;  2R8A A;  3AAA B;  1G90 A;  3JCU O;  4FSP A;  4KR8 A;  3SZV A;  5GV0 A;  3LK2 A;  3DWO X;  5ADX L;  1OSM A;  2F1V A;  4RLB A;  3SYS A;  3LK3 A;  1ZHY A;  4UB6 O;  3QRC A;  1QJ9 A;  2XE5 A;  4IL6 O;  5PRN A;  3VE1 A;  1GFN A;  2KZ7 B;  2Y0K A;  3GP6 A;  4AYN A;  1IZN B;  4N58 A;  3SY9 A;  3A0B O;  3TZG A;  5G26 A;  5D5D A;  3PRN A;  2J4U P;  3PQU A;  3WU2 O;  2K4T A;  3DZM A;  4JCH A;  2MHL A; 
#chains in the Genus database with same CATH homology
 2KXP A;  3UU2 A;  4PUX A;  4AYM C;  1OPF A;  2ZFG A;  4GHB A;  5T5F A;  3VY9 X;  4D64 A;  3JTY A;  4AZL A;  2XTQ A;  3AA6 B;  3VZU X;  5ADX K;  3HOE A;  5DL8 A;  5AFU L;  4FRT A;  4XNK A;  3FYX A;  4AKM A;  2N2M A;  4B61 A;  4O4X A;  2N2L A;  3LK3 B;  2ZLD A;  4GF4 A;  3V8U A;  3AA6 A;  4FUV A;  3UPG A;  5JDP A;  4G75 A;  4AFK A;  4D5U A;  3G7G A;  4C69 X;  2XE1 A;  3LK2 B;  4LSE A;  2Y7S A;  5DL6 A;  2K0L A;  3AAE A;  2M07 A;  3KVD D;  3T24 A;  3LK4 2;  2KZ7 A;  3POU A;  2Y0H A;  1E54 A;  3EMN X;  3HWB A;  1Q9G A;  3PQS A;  4LSF A;  1P4T A;  4RL9 A;  4LSI A;  3POR A;  3AA0 B;  3LK4 1;  1ZHW A;  1BT9 A;  1GFO A;  2LFU A;  4RJW A;  2JMM A;  3AAA A;  4RLC A;  1ZHT A;  1HXU A;  5FVN A;  1IZN A;  2KDY A;  2KC0 A;  1ZHZ A;  1BH3 A;  1GFP A;  1PHO A;  4FZN A;  4F4B A;  1THQ A;  4FOZ A;  4FT6 A;  4Z3T A;  4FES A;  4XNL A;  4O3W A;  3C5O A;  3POQ A;  2QTK A;  4O4U A;  2POR A;  1MM5 A;  2XE3 A;  2XTR A;  4G76 A;  4KR4 A;  3AA7 B;  2M06 A;  3AA0 A;  2F1T A;  2XG6 A;  2O4V A;  2Y2X A;  4GCS A;  3VZT X;  2W81 C;  4O3Y A;  1GFM A;  3A2S X;  2YPV A;  4E1S A;  2Y0L A;  2ERV A;  3AA7 A;  4D65 A;  2XMX A;  1Q9F A;  3VZW X;  3SYB A;  1YS5 A;  2W80 C;  1QJP A;  2FGR A;  3K19 A;  5EE2 A;  2FGQ X;  3T0S A;  4AKR A;  4FSO A;  4E1T A;  4LSH A;  4AYD C;  4JFB A;  4U9C A;  7PRN A;  8PRN A;  1MPF A;  5DL5 A;  3WI4 A;  2XE2 A;  4BUM X;  3POX A;  4AUI A;  3UAQ A;  1PRN A;  4FZM A;  4FMS A;  2ODJ A;  4FZL A;  2GE4 A;  4GCP A;  1BXW A;  4O49 A;  3T20 A;  4O3X B;  2PRN A;  2YNK A;  3O0E A;  2OMF A;  1H6S 1;  1MM4 A;  3SZD A;  4AYE C;  3AA1 A;  3QRA A;  2LHF A;  3DA4 A;  3HW9 A;  3VY8 X;  1ZHX A;  5DL7 A;  1ORM A;  3HOL A;  4O3Z A;  2X27 X;  4RJX A;  4N59 A;  3AA1 B;  3AAE B;  3DA3 A;  4GCQ A;  2J1N A;  2MNH A;  2KXP B;  5IYU A;  1QJ8 A;  4QQ1 A;  3RBH A;  1GFQ A;  1HXX A;  4AKR B;  4KRA A;  4AYI D;  3NSG A;  1G90 A;  3SY7 A;  1HXT A;  4FRX A;  3VE2 A;  3AAA B;  4FSP A;  4KR8 A;  3SZV A;  5GV0 A;  3LK2 A;  5ADX L;  1OSM A;  2F1V A;  4RLB A;  3SYS A;  3LK3 A;  1ZHY A;  3QRC A;  1QJ9 A;  2XE5 A;  5AFU K;  5PRN A;  3VE1 A;  1GFN A;  2KZ7 B;  2Y0K A;  3GP6 A;  4AYN A;  1IZN B;  4N58 A;  3SY9 A;  3TZG A;  6PRN A;  5G26 A;  5D5D A;  3PRN A;  2J4U P;  3PQU A;  2K4T A;  3WI5 A;  4JCH A;  2MHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...