4BUMX

Crystal structure of the voltage dependant anion channel 2 from zebrafish.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
283
structure length
283
Chain Sequence
MAVPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKYKRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structure and Double Electron-Electron Resonance of the Zebrafish Voltage Dependent Anion Channel 2 Reveal an Oligomeric Population.
pubmed doi rcsb
molecule keywords VOLTAGE-DEPENDENT ANION CHANNEL 2
source organism Danio rerio
molecule tags Membrane protein
total genus 63
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01459 Porin_3 Eukaryotic porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4bumX00
4FT6A 3SZDA 1BH3A 3NSGA 3VZTX 2ZLDA 3POUA 2Y0LA 4RJWA 3SZVA 3T0SA 1MPFA 4AUIA 2J4UP 1HXTA 4GCSA 4D65A 2ZFGA 3K19A 1GFNA 5FVNA 8PRNA 2PORA 3JTYA 3POQA 4FMSA 4FSOA 2QTKA 3VY8X 3UU2A 2XG6A 2PRNA 4FOZA 4LSHA 2OMFA 2XE5A 2XE1A 3PRNA 5DL5A 1OSMA 3SYSA 2XE3A 3WI5A 1HXUA 3HW9A 2O4VA 3UPGA 3O0EA 2J1NA 1GFOA 2XE2A 3A2SX 7PRNA 2Y2XA 1GFPA 2ODJA 4LSEA 1PRNA 1HXXA 2Y0HA 4GCPA 3VZUX 2Y0KA 3VZWX 6PRNA 4FRXA 5DL7A 4KR8A 5DL8A 4D64A 1PHOA 1GFMA 1BT9A 3POXA 3SY9A 3EMNX 3VY9X 1GFQA 3T24A 4LSFA 1OPFA 3WI4A 5DL6A 4KR4A 1E54A 3SY7A 4RJXA 3PORA 4KRAA 4C69X 3SYBA 1H6S1 2K4TA 4GCQA 4BUMX 5JDPA 3FYXA 5PRNA 2FGQX 4LSIA 3T20A 2FGRA 4D5UA 4JFBA 3HWBA 4FRTA 4FSPA
chains in the Genus database with same CATH superfamily
4FT6A 3SZDA 1Q9FA 1BH3A 3NSGA 4N58A 4PJ0O 1T16A 2KXPA 3BS0A 3VZTX 2ZLDA 3POUA 2Y0LA 3DA3A 4RJWA 3SZVA 4RL9A 5G39A 4FZNA 3T0SA 3V8UA 2M06A 3AAAB 3JCUO 1MPFA 4UB6O 4AUIA 2J4UP 1HXTA 5GTHO 4GCSA 2F1VA 4GHBA 4AZLA 2ZFGA 4D65A 6PRNA 4U9CA 3K19A 1GFNA 5FVNA 8PRNA 2MHLA 4FUVA 2X27X 3BRZA 2PORA 3PGUA 3PQUA 3JTYA 3POQA 1ZHWA 4E1SA 4FMSA 2R88A 4G76A 3VE1A 4FSOA 2QTKA 4AKMA 3LK3B 3VY8X 2IWWA 2R8AA 3UU2A 3LK3A 3PGRA 4RLCA 2PRNA 2KZ7B 2XG6A 4FOZA 4UB8O 5KAIO 3AA0B 2KZ7A 1QJ8A 3AA1B 3WU2O 5GTIO 4LSHA 3AA0A 2OMFA 3AA1A 2XE5A 1MM4A 2KC0A 4FESA 2R4NA 2XE1A 3DA4A 3PRNA 5DL5A 2LFUA 3VE2A 1OSMA 3QRCA 3SYSA 1T1LA 2XE3A 3WI5A 2XTRA 1HXUA 1QJPA 5ADXL 3HW9A 3AAAA 1BXWA 4G75A 2WVPA 2XMXA 2YNKA 4GF4A 2O4VA 4O3WA 3PGSA 4O3ZA 4CTDA 1ZHXA 3UPGA 3KZIO 4O49A 3C5OA 3O0EA 5AFUL 4AYEC 5ADXK 5IYUA 4RLBA 2J1NA 1GFOA 5EE2A 2XE2A 5H2FO 3A2SX 7PRNA 2AXTO 2Y2XA 4PUXA 2W81C 3PF1A 1GFPA 1Q9GA 2ODJA 4LSEA 3G7GA 2N2MA 1ZHTA 4O3XB 1PRNA 1HXXA 2ERVA 2Y0HA 4N74A 4QQ1A 2M07A 4GCPA 5D5DA 2Y0KA 3VZUX 3KVDD 1P4TA 3BRYA 1ZHYA 3LK2B 3NJTA 4FRXA 2WJRA 3VZWX 4AYDC 2WJQA 5DL7A 4AKRB 2XTQA 4KR8A 3DZMA 1ORMA 5DL8A 2GE4A 3TZGA 4AKRA 1PHOA 4D64A 1S5LO 1GFMA 1BT9A 4AFKA 3AA6B 3POXA 3PQSA 3DWNA 3AA6A 4AYNA 3AAEB 3SY9A 5G26A 3EMNX 5E79O 3AAEA 4IL6O 3LK42 3VY9X 2Y7SA 4K3CA 1YS5A 2JQYA 2R89A 1GFQA 3T24A 1ZHZA 2YPVA 1OPFA 4LSFA 1MM5A 1QJ9A 2F1TA 2R4LA 2LHFA 3WI4A 4XNLA 5DL6A 5TISO 4N59A 5B66O 5G3AA 4JCHA 2KXPB 1E54A 2KDYA 4FZMA 4K3BA 4KR4A 4O3YA 4O4UA 4RJXA 3SY7A 3PORA 5AFUK 4C4VB 2IWVA 4B61A 4KRAA 4C4VA 4FZLA 5KAFO 3RBHA 4C69X 3HOLA 1H6S1 4FQEA 3LK2A 3SYBA 2K4TA 4E1TA 3A0BO 3UAQA 3A0HO 4GCQA 4XNKA 2MNHA 4BUMX 5JDPA 3HOEA 3FYXA 1THQA 5GV0A 2X9KA 5PRNA 3LK41 2FGQX 2N2LA 1IZNB 2F1CX 4PR7A 4C00A 1IZNA 2R4PA 3GP6A 4LSIA 4O4XA 5B5EO 3T20A 4AYID 4AYMC 3AA7B 3QRAA 2FGRA 4F4BA 4FSPA 3AA7A 2R4OA 5G38A 4JFBA 5T5FA 4D5UA 4Z3TA 4N75A 3HWBA 1G90A 2K0LA 2JMMA 2W80C 4FRTA 3DWOX
chains in the Genus database with same CATH topology
4FT6A 3SZDA 1Q9FA 1BH3A 3NSGA 4N58A 2KXPA 3VZTX 2ZLDA 3POUA 2Y0LA 3DA3A 4RJWA 3SZVA 4RL9A 4FZNA 3T0SA 3V8UA 2M06A 3AAAB 1MPFA 4AUIA 2J4UP 1HXTA 4GCSA 2F1VA 4GHBA 4AZLA 2ZFGA 4D65A 4U9CA 3K19A 1GFNA 5FVNA 8PRNA 2MHLA 4FUVA 2X27X 2PORA 3PQUA 3JTYA 3POQA 1ZHWA 4E1SA 4FMSA 4G76A 3VE1A 4AKMA 4FSOA 2QTKA 3LK3B 3VY8X 3UU2A 3LK3A 4RLCA 2XG6A 2PRNA 2KZ7B 4FOZA 3AA0B 2KZ7A 1QJ8A 3AA1B 4LSHA 3AA0A 2OMFA 3AA1A 2XE5A 1MM4A 2KC0A 4FESA 2XE1A 3DA4A 3PRNA 5DL5A 2LFUA 3VE2A 1OSMA 3QRCA 3SYSA 2XE3A 3WI5A 2XTRA 1HXUA 1QJPA 5ADXL 3HW9A 3AAAA 1BXWA 4G75A 2YNKA 2XMXA 4GF4A 2O4VA 4O3WA 4O3ZA 1ZHXA 3UPGA 4O49A 3C5OA 3O0EA 5AFUL 4AYEC 5ADXK 5IYUA 4RLBA 2J1NA 1GFOA 5EE2A 2XE2A 3A2SX 7PRNA 2Y2XA 4PUXA 2W81C 1GFPA 1Q9GA 2ODJA 4LSEA 3G7GA 2N2MA 1ZHTA 4O3XB 1PRNA 1HXXA 2ERVA 2Y0HA 4QQ1A 2M07A 4GCPA 5D5DA 2Y0KA 3VZUX 3KVDD 1P4TA 3LK2B 1ZHYA 4FRXA 3VZWX 4AYDC 6PRNA 5DL7A 4AKRB 2XTQA 4KR8A 3TZGA 1ORMA 5DL8A 2GE4A 4AKRA 4D64A 1PHOA 1GFMA 1BT9A 4AFKA 3AA6B 3POXA 3PQSA 3AA6A 4AYNA 3AAEB 3SY9A 5G26A 3EMNX 3AAEA 3LK42 3VY9X 2Y7SA 1YS5A 1GFQA 3T24A 1ZHZA 2YPVA 1OPFA 4LSFA 1MM5A 1QJ9A 2F1TA 2LHFA 3WI4A 4XNLA 5DL6A 4N59A 4JCHA 2KXPB 1E54A 2KDYA 4FZMA 4KR4A 4O3YA 4O4UA 4RJXA 3SY7A 5AFUK 3PORA 4B61A 4KRAA 4FZLA 3RBHA 4C69X 3HOLA 1H6S1 3SYBA 3LK2A 2K4TA 4E1TA 3UAQA 4GCQA 4XNKA 4BUMX 2MNHA 5JDPA 3HOEA 3FYXA 1THQA 5GV0A 5PRNA 3LK41 2FGQX 2N2LA 1IZNB 1IZNA 3GP6A 4LSIA 4O4XA 3T20A 4AYID 4AYMC 3AA7B 3QRAA 2FGRA 4F4BA 3AA7A 4D5UA 4JFBA 5T5FA 4Z3TA 1G90A 3HWBA 2K0LA 2JMMA 2W80C 4FRTA 4FSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT6 A;  3SZD A;  1BH3 A;  3NSG A;  3VZT X;  2ZLD A;  3POU A;  2Y0L A;  4RJW A;  3SZV A;  3T0S A;  1MPF A;  4AUI A;  2J4U P;  1HXT A;  4GCS A;  4D65 A;  2ZFG A;  3K19 A;  1GFN A;  5FVN A;  8PRN A;  2POR A;  3JTY A;  3POQ A;  4FMS A;  4FSO A;  2QTK A;  3VY8 X;  3UU2 A;  2XG6 A;  2PRN A;  4FOZ A;  4LSH A;  2OMF A;  2XE5 A;  2XE1 A;  3PRN A;  5DL5 A;  1OSM A;  3SYS A;  2XE3 A;  3WI5 A;  1HXU A;  3HW9 A;  2O4V A;  3UPG A;  3O0E A;  2J1N A;  1GFO A;  2XE2 A;  3A2S X;  7PRN A;  2Y2X A;  1GFP A;  2ODJ A;  4LSE A;  1PRN A;  1HXX A;  2Y0H A;  4GCP A;  3VZU X;  2Y0K A;  3VZW X;  6PRN A;  4FRX A;  5DL7 A;  4KR8 A;  5DL8 A;  4D64 A;  1PHO A;  1GFM A;  1BT9 A;  3POX A;  3SY9 A;  3EMN X;  3VY9 X;  1GFQ A;  3T24 A;  4LSF A;  1OPF A;  3WI4 A;  5DL6 A;  4KR4 A;  1E54 A;  3SY7 A;  4RJX A;  3POR A;  4KRA A;  4C69 X;  3SYB A;  1H6S 1;  2K4T A;  4GCQ A;  4BUM X;  5JDP A;  3FYX A;  5PRN A;  2FGQ X;  4LSI A;  3T20 A;  2FGR A;  4D5U A;  4JFB A;  3HWB A;  4FRT A;  4FSP A; 
#chains in the Genus database with same CATH topology
 4FT6 A;  3SZD A;  1Q9F A;  1BH3 A;  3NSG A;  4N58 A;  4PJ0 O;  1T16 A;  2KXP A;  3BS0 A;  3VZT X;  2ZLD A;  3POU A;  2Y0L A;  3DA3 A;  4RJW A;  3SZV A;  4RL9 A;  5G39 A;  4FZN A;  3T0S A;  3V8U A;  2M06 A;  3AAA B;  3JCU O;  1MPF A;  4UB6 O;  4AUI A;  2J4U P;  1HXT A;  5GTH O;  4GCS A;  2F1V A;  4GHB A;  4AZL A;  2ZFG A;  4D65 A;  6PRN A;  4U9C A;  3K19 A;  1GFN A;  5FVN A;  8PRN A;  2MHL A;  4FUV A;  2X27 X;  3BRZ A;  2POR A;  3PGU A;  3PQU A;  3JTY A;  3POQ A;  1ZHW A;  4E1S A;  4FMS A;  2R88 A;  4G76 A;  3VE1 A;  4FSO A;  2QTK A;  4AKM A;  3LK3 B;  3VY8 X;  2IWW A;  2R8A A;  3UU2 A;  3LK3 A;  3PGR A;  4RLC A;  2PRN A;  2KZ7 B;  2XG6 A;  4FOZ A;  4UB8 O;  5KAI O;  3AA0 B;  2KZ7 A;  1QJ8 A;  3AA1 B;  3WU2 O;  5GTI O;  4LSH A;  3AA0 A;  2OMF A;  3AA1 A;  2XE5 A;  1MM4 A;  2KC0 A;  4FES A;  2R4N A;  2XE1 A;  3DA4 A;  3PRN A;  5DL5 A;  2LFU A;  3VE2 A;  1OSM A;  3QRC A;  3SYS A;  1T1L A;  2XE3 A;  3WI5 A;  2XTR A;  1HXU A;  1QJP A;  5ADX L;  3HW9 A;  3AAA A;  1BXW A;  4G75 A;  2WVP A;  2XMX A;  2YNK A;  4GF4 A;  2O4V A;  4O3W A;  3PGS A;  4O3Z A;  4CTD A;  1ZHX A;  3UPG A;  3KZI O;  4O49 A;  3C5O A;  3O0E A;  5AFU L;  4AYE C;  5ADX K;  5IYU A;  4RLB A;  2J1N A;  1GFO A;  5EE2 A;  2XE2 A;  5H2F O;  3A2S X;  7PRN A;  2AXT O;  2Y2X A;  4PUX A;  2W81 C;  3PF1 A;  1GFP A;  1Q9G A;  2ODJ A;  4LSE A;  3G7G A;  2N2M A;  1ZHT A;  4O3X B;  1PRN A;  1HXX A;  2ERV A;  2Y0H A;  4N74 A;  4QQ1 A;  2M07 A;  4GCP A;  5D5D A;  2Y0K A;  3VZU X;  3KVD D;  1P4T A;  3BRY A;  1ZHY A;  3LK2 B;  3NJT A;  4FRX A;  2WJR A;  3VZW X;  4AYD C;  2WJQ A;  5DL7 A;  4AKR B;  2XTQ A;  4KR8 A;  3DZM A;  1ORM A;  5DL8 A;  2GE4 A;  3TZG A;  4AKR A;  1PHO A;  4D64 A;  1S5L O;  1GFM A;  1BT9 A;  4AFK A;  3AA6 B;  3POX A;  3PQS A;  3DWN A;  3AA6 A;  4AYN A;  3AAE B;  3SY9 A;  5G26 A;  3EMN X;  5E79 O;  3AAE A;  4IL6 O;  3LK4 2;  3VY9 X;  2Y7S A;  4K3C A;  1YS5 A;  2JQY A;  2R89 A;  1GFQ A;  3T24 A;  1ZHZ A;  2YPV A;  1OPF A;  4LSF A;  1MM5 A;  1QJ9 A;  2F1T A;  2R4L A;  2LHF A;  3WI4 A;  4XNL A;  5DL6 A;  5TIS O;  4N59 A;  5B66 O;  5G3A A;  4JCH A;  2KXP B;  1E54 A;  2KDY A;  4FZM A;  4K3B A;  4KR4 A;  4O3Y A;  4O4U A;  4RJX A;  3SY7 A;  3POR A;  5AFU K;  4C4V B;  2IWV A;  4B61 A;  4KRA A;  4C4V A;  4FZL A;  5KAF O;  3RBH A;  4C69 X;  3HOL A;  1H6S 1;  4FQE A;  3LK2 A;  3SYB A;  2K4T A;  4E1T A;  3A0B O;  3UAQ A;  3A0H O;  4GCQ A;  4XNK A;  2MNH A;  4BUM X;  5JDP A;  3HOE A;  3FYX A;  1THQ A;  5GV0 A;  2X9K A;  5PRN A;  3LK4 1;  2FGQ X;  2N2L A;  1IZN B;  2F1C X;  4PR7 A;  4C00 A;  1IZN A;  2R4P A;  3GP6 A;  4LSI A;  4O4X A;  5B5E O;  3T20 A;  4AYI D;  4AYM C;  3AA7 B;  3QRA A;  2FGR A;  4F4B A;  4FSP A;  3AA7 A;  2R4O A;  5G38 A;  4JFB A;  5T5F A;  4D5U A;  4Z3T A;  4N75 A;  3HWB A;  1G90 A;  2K0L A;  2JMM A;  2W80 C;  4FRT A;  3DWO X; 
#chains in the Genus database with same CATH homology
 4FT6 A;  3SZD A;  1Q9F A;  1BH3 A;  3NSG A;  4N58 A;  2KXP A;  3VZT X;  2ZLD A;  3POU A;  2Y0L A;  3DA3 A;  4RJW A;  3SZV A;  4RL9 A;  4FZN A;  3T0S A;  3V8U A;  2M06 A;  3AAA B;  1MPF A;  4AUI A;  2J4U P;  1HXT A;  4GCS A;  2F1V A;  4GHB A;  4AZL A;  2ZFG A;  4D65 A;  4U9C A;  3K19 A;  1GFN A;  5FVN A;  8PRN A;  2MHL A;  4FUV A;  2X27 X;  2POR A;  3PQU A;  3JTY A;  3POQ A;  1ZHW A;  4E1S A;  4FMS A;  4G76 A;  3VE1 A;  4AKM A;  4FSO A;  2QTK A;  3LK3 B;  3VY8 X;  3UU2 A;  3LK3 A;  4RLC A;  2XG6 A;  2PRN A;  2KZ7 B;  4FOZ A;  3AA0 B;  2KZ7 A;  1QJ8 A;  3AA1 B;  4LSH A;  3AA0 A;  2OMF A;  3AA1 A;  2XE5 A;  1MM4 A;  2KC0 A;  4FES A;  2XE1 A;  3DA4 A;  3PRN A;  5DL5 A;  2LFU A;  3VE2 A;  1OSM A;  3QRC A;  3SYS A;  2XE3 A;  3WI5 A;  2XTR A;  1HXU A;  1QJP A;  5ADX L;  3HW9 A;  3AAA A;  1BXW A;  4G75 A;  2YNK A;  2XMX A;  4GF4 A;  2O4V A;  4O3W A;  4O3Z A;  1ZHX A;  3UPG A;  4O49 A;  3C5O A;  3O0E A;  5AFU L;  4AYE C;  5ADX K;  5IYU A;  4RLB A;  2J1N A;  1GFO A;  5EE2 A;  2XE2 A;  3A2S X;  7PRN A;  2Y2X A;  4PUX A;  2W81 C;  1GFP A;  1Q9G A;  2ODJ A;  4LSE A;  3G7G A;  2N2M A;  1ZHT A;  4O3X B;  1PRN A;  1HXX A;  2ERV A;  2Y0H A;  4QQ1 A;  2M07 A;  4GCP A;  5D5D A;  2Y0K A;  3VZU X;  3KVD D;  1P4T A;  3LK2 B;  1ZHY A;  4FRX A;  3VZW X;  4AYD C;  6PRN A;  5DL7 A;  4AKR B;  2XTQ A;  4KR8 A;  3TZG A;  1ORM A;  5DL8 A;  2GE4 A;  4AKR A;  4D64 A;  1PHO A;  1GFM A;  1BT9 A;  4AFK A;  3AA6 B;  3POX A;  3PQS A;  3AA6 A;  4AYN A;  3AAE B;  3SY9 A;  5G26 A;  3EMN X;  3AAE A;  3LK4 2;  3VY9 X;  2Y7S A;  1YS5 A;  1GFQ A;  3T24 A;  1ZHZ A;  2YPV A;  1OPF A;  4LSF A;  1MM5 A;  1QJ9 A;  2F1T A;  2LHF A;  3WI4 A;  4XNL A;  5DL6 A;  4N59 A;  4JCH A;  2KXP B;  1E54 A;  2KDY A;  4FZM A;  4KR4 A;  4O3Y A;  4O4U A;  4RJX A;  3SY7 A;  5AFU K;  3POR A;  4B61 A;  4KRA A;  4FZL A;  3RBH A;  4C69 X;  3HOL A;  1H6S 1;  3SYB A;  3LK2 A;  2K4T A;  4E1T A;  3UAQ A;  4GCQ A;  4XNK A;  4BUM X;  2MNH A;  5JDP A;  3HOE A;  3FYX A;  1THQ A;  5GV0 A;  5PRN A;  3LK4 1;  2FGQ X;  2N2L A;  1IZN B;  1IZN A;  3GP6 A;  4LSI A;  4O4X A;  3T20 A;  4AYI D;  4AYM C;  3AA7 B;  3QRA A;  2FGR A;  4F4B A;  3AA7 A;  4D5U A;  4JFB A;  5T5F A;  4Z3T A;  1G90 A;  3HWB A;  2K0L A;  2JMM A;  2W80 C;  4FRT A;  4FSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...