4BUPA

A novel route to product specificity in the suv4-20 family of histone h4k20 methyltransferases
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
232
Chain Sequence
GSHMSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1
publication title A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 73
structure length 232
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bupA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4bupA02
3MO0A 3OXLA 3DB5A 4C1QA 1MUFA 3CBMA 5CPRB 4MI5A 4AU7A 3EP0A 5JIYA 3MO2A 5KJNA 4YNMA 3CBOA 4MI0A 1PEGA 3F9WA 4Z4PA 3M5AA 3F9ZA 4BUPA 5JINA 4FMUA 5TTFA 3DALA 3IHXA 3PDNA 5EX3A 4I51A 3OXFA 3QWWA 4J8OA 3M53A 5HI7A 2W5YA 2W5ZA 5TH7A 3BO5A 3VV0A 4JLGA 3M56A 3VUZA 3OXGA 4E47A 5F6KC 2IGQA 5ARGA 3OS5A 4YNPA 3S7FA 2O8JA 3S7BA 3TG4A 3K5KA 5TEGA 1O9SA 4WUYA 4YPAA 4H12A 3M55A 3MEKA 3M59A 5CCLA 5F59A 5EG2A 3M57A 3S7JA 1MVXA 2RFIA 4QENA 5T0MA 4YPEA 3RQ4A 3KMJA 3CBPA 5HQ8A 2R3AA 4J7FA 1MT6A 5KJLA 3RAYA 3SWCA 2BQZA 5JHNA 4J83A 3S8PA 1ZKKA 3F9XA 4JDSA 4NVQA 5JJ0A 3M54A 3QWPA 4YNDA 2QPWA 5EX0A 3RU0A 3HNAA 5F6LA 5T0KA 3KMTA 3OPEA 4QEPA 5CCMA 3SW9A 1ML9A 5T5GA 5LSXA 4NJ5A 3QWVA 4IJDA 1N6AA 3MO5A 4QEOA 5LSZA 2JV0A 3OOIA 5ARFA 4RZ0A 4IJ8A 1MVHA 3TG5A 3M58A 1H3IA 3KMAA 1XQHA 3F9YA 2G46A 4LDGA 4O6FA 3S7DA 3N71A 4YPUA 2F69A 4O30A 5KJMA 3FPDA 3RJWA 5F5EA 5KJKA 4J7IA 1N3JA 1N6CA 3RIBA 5AYFA
chains in the Genus database with same CATH superfamily
3C18A 3MO0A 3KEYA 4AWXB 3HOVJ 2VXDA 4CCLA 3LSRA 1Y8QB 3TDZC 4AU7A 1WHUA 4RB1A 1X4PA 3SHFA 2ZKZA 3DF8A 1LDJA 2M87A 5DD8A 4J00A 2G7HA 4M74A 2VASA 3MFKA 1QZEA 1FYLA 4ETSA 5KAFC 3HSEA 2JTVA 1FJLA 2E36A 1JTYA 2V79A 4I99C 1FOWA 2EQRA 1TQMA 1UB9A 1ZG3A 1BI3A 3HOUJ 3FXLA 4KUMA 5EEAA 4HG2A 4U7DA 1EKEA 2J5PA 1RUNA 2HQNA 3ZMTA 1J0RA 3QAHA 3A03A 3WU2C 2DMNA 1AWCA 2HVRA 2XAHA 4UV8A 1UHWA 2FD5A 2JRMA 4G8XA 2FE3A 3ZR8X 2H8RA 4P55A 4M9XA 1FBSA 3MQ0A 3OYLA 2EIJH 2LR8A 4LB5A 2Z5UA 3S7BA 2VONA 5C4JJ 2XUBA 3HKZA 3MEKA 3M1EA 5F59A 5HNFA 1R4MB 5EG2A 2BEOA 1B6AA 2QUFA 1S7AA 2HKXA 1MVXA 4B48A 2RFIA 5CVUA 3OYIA 2Y0SN 2VPRA 2CU7A 4BY7J 1YJWI 4NQWB 2Q8KA 4M9ZA 1YOVB 2WADA 2RKHA 2CW8A 1VQ6I 2DA2A 3QPTA 3N4MA 1MMDA 3CMMA 3ZGKA 3PNYA 2IPQX 5JLWA 2W4SA 4ENMA 3ZPLA 2AXTC 1OFCX 2VT3A 5F1RA 4WCGA 5FKLA 2VBZA 3K7AJ 2K27A 1FZPB 3HJEA 2Z2SB 4IHWA 5E8IA 4Y33A 1HLVA 1ML9A 5T5GA 2MFZA 1OYIA 1YJ9I 3MO5A 2ELHA 1NTCA 1ZARA 2DFEA 2XIGA 4WF2A 3ELKA 4XLFA 4CDGA 4DZPA 1YRNB 4QEOA 3CO7C 3BR3A 3GTMJ 4D7NA 3M58A 3SFIA 5DTDA 1JGGA 1KU7A 5F1JA 1IXCA 4HW0A 3WTZA 2V4JC 1SFXA 2ZBKA 5IP7J 5FJ8J 4ZYAA 1DP3A 1SANA 1Y8RB 3FDYA 1ETWA 1YLFA 2CW0F 2J5OA 1AKHA 2QVOA 1BI2A 1Y56A 2DMUA 3ZQIA 4FCYA 4N4OB 3ZN1A 3RIBA 4RLQA 3D5RC 2XF7A 3ABTA 1RETA 3ULQB 1YX5A 2KJBA 3U1DA 5LHHA 1ZH5A 3HXLA 1SAXA 2WV0A 4ZTJA 2VLAA 4BBSJ 3MO2A 4B43A 2JVHA 1YITI 3AG1H 4C2MJ 3I56I 4FISA 4HQMA 3E6DA 1IAWA 1X58A 3RPQA 2E60A 2AO9A 5LFAA 3IWFA 2ADUA 3S3OA 3DEEA 1IO2A 2QQ9A 3TP3A 4HV5A 4U0WA 2BV6A 2XC7A 4IHSA 3PO2J 2E2IJ 2DJNA 1Z1DA 4RA2A 2K5CA 2R3SA 2L9RA 1VTNC 1TLHB 5M5YJ 2RV8A 3FKJA 2DCEA 2HEOA 4Y4RA 3ZQFA 1G6NA 1ETOA 2E5ZA 2YPRA 4KIFA 4LMYA 3S7FA 4LIUA 3RSNA 4DYQA 4KA4A 4XRFA 2O8JA 4UUSB 2M34A 4XKWA 5BNGA 1R49A 3K5KA 2YR2A 1I5ZA 5IT9K 1S72I 3FF5A 3MWMA 3WHCA 2DA5A 4GXOA 2VOPA 3HGGA 2OCEA 4HX4A 3BWGA 1F1ZA 1U8RA 5DCMB 2P6TA 4CCOA 3FMSA 2BQZA 1NG6A 2QCOA 5LHGA 3S1MJ 2V7FA 2JVGA 3B02A 1MH4A 2CH0A 3S15J 2FF4A 1B4AA 3E6MA 4LD5A 3BZCA 2P4WA 3LSIA 4BEHB 2AXLA 3BQYA 4GRIA 2HOSA 2QQAA 2P7VB 3DQVC 4RLFA 1HOMA 5IY5H 1H9GA 4L0ZB 2EBIA 3FXKA 4IEJA 4D7MA 4FTHA 3HUGA 2CUZA 3HPHA 1KA8A 2XRLA 3NWTA 2QLZA 4WX9A 4UY8I 3COAC 3BTIA 3SZTA 4A12A 2DT7B 2X9DA 4XKVA 4AM3A 2YU9J 2AS5F 1NK2P 2VKVA 1FP2A 2YX4A 4ABZA 5LRSA 4E7SA 1APLC 1W1WE 5J47A 2F5VA 2HVSA 4H4KC 5CLSA 1W4MA 2BY2A 4AIHA 1PP7U 1JJ6C 4F92B 3FXQA 2F69A 4KMFA 5E1WA 2IBDA 1Y39A 2F4IA 3L2VA 3H92A 4CCNA 2EA4A 2OV7A 5EYRA 4IRHA 2ZFUA 4JX4A 2TCTA 2DA6A 4H0EA 3Q0VA 3QYEA 4Q48A 2EFQA 4Y17A 1TBXA 1Z3YA 4HF0A 3RYPA 3ABLH 4B3AA 4CH7A 1W7PB 3HTUA 2LD5A 1REPC 3PQKA 1R9TJ 3F21A 1KU2A 2L01A 3V4GA 3W6KB 3G71I 1YX3A 1QZYA 3LWFA 1N78A 3CDIA 3CBOA 1W5CC 1B8IA 2F4MB 2IA2A 5A2QZ 3S1QJ 3K1MA 3JRHA 5ILUA 1X1PA 4BBRJ 5L3BA 3HOWJ 3MKZA 1ZELA 2I10A 3CCRI 3HYIA 4BXFA 4G7HF 1MJ9A 1P9QC 2ZNZA 1FSHA 4A0ZA 1LEAA 2IS6A 2M8GX 2NNNA 2XAGA 2VBXA 3HM5A 2FMYA 4LIVA 4DNCA 1MJBA 3MZHA 4XLCA 2FEZA 2R7OA 2M3AA 3CZ6A 2IGQA 2G9WA 3VYTB 1XSXA 2WA0A 3PNVA 2PJPA 2JA7J 3KEOA 1KYZA 4U87A 3OIOA 4B4CA 2Y0SA 5DM7F 5L3EA 3BR6A 4UNOA 4YPAA 2IGKA 5FRMA 2KHMA 3D5LA 4G9YA 2BVLA 2F6CA 3KZYA 2QYOA 3FXUA 3S93A 5TJJA 4G12A 2EB7A 3I4NJ 1WKMA 1HF0A 4NHJA 5HQ8A 1QPMA 2A61A 1J09A 1LEBA 3RKWA 5JHNA 3O8GA 2B0LA 1CGPA 2A6TA 4IHYA 2A5YB 3F9XA 4BU2A 2ZC2A 4JDSA 1TTYA 3M9AA 2VE9A 2Y0MA 2L0KA 2MG4A 5HS8A 2CV1A 1VQ8I 3BCAA 2A6HF 4OU0A 1RUOA 3ONQA 4XOPA 4EQQA 3GTPJ 3KP2A 4ASNA 2BY3A 3GLLA 2K02A 2IS1A 1VNDA 2YS9A 3C1DA 2KRFA 4BHPA 5D6FA 1G4DA 4IZZA 3S14J 1ETVA 2LREA 4W1UA 3F6OA 3SDBA 1QVUA 1WRJA 3EUKL 4RAGA 2RNJA 1S8NA 5BPIA 3OYNA 2X48A 3RZOJ 4PGGA 3H36A 2GXGA 5DEQA 5HVQC 1FOXA 1V5EA 1BN5A 2QSFX 2X6WA 5J4VA 3DP7A 4IQ4A 5FD5A 4EM2A 4E4HA 4EJWA 1PVEA 2DAOA 2CSOA 4B47A 3R61A 5K5RA 3GXOA 2VOOA 2OU2A 1ZHFA 4BHBA 1P92A 1FBUA 4IHTA 3RJWA 1X1AA 1J75A 1D1AA 3DLLF 1SFEA 2EILH 1N3JA 5AYFA 3E1SA 1SEUA 4FQGA 5ERIA 5EG0B 1MUFA 3BT9A 3FKIJ 1QRYA 1ODDA 2QBYB 1OCZH 4EATA 3EP0A 5JIYA 1JHFA 5LBQA 3Q9VA 4MIMA 3R4KA 3IKTA 4BGDA 1LVAA 1YW7A 4ON0A 5FLXZ 1TW3A 1PEGA 3JSOA 1FMWA 2IAIA 4YELA 3M5AA 5HOOA 2EFOA 1V54H 3DALA 3IHXA 5D4RA 3D0SA 4FHTA 3OXFA 2RQQA 4J01A 2DOEA 2E35A 4XRMA 2W5ZA 3RJPA 1MH3A 3AKZA 4YFXF 2LSOA 2Y30A 5E3LA 4O5VA 1TZLA 1R22A 1ONVA 5B1AH 2HYGD 4B8XA 1JGSA 5D5VB 2ESHA 5JHFA 1EV7A 4IF4A 1GLNA 2DMPA 3JRDA 1A35A 1AOYA 3SFZA 3HIFA 5CQGA 3TKYA 5ICCA 5C3EJ 3LL7A 3GYHX 2MBFA 3M55A 5KK1A 4HNVA 1X1BA 3LAJA 2P5LC 4R1HA 2GXAA 3F72A 1MBJA 2P6SA 1RR8C 3O8HA 4UUTA 3R0JA 3ERMA 3RDIA 4OAYA 4UHTA 5HODA 1TWCJ 3IHUA 4BJTA 3FK7A 4A2UA 3E7LA 2A69F 4MFDA 3IH2A 5GAEJ 3CCYA 2M1BA 1TWAJ 4RM3A 2VT2A 3GTKJ 1FYKA 3G3ZA 1DUXC 2N8GA 1VQLI 4D5CA 1LDKB 1SD7A 4ESBA 5GTHC 2IRFG 1GV5A 1VQ5I 2NOJB 1RKTA 1SD6A 1A6QA 3VFZA 3NAUA 2HDCA 3TW6A 1G3TA 2L7ZA 3KIOA 3EYYA 3ZQQA 5FKNA 3W6VA 5ARFA 3MCZA 1IDYA 1FTZA 4CCJA 3GFJA 3ZMDA 1H3IA 1IRFA 2ZXWH 3BTLA 3OL3A 2G46A 1OQYA 1OYWA 3OWTA 5LGTA 4A3KJ 2WAQN 3QP6A 3L2QA 3S1NJ 3H9QA 4L9TA 4BY1J 4IKFA 2KQRA 1WGXA 2NVYJ 4QIWN 1U0JA 3JAMZ 2DU9A 1W5SA 3F23A 2DDBA 4LG0B 2L02A 4A5NA 2B7EA 2ELJA 2GOMA 4NUBA 1F36A 3QRFF 2RREA 2OQGA 1FWZA 4FE7A 1T08B 3QU6A 4RAYA 4A3JJ 1PUEE 4MGRA 3DBLB 2ZJPF 2NNYA 3EUHA 5B3SH 4L5IA 2BY0A 4KDPA 3F9ZA 3KYDB 1K78A 4FMUA 2VBWA 3H0GJ 2FX0A 1J9IA 1GXPA 2JQ7A 3C2GA 3IC7A 2IT0A 2CO5A 1ZG5A 2DFFA 3FWEA 4J8OA 3IUOA 2HZTA 3KETA 4HZFA 5TH7A 3WU0A 1MMGA 1UFMA 3M8EA 3CUQB 4JK1X 1W5TA 2HXIA 2R7ZJ 1K61A 2CQKA 1QVTA 3PUFA 5E1XA 5E18F 1RRJA 2HTJA 3H5AA 1GVJA 4A3DJ 3OS5A 4ENNA 3F9KA 1JUMA 1S7EA 4GO1A 2FNAA 4YNPA 1WH7A 2V9VA 2EJRA 3PIPF 2KP6A 1HXDA 4L9JA 2JA8J 3TO6A 3OYGA 4ZC3A 3KZIC 3P5JA 4U0VA 5E3MA 3V7CA 1OPCA 4HNUA 4EGYA 5M5WJ 5JVTA 2RN7A 4Y7NJ 2WY7Q 5E3OA 1YW8A 1XMKA 2V26A 4M3DA 1B72A 1KQ0A 1K6YA 2CW7A 2XAUA 3HRUA 4DZJA 2HOTA 1Q1VA 1ETQA 3CMEI 1B9MA 4XLEA 2VE8A 1AKHB 1Z7LA 1OISA 1V5FA 2KT0A 4PCQA 2BXYA 1WJDA 4CYCB 3TGNA 2W00A 1TT0A 1YYVA 1SVLA 5HS9A 2BW3A 4L9VA 1IG7A 3K4NA 1FBQA 3ECHA 5LSZA 1P4AA 3I53A 3WTTC 3DPLC 1G3WA 2EFNA 2GXBA 1XQHA 2XROA 4TV7A 4ZYEA 4WXHA 1ZKGA 4B09A 3K69A 2IVMA 3CCMI 4PJ0C 3IL2A 4EVIA 2X51A 5L3GA 4E70A 4JQFA 4A6EA 1I6XA 5EZGA 1O3TA 2QSGX 2HQ5A 2M2EA 1PDNC 1KU9A 2IS4A 1FEXA 1ZN2A 2EIMH 2LC2A 3GVAA 3KE2A 2PJRA 3RKXA 3TO9A 3BR1A 1IW7F 2CUEA 4DYRA 2GAUA 2VJIA 4ESJA 4I6ZA 1LVKA 2ZSIB 3L00A 4NC7A 1RC9A 2NVUB 2DT6A 3KLNA 1T33A 4II2A 1T0FC 2GIZA 2LBFB 5JINA 1R6RA 5KCMA 1U2WA 4OINF 4M3FA 5E3NA 2A68F 2Q2EB 3I64A 1KQ8A 2STTA 2K86A 3TMOA 4PSWA 2BHYA 2CMPA 1BI1A 3LSGA 2DJIA 2P7CB 4IOAF 1QGPA 1IZ1A 3DLAA 1W0TA 2M0MA 2CQNA 4IX7A 3VUZA 4KIBA 3OXGA 5F64A 2FBHA 3BR5A 4XMYA 1RNLA 2M8EA 3AG3H 2AQFA 1CQTA 4F93B 3M07A 4BAYA 1YW9A 3I4PA 1POGA 2VL8A 4HA8A 1O9SA 3SZPA 4H12A 3OYFA 3VYRB 2KRCA 2DOFA 4NB5A 2F48A 4RDUA 3LQRA 1LE8A 3FK6A 3RIRA 4BHCA 4CA0A 2XV4S 2Z16A 1VQKI 4XOTA 2ICWG 4KITB 3CBPA 3WTSC 2NS0A 4C30A 2R3AA 4J7FA 4HOBA 3Q3SA 1F43A 2L3DA 2JUGA 2GIVA 2E7WA 5K7HA 4HF2A 2AHQA 2PI0A 3AG4H 5IYDJ 6PAXA 1MBEA 1SFUA 2X85A 2B63J 3PJRA 2M5WA 4ZTFA 3HOZJ 3SZGA 5IYBJ 2R7UA 3KCCA 4G6QA 1AHDP 4KN4X 2VKHA 4IRIA 2QPWA 3K70C 4ENKA 4M73A 2DA3A 3OYCA 3KMTA 3A2KA 4M6YA 4QTRA 2LTPA 2WAQA 4KJZA 1HC8A 1ZGWA 1LFUP 1CF7B 3QWLA 3ABKH 2A3SA 3PFYA 4DJAA 5A2QK 4BE0A 1MIJA 1OCPA 1UG2A 2VI6A 4D5FA 4XK4A 1MNEA 1L0OC 2FQ4A 3GX4X 4PUSA 1MW7A 4RGUA 4ZH4F 5BS6A 1S29A 3OR1C 4AC0A 4OMZA 5L3CA 1YO5C 2LKXA 3SJMA 4AYBN 2KISA 3BJOA 2HPMA 2B9SA 4A0XA 2XGXA 2BHZA 2LMDA 5EEHA 3H3VK 3C2HA 3WGHA 2BE5F 1WJBA 1G8XA 1PYVA 3DPUA 3R60A 4XM3A 4Y13A 3I4MJ 4MI5A 2R7RA 1RZ4A 1GUUA 4BH9A 2D1HA 1P7IA 1OYYA 5DUIA 2XRNA 5EGOA 3ECOA 1WSUA 2ZJQF 2IJLA 3A0BC 3M8FA 2UV1A 1NG7A 2BGCA 1IXRC 3TP0A 5AONA 5FLVA 2ECBA 3OYDA 3IWZA 2LY2A 4HDVA 4LG3A 3HL2A 3S17J 2KZVA 2O9LA 1FY7A 3IH3A 1PUFA 2JZYA 1O57A 3VYSB 3ESWB 5D6EA 5GADJ 3WTWC 3QYFA 2DFIA 4YG2F 3CMAI 2EFWA 5ARGA 2PBIA 5J1YA 3AG2H 2ZO4A 5CYVA 4E7HA 1R1VA 5BOXA 3CDLA 2W7NA 3F8NA 2FNPA 2IW5A 2HNHA 4QSHA 4WUYA 4JX6A 5L3FA 1B9NA 4FX0A 2DODA 3BPVA 4AIDA 1IUYA 3G2BA 1XC5A 1R7JA 1IN5A 2VKEA 2ZMEC 1EA3A 3BY6A 2MYSA 4DOZA 4EM1A 3F8BA 5DS9A 2DTZA 1H8AC 4OAZA 4O6JA 2OJED 5CVJA 3F3XA 4HX8A 1MT6A 2E71A 1TNTA 2FRHA 3K4JA 3F8FA 3QQAA 4A3LJ 1FIAA 3MKLA 3JR9A 1OR7A 3C3WA 3EQLF 1LJ9A 2IGOA 4AIKA 4HLYA 2NVTJ 2HGCA 1WVRA 2IEKA 2ZMEB 3P9CA 3VDXA 5FKKA 1STZA 2ISYA 3RU0A 3H9JA 2Z3YA 2QF7A 1HDDC 2DO7A 2R5YB 4UVAA 2X1EA 3I3LA 4BXUA 2H1LA 4C2UA 4QWQA 1BIAA 4XLAA 2DA1A 1YIJI 1U3EM 1A31A 2OTJI 2E1MC 3K1PA 1FNNA 1QA6A 5FLXK 4RZ0A 3KYCB 3QODA 1MVHA 3TG5A 3CUOA 5FO5A 1ZAOA 4EMSA 2LDUA 2ZXHA 1DPRA 3KX2A 4BACA 1HBXG 3BCBA 4BXXJ 3GFLA 3CLQA 1D1BA 3JTHA 3FXMA 2L2OA 1FOKA 2E1MB 4XLHA 1X3UA 4BJ5C 1VFCA 3OIPA 5HDNA 2YX7A 2VQCA 3AAFA 5GPCA 2D45A 4JX5A 5B5EC 3EYIA 5AIQA 3CCSI 3K4BA 1Y6IA 3GTQJ 5EF6A 1ZGJA 3FMQA 3GZNB 3FIWA 4MQ9F 3OIQA 1OLTA 4I01A 4P96A 3L2WA 1O3QA 3NQOA 4G94A 3PM1A 1Z3XA 4M72A 5IYCJ 4CXFA 2HOAA 1TP4A 4Y15A 3J81Z 1RIOH 4HV6A 1O7LA 1BI0A 5HDGA 4XRSA 2LFBA 3HDDA 1K4TA 2O61A 5TGTA 1J2XA 4BUPA 2DPUA 2FJ1A 3OYMA 4G6TB 3D5SC 2Y69H 3MAJA 3ZOBA 3M53A 1D5YA 2A07F 4DBQA 4P9UA 3K4KA 5E79C 2G7UA 2QKLB 4M3BA 3U21A 3CESA 1X3WB 3NRVA 5CVIA 1Z6TA 2A6EF 2G0EA 4I2OA 3I59A 3TBIA 4A3FJ 3J7YJ 3CJRB 2EV5A 1VQNI 2H1KA 4L0YB 1QHGA 1VQMI 4FT8A 2Q0OA 3JCUC 1UELB 3VSKA 1MDMB 2MLGA 5J1RA 1XX5A 1XDSA 3LOCA 4RAZA 2BZTA 2Z33A 3TOBA 3CJTB 1R23A 2V1NA 5D8KB 4F3QA 1BL0A 4RBOA 3OOUA 2ME6A 2EV6A 4P5OA 2NYXA 1AU7A 4PFPA 4DGWB 3X2QH 4GGGA 1T8IA 4UVCA 2O0YA 4Q5SF 4NQWA 4GYGA 1I27A 1IRGA 4E7ZA 3M54A 1MMNA 3DBRB 4UB8C 5FKOA 5CJ9A 3JAMK 2FUG2 3S32A 1W36C 1FLIA 3SXYA 4QPQA 4IPAA 4A3CJ 1A5JA 4XICA 2Z9OA 2HTSA 2HFHA 3A02A 2ID3A 4P1WA 3BROA 4Y52J 2HVQA 2QWWA 3K1NA 2GWRA 3T0YA 3QWVA 5LSXA 1K83J 2HR3A 3B6CA 3HPGA 3L7WA 3A01A 1RPWA 4IHVA 3BDDA 1UHSA 3E97A 2RGVA 2PMUA 3OOIA 4FETA 4OIRF 3Q9SA 5KAIC 2R93J 2BVMA 4AYBA 1T38A 1ETKA 1DDNA 1YRNA 4DQ2A 3TDUC 3E5UA 5D4SA 3H1CA 4N9IA 3V7RA 1KONA 2K9SA 1DPUA 3N71A 3GCMA 1ETYA 1XN7A 2NRAC 1R00A 4W97A 4AUXA 3RKQA 4KMUX 3VWBA 3VODA 4PJJA 3K4CA 3J7AY 2KIQA 2W82A 2TDXA 2PMHA 1JUPA 2F5CA 2MH2A 3IH4A 4I0AA 2VPLA 2VC0A 2F5FA 4PJMA 2W1OA 2K9NA 5EZHA 5LRRA 2JWTA 3CCUI 1NHAA 4XSZF 1X2NA 5HLGA 1JKOC 5FFZA 1IN4A 2ELKA 2JPBA 2H94A 2OZUA 1S9HA 2ZCWA 1HDPA 3RTRA 4D0PA 1G3YA 3W2VA 2L4AA 3FZVA 1I3AA 1FP1D 2PG4A 4V2FA 4BS9A 4A3GJ 3DBHB 4MQVA 3BZKA 1WJAA 1VQ9I 2XSJC 5ICEA 3S1RJ 2ACJA 1M1EB 2NAZA 4C3HJ 3JREA 3E5QA 3I58A 1MZBA 2L7FP 4NNJA 3R6SA 1T98A 3CP8A 4PSXA 2UWMA 3VEPA 2FU4A 2HU9A 2E1CA 2KFDA 1V5GA 4U0YA 1O3SA 2DQRA 2PFBA 3C7JA 1LNWA 2FOKA 3ZMVA 3H9GA 2E2HJ 1JTXA 4EEFG 1F5TA 2L9SA 1FC3A 3WU1B 2OF7A 1DGWY 1U5TC 3L2CA 4AVZA 1W7PD 3ISPA 5CCLA 3EDPA 2BW3B 1IN6A 4UUSA 4EV0A 1VQ7I 1OCOH 3WGGA 3LA2A 2JT1A 3UR3C 2H09A 2R7DA 1J7KA 2KZGA 1BJZA 2VJJA 5B66C 2DT5A 3IRQA 1LFBA 1R5HA 2JSPA 1U5TB 2PLYA 3G4SI 4I76A 5DCMA 1Z77A 3E5XA 5JFRA 5EEGA 3WTXC 3JRBA 2VN2A 3OYEA 3PL8A 1TT5B 2MW8A 5HLIA 1O7FA 1P2FA 5D8LB 1YTYA 1FMVA 4WK8F 1OKRA 1H88C 2LG4A 3UKGA 4CYDA 4BQOA 2ZJRF 1DP7P 3OPEA 4BEHA 1P4WA 3HSFA 1IV8A 3T8TA 3CCVI 5CCMA 2DLLA 1JKQC 1R36A 2KJCA 4DBRA 4F91B 3LMMA 2BBYA 2OCCH 4DYCA 2Y75A 1X3ZB 4ENJA 1HW2A 2NS7A 3IKVA 4Q4ZF 4MEXF 1VZ0A 1JJ8C 1YI2I 2LF8A 2EZHA 5ICFA 2XHKA 3T5XA 2VJ5A 4CZCA 2OBPA 1I1SA 4EGZA 4O6FA 1SVMA 3BG3A 4YRVA 3TEDA 4I09A 4DW6A 2XPVA 3H5RA 1WJ5A 1ON1A 3MZYA 3DKXA 2EIKH 2Q1ZB 4B1RA 5GAHJ 1OCRH 1L3LA 4BDYA 1EH7A 1XD7A 3F8MA 1AA7A 4ZDLA 3JTGA 1MKMA 3FISA 2PN6A 5CVRA 3ZMUA 2K4BA 1SMYF 1Z91A 1HSJA 1ON2A 3ZQLA 1XGOA 3PO3J 1WH5A 1YS6A 2ZXIA 4IO9F 2DA4A 2MD5A 5C4XJ 2QEXI 3PIOF 1IN8A 2K85A 4K2EA 3BG9A 3SEQA 3E0JB 1W7PA 4HX7A 4LFUA 4XR6A 4ZYGA 4MI0A 1LE8B 3LSTA 1WJFA 2DFHA 3OS0A 1NK3P 5BPDA 2K7LA 4GDFA 3G73A 4UUVA 2GQQA 2EK5A 1JI8A 1QPIA 1RR7A 2FA5A 2KIUA 2WC2A 5DCFA 5HI7A 2LY1A 2W5YA 2X1DA 2M7BA 2M0CA 3GFMA 3HHGA 3CC4I 3OYAA 3VV0A 3FM5A 5LHIA 2W25A 3EPZA 3GW2A 4LITA 4KNYA 4E47A 2VQLA 2EPFA 2L4MA 2M7AA 4A3BJ 4IL6C 1B1BA 1U9OA 1USSA 3LSHA 2WAEA 2XF5A 2LK2A 4A93J 2Y48A 2HZDA 5TEGA 2FQ3A 1Y0NA 4NBQA 4XQFA 2BXZA 4M9SA 2ZSHB 2QKMB 2CFXA 1Z21A 4M3GA 3KEQA 2CQQA 1LPQA 2UXXA 2IGNA 5JR3A 4E7JA 4S0HB 1E0EA 5LLQA 3KMJA 1WWXA 1MMSA 3LQQA 1S3JA 3CDHA 3LA3A 3S2WA 1T6SA 5LEKA 3QPLA 4ZYHA 2R7XA 3KP7A 1UCRA 2OZ6A 2XKPA 5TISC 1T39A 1BOBA 2OUMA 1R58A 2MH9A 4UVBA 4YFNF 1LQ1A 3K2AA 5T0KA 1FTTA 4II3A 2L5QA 3MD2A 4Z6YA 4QEPA 3IV5A 1PP8F 3OYBA 1HW5A 1Z0XA 2XDVA 4HBLA 3KP4A 4ZDPA 4B44A 3MKWB 2GM4A 3V42A 5BQTA 2I5UA 4X0GA 3I71A 1XTAA 2ZFWA 3JSPA 1Y1WJ 4EJTA 1HSTA 5H2FC 2O7OA 1LKXA 3FHNA 1YG2A 3K0LA 3LNQA 4KT6A 4S05A 1FX7A 1SFOJ 1WFXA 1PUFB 1R1UA 3WHBA 5IP9J 3W2AA 4RB0A 4E7IA 5F5EA 2CS3A 1E2XA 2JMWA 4NC8A 1ORKA 5GPAA 3F8CA 3SQNA 2W24A 3DTKA 4KN7X 4WXDA 2KLOA 2R7WA 4XL9A 2Z1DA 4AIJA 3N97A 3P9KA 1VQOI 1D0XA 2QBYA 2CJJA 1DGRM 2LKSA 3B73A 2BY1A 1XSVA 1OR7C 2E1NA 1FIPA 3O2PE 3OV8A 4EJVA 1R4NB 1WPKA 3ERED 2DYSH 2DBBA 3ZQHA 1MBHA 1MSEC 2E1OA 1EF4A 2JJ7A 1ACIA 2CV0A 4IOCF 4ANJA 1YFHA 1XGSA 3ZQ7A 1LB2A 1I3QJ 5ILSA 3ROUA 5KVRA 3KP6A 1VI0A 5IP6A 4XRSG 4CHUA 1R5GA 2C6YA 2L54A 1QO0D 4A0YA 3LSMA 3U9GA 2NS8A 2Z99A 3K4MA 3FMRA 1BIBA 1S5LC 1XPXA 3K9TA 2DI3A 5JI6A 3BOQA 4JP0A 1T95A 4HRIA 3GLXA 4NDLA 3PQJA 5LGNA 2HYJA 3HOTA 3K2ZA 2DN0A 4BDZA 4C2TA 3BJ6A 2TRTA 1BW5A 2R4GA 2R5ZA 4HAMA 2ISZA 1YE9A 1GVDA 3Q0UA 4RAFA 4XN3A 1U8BA 1YJNI 3JRCA 3OS1A 2DOAA 1HW1A 4AVPA 3SWCA 3G1OA 3LAPA 3AL0C 4WWCA 2KPMA 3FBIB 2H6CA 4MNUA 3A4CA 2EZLA 2PQ8A 1HCRA 4NVQA 3DU5A 4M3EA 1XG1A 3NEUA 2W84A 3H5NA 3JRFA 5KHDA 2K9LA 3OL4A 3HUGB 4BYYA 1K79A 5ED4A 5F6LA 9ANTA 3OY9A 3T8RA 3U2RA 4IJAA 3RKYA 3GBGA 2UZKA 2E7XA 3AL0B 4NC6A 2QGUA 3ABMH 1IUFA 1QNTA 4JBAA 3SW9A 4RM2A 3KFWX 3J81K 4I7HA 3QOPA 4KIGA 1JUSA 2JUCA 3CC2I 3H35A 4G6DA 2P5KA 4J19A 1X4OA 2V9KA 1IF1A 3V7SA 3F9YA 2XKOA 3L2RA 4LK1F 4A69C 4XN0A 5GAGJ 2VXZA 4XNFA 2DA7A 1XS9A 4XLPF 3MKYB 2WB1N 4N9HA 1U78A 3O3KA 1WZ2A 2V9PA 3WG9A 3HZJA 1SC7A 4CO8A 2VQGA 1A6IA 1SD4A 3T1BA 3HTSB 1WJCA 4YIIA 4N4NB 1N6CA 1G59A 3BG5A 3GZ6A 3IAM2 3CBMA 3I59B 5B1BH 3BG7A 3LSPA 2R92J 1BR4A 1B8IB 1FOYA 1K4SA 4LG0A 1I6HJ 2KIMA 1LUJB 3CCEI 3PSIA 3CC7I 3G1MA 2CUFA 1V55H 2HDWA 3CD6I 3GTOJ 4BE1A 1FYMA 2PMZN 3QWWA 4L18B 2BOLA 2OC6A 1XCBA 4LB6B 4GYIA 3WGIA 1DU6A 1ZQ3P 2P81A 2KDZA 1N25A 1ZK8A 5HNHA 4RB3C 4L9NA 2Y2ZA 4PJNA 3FXOA 4PK4A 1ZTRA 2VBYA 4PDKA 3GO5A 3H0DA 1ZRCA 1B59A 1YS7A 3CUQA 4XKCA 3VYUB 2DTRA 2W85A 5K5QA 2LNBA 2XPUA 3GWZA 1XMAA 2COMA 2F5EA 3HSRA 1WI3A 1UG0A 1BBYA 3DEWA 3FBNB 2E19A 2FMLA 2QQ8A 2VKDA 3A01B 1IDZA 2RNGA 5F0CA 1F9NA 2JA2A 1SD5A 3WTVC 3S16J 3H3ZA 2VODA 1WQ2A 2ZNYA 3CCLI 1TQIA 5KJLA 5E20A 3L09A 2GBYA 3K6GA 4R79A 1ZKKA 1DU0A 2P0WA 1GDTA 2BYVE 2LF7A 3OSGA 2JSCA 5L3DA 2VUMJ 4D9JA 2XB0X 3Q0WA 1YQAA 2QENA 3IAS2 3LA7A 2JPCA 3BQZA 4RMNA 1ZGAA 2ZXJA 1U6GA 2LLKA 3OOPA 1FT9A 4XLNF 2YSRA 1IRXA 3M3YJ 2X6OA 2DK5A 2MD0A 3L9FA 4ZJZA 4CYCA 3OSFA 3TQNA 2V1DA 1Z05A 4UXNA 5K7FA 2V1XA 2EWNA 1MNDA 1ZR4A 4RGSA 3HOXJ 2E34A 2KKOA 2O03A 4HYEA 5FRNA 1BR1A 2OQRA 1UJ8A 1YHQI 2GA2A 1KQ9A 5LGUA 2HYFA 2QM3A 3VB2A 3ABUA 2OTLI 2F4OB 4ZZLA 5GP9A 1O3RA 3M7GA 3DV8A 2FBIA 2IXSA 2W48A 4MLOA 1D0YA 3WODF 3J80Z 2LOOA 4LLLA 2EH3A 3JW4A 3TO7A 3V8KA 2NVQJ 2QA4I 3QPSA 3M1CA 5LEJA 2K9MA 1ZG1A 1UAAA 2DW4A 3BG6A 1O4XA 5D5XB 2D2WA 1ETXA 2MGQA 1MSFC 2L9VA 2VJ4A 1TQPA 1P7JA 5TTFA 2KL4A 3HBLA 3K70D 2HXOA 5EX3A 3L1PA 2EV0A 4I51A 3HB9A 3C2BA 3FX3A 4XONA 2LBFA 4A6DA 2JA5J 2HKOA 3NWSA 3DEUA 3DKYA 2Q2EA 1G3SA 5F27A 4C3IJ 4OWRB 5CQEA 1JT0A 4HSTA 3RPUD 4CUGA 5J6XA 3REOA 2DPDA 4MO7A 3GMEA 1ZR2A 4M6VA 2MA3A 1XCVA 1JT6A 3CTAA 5F6KC 4Q47A 2JK3A 3EUAA 1MBKA 2MC3A 1T0FA 2CGPA 4HF1A 1QU3A 1I50J 2CG4A 3JRAA 1BA5A 4MFEA 1HKQA 1BM9A 2L7KA 3ZXSA 1UMQA 4OIQF 3MMYB 5JLXA 1KYWA 4IQJA 2X6YA 2XASA 3W6JB 1R71A 3OS2A 4LOCA 5DYMA 3PNTA 2H27A 2DMQA 3DTIA 1X2MA 5D5WB 5T0MA 3HEFA 1UZCA 1Z9CA 3OMYA 4ZYDA 4CSWA 1IN7A 4MTEA 2LYCA 3HHHA 3JRIA 3RAYA 4YEJA 4C9YA 3P9IA 5DV5A 5H6RA 4FASD 1D1CA 4QLCU 1ZLJA 2HQAA 1SVOA 1GT0C 3PFIA 2CUJA 4XSXF 5J40A 4CCMA 5F0HA 1VQPI 5EX0A 3HC7A 3V8JA 2STWA 3HNAA 2DK8A 3O6BB 2ME0A 3QPHA 3HRTA 2XGCA 4O3MA 3HGYA 4X1EA 1QBJA 2UUZA 2DXIA 3A1YA 3I5UA 2IS2A 2HI3A 2QQBA 5IOYA 2WB1A 2O3FA 4E7KA 1TWHJ 1ITYA 1N75A 3B6AA 2COBA 4MTDA 4IRGA 2K40A 3BR2A 1CF7A 4HDUA 1HQCA 2DQLA 2QZ8A 1WJEA 4KFCA 2M30A 4LDGA 1XGMA 5H6QA 5F0FA 3S7DA 3FXJA 4O30A 1XSDA 3BR0A 3EUHC 2AQEA 5KJMA 4PGHA 2JA6J 1D0ZA 2DDAA 3RPUA 1Y0UA 2WV1A 2RDPA 3RZDJ 2IA0A 3KZZA 2M4GA 4CICA 2OA4A 2V6EA 1G2HA 2PMZA 2KMUA 3GF2A 2M9HA 4LJZF 1LFPA 5GTIC 1D3YA 3Q5FA 2ESNA 1J5YA 1ZRDA 4BJ6C 1K78B 2NXNB 2D5VA 5E17F 3G1LA 4RGRA 1K6OA 3CJNA 3FM3A 3MVPA 5H20A 2NOGA 2R0QC 1J59A 1H9TA 4LK0F 4DIQA 1EJ9A 2LRDA 3PDNA 3F22A 2LY9A 1IC8A 4C3JJ 3FXRA 1XMXA 2WBMA 5FROA 3OYJA 3BO5A 1OCTC 4JLGA 2X1CA 1E3PA 3CCQI 5JVGF 2L7MP 2X4HA 3G6EI 2F2EA 2O8XA 1ZLKA 1F4KA 1T2KA 2XVCA 3DPTA 2YUSA 3PSFA 2EFPA 2LKPA 2NVXJ 2DMTA 3TG4A 1X1CA 2CQXA 3GEZA 3CJQB 4PFOA 1EH8A 5EDNA 2HDDA 3M59A 4PJLA 4L5EA 2P5VA 3BJAA 1B72B 3E3VA 3VOEA 4KISA 3S7JA 4S04A 1TL8A 1ZREA 3TL4X 4QENA 4YPEA 4A3EJ 2XF6A 1C0WA 5HS7A 2IA1A 4RGXA 4GCVA 4J83A 3S8PA 3I54A 1XB4A 2QSHX 1IV6A 5JJ0A 3ZMZA 4CCKA 2WAFA 1A04A 2CQ7A 3RYRA 3WE3A 4YIRX 1D8JA 4YNDA 3HOSA 5TRDA 2FXAA 1JXSA 3CP2A 2ZMEA 3MZ8A 2CV2A 3BPXA 5FKMA 1ZYRF 2M4KA 2V6CA 5FGMA 3DFGA 1VQ4I 2E2JJ 3V8LA 3K4LA 4HNTA 1MNMC 5IT9Z 2PEXA 3LSKA 4XORA 2XAJA 1N77A 2K4JA 2R5YA 1Z67A 3I9V2 4LLGF 1OMIA 4IHXA 3ZN0A 4BE2A 3GFIA 1D8KA 3LFUA 3TW7A 2KRHA 1Z6RA 2R7QA 3K10A 1RESA 1QZZA 2W57A 4OMYA 4YPUA 2I8DA 1IGNA 1HKSA 3NARA 3QOEA 1MMAA 1KZHA 3ZMSA 5HDKA 2V1UA 4KYWA 4CGZA 1KU3A 2VB6A 3FPDA 3DU6A 2P8TA 1U9NA 2XAQA 3A0HC 4UV9A 2PX9A 1MBFA 3CLOA 2PJRB 4B3XA 5HLTA 5KJKA 4J7IA 1OJLA 1I39A 3FHZA 5K5OA 5IOZA 3DB5A 5BMZA 2FSWA 5CPRB 4E7LA 1X1DA 5CKTA 3W3CA 3BLYA 4R8HA 2K3PA 1HKTA 3ZRGA 5ILVA 2XSDC 1Q1HA 2OPTA 4YIFA 1E3HA 5FB2A 4ESFA 1QQIA 2ZJ2A 2XAFA 4HLXA 3SYTA 5KJNA 1BR2A 2XGDA 2R5ZB 2KDOA 1Z7UA 3CF2A 3SEZA 4F7ZA 4Z4PA 4I0BA 1W36D 1IJWC 4ZZDA 5DDGA 2A5WA 4D1QA 4G7OF 4F55A 3WTYC 3ZQGA 5LD2C 3HOYJ 3GUDA 2EZIA 2CFOA 3LFKA 5DUKA 3KP5A 1ULYA 1PJRA 2D1VA 4XKBA 2XPWA 2L9NA 3HG9A 3M56A 2R7FA 2HWVA 3ZQCA 4JYKA 5F6FA 2LP0A 3CQZJ 2RAEA 5IPAA 4BQAA 5FLMJ 2LVSA 2OD5A 4V2GA 3VPRA 1BC8C 3KLOA 5J1UA 5FFXA 2FOWA 3BTJA 4OOIA 4HQEA 2R7VA 3J7AO 3M8JA 5J8CA 4GFBA 3M4OJ 1R5ID 2RQPA 4WXCA 3KYLA 3E6CC 1S6LA 3UNGC 3M57A 1MDMA 1Y1VJ 1MD0A 3ZCOA 4U88A 5F08A 2OAZA 1T56A 3ASOH 1V4RA 2GZWA 3HKZN 4E6KG 2VIXA 3VSLA 1TNSA 3GZ5A 3KPHA 1RI7A 1BW6A 1GXQA 2ECCA 5DD4A 5IT3A 1QHHD 3MEXA 2K3FA 2HQRA 2X0LA 3JRGA 1XDUA 3H3UA 1FSEA 4JOMA 3P7NA 2ID6A 2WTEA 3MN2A 2ETHA 3J7ZI 3S2DJ 3CMYA 4FE4A 3D1NI 3IP4B 1A36A 1W0UA 4QPOA 4HSRA 2JRTA 5HLHA 4HEA2 5DM6F 3W2WA 3OYKA 1N6AA 3S3MA 4BKXA 1NH3A 2O6GE 3ML6A 4IJ8A 1TWFJ 3BP8A 3WTUC 2R7SA 5J4YA 1UHMA 5KNLA 3DWLE 4CZZA 5ICGA 2X6XA 2EINH 4KT5C 3CUQC 4EJOA 4U7BA 3GTGJ 2CRGA 2F5DA 4V19K 5E8GA 2M45A 2FBKA 2GA1A 2XB5A 4ITVA 4P9FA 1E3OC 3SDGA 3QP5A 4BQQA 3QU3A 2RC4A 3ZP5A 4L5JA 1EH6A 2H6BA 4BL0B 3DCFA 3OXLA 4C1QA 1DQUA 2K9QA 5J3LA 2RVCA 4F52A 1P6RA 5C44J 2WWYA 3RI4A 2GLOA 1S7OA 3CO6C 1H89C 4EM0B 5EGOB 5CVVA 2JN6A 3CCJI 1GV2A 1KGSA 3I55I 4YNMA 2HPIA 3HRSA 3ASNH 4LLNA 2R7TA 3F9WA 3U1KA 5JHUA 5M3FJ 3GTLJ 1P4XA 1H0MA 1MGTA 2H8WA 2MLKA 4M71A 1I1GA 4I98B 4Z2YA 4IXAA 4ZDOA 5F04A 1TC3C 1E17A 1TW2A 2Y9ZA 2EZKA 1JE8A 2IGMA 2DYRH 2Y31A 1JKPC 4XIDA 3L2UA 3KP3A 4A3IJ 2VQHA 4A5MA 1BOAA 1ERDA 5EG0A 1VF9A 3EETA 1SAUA 5M5XJ 3OR2C 1BJAA 5EJCA 3GTJJ 4EJUA 4BNCA 4X6AJ 2MSYA 3DXJF 4A3MJ 3QYBA 3S3NA 1FPQA 1R1TA 4OIPF 4LGWA 2WY8Q 2Y9YA 5FD6A 4YFKF 2O8KA 3BTCA 3RQ4A 3R0AA 3AFHA 3WG7H 4BQNA 4RB2C 1IXSB 2E5NA 3RQIA 1IRZA 2LH9A 1D5VA 5K7ZA 4G7ZF 1X19A 1WCMJ 2HOEA 1YIOA 2CYYA 4UB6C 4HPQA 1ZRFA 2ZB9A 3DTEA 1LDDA 3LSJA 2CWEA 1U5TA 5M3MJ 5AIPA 2A05A 2KIFA 3WE2A 3QWPA 1GHCA 5E1ZB 1BC7C 2EA2A 3HRMA 3IRRA 3J80K 1SFKA 1USTA 4N0BA 1WI9A 4MHGA 1JHHA 3S2HJ 1SMTA 5D5UB 4NJ5A 4IJDA 1XGNA 2GOXB 2VC1A 4M6XA 4Y3OA 3RCOA 4RS8A 4XBFA 2O5RA 4OIOF 2JV0A 4FX4A 3BZ6A 2UXNA 1JKRC 3KMAA 3PUBA 2MABA 2HS5A 5K1YA 1OCCH 2MC4A 1MJAA 3F0CA 4MEYF 1K7AA 2XGEA 4KICA 3I0TA 3OYHA 1V3FA 3DKWA 3N05A 1HA8A 3F6VA 4IVNA 1TWGJ 3CF5F 3BC8A 1MBGA 4I02A 2YU3A 2IP2A 1ENHA 3TOAA 3E6BA 4AD9A 4PZJA 1RKWA 5J8FA
chains in the Genus database with same CATH topology
2LOOA 3MO0A 3KEYA 2VPLA 2VXDA 4CCLA 4AU7A 2ELJA 3M1CA 2GOMA 2K9MA 2W1OA 4NUBA 2RREA 1X4PA 4PJMA 1UAAA 4J00A 3BG6A 2VASA 1S9HA 3RTRA 3W2VA 2VJ4A 3F9ZA 4FMUA 5TTFA 2KL4A 3K70D 4BS9A 3C2GA 5EX3A 4I51A 4XONA 2LBFA 1WJAA 4HG2A 2XSJC 3IUOA 4J8OA 3NWSA 3DKYA 5TH7A 4OWRB 5CQEA 4NNJA 1MMGA 4HSTA 3RPUD 4CUGA 2HVRA 3CP8A 4PSXA 2UWMA 2HU9A 3ZR8X 1V5GA 5F6KC 3H5AA 3OS5A 3EUAA 3F9KA 3H9GA 1QU3A 4YNPA 2L9SA 3OYLA 2KP6A 3S7BA 3OYGA 2L7KA 1DGWY 4ZC3A 3ZXSA 4AVZA 3MMYB 3HKZA 3MEKA 4HNUA 5CCLA 4IQJA 2X6YA 2BW3B 5HNFA 5EG2A 5F59A 2WY7Q 3OS2A 1MVXA 3PNTA 4B48A 2RFIA 3DTIA 5T0MA 2V26A 3UR3C 3OMYA 3OYIA 2XAUA 1K6YA 2CW7A 4CSWA 2VJJA 2LYCA 3RAYA 4NQWB 2JSPA 4YEJA 4C9YA 2WADA 2CW8A 4FASD 1D1CA 1MMDA 3CMMA 3ZGKA 2HQAA 3PNYA 2CUJA 4XLEA 2W4SA 3OYEA 3PL8A 4CCMA 1Z7LA 5EX0A 3HC7A 1FMVA 1V5FA 3HNAA 2LG4A 4BQOA 3OPEA 4BEHA 2Z2SB 1WJDA 5CCMA 2UUZA 2DXIA 4F91B 3A1YA 4Y33A 4DBRA 2IS2A 2W00A 1TT0A 3LMMA 2MFZA 1ML9A 5T5GA 2WB1A 4E7KA 2BW3A 3MO5A 3K4NA 4XLFA 1N75A 4QEOA 5LSZA 1VZ0A 3DPLC 3M58A 2VJ5A 4CZCA 1XQHA 1WJEA 4LDGA 4O6FA 3S7DA 2V4JC 4O30A 4YRVA 2X51A 3EUHC 4ZYAA 1DP3A 2AQEA 5KJMA 3H5RA 3FDYA 4JQFA 1WJ5A 3DKXA 1D0ZA 2Q1ZB 1Y56A 4BDYA 4N4OB 4ZDLA 1AA7A 3RIBA 4RLQA 3D5RC 2IS4A 2XF7A 2LC2A 1YX5A 2M4GA 2V6EA 2PJRA 2PMZA 2KMUA 3HXLA 2ZXIA 1LFPA 4ZTJA 2VLAA 3MO2A 2VJIA 1LVKA 2ZSIB 4B43A 3SEQA 2JVHA 3E0JB 4BJ6C 4NC7A 2DT6A 4XR6A 4MI0A 4II2A 1WJFA 1T0FC 2E60A 3OS0A 5LFAA 2LBFB 5JINA 1R6RA 5KCMA 3S3OA 2Q2EB 4DIQA 3PDNA 2LRDA 3DEEA 1JI8A 3TMOA 4PSWA 2XC7A 2CMPA 5HI7A 5FROA 2LY1A 2WBMA 2DJIA 3LSGA 2X1DA 2W5YA 2M7BA 2K5CA 3OYJA 3DLAA 3FKJA 3OYAA 2DCEA 2M0MA 3BO5A 4JLGA 2X1CA 3EPZA 4LITA 4IX7A 3VV0A 4Y4RA 3OXGA 3VUZA 2VQLA 4E47A 2M7AA 2E5ZA 4XMYA 3DPTA 3LSHA 2WAEA 2XF5A 3PSFA 3S7FA 2AQFA 4LIUA 3RSNA 4F93B 2HZDA 2O8JA 3TG4A 1X1CA 4XKWA 3K5KA 5TEGA 3CJQB 2VL8A 4PFOA 1O9SA 4XQFA 3OYFA 4H12A 3VYRB 2KRCA 3M59A 2ZSHB 2QKMB 4PJLA 1Z21A 4KISA 3S7JA 4CA0A 2Z16A 3TL4X 2IGNA 4XOTA 4E7JA 4QENA 4YPEA 2XF6A 1E0EA 4KITB 3KMJA 3CBPA 2R3AA 4C30A 4J7FA 4CCOA 2JUGA 2BQZA 1NG6A 4J83A 3S8PA 2V7FA 2JVGA 2CH0A 2R7XA 2X85A 3PJRA 5JJ0A 4CCKA 4ZTFA 2WAFA 3SZGA 2R7UA 1BOBA 3LSIA 4BEHB 2OUMA 4YNDA 3HOSA 2VKHA 4GRIA 2QPWA 3DQVC 3CP2A 4RLFA 3K70C 2CV2A 5T0KA 3OYCA 3KMTA 4II3A 2M4KA 2L5QA 3MD2A 3A2KA 4QEPA 2CUZA 3HPHA 3K4LA 4HNTA 3NWTA 3OYBA 2WAQA 4KJZA 3LSKA 4XORA 1N77A 2DT7B 2XDVA 4XKVA 4ZDPA 3I9V2 4B44A 3MKWB 3PFYA 3V42A 4DJAA 4E7SA 4X0GA 4BE2A 3LFUA 2KRHA 4BE0A 2R7QA 3K10A 2F5VA 1LKXA 3FHNA 4H4KC 2HVSA 4F92B 1MNEA 2F69A 4KT6A 2I8DA 4YPUA 3QOEA 4PUSA 1MW7A 1MMAA 1WFXA 3W2AA 2F4IA 2VB6A 3FPDA 3DU6A 3OR1C 4E7IA 3L2VA 4CCNA 5F5EA 2CS3A 2OV7A 2PJRB 2ZFUA 4B3XA 5HLTA 5KJKA 2HPMA 4J7IA 3QYEA 4NC8A 3DB5A 1Z3YA 3C2HA 5CPRB 4E7LA 1WJBA 1X1DA 5CKTA 3BLYA 1G8XA 1PYVA 2K3PA 3DPUA 4XM3A 3W3CA 3ZRGA 3DTKA 4CH7A 2R7RA 2KLOA 2R7WA 4XL9A 2Z1DA 1YX3A 1D0XA 1N78A 1DGRM 3SYTA 5KJNA 1BR2A 1OR7C 3CBOA 2KDOA 2UV1A 3CF2A 3SEZA 1NG7A 4Z4PA 1W36D 3OYDA 2A5WA 4D1QA 2LY2A 4F55A 4LG3A 1ZELA 3MKZA 4ANJA 3HL2A 5LD2C 2CV0A 2CFOA 2KZVA 4BXFA 1P9QC 2IS6A 1PJRA 3VYSB 4XKBA 2L9NA 3LSMA 3HG9A 3M56A 4LIVA 3QYFA 3K4MA 2R7OA 4XLCA 2M3AA 3CZ6A 2IGQA 5ARGA 3VYTB 3PNVA 2WA0A 4E7HA 1T95A 4U87A 4HRIA 2W7NA 2Y0SA 2R7VA 2HNHA 3M8JA 4WUYA 2IGKA 3HOTA 5FRMA 4YPAA 4BDZA 2KHMA 3D5LA 3KYLA 4C2TA 3G2BA 2R4GA 3UNGC 2BVLA 2F6CA 3M57A 1YE9A 4XN3A 1EA3A 4DOZA 2MYSA 3ZCOA 3S93A 4OAZA 3OS1A 5HQ8A 2DOAA 1MT6A 1J09A 3SWCA 3K4JA 5JHNA 3AL0C 4E6KG 2A6TA 2VIXA 3VSLA 2KPMA 3FBIB 3F9XA 3A4CA 4BU2A 4JDSA 4NVQA 3DU5A 2IGOA 1QHHD 2CV1A 3BCAA 3VDXA 3H5NA 4JOMA 3ONQA 4XOPA 5KHDA 2K9LA 3OL4A 3HUGB 3RU0A 3H9JA 5F6LA 3OY9A 2IS1A 3GBGA 3IP4B 3AL0B 3SW9A 4IZZA 2X1EA 3I3LA 4HSRA 4QPOA 4RM2A 2LREA 4C2UA 3SDBA 4XLAA 4HEA2 3EUKL 3W2WA 3OYKA 1N6AA 2E1MC 3S3MA 3H35A 4RZ0A 3QODA 3OYNA 4IJ8A 1MVHA 3TG5A 1X4OA 2V9KA 2R7SA 5KNLA 5HVQC 3DWLE 1V5EA 3F9YA 3L2RA 2X6WA 2X6XA 2ZXHA 3KX2A 4XN0A 2VXZA 4U7BA 4IQ4A 4XNFA 4BACA 4E4HA 4MI5A 3BCBA 3MKYB 1D1BA 4B47A 2L2OA 4ITVA 2E1MB 4XLHA 4BJ5C 3RJWA 3OIPA 4BQQA 1X1AA 2VQCA 2VQGA 1D1AA 1WJCA 4BL0B 1N3JA 4N4NB 3K4BA 1N6CA 1G59A 5AYFA 3E1SA 1Y6IA 3OXLA 4C1QA 1DQUA 4F52A 1MUFA 3IAM2 3OIQA 3CBMA 1OLTA 3L2WA 4EATA 1Z3XA 3EP0A 5JIYA 3BG7A 1BR4A 4BGDA 3PSIA 4YNMA 2HPIA 1PEGA 2HDWA 2R7TA 3F9WA 5TGTA 1FMWA 4YELA 3M5AA 4BUPA 4BE1A 5HOOA 3DALA 3IHXA 3OXFA 3OYMA 3QWWA 4G6TB 2RQQA 4J01A 3D5SC 3M53A 2BOLA 2OC6A 4ZDOA 2W5ZA 5HNHA 4DBQA 3AKZA 2IGMA 3K4KA 4PJNA 4PK4A 1TZLA 3L2UA 2QKLB 3U21A 3CESA 3H0DA 2VQHA 1ERDA 4XKCA 3VYUB 5JHFA 1GLNA 1SAUA 5CQGA 3TBIA 3CJRB 3OR2C 1QHGA 3VSKA 1UELB 1UG0A 3LL7A 3FBNB 3M55A 1X1BA 2VKDA 3QYBA 2RNGA 3S3NA 2JA2A 2WY8Q 2V1NA 4F3QA 3OOUA 3RQ4A 4BQNA 3AFHA 4OAYA 2E5NA 4P5OA 2LH9A 5KJLA 4PFPA 4DGWB 4BJTA 1X19A 3K6GA 4HPQA 4R79A 1ZKKA 2P0WA 3DTEA 4RM3A 4E7ZA 4D9JA 3M54A 1MMNA 3QWPA 2FUG2 3S32A 1W36C 3IAS2 1LDKB 1SFKA 4RMNA 4QPQA 2NOJB 1IRXA 4P1WA 2HVQA 5LSXA 4NJ5A 3QWVA 4IJDA 2GOXB 3HPGA 2MD0A 4Y3OA 4ZJZA 3ZQQA 3RCOA 2O5RA 2JV0A 3OOIA 5ARFA 4FETA 4CCJA 1MNDA 2BVMA 4AYBA 1H3IA 3KMAA 3PUBA 2MABA 5FRNA 3OL3A 2G46A 3OWTA 2MC4A 1BR1A 1KONA 3N71A 3L2QA 3OYHA 3H9QA 3N05A 1HA8A 4IKFA 2KQRA 3VWBA 4PJJA 3K4CA 3BC8A 1U0JA 3J7AY 2IXSA 4MLOA 1D0YA 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO0 A;  3OXL A;  3DB5 A;  4C1Q A;  1MUF A;  3CBM A;  5CPR B;  4MI5 A;  4AU7 A;  3EP0 A;  5JIY A;  3MO2 A;  5KJN A;  4YNM A;  3CBO A;  4MI0 A;  1PEG A;  3F9W A;  4Z4P A;  3M5A A;  3F9Z A;  4BUP A;  5JIN A;  4FMU A;  5TTF A;  3DAL A;  3IHX A;  3PDN A;  5EX3 A;  4I51 A;  3OXF A;  3QWW A;  4J8O A;  3M53 A;  5HI7 A;  2W5Y A;  2W5Z A;  5TH7 A;  3BO5 A;  3VV0 A;  4JLG A;  3M56 A;  3VUZ A;  3OXG A;  4E47 A;  5F6K C;  2IGQ A;  5ARG A;  3OS5 A;  4YNP A;  3S7F A;  2O8J A;  3S7B A;  3TG4 A;  3K5K A;  5TEG A;  1O9S A;  4WUY A;  4YPA A;  4H12 A;  3M55 A;  3MEK A;  3M59 A;  5CCL A;  5F59 A;  5EG2 A;  3M57 A;  3S7J A;  1MVX A;  2RFI A;  4QEN A;  5T0M A;  4YPE A;  3RQ4 A;  3KMJ A;  3CBP A;  5HQ8 A;  2R3A A;  4J7F A;  1MT6 A;  5KJL A;  3RAY A;  3SWC A;  2BQZ A;  5JHN A;  4J83 A;  3S8P A;  1ZKK A;  3F9X A;  4JDS A;  4NVQ A;  5JJ0 A;  3M54 A;  3QWP A;  4YND A;  2QPW A;  5EX0 A;  3RU0 A;  3HNA A;  5F6L A;  5T0K A;  3KMT A;  3OPE A;  4QEP A;  5CCM A;  3SW9 A;  1ML9 A;  5T5G A;  5LSX A;  4NJ5 A;  3QWV A;  4IJD A;  1N6A A;  3MO5 A;  4QEO A;  5LSZ A;  2JV0 A;  3OOI A;  5ARF A;  4RZ0 A;  4IJ8 A;  1MVH A;  3TG5 A;  3M58 A;  1H3I A;  3KMA A;  1XQH A;  3F9Y A;  2G46 A;  4LDG A;  4O6F A;  3S7D A;  3N71 A;  4YPU A;  2F69 A;  4O30 A;  5KJM A;  3FPD A;  3RJW A;  5F5E A;  5KJK A;  4J7I A;  1N3J A;  1N6C A;  3RIB A;  5AYF A; 
#chains in the Genus database with same CATH topology
 3C18 A;  3MO0 A;  3KEY A;  4AWX B;  3HOV J;  2VXD A;  4CCL A;  3LSR A;  1Y8Q B;  3TDZ C;  4AU7 A;  1WHU A;  4RB1 A;  1X4P A;  3SHF A;  2ZKZ A;  3DF8 A;  1LDJ A;  2M87 A;  5DD8 A;  4J00 A;  2G7H A;  4M74 A;  2VAS A;  3MFK A;  1QZE A;  1FYL A;  4ETS A;  5KAF C;  3HSE A;  2JTV A;  1FJL A;  2E36 A;  1JTY A;  2V79 A;  4I99 C;  1FOW A;  2EQR A;  1TQM A;  1UB9 A;  1ZG3 A;  1BI3 A;  3HOU J;  3FXL A;  4KUM A;  5EEA A;  4HG2 A;  4U7D A;  1EKE A;  2J5P A;  1RUN A;  2HQN A;  3ZMT A;  1J0R A;  3QAH A;  3A03 A;  3WU2 C;  2DMN A;  1AWC A;  2HVR A;  2XAH A;  4UV8 A;  1UHW A;  2FD5 A;  2JRM A;  4G8X A;  2FE3 A;  3ZR8 X;  2H8R A;  4P55 A;  4M9X A;  1FBS A;  3MQ0 A;  3OYL A;  2EIJ H;  2LR8 A;  4LB5 A;  2Z5U A;  3S7B A;  2VON A;  5C4J J;  2XUB A;  3HKZ A;  3MEK A;  3M1E A;  5F59 A;  5HNF A;  1R4M B;  5EG2 A;  2BEO A;  1B6A A;  2QUF A;  1S7A A;  2HKX A;  1MVX A;  4B48 A;  2RFI A;  5CVU A;  3OYI A;  2Y0S N;  2VPR A;  2CU7 A;  4BY7 J;  1YJW I;  4NQW B;  2Q8K A;  4M9Z A;  1YOV B;  2WAD A;  2RKH A;  2CW8 A;  1VQ6 I;  2DA2 A;  3QPT A;  3N4M A;  1MMD A;  3CMM A;  3ZGK A;  3PNY A;  2IPQ X;  5JLW A;  2W4S A;  4ENM A;  3ZPL A;  2AXT C;  1OFC X;  2VT3 A;  5F1R A;  4WCG A;  5FKL A;  2VBZ A;  3K7A J;  2K27 A;  1FZP B;  3HJE A;  2Z2S B;  4IHW A;  5E8I A;  4Y33 A;  1HLV A;  1ML9 A;  5T5G A;  2MFZ A;  1OYI A;  1YJ9 I;  3MO5 A;  2ELH A;  1NTC A;  1ZAR A;  2DFE A;  2XIG A;  4WF2 A;  3ELK A;  4XLF A;  4CDG A;  4DZP A;  1YRN B;  4QEO A;  3CO7 C;  3BR3 A;  3GTM J;  4D7N A;  3M58 A;  3SFI A;  5DTD A;  1JGG A;  1KU7 A;  5F1J A;  1IXC A;  4HW0 A;  3WTZ A;  2V4J C;  1SFX A;  2ZBK A;  5IP7 J;  5FJ8 J;  4ZYA A;  1DP3 A;  1SAN A;  1Y8R B;  3FDY A;  1ETW A;  1YLF A;  2CW0 F;  2J5O A;  1AKH A;  2QVO A;  1BI2 A;  1Y56 A;  2DMU A;  3ZQI A;  4FCY A;  4N4O B;  3ZN1 A;  3RIB A;  4RLQ A;  3D5R C;  2XF7 A;  3ABT A;  1RET A;  3ULQ B;  1YX5 A;  2KJB A;  3U1D A;  5LHH A;  1ZH5 A;  3HXL A;  1SAX A;  2WV0 A;  4ZTJ A;  2VLA A;  4BBS J;  3MO2 A;  4B43 A;  2JVH A;  1YIT I;  3AG1 H;  4C2M J;  3I56 I;  4FIS A;  4HQM A;  3E6D A;  1IAW A;  1X58 A;  3RPQ A;  2E60 A;  2AO9 A;  5LFA A;  3IWF A;  2ADU A;  3S3O A;  3DEE A;  1IO2 A;  2QQ9 A;  3TP3 A;  4HV5 A;  4U0W A;  2BV6 A;  2XC7 A;  4IHS A;  3PO2 J;  2E2I J;  2DJN A;  1Z1D A;  4RA2 A;  2K5C A;  2R3S A;  2L9R A;  1VTN C;  1TLH B;  5M5Y J;  2RV8 A;  3FKJ A;  2DCE A;  2HEO A;  4Y4R A;  3ZQF A;  1G6N A;  1ETO A;  2E5Z A;  2YPR A;  4KIF A;  4LMY A;  3S7F A;  4LIU A;  3RSN A;  4DYQ A;  4KA4 A;  4XRF A;  2O8J A;  4UUS B;  2M34 A;  4XKW A;  5BNG A;  1R49 A;  3K5K A;  2YR2 A;  1I5Z A;  5IT9 K;  1S72 I;  3FF5 A;  3MWM A;  3WHC A;  2DA5 A;  4GXO A;  2VOP A;  3HGG A;  2OCE A;  4HX4 A;  3BWG A;  1F1Z A;  1U8R A;  5DCM B;  2P6T A;  4CCO A;  3FMS A;  2BQZ A;  1NG6 A;  2QCO A;  5LHG A;  3S1M J;  2V7F A;  2JVG A;  3B02 A;  1MH4 A;  2CH0 A;  3S15 J;  2FF4 A;  1B4A A;  3E6M A;  4LD5 A;  3BZC A;  2P4W A;  3LSI A;  4BEH B;  2AXL A;  3BQY A;  4GRI A;  2HOS A;  2QQA A;  2P7V B;  3DQV C;  4RLF A;  1HOM A;  5IY5 H;  1H9G A;  4L0Z B;  2EBI A;  3FXK A;  4IEJ A;  4D7M A;  4FTH A;  3HUG A;  2CUZ A;  3HPH A;  1KA8 A;  2XRL A;  3NWT A;  2QLZ A;  4WX9 A;  4UY8 I;  3COA C;  3BTI A;  3SZT A;  4A12 A;  2DT7 B;  2X9D A;  4XKV A;  4AM3 A;  2YU9 J;  2AS5 F;  1NK2 P;  2VKV A;  1FP2 A;  2YX4 A;  4ABZ A;  5LRS A;  4E7S A;  1APL C;  1W1W E;  5J47 A;  2F5V A;  2HVS A;  4H4K C;  5CLS A;  1W4M A;  2BY2 A;  4AIH A;  1PP7 U;  1JJ6 C;  4F92 B;  3FXQ A;  2F69 A;  4KMF A;  5E1W A;  2IBD A;  1Y39 A;  2F4I A;  3L2V A;  3H92 A;  4CCN A;  2EA4 A;  2OV7 A;  5EYR A;  4IRH A;  2ZFU A;  4JX4 A;  2TCT A;  2DA6 A;  4H0E A;  3Q0V A;  3QYE A;  4Q48 A;  2EFQ A;  4Y17 A;  1TBX A;  1Z3Y A;  4HF0 A;  3RYP A;  3ABL H;  4B3A A;  4CH7 A;  1W7P B;  3HTU A;  2LD5 A;  1REP C;  3PQK A;  1R9T J;  3F21 A;  1KU2 A;  2L01 A;  3V4G A;  3W6K B;  3G71 I;  1YX3 A;  1QZY A;  3LWF A;  1N78 A;  3CDI A;  3CBO A;  1W5C C;  1B8I A;  2F4M B;  2IA2 A;  5A2Q Z;  3S1Q J;  3K1M A;  3JRH A;  5ILU A;  1X1P A;  4BBR J;  5L3B A;  3HOW J;  3MKZ A;  1ZEL A;  2I10 A;  3CCR I;  3HYI A;  4BXF A;  4G7H F;  1MJ9 A;  1P9Q C;  2ZNZ A;  1FSH A;  4A0Z A;  1LEA A;  2IS6 A;  2M8G X;  2NNN A;  2XAG A;  2VBX A;  3HM5 A;  2FMY A;  4LIV A;  4DNC A;  1MJB A;  3MZH A;  4XLC A;  2FEZ A;  2R7O A;  2M3A A;  3CZ6 A;  2IGQ A;  2G9W A;  3VYT B;  1XSX A;  2WA0 A;  3PNV A;  2PJP A;  2JA7 J;  3KEO A;  1KYZ A;  4U87 A;  3OIO A;  4B4C A;  2Y0S A;  5DM7 F;  5L3E A;  3BR6 A;  4UNO A;  4YPA A;  2IGK A;  5FRM A;  2KHM A;  3D5L A;  4G9Y A;  2BVL A;  2F6C A;  3KZY A;  2QYO A;  3FXU A;  3S93 A;  5TJJ A;  4G12 A;  2EB7 A;  3I4N J;  1WKM A;  1HF0 A;  4NHJ A;  5HQ8 A;  1QPM A;  2A61 A;  1J09 A;  1LEB A;  3RKW A;  5JHN A;  3O8G A;  2B0L A;  1CGP A;  2A6T A;  4IHY A;  2A5Y B;  3F9X A;  4BU2 A;  2ZC2 A;  4JDS A;  1TTY A;  3M9A A;  2VE9 A;  2Y0M A;  2L0K A;  2MG4 A;  5HS8 A;  2CV1 A;  1VQ8 I;  3BCA A;  2A6H F;  4OU0 A;  1RUO A;  3ONQ A;  4XOP A;  4EQQ A;  3GTP J;  3KP2 A;  4ASN A;  2BY3 A;  3GLL A;  2K02 A;  2IS1 A;  1VND A;  2YS9 A;  3C1D A;  2KRF A;  4BHP A;  5D6F A;  1G4D A;  4IZZ A;  3S14 J;  1ETV A;  2LRE A;  4W1U A;  3F6O A;  3SDB A;  1QVU A;  1WRJ A;  3EUK L;  4RAG A;  2RNJ A;  1S8N A;  5BPI A;  3OYN A;  2X48 A;  3RZO J;  4PGG A;  3H36 A;  2GXG A;  5DEQ A;  5HVQ C;  1FOX A;  1V5E A;  1BN5 A;  2QSF X;  2X6W A;  5J4V A;  3DP7 A;  4IQ4 A;  5FD5 A;  4EM2 A;  4E4H A;  4EJW A;  1PVE A;  2DAO A;  2CSO A;  4B47 A;  3R61 A;  5K5R A;  3GXO A;  2VOO A;  2OU2 A;  1ZHF A;  4BHB A;  1P92 A;  1FBU A;  4IHT A;  3RJW A;  1X1A A;  1J75 A;  1D1A A;  3DLL F;  1SFE A;  2EIL H;  1N3J A;  5AYF A;  3E1S A;  1SEU A;  4FQG A;  5ERI A;  5EG0 B;  1MUF A;  3BT9 A;  3FKI J;  1QRY A;  1ODD A;  2QBY B;  1OCZ H;  4EAT A;  3EP0 A;  5JIY A;  1JHF A;  5LBQ A;  3Q9V A;  4MIM A;  3R4K A;  3IKT A;  4BGD A;  1LVA A;  1YW7 A;  4ON0 A;  5FLX Z;  1TW3 A;  1PEG A;  3JSO A;  1FMW A;  2IAI A;  4YEL A;  3M5A A;  5HOO A;  2EFO A;  1V54 H;  3DAL A;  3IHX A;  5D4R A;  3D0S A;  4FHT A;  3OXF A;  2RQQ A;  4J01 A;  2DOE A;  2E35 A;  4XRM A;  2W5Z A;  3RJP A;  1MH3 A;  3AKZ A;  4YFX F;  2LSO A;  2Y30 A;  5E3L A;  4O5V A;  1TZL A;  1R22 A;  1ONV A;  5B1A H;  2HYG D;  4B8X A;  1JGS A;  5D5V B;  2ESH A;  5JHF A;  1EV7 A;  4IF4 A;  1GLN A;  2DMP A;  3JRD A;  1A35 A;  1AOY A;  3SFZ A;  3HIF A;  5CQG A;  3TKY A;  5ICC A;  5C3E J;  3LL7 A;  3GYH X;  2MBF A;  3M55 A;  5KK1 A;  4HNV A;  1X1B A;  3LAJ A;  2P5L C;  4R1H A;  2GXA A;  3F72 A;  1MBJ A;  2P6S A;  1RR8 C;  3O8H A;  4UUT A;  3R0J A;  3ERM A;  3RDI A;  4OAY A;  4UHT A;  5HOD A;  1TWC J;  3IHU A;  4BJT A;  3FK7 A;  4A2U A;  3E7L A;  2A69 F;  4MFD A;  3IH2 A;  5GAE J;  3CCY A;  2M1B A;  1TWA J;  4RM3 A;  2VT2 A;  3GTK J;  1FYK A;  3G3Z A;  1DUX C;  2N8G A;  1VQL I;  4D5C A;  1LDK B;  1SD7 A;  4ESB A;  5GTH C;  2IRF G;  1GV5 A;  1VQ5 I;  2NOJ B;  1RKT A;  1SD6 A;  1A6Q A;  3VFZ A;  3NAU A;  2HDC A;  3TW6 A;  1G3T A;  2L7Z A;  3KIO A;  3EYY A;  3ZQQ A;  5FKN A;  3W6V A;  5ARF A;  3MCZ A;  1IDY A;  1FTZ A;  4CCJ A;  3GFJ A;  3ZMD A;  1H3I A;  1IRF A;  2ZXW H;  3BTL A;  3OL3 A;  2G46 A;  1OQY A;  1OYW A;  3OWT A;  5LGT A;  4A3K J;  2WAQ N;  3QP6 A;  3L2Q A;  3S1N J;  3H9Q A;  4L9T A;  4BY1 J;  4IKF A;  2KQR A;  1WGX A;  2NVY J;  4QIW N;  1U0J A;  3JAM Z;  2DU9 A;  1W5S A;  3F23 A;  2DDB A;  4LG0 B;  2L02 A;  4A5N A;  2B7E A;  2ELJ A;  2GOM A;  4NUB A;  1F36 A;  3QRF F;  2RRE A;  2OQG A;  1FWZ A;  4FE7 A;  1T08 B;  3QU6 A;  4RAY A;  4A3J J;  1PUE E;  4MGR A;  3DBL B;  2ZJP F;  2NNY A;  3EUH A;  5B3S H;  4L5I A;  2BY0 A;  4KDP A;  3F9Z A;  3KYD B;  1K78 A;  4FMU A;  2VBW A;  3H0G J;  2FX0 A;  1J9I A;  1GXP A;  2JQ7 A;  3C2G A;  3IC7 A;  2IT0 A;  2CO5 A;  1ZG5 A;  2DFF A;  3FWE A;  4J8O A;  3IUO A;  2HZT A;  3KET A;  4HZF A;  5TH7 A;  3WU0 A;  1MMG A;  1UFM A;  3M8E A;  3CUQ B;  4JK1 X;  1W5T A;  2HXI A;  2R7Z J;  1K61 A;  2CQK A;  1QVT A;  3PUF A;  5E1X A;  5E18 F;  1RRJ A;  2HTJ A;  3H5A A;  1GVJ A;  4A3D J;  3OS5 A;  4ENN A;  3F9K A;  1JUM A;  1S7E A;  4GO1 A;  2FNA A;  4YNP A;  1WH7 A;  2V9V A;  2EJR A;  3PIP F;  2KP6 A;  1HXD A;  4L9J A;  2JA8 J;  3TO6 A;  3OYG A;  4ZC3 A;  3KZI C;  3P5J A;  4U0V A;  5E3M A;  3V7C A;  1OPC A;  4HNU A;  4EGY A;  5M5W J;  5JVT A;  2RN7 A;  4Y7N J;  2WY7 Q;  5E3O A;  1YW8 A;  1XMK A;  2V26 A;  4M3D A;  1B72 A;  1KQ0 A;  1K6Y A;  2CW7 A;  2XAU A;  3HRU A;  4DZJ A;  2HOT A;  1Q1V A;  1ETQ A;  3CME I;  1B9M A;  4XLE A;  2VE8 A;  1AKH B;  1Z7L A;  1OIS A;  1V5F A;  2KT0 A;  4PCQ A;  2BXY A;  1WJD A;  4CYC B;  3TGN A;  2W00 A;  1TT0 A;  1YYV A;  1SVL A;  5HS9 A;  2BW3 A;  4L9V A;  1IG7 A;  3K4N A;  1FBQ A;  3ECH A;  5LSZ A;  1P4A A;  3I53 A;  3WTT C;  3DPL C;  1G3W A;  2EFN A;  2GXB A;  1XQH A;  2XRO A;  4TV7 A;  4ZYE A;  4WXH A;  1ZKG A;  4B09 A;  3K69 A;  2IVM A;  3CCM I;  4PJ0 C;  3IL2 A;  4EVI A;  2X51 A;  5L3G A;  4E70 A;  4JQF A;  4A6E A;  1I6X A;  5EZG A;  1O3T A;  2QSG X;  2HQ5 A;  2M2E A;  1PDN C;  1KU9 A;  2IS4 A;  1FEX A;  1ZN2 A;  2EIM H;  2LC2 A;  3GVA A;  3KE2 A;  2PJR A;  3RKX A;  3TO9 A;  3BR1 A;  1IW7 F;  2CUE A;  4DYR A;  2GAU A;  2VJI A;  4ESJ A;  4I6Z A;  1LVK A;  2ZSI B;  3L00 A;  4NC7 A;  1RC9 A;  2NVU B;  2DT6 A;  3KLN A;  1T33 A;  4II2 A;  1T0F C;  2GIZ A;  2LBF B;  5JIN A;  1R6R A;  5KCM A;  1U2W A;  4OIN F;  4M3F A;  5E3N A;  2A68 F;  2Q2E B;  3I64 A;  1KQ8 A;  2STT A;  2K86 A;  3TMO A;  4PSW A;  2BHY A;  2CMP A;  1BI1 A;  3LSG A;  2DJI A;  2P7C B;  4IOA F;  1QGP A;  1IZ1 A;  3DLA A;  1W0T A;  2M0M A;  2CQN A;  4IX7 A;  3VUZ A;  4KIB A;  3OXG A;  5F64 A;  2FBH A;  3BR5 A;  4XMY A;  1RNL A;  2M8E A;  3AG3 H;  2AQF A;  1CQT A;  4F93 B;  3M07 A;  4BAY A;  1YW9 A;  3I4P A;  1POG A;  2VL8 A;  4HA8 A;  1O9S A;  3SZP A;  4H12 A;  3OYF A;  3VYR B;  2KRC A;  2DOF A;  4NB5 A;  2F48 A;  4RDU A;  3LQR A;  1LE8 A;  3FK6 A;  3RIR A;  4BHC A;  4CA0 A;  2XV4 S;  2Z16 A;  1VQK I;  4XOT A;  2ICW G;  4KIT B;  3CBP A;  3WTS C;  2NS0 A;  4C30 A;  2R3A A;  4J7F A;  4HOB A;  3Q3S A;  1F43 A;  2L3D A;  2JUG A;  2GIV A;  2E7W A;  5K7H A;  4HF2 A;  2AHQ A;  2PI0 A;  3AG4 H;  5IYD J;  6PAX A;  1MBE A;  1SFU A;  2X85 A;  2B63 J;  3PJR A;  2M5W A;  4ZTF A;  3HOZ J;  3SZG A;  5IYB J;  2R7U A;  3KCC A;  4G6Q A;  1AHD P;  4KN4 X;  2VKH A;  4IRI A;  2QPW A;  3K70 C;  4ENK A;  4M73 A;  2DA3 A;  3OYC A;  3KMT A;  3A2K A;  4M6Y A;  4QTR A;  2LTP A;  2WAQ A;  4KJZ A;  1HC8 A;  1ZGW A;  1LFU P;  1CF7 B;  3QWL A;  3ABK H;  2A3S A;  3PFY A;  4DJA A;  5A2Q K;  4BE0 A;  1MIJ A;  1OCP A;  1UG2 A;  2VI6 A;  4D5F A;  4XK4 A;  1MNE A;  1L0O C;  2FQ4 A;  3GX4 X;  4PUS A;  1MW7 A;  4RGU A;  4ZH4 F;  5BS6 A;  1S29 A;  3OR1 C;  4AC0 A;  4OMZ A;  5L3C A;  1YO5 C;  2LKX A;  3SJM A;  4AYB N;  2KIS A;  3BJO A;  2HPM A;  2B9S A;  4A0X A;  2XGX A;  2BHZ A;  2LMD A;  5EEH A;  3H3V K;  3C2H A;  3WGH A;  2BE5 F;  1WJB A;  1G8X A;  1PYV A;  3DPU A;  3R60 A;  4XM3 A;  4Y13 A;  3I4M J;  4MI5 A;  2R7R A;  1RZ4 A;  1GUU A;  4BH9 A;  2D1H A;  1P7I A;  1OYY A;  5DUI A;  2XRN A;  5EGO A;  3ECO A;  1WSU A;  2ZJQ F;  2IJL A;  3A0B C;  3M8F A;  2UV1 A;  1NG7 A;  2BGC A;  1IXR C;  3TP0 A;  5AON A;  5FLV A;  2ECB A;  3OYD A;  3IWZ A;  2LY2 A;  4HDV A;  4LG3 A;  3HL2 A;  3S17 J;  2KZV A;  2O9L A;  1FY7 A;  3IH3 A;  1PUF A;  2JZY A;  1O57 A;  3VYS B;  3ESW B;  5D6E A;  5GAD J;  3WTW C;  3QYF A;  2DFI A;  4YG2 F;  3CMA I;  2EFW A;  5ARG A;  2PBI A;  5J1Y A;  3AG2 H;  2ZO4 A;  5CYV A;  4E7H A;  1R1V A;  5BOX A;  3CDL A;  2W7N A;  3F8N A;  2FNP A;  2IW5 A;  2HNH A;  4QSH A;  4WUY A;  4JX6 A;  5L3F A;  1B9N A;  4FX0 A;  2DOD A;  3BPV A;  4AID A;  1IUY A;  3G2B A;  1XC5 A;  1R7J A;  1IN5 A;  2VKE A;  2ZME C;  1EA3 A;  3BY6 A;  2MYS A;  4DOZ A;  4EM1 A;  3F8B A;  5DS9 A;  2DTZ A;  1H8A C;  4OAZ A;  4O6J A;  2OJE D;  5CVJ A;  3F3X A;  4HX8 A;  1MT6 A;  2E71 A;  1TNT A;  2FRH A;  3K4J A;  3F8F A;  3QQA A;  4A3L J;  1FIA A;  3MKL A;  3JR9 A;  1OR7 A;  3C3W A;  3EQL F;  1LJ9 A;  2IGO A;  4AIK A;  4HLY A;  2NVT J;  2HGC A;  1WVR A;  2IEK A;  2ZME B;  3P9C A;  3VDX A;  5FKK A;  1STZ A;  2ISY A;  3RU0 A;  3H9J A;  2Z3Y A;  2QF7 A;  1HDD C;  2DO7 A;  2R5Y B;  4UVA A;  2X1E A;  3I3L A;  4BXU A;  2H1L A;  4C2U A;  4QWQ A;  1BIA A;  4XLA A;  2DA1 A;  1YIJ I;  1U3E M;  1A31 A;  2OTJ I;  2E1M C;  3K1P A;  1FNN A;  1QA6 A;  5FLX K;  4RZ0 A;  3KYC B;  3QOD A;  1MVH A;  3TG5 A;  3CUO A;  5FO5 A;  1ZAO A;  4EMS A;  2LDU A;  2ZXH A;  1DPR A;  3KX2 A;  4BAC A;  1HBX G;  3BCB A;  4BXX J;  3GFL A;  3CLQ A;  1D1B A;  3JTH A;  3FXM A;  2L2O A;  1FOK A;  2E1M B;  4XLH A;  1X3U A;  4BJ5 C;  1VFC A;  3OIP A;  5HDN A;  2YX7 A;  2VQC A;  3AAF A;  5GPC A;  2D45 A;  4JX5 A;  5B5E C;  3EYI A;  5AIQ A;  3CCS I;  3K4B A;  1Y6I A;  3GTQ J;  5EF6 A;  1ZGJ A;  3FMQ A;  3GZN B;  3FIW A;  4MQ9 F;  3OIQ A;  1OLT A;  4I01 A;  4P96 A;  3L2W A;  1O3Q A;  3NQO A;  4G94 A;  3PM1 A;  1Z3X A;  4M72 A;  5IYC J;  4CXF A;  2HOA A;  1TP4 A;  4Y15 A;  3J81 Z;  1RIO H;  4HV6 A;  1O7L A;  1BI0 A;  5HDG A;  4XRS A;  2LFB A;  3HDD A;  1K4T A;  2O61 A;  5TGT A;  1J2X A;  4BUP A;  2DPU A;  2FJ1 A;  3OYM A;  4G6T B;  3D5S C;  2Y69 H;  3MAJ A;  3ZOB A;  3M53 A;  1D5Y A;  2A07 F;  4DBQ A;  4P9U A;  3K4K A;  5E79 C;  2G7U A;  2QKL B;  4M3B A;  3U21 A;  3CES A;  1X3W B;  3NRV A;  5CVI A;  1Z6T A;  2A6E F;  2G0E A;  4I2O A;  3I59 A;  3TBI A;  4A3F J;  3J7Y J;  3CJR B;  2EV5 A;  1VQN I;  2H1K A;  4L0Y B;  1QHG A;  1VQM I;  4FT8 A;  2Q0O A;  3JCU C;  1UEL B;  3VSK A;  1MDM B;  2MLG A;  5J1R A;  1XX5 A;  1XDS A;  3LOC A;  4RAZ A;  2BZT A;  2Z33 A;  3TOB A;  3CJT B;  1R23 A;  2V1N A;  5D8K B;  4F3Q A;  1BL0 A;  4RBO A;  3OOU A;  2ME6 A;  2EV6 A;  4P5O A;  2NYX A;  1AU7 A;  4PFP A;  4DGW B;  3X2Q H;  4GGG A;  1T8I A;  4UVC A;  2O0Y A;  4Q5S F;  4NQW A;  4GYG A;  1I27 A;  1IRG A;  4E7Z A;  3M54 A;  1MMN A;  3DBR B;  4UB8 C;  5FKO A;  5CJ9 A;  3JAM K;  2FUG 2;  3S32 A;  1W36 C;  1FLI A;  3SXY A;  4QPQ A;  4IPA A;  4A3C J;  1A5J A;  4XIC A;  2Z9O A;  2HTS A;  2HFH A;  3A02 A;  2ID3 A;  4P1W A;  3BRO A;  4Y52 J;  2HVQ A;  2QWW A;  3K1N A;  2GWR A;  3T0Y A;  3QWV A;  5LSX A;  1K83 J;  2HR3 A;  3B6C A;  3HPG A;  3L7W A;  3A01 A;  1RPW A;  4IHV A;  3BDD A;  1UHS A;  3E97 A;  2RGV A;  2PMU A;  3OOI A;  4FET A;  4OIR F;  3Q9S A;  5KAI C;  2R93 J;  2BVM A;  4AYB A;  1T38 A;  1ETK A;  1DDN A;  1YRN A;  4DQ2 A;  3TDU C;  3E5U A;  5D4S A;  3H1C A;  4N9I A;  3V7R A;  1KON A;  2K9S A;  1DPU A;  3N71 A;  3GCM A;  1ETY A;  1XN7 A;  2NRA C;  1R00 A;  4W97 A;  4AUX A;  3RKQ A;  4KMU X;  3VWB A;  3VOD A;  4PJJ A;  3K4C A;  3J7A Y;  2KIQ A;  2W82 A;  2TDX A;  2PMH A;  1JUP A;  2F5C A;  2MH2 A;  3IH4 A;  4I0A A;  2VPL A;  2VC0 A;  2F5F A;  4PJM A;  2W1O A;  2K9N A;  5EZH A;  5LRR A;  2JWT A;  3CCU I;  1NHA A;  4XSZ F;  1X2N A;  5HLG A;  1JKO C;  5FFZ A;  1IN4 A;  2ELK A;  2JPB A;  2H94 A;  2OZU A;  1S9H A;  2ZCW A;  1HDP A;  3RTR A;  4D0P A;  1G3Y A;  3W2V A;  2L4A A;  3FZV A;  1I3A A;  1FP1 D;  2PG4 A;  4V2F A;  4BS9 A;  4A3G J;  3DBH B;  4MQV A;  3BZK A;  1WJA A;  1VQ9 I;  2XSJ C;  5ICE A;  3S1R J;  2ACJ A;  1M1E B;  2NAZ A;  4C3H J;  3JRE A;  3E5Q A;  3I58 A;  1MZB A;  2L7F P;  4NNJ A;  3R6S A;  1T98 A;  3CP8 A;  4PSX A;  2UWM A;  3VEP A;  2FU4 A;  2HU9 A;  2E1C A;  2KFD A;  1V5G A;  4U0Y A;  1O3S A;  2DQR A;  2PFB A;  3C7J A;  1LNW A;  2FOK A;  3ZMV A;  3H9G A;  2E2H J;  1JTX A;  4EEF G;  1F5T A;  2L9S A;  1FC3 A;  3WU1 B;  2OF7 A;  1DGW Y;  1U5T C;  3L2C A;  4AVZ A;  1W7P D;  3ISP A;  5CCL A;  3EDP A;  2BW3 B;  1IN6 A;  4UUS A;  4EV0 A;  1VQ7 I;  1OCO H;  3WGG A;  3LA2 A;  2JT1 A;  3UR3 C;  2H09 A;  2R7D A;  1J7K A;  2KZG A;  1BJZ A;  2VJJ A;  5B66 C;  2DT5 A;  3IRQ A;  1LFB A;  1R5H A;  2JSP A;  1U5T B;  2PLY A;  3G4S I;  4I76 A;  5DCM A;  1Z77 A;  3E5X A;  5JFR A;  5EEG A;  3WTX C;  3JRB A;  2VN2 A;  3OYE A;  3PL8 A;  1TT5 B;  2MW8 A;  5HLI A;  1O7F A;  1P2F A;  5D8L B;  1YTY A;  1FMV A;  4WK8 F;  1OKR A;  1H88 C;  2LG4 A;  3UKG A;  4CYD A;  4BQO A;  2ZJR F;  1DP7 P;  3OPE A;  4BEH A;  1P4W A;  3HSF A;  1IV8 A;  3T8T A;  3CCV I;  5CCM A;  2DLL A;  1JKQ C;  1R36 A;  2KJC A;  4DBR A;  4F91 B;  3LMM A;  2BBY A;  2OCC H;  4DYC A;  2Y75 A;  1X3Z B;  4ENJ A;  1HW2 A;  2NS7 A;  3IKV A;  4Q4Z F;  4MEX F;  1VZ0 A;  1JJ8 C;  1YI2 I;  2LF8 A;  2EZH A;  5ICF A;  2XHK A;  3T5X A;  2VJ5 A;  4CZC A;  2OBP A;  1I1S A;  4EGZ A;  4O6F A;  1SVM A;  3BG3 A;  4YRV A;  3TED A;  4I09 A;  4DW6 A;  2XPV A;  3H5R A;  1WJ5 A;  1ON1 A;  3MZY A;  3DKX A;  2EIK H;  2Q1Z B;  4B1R A;  5GAH J;  1OCR H;  1L3L A;  4BDY A;  1EH7 A;  1XD7 A;  3F8M A;  1AA7 A;  4ZDL A;  3JTG A;  1MKM A;  3FIS A;  2PN6 A;  5CVR A;  3ZMU A;  2K4B A;  1SMY F;  1Z91 A;  1HSJ A;  1ON2 A;  3ZQL A;  1XGO A;  3PO3 J;  1WH5 A;  1YS6 A;  2ZXI A;  4IO9 F;  2DA4 A;  2MD5 A;  5C4X J;  2QEX I;  3PIO F;  1IN8 A;  2K85 A;  4K2E A;  3BG9 A;  3SEQ A;  3E0J B;  1W7P A;  4HX7 A;  4LFU A;  4XR6 A;  4ZYG A;  4MI0 A;  1LE8 B;  3LST A;  1WJF A;  2DFH A;  3OS0 A;  1NK3 P;  5BPD A;  2K7L A;  4GDF A;  3G73 A;  4UUV A;  2GQQ A;  2EK5 A;  1JI8 A;  1QPI A;  1RR7 A;  2FA5 A;  2KIU A;  2WC2 A;  5DCF A;  5HI7 A;  2LY1 A;  2W5Y A;  2X1D A;  2M7B A;  2M0C A;  3GFM A;  3HHG A;  3CC4 I;  3OYA A;  3VV0 A;  3FM5 A;  5LHI A;  2W25 A;  3EPZ A;  3GW2 A;  4LIT A;  4KNY A;  4E47 A;  2VQL A;  2EPF A;  2L4M A;  2M7A A;  4A3B J;  4IL6 C;  1B1B A;  1U9O A;  1USS A;  3LSH A;  2WAE A;  2XF5 A;  2LK2 A;  4A93 J;  2Y48 A;  2HZD A;  5TEG A;  2FQ3 A;  1Y0N A;  4NBQ A;  4XQF A;  2BXZ A;  4M9S A;  2ZSH B;  2QKM B;  2CFX A;  1Z21 A;  4M3G A;  3KEQ A;  2CQQ A;  1LPQ A;  2UXX A;  2IGN A;  5JR3 A;  4E7J A;  4S0H B;  1E0E A;  5LLQ A;  3KMJ A;  1WWX A;  1MMS A;  3LQQ A;  1S3J A;  3CDH A;  3LA3 A;  3S2W A;  1T6S A;  5LEK A;  3QPL A;  4ZYH A;  2R7X A;  3KP7 A;  1UCR A;  2OZ6 A;  2XKP A;  5TIS C;  1T39 A;  1BOB A;  2OUM A;  1R58 A;  2MH9 A;  4UVB A;  4YFN F;  1LQ1 A;  3K2A A;  5T0K A;  1FTT A;  4II3 A;  2L5Q A;  3MD2 A;  4Z6Y A;  4QEP A;  3IV5 A;  1PP8 F;  3OYB A;  1HW5 A;  1Z0X A;  2XDV A;  4HBL A;  3KP4 A;  4ZDP A;  4B44 A;  3MKW B;  2GM4 A;  3V42 A;  5BQT A;  2I5U A;  4X0G A;  3I71 A;  1XTA A;  2ZFW A;  3JSP A;  1Y1W J;  4EJT A;  1HST A;  5H2F C;  2O7O A;  1LKX A;  3FHN A;  1YG2 A;  3K0L A;  3LNQ A;  4KT6 A;  4S05 A;  1FX7 A;  1SFO J;  1WFX A;  1PUF B;  1R1U A;  3WHB A;  5IP9 J;  3W2A A;  4RB0 A;  4E7I A;  5F5E A;  2CS3 A;  1E2X A;  2JMW A;  4NC8 A;  1ORK A;  5GPA A;  3F8C A;  3SQN A;  2W24 A;  3DTK A;  4KN7 X;  4WXD A;  2KLO A;  2R7W A;  4XL9 A;  2Z1D A;  4AIJ A;  3N97 A;  3P9K A;  1VQO I;  1D0X A;  2QBY A;  2CJJ A;  1DGR M;  2LKS A;  3B73 A;  2BY1 A;  1XSV A;  1OR7 C;  2E1N A;  1FIP A;  3O2P E;  3OV8 A;  4EJV A;  1R4N B;  1WPK A;  3ERE D;  2DYS H;  2DBB A;  3ZQH A;  1MBH A;  1MSE C;  2E1O A;  1EF4 A;  2JJ7 A;  1ACI A;  2CV0 A;  4IOC F;  4ANJ A;  1YFH A;  1XGS A;  3ZQ7 A;  1LB2 A;  1I3Q J;  5ILS A;  3ROU A;  5KVR A;  3KP6 A;  1VI0 A;  5IP6 A;  4XRS G;  4CHU A;  1R5G A;  2C6Y A;  2L54 A;  1QO0 D;  4A0Y A;  3LSM A;  3U9G A;  2NS8 A;  2Z99 A;  3K4M A;  3FMR A;  1BIB A;  1S5L C;  1XPX A;  3K9T A;  2DI3 A;  5JI6 A;  3BOQ A;  4JP0 A;  1T95 A;  4HRI A;  3GLX A;  4NDL A;  3PQJ A;  5LGN A;  2HYJ A;  3HOT A;  3K2Z A;  2DN0 A;  4BDZ A;  4C2T A;  3BJ6 A;  2TRT A;  1BW5 A;  2R4G A;  2R5Z A;  4HAM A;  2ISZ A;  1YE9 A;  1GVD A;  3Q0U A;  4RAF A;  4XN3 A;  1U8B A;  1YJN I;  3JRC A;  3OS1 A;  2DOA A;  1HW1 A;  4AVP A;  3SWC A;  3G1O A;  3LAP A;  3AL0 C;  4WWC A;  2KPM A;  3FBI B;  2H6C A;  4MNU A;  3A4C A;  2EZL A;  2PQ8 A;  1HCR A;  4NVQ A;  3DU5 A;  4M3E A;  1XG1 A;  3NEU A;  2W84 A;  3H5N A;  3JRF A;  5KHD A;  2K9L A;  3OL4 A;  3HUG B;  4BYY A;  1K79 A;  5ED4 A;  5F6L A;  9ANT A;  3OY9 A;  3T8R A;  3U2R A;  4IJA A;  3RKY A;  3GBG A;  2UZK A;  2E7X A;  3AL0 B;  4NC6 A;  2QGU A;  3ABM H;  1IUF A;  1QNT A;  4JBA A;  3SW9 A;  4RM2 A;  3KFW X;  3J81 K;  4I7H A;  3QOP A;  4KIG A;  1JUS A;  2JUC A;  3CC2 I;  3H35 A;  4G6D A;  2P5K A;  4J19 A;  1X4O A;  2V9K A;  1IF1 A;  3V7S A;  3F9Y A;  2XKO A;  3L2R A;  4LK1 F;  4A69 C;  4XN0 A;  5GAG J;  2VXZ A;  4XNF A;  2DA7 A;  1XS9 A;  4XLP F;  3MKY B;  2WB1 N;  4N9H A;  1U78 A;  3O3K A;  1WZ2 A;  2V9P A;  3WG9 A;  3HZJ A;  1SC7 A;  4CO8 A;  2VQG A;  1A6I A;  1SD4 A;  3T1B A;  3HTS B;  1WJC A;  4YII A;  4N4N B;  1N6C A;  1G59 A;  3BG5 A;  3GZ6 A;  3IAM 2;  3CBM A;  3I59 B;  5B1B H;  3BG7 A;  3LSP A;  2R92 J;  1BR4 A;  1B8I B;  1FOY A;  1K4S A;  4LG0 A;  1I6H J;  2KIM A;  1LUJ B;  3CCE I;  3PSI A;  3CC7 I;  3G1M A;  2CUF A;  1V55 H;  2HDW A;  3CD6 I;  3GTO J;  4BE1 A;  1FYM A;  2PMZ N;  3QWW A;  4L18 B;  2BOL A;  2OC6 A;  1XCB A;  4LB6 B;  4GYI A;  3WGI A;  1DU6 A;  1ZQ3 P;  2P81 A;  2KDZ A;  1N25 A;  1ZK8 A;  5HNH A;  4RB3 C;  4L9N A;  2Y2Z A;  4PJN A;  3FXO A;  4PK4 A;  1ZTR A;  2VBY A;  4PDK A;  3GO5 A;  3H0D A;  1ZRC A;  1B59 A;  1YS7 A;  3CUQ A;  4XKC A;  3VYU B;  2DTR A;  2W85 A;  5K5Q A;  2LNB A;  2XPU A;  3GWZ A;  1XMA A;  2COM A;  2F5E A;  3HSR A;  1WI3 A;  1UG0 A;  1BBY A;  3DEW A;  3FBN B;  2E19 A;  2FML A;  2QQ8 A;  2VKD A;  3A01 B;  1IDZ A;  2RNG A;  5F0C A;  1F9N A;  2JA2 A;  1SD5 A;  3WTV C;  3S16 J;  3H3Z A;  2VOD A;  1WQ2 A;  2ZNY A;  3CCL I;  1TQI A;  5KJL A;  5E20 A;  3L09 A;  2GBY A;  3K6G A;  4R79 A;  1ZKK A;  1DU0 A;  2P0W A;  1GDT A;  2BYV E;  2LF7 A;  3OSG A;  2JSC A;  5L3D A;  2VUM J;  4D9J A;  2XB0 X;  3Q0W A;  1YQA A;  2QEN A;  3IAS 2;  3LA7 A;  2JPC A;  3BQZ A;  4RMN A;  1ZGA A;  2ZXJ A;  1U6G A;  2LLK A;  3OOP A;  1FT9 A;  4XLN F;  2YSR A;  1IRX A;  3M3Y J;  2X6O A;  2DK5 A;  2MD0 A;  3L9F A;  4ZJZ A;  4CYC A;  3OSF A;  3TQN A;  2V1D A;  1Z05 A;  4UXN A;  5K7F A;  2V1X A;  2EWN A;  1MND A;  1ZR4 A;  4RGS A;  3HOX J;  2E34 A;  2KKO A;  2O03 A;  4HYE A;  5FRN A;  1BR1 A;  2OQR A;  1UJ8 A;  1YHQ I;  2GA2 A;  1KQ9 A;  5LGU A;  2HYF A;  2QM3 A;  3VB2 A;  3ABU A;  2OTL I;  2F4O B;  4ZZL A;  5GP9 A;  1O3R A;  3M7G A;  3DV8 A;  2FBI A;  2IXS A;  2W48 A;  4MLO A;  1D0Y A;  3WOD F;  3J80 Z;  2LOO A;  4LLL A;  2EH3 A;  3JW4 A;  3TO7 A;  3V8K A;  2NVQ J;  2QA4 I;  3QPS A;  3M1C A;  5LEJ A;  2K9M A;  1ZG1 A;  1UAA A;  2DW4 A;  3BG6 A;  1O4X A;  5D5X B;  2D2W A;  1ETX A;  2MGQ A;  1MSF C;  2L9V A;  2VJ4 A;  1TQP A;  1P7J A;  5TTF A;  2KL4 A;  3HBL A;  3K70 D;  2HXO A;  5EX3 A;  3L1P A;  2EV0 A;  4I51 A;  3HB9 A;  3C2B A;  3FX3 A;  4XON A;  2LBF A;  4A6D A;  2JA5 J;  2HKO A;  3NWS A;  3DEU A;  3DKY A;  2Q2E A;  1G3S A;  5F27 A;  4C3I J;  4OWR B;  5CQE A;  1JT0 A;  4HST A;  3RPU D;  4CUG A;  5J6X A;  3REO A;  2DPD A;  4MO7 A;  3GME A;  1ZR2 A;  4M6V A;  2MA3 A;  1XCV A;  1JT6 A;  3CTA A;  5F6K C;  4Q47 A;  2JK3 A;  3EUA A;  1MBK A;  2MC3 A;  1T0F A;  2CGP A;  4HF1 A;  1QU3 A;  1I50 J;  2CG4 A;  3JRA A;  1BA5 A;  4MFE A;  1HKQ A;  1BM9 A;  2L7K A;  3ZXS A;  1UMQ A;  4OIQ F;  3MMY B;  5JLX A;  1KYW A;  4IQJ A;  2X6Y A;  2XAS A;  3W6J B;  1R71 A;  3OS2 A;  4LOC A;  5DYM A;  3PNT A;  2H27 A;  2DMQ A;  3DTI A;  1X2M A;  5D5W B;  5T0M A;  3HEF A;  1UZC A;  1Z9C A;  3OMY A;  4ZYD A;  4CSW A;  1IN7 A;  4MTE A;  2LYC A;  3HHH A;  3JRI A;  3RAY A;  4YEJ A;  4C9Y A;  3P9I A;  5DV5 A;  5H6R A;  4FAS D;  1D1C A;  4QLC U;  1ZLJ A;  2HQA A;  1SVO A;  1GT0 C;  3PFI A;  2CUJ A;  4XSX F;  5J40 A;  4CCM A;  5F0H A;  1VQP I;  5EX0 A;  3HC7 A;  3V8J A;  2STW A;  3HNA A;  2DK8 A;  3O6B B;  2ME0 A;  3QPH A;  3HRT A;  2XGC A;  4O3M A;  3HGY A;  4X1E A;  1QBJ A;  2UUZ A;  2DXI A;  3A1Y A;  3I5U A;  2IS2 A;  2HI3 A;  2QQB A;  5IOY A;  2WB1 A;  2O3F A;  4E7K A;  1TWH J;  1ITY A;  1N75 A;  3B6A A;  2COB A;  4MTD A;  4IRG A;  2K40 A;  3BR2 A;  1CF7 A;  4HDU A;  1HQC A;  2DQL A;  2QZ8 A;  1WJE A;  4KFC A;  2M30 A;  4LDG A;  1XGM A;  5H6Q A;  5F0F A;  3S7D A;  3FXJ A;  4O30 A;  1XSD A;  3BR0 A;  3EUH C;  2AQE A;  5KJM A;  4PGH A;  2JA6 J;  1D0Z A;  2DDA A;  3RPU A;  1Y0U A;  2WV1 A;  2RDP A;  3RZD J;  2IA0 A;  3KZZ A;  2M4G A;  4CIC A;  2OA4 A;  2V6E A;  1G2H A;  2PMZ A;  2KMU A;  3GF2 A;  2M9H A;  4LJZ F;  1LFP A;  5GTI C;  1D3Y A;  3Q5F A;  2ESN A;  1J5Y A;  1ZRD A;  4BJ6 C;  1K78 B;  2NXN B;  2D5V A;  5E17 F;  3G1L A;  4RGR A;  1K6O A;  3CJN A;  3FM3 A;  3MVP A;  5H20 A;  2NOG A;  2R0Q C;  1J59 A;  1H9T A;  4LK0 F;  4DIQ A;  1EJ9 A;  2LRD A;  3PDN A;  3F22 A;  2LY9 A;  1IC8 A;  4C3J J;  3FXR A;  1XMX A;  2WBM A;  5FRO A;  3OYJ A;  3BO5 A;  1OCT C;  4JLG A;  2X1C A;  1E3P A;  3CCQ I;  5JVG F;  2L7M P;  2X4H A;  3G6E I;  2F2E A;  2O8X A;  1ZLK A;  1F4K A;  1T2K A;  2XVC A;  3DPT A;  2YUS A;  3PSF A;  2EFP A;  2LKP A;  2NVX J;  2DMT A;  3TG4 A;  1X1C A;  2CQX A;  3GEZ A;  3CJQ B;  4PFO A;  1EH8 A;  5EDN A;  2HDD A;  3M59 A;  4PJL A;  4L5E A;  2P5V A;  3BJA A;  1B72 B;  3E3V A;  3VOE A;  4KIS A;  3S7J A;  4S04 A;  1TL8 A;  1ZRE A;  3TL4 X;  4QEN A;  4YPE A;  4A3E J;  2XF6 A;  1C0W A;  5HS7 A;  2IA1 A;  4RGX A;  4GCV A;  4J83 A;  3S8P A;  3I54 A;  1XB4 A;  2QSH X;  1IV6 A;  5JJ0 A;  3ZMZ A;  4CCK A;  2WAF A;  1A04 A;  2CQ7 A;  3RYR A;  3WE3 A;  4YIR X;  1D8J A;  4YND A;  3HOS A;  5TRD A;  2FXA A;  1JXS A;  3CP2 A;  2ZME A;  3MZ8 A;  2CV2 A;  3BPX A;  5FKM A;  1ZYR F;  2M4K A;  2V6C A;  5FGM A;  3DFG A;  1VQ4 I;  2E2J J;  3V8L A;  3K4L A;  4HNT A;  1MNM C;  5IT9 Z;  2PEX A;  3LSK A;  4XOR A;  2XAJ A;  1N77 A;  2K4J A;  2R5Y A;  1Z67 A;  3I9V 2;  4LLG F;  1OMI A;  4IHX A;  3ZN0 A;  4BE2 A;  3GFI A;  1D8K A;  3LFU A;  3TW7 A;  2KRH A;  1Z6R A;  2R7Q A;  3K10 A;  1RES A;  1QZZ A;  2W57 A;  4OMY A;  4YPU A;  2I8D A;  1IGN A;  1HKS A;  3NAR A;  3QOE A;  1MMA A;  1KZH A;  3ZMS A;  5HDK A;  2V1U A;  4KYW A;  4CGZ A;  1KU3 A;  2VB6 A;  3FPD A;  3DU6 A;  2P8T A;  1U9N A;  2XAQ A;  3A0H C;  4UV9 A;  2PX9 A;  1MBF A;  3CLO A;  2PJR B;  4B3X A;  5HLT A;  5KJK A;  4J7I A;  1OJL A;  1I39 A;  3FHZ A;  5K5O A;  5IOZ A;  3DB5 A;  5BMZ A;  2FSW A;  5CPR B;  4E7L A;  1X1D A;  5CKT A;  3W3C A;  3BLY A;  4R8H A;  2K3P A;  1HKT A;  3ZRG A;  5ILV A;  2XSD C;  1Q1H A;  2OPT A;  4YIF A;  1E3H A;  5FB2 A;  4ESF A;  1QQI A;  2ZJ2 A;  2XAF A;  4HLX A;  3SYT A;  5KJN A;  1BR2 A;  2XGD A;  2R5Z B;  2KDO A;  1Z7U A;  3CF2 A;  3SEZ A;  4F7Z A;  4Z4P A;  4I0B A;  1W36 D;  1IJW C;  4ZZD A;  5DDG A;  2A5W A;  4D1Q A;  4G7O F;  4F55 A;  3WTY C;  3ZQG A;  5LD2 C;  3HOY J;  3GUD A;  2EZI A;  2CFO A;  3LFK A;  5DUK A;  3KP5 A;  1ULY A;  1PJR A;  2D1V A;  4XKB A;  2XPW A;  2L9N A;  3HG9 A;  3M56 A;  2R7F A;  2HWV A;  3ZQC A;  4JYK A;  5F6F A;  2LP0 A;  3CQZ J;  2RAE A;  5IPA A;  4BQA A;  5FLM J;  2LVS A;  2OD5 A;  4V2G A;  3VPR A;  1BC8 C;  3KLO A;  5J1U A;  5FFX A;  2FOW A;  3BTJ A;  4OOI A;  4HQE A;  2R7V A;  3J7A O;  3M8J A;  5J8C A;  4GFB A;  3M4O J;  1R5I D;  2RQP A;  4WXC A;  3KYL A;  3E6C C;  1S6L A;  3UNG C;  3M57 A;  1MDM A;  1Y1V J;  1MD0 A;  3ZCO A;  4U88 A;  5F08 A;  2OAZ A;  1T56 A;  3ASO H;  1V4R A;  2GZW A;  3HKZ N;  4E6K G;  2VIX A;  3VSL A;  1TNS A;  3GZ5 A;  3KPH A;  1RI7 A;  1BW6 A;  1GXQ A;  2ECC A;  5DD4 A;  5IT3 A;  1QHH D;  3MEX A;  2K3F A;  2HQR A;  2X0L A;  3JRG A;  1XDU A;  3H3U A;  1FSE A;  4JOM A;  3P7N A;  2ID6 A;  2WTE A;  3MN2 A;  2ETH A;  3J7Z I;  3S2D J;  3CMY A;  4FE4 A;  3D1N I;  3IP4 B;  1A36 A;  1W0U A;  4QPO A;  4HSR A;  2JRT A;  5HLH A;  4HEA 2;  5DM6 F;  3W2W A;  3OYK A;  1N6A A;  3S3M A;  4BKX A;  1NH3 A;  2O6G E;  3ML6 A;  4IJ8 A;  1TWF J;  3BP8 A;  3WTU C;  2R7S A;  5J4Y A;  1UHM A;  5KNL A;  3DWL E;  4CZZ A;  5ICG A;  2X6X A;  2EIN H;  4KT5 C;  3CUQ C;  4EJO A;  4U7B A;  3GTG J;  2CRG A;  2F5D A;  4V19 K;  5E8G A;  2M45 A;  2FBK A;  2GA1 A;  2XB5 A;  4ITV A;  4P9F A;  1E3O C;  3SDG A;  3QP5 A;  4BQQ A;  3QU3 A;  2RC4 A;  3ZP5 A;  4L5J A;  1EH6 A;  2H6B A;  4BL0 B;  3DCF A;  3OXL A;  4C1Q A;  1DQU A;  2K9Q A;  5J3L A;  2RVC A;  4F52 A;  1P6R A;  5C44 J;  2WWY A;  3RI4 A;  2GLO A;  1S7O A;  3CO6 C;  1H89 C;  4EM0 B;  5EGO B;  5CVV A;  2JN6 A;  3CCJ I;  1GV2 A;  1KGS A;  3I55 I;  4YNM A;  2HPI A;  3HRS A;  3ASN H;  4LLN A;  2R7T A;  3F9W A;  3U1K A;  5JHU A;  5M3F J;  3GTL J;  1P4X A;  1H0M A;  1MGT A;  2H8W A;  2MLK A;  4M71 A;  1I1G A;  4I98 B;  4Z2Y A;  4IXA A;  4ZDO A;  5F04 A;  1TC3 C;  1E17 A;  1TW2 A;  2Y9Z A;  2EZK A;  1JE8 A;  2IGM A;  2DYR H;  2Y31 A;  1JKP C;  4XID A;  3L2U A;  3KP3 A;  4A3I J;  2VQH A;  4A5M A;  1BOA A;  1ERD A;  5EG0 A;  1VF9 A;  3EET A;  1SAU A;  5M5X J;  3OR2 C;  1BJA A;  5EJC A;  3GTJ J;  4EJU A;  4BNC A;  4X6A J;  2MSY A;  3DXJ F;  4A3M J;  3QYB A;  3S3N A;  1FPQ A;  1R1T A;  4OIP F;  4LGW A;  2WY8 Q;  2Y9Y A;  5FD6 A;  4YFK F;  2O8K A;  3BTC A;  3RQ4 A;  3R0A A;  3AFH A;  3WG7 H;  4BQN A;  4RB2 C;  1IXS B;  2E5N A;  3RQI A;  1IRZ A;  2LH9 A;  1D5V A;  5K7Z A;  4G7Z F;  1X19 A;  1WCM J;  2HOE A;  1YIO A;  2CYY A;  4UB6 C;  4HPQ A;  1ZRF A;  2ZB9 A;  3DTE A;  1LDD A;  3LSJ A;  2CWE A;  1U5T A;  5M3M J;  5AIP A;  2A05 A;  2KIF A;  3WE2 A;  3QWP A;  1GHC A;  5E1Z B;  1BC7 C;  2EA2 A;  3HRM A;  3IRR A;  3J80 K;  1SFK A;  1UST A;  4N0B A;  1WI9 A;  4MHG A;  1JHH A;  3S2H J;  1SMT A;  5D5U B;  4NJ5 A;  4IJD A;  1XGN A;  2GOX B;  2VC1 A;  4M6X A;  4Y3O A;  3RCO A;  4RS8 A;  4XBF A;  2O5R A;  4OIO F;  2JV0 A;  4FX4 A;  3BZ6 A;  2UXN A;  1JKR C;  3KMA A;  3PUB A;  2MAB A;  2HS5 A;  5K1Y A;  1OCC H;  2MC4 A;  1MJA A;  3F0C A;  4MEY F;  1K7A A;  2XGE A;  4KIC A;  3I0T A;  3OYH A;  1V3F A;  3DKW A;  3N05 A;  1HA8 A;  3F6V A;  4IVN A;  1TWG J;  3CF5 F;  3BC8 A;  1MBG A;  4I02 A;  2YU3 A;  2IP2 A;  1ENH A;  3TOA A;  3E6B A;  4AD9 A;  4PZJ A;  1RKW A;  5J8F A; 
#chains in the Genus database with same CATH homology
 2LOO A;  3MO0 A;  3KEY A;  2VPL A;  2VXD A;  4CCL A;  4AU7 A;  2ELJ A;  3M1C A;  2GOM A;  2K9M A;  2W1O A;  4NUB A;  2RRE A;  1X4P A;  4PJM A;  1UAA A;  4J00 A;  3BG6 A;  2VAS A;  1S9H A;  3RTR A;  3W2V A;  2VJ4 A;  3F9Z A;  4FMU A;  5TTF A;  2KL4 A;  3K70 D;  4BS9 A;  3C2G A;  5EX3 A;  4I51 A;  4XON A;  2LBF A;  1WJA A;  4HG2 A;  2XSJ C;  3IUO A;  4J8O A;  3NWS A;  3DKY A;  5TH7 A;  4OWR B;  5CQE A;  4NNJ A;  1MMG A;  4HST A;  3RPU D;  4CUG A;  2HVR A;  3CP8 A;  4PSX A;  2UWM A;  2HU9 A;  3ZR8 X;  1V5G A;  5F6K C;  3H5A A;  3OS5 A;  3EUA A;  3F9K A;  3H9G A;  1QU3 A;  4YNP A;  2L9S A;  3OYL A;  2KP6 A;  3S7B A;  3OYG A;  2L7K A;  1DGW Y;  4ZC3 A;  3ZXS A;  4AVZ A;  3MMY B;  3HKZ A;  3MEK A;  4HNU A;  5CCL A;  4IQJ A;  2X6Y A;  2BW3 B;  5HNF A;  5EG2 A;  5F59 A;  2WY7 Q;  3OS2 A;  1MVX A;  3PNT A;  4B48 A;  2RFI A;  3DTI A;  5T0M A;  2V26 A;  3UR3 C;  3OMY A;  3OYI A;  2XAU A;  1K6Y A;  2CW7 A;  4CSW A;  2VJJ A;  2LYC A;  3RAY A;  4NQW B;  2JSP A;  4YEJ A;  4C9Y A;  2WAD A;  2CW8 A;  4FAS D;  1D1C A;  1MMD A;  3CMM A;  3ZGK A;  2HQA A;  3PNY A;  2CUJ A;  4XLE A;  2W4S A;  3OYE A;  3PL8 A;  4CCM A;  1Z7L A;  5EX0 A;  3HC7 A;  1FMV A;  1V5F A;  3HNA A;  2LG4 A;  4BQO A;  3OPE A;  4BEH A;  2Z2S B;  1WJD A;  5CCM A;  2UUZ A;  2DXI A;  4F91 B;  3A1Y A;  4Y33 A;  4DBR A;  2IS2 A;  2W00 A;  1TT0 A;  3LMM A;  2MFZ A;  1ML9 A;  5T5G A;  2WB1 A;  4E7K A;  2BW3 A;  3MO5 A;  3K4N A;  4XLF A;  1N75 A;  4QEO A;  5LSZ A;  1VZ0 A;  3DPL C;  3M58 A;  2VJ5 A;  4CZC A;  1XQH A;  1WJE A;  4LDG A;  4O6F A;  3S7D A;  2V4J C;  4O30 A;  4YRV A;  2X51 A;  3EUH C;  4ZYA A;  1DP3 A;  2AQE A;  5KJM A;  3H5R A;  3FDY A;  4JQF A;  1WJ5 A;  3DKX A;  1D0Z A;  2Q1Z B;  1Y56 A;  4BDY A;  4N4O B;  4ZDL A;  1AA7 A;  3RIB A;  4RLQ A;  3D5R C;  2IS4 A;  2XF7 A;  2LC2 A;  1YX5 A;  2M4G A;  2V6E A;  2PJR A;  2PMZ A;  2KMU A;  3HXL A;  2ZXI A;  1LFP A;  4ZTJ A;  2VLA A;  3MO2 A;  2VJI A;  1LVK A;  2ZSI B;  4B43 A;  3SEQ A;  2JVH A;  3E0J B;  4BJ6 C;  4NC7 A;  2DT6 A;  4XR6 A;  4MI0 A;  4II2 A;  1WJF A;  1T0F C;  2E60 A;  3OS0 A;  5LFA A;  2LBF B;  5JIN A;  1R6R A;  5KCM A;  3S3O A;  2Q2E B;  4DIQ A;  3PDN A;  2LRD A;  3DEE A;  1JI8 A;  3TMO A;  4PSW A;  2XC7 A;  2CMP A;  5HI7 A;  5FRO A;  2LY1 A;  2WBM A;  2DJI A;  3LSG A;  2X1D A;  2W5Y A;  2M7B A;  2K5C A;  3OYJ A;  3DLA A;  3FKJ A;  3OYA A;  2DCE A;  2M0M A;  3BO5 A;  4JLG A;  2X1C A;  3EPZ A;  4LIT A;  4IX7 A;  3VV0 A;  4Y4R A;  3OXG A;  3VUZ A;  2VQL A;  4E47 A;  2M7A A;  2E5Z A;  4XMY A;  3DPT A;  3LSH A;  2WAE A;  2XF5 A;  3PSF A;  3S7F A;  2AQF A;  4LIU A;  3RSN A;  4F93 B;  2HZD A;  2O8J A;  3TG4 A;  1X1C A;  4XKW A;  3K5K A;  5TEG A;  3CJQ B;  2VL8 A;  4PFO A;  1O9S A;  4XQF A;  3OYF A;  4H12 A;  3VYR B;  2KRC A;  3M59 A;  2ZSH B;  2QKM B;  4PJL A;  1Z21 A;  4KIS A;  3S7J A;  4CA0 A;  2Z16 A;  3TL4 X;  2IGN A;  4XOT A;  4E7J A;  4QEN A;  4YPE A;  2XF6 A;  1E0E A;  4KIT B;  3KMJ A;  3CBP A;  2R3A A;  4C30 A;  4J7F A;  4CCO A;  2JUG A;  2BQZ A;  1NG6 A;  4J83 A;  3S8P A;  2V7F A;  2JVG A;  2CH0 A;  2R7X A;  2X85 A;  3PJR A;  5JJ0 A;  4CCK A;  4ZTF A;  2WAF A;  3SZG A;  2R7U A;  1BOB A;  3LSI A;  4BEH B;  2OUM A;  4YND A;  3HOS A;  2VKH A;  4GRI A;  2QPW A;  3DQV C;  3CP2 A;  4RLF A;  3K70 C;  2CV2 A;  5T0K A;  3OYC A;  3KMT A;  4II3 A;  2M4K A;  2L5Q A;  3MD2 A;  3A2K A;  4QEP A;  2CUZ A;  3HPH A;  3K4L A;  4HNT A;  3NWT A;  3OYB A;  2WAQ A;  4KJZ A;  3LSK A;  4XOR A;  1N77 A;  2DT7 B;  2XDV A;  4XKV A;  4ZDP A;  3I9V 2;  4B44 A;  3MKW B;  3PFY A;  3V42 A;  4DJA A;  4E7S A;  4X0G A;  4BE2 A;  3LFU A;  2KRH A;  4BE0 A;  2R7Q A;  3K10 A;  2F5V A;  1LKX A;  3FHN A;  4H4K C;  2HVS A;  4F92 B;  1MNE A;  2F69 A;  4KT6 A;  2I8D A;  4YPU A;  3QOE A;  4PUS A;  1MW7 A;  1MMA A;  1WFX A;  3W2A A;  2F4I A;  2VB6 A;  3FPD A;  3DU6 A;  3OR1 C;  4E7I A;  3L2V A;  4CCN A;  5F5E A;  2CS3 A;  2OV7 A;  2PJR B;  2ZFU A;  4B3X A;  5HLT A;  5KJK A;  2HPM A;  4J7I A;  3QYE A;  4NC8 A;  3DB5 A;  1Z3Y A;  3C2H A;  5CPR B;  4E7L A;  1WJB A;  1X1D A;  5CKT A;  3BLY A;  1G8X A;  1PYV A;  2K3P A;  3DPU A;  4XM3 A;  3W3C A;  3ZRG A;  3DTK A;  4CH7 A;  2R7R A;  2KLO A;  2R7W A;  4XL9 A;  2Z1D A;  1YX3 A;  1D0X A;  1N78 A;  1DGR M;  3SYT A;  5KJN A;  1BR2 A;  1OR7 C;  3CBO A;  2KDO A;  2UV1 A;  3CF2 A;  3SEZ A;  1NG7 A;  4Z4P A;  1W36 D;  3OYD A;  2A5W A;  4D1Q A;  2LY2 A;  4F55 A;  4LG3 A;  1ZEL A;  3MKZ A;  4ANJ A;  3HL2 A;  5LD2 C;  2CV0 A;  2CFO A;  2KZV A;  4BXF A;  1P9Q C;  2IS6 A;  1PJR A;  3VYS B;  4XKB A;  2L9N A;  3LSM A;  3HG9 A;  3M56 A;  4LIV A;  3QYF A;  3K4M A;  2R7O A;  4XLC A;  2M3A A;  3CZ6 A;  2IGQ A;  5ARG A;  3VYT B;  3PNV A;  2WA0 A;  4E7H A;  1T95 A;  4U87 A;  4HRI A;  2W7N A;  2Y0S A;  2R7V A;  2HNH A;  3M8J A;  4WUY A;  2IGK A;  3HOT A;  5FRM A;  4YPA A;  4BDZ A;  2KHM A;  3D5L A;  3KYL A;  4C2T A;  3G2B A;  2R4G A;  3UNG C;  2BVL A;  2F6C A;  3M57 A;  1YE9 A;  4XN3 A;  1EA3 A;  4DOZ A;  2MYS A;  3ZCO A;  3S93 A;  4OAZ A;  3OS1 A;  5HQ8 A;  2DOA A;  1MT6 A;  1J09 A;  3SWC A;  3K4J A;  5JHN A;  3AL0 C;  4E6K G;  2A6T A;  2VIX A;  3VSL A;  2KPM A;  3FBI B;  3F9X A;  3A4C A;  4BU2 A;  4JDS A;  4NVQ A;  3DU5 A;  2IGO A;  1QHH D;  2CV1 A;  3BCA A;  3VDX A;  3H5N A;  4JOM A;  3ONQ A;  4XOP A;  5KHD A;  2K9L A;  3OL4 A;  3HUG B;  3RU0 A;  3H9J A;  5F6L A;  3OY9 A;  2IS1 A;  3GBG A;  3IP4 B;  3AL0 B;  3SW9 A;  4IZZ A;  2X1E A;  3I3L A;  4HSR A;  4QPO A;  4RM2 A;  2LRE A;  4C2U A;  3SDB A;  4XLA A;  4HEA 2;  3EUK L;  3W2W A;  3OYK A;  1N6A A;  2E1M C;  3S3M A;  3H35 A;  4RZ0 A;  3QOD A;  3OYN A;  4IJ8 A;  1MVH A;  3TG5 A;  1X4O A;  2V9K A;  2R7S A;  5KNL A;  5HVQ C;  3DWL E;  1V5E A;  3F9Y A;  3L2R A;  2X6W A;  2X6X A;  2ZXH A;  3KX2 A;  4XN0 A;  2VXZ A;  4U7B A;  4IQ4 A;  4XNF A;  4BAC A;  4E4H A;  4MI5 A;  3BCB A;  3MKY B;  1D1B A;  4B47 A;  2L2O A;  4ITV A;  2E1M B;  4XLH A;  4BJ5 C;  3RJW A;  3OIP A;  4BQQ A;  1X1A A;  2VQC A;  2VQG A;  1D1A A;  1WJC A;  4BL0 B;  1N3J A;  4N4N B;  3K4B A;  1N6C A;  1G59 A;  5AYF A;  3E1S A;  1Y6I A;  3OXL A;  4C1Q A;  1DQU A;  4F52 A;  1MUF A;  3IAM 2;  3OIQ A;  3CBM A;  1OLT A;  3L2W A;  4EAT A;  1Z3X A;  3EP0 A;  5JIY A;  3BG7 A;  1BR4 A;  4BGD A;  3PSI A;  4YNM A;  2HPI A;  1PEG A;  2HDW A;  2R7T A;  3F9W A;  5TGT A;  1FMW A;  4YEL A;  3M5A A;  4BUP A;  4BE1 A;  5HOO A;  3DAL A;  3IHX A;  3OXF A;  3OYM A;  3QWW A;  4G6T B;  2RQQ A;  4J01 A;  3D5S C;  3M53 A;  2BOL A;  2OC6 A;  4ZDO A;  2W5Z A;  5HNH A;  4DBQ A;  3AKZ A;  2IGM A;  3K4K A;  4PJN A;  4PK4 A;  1TZL A;  3L2U A;  2QKL B;  3U21 A;  3CES A;  3H0D A;  2VQH A;  1ERD A;  4XKC A;  3VYU B;  5JHF A;  1GLN A;  1SAU A;  5CQG A;  3TBI A;  3CJR B;  3OR2 C;  1QHG A;  3VSK A;  1UEL B;  1UG0 A;  3LL7 A;  3FBN B;  3M55 A;  1X1B A;  2VKD A;  3QYB A;  2RNG A;  3S3N A;  2JA2 A;  2WY8 Q;  2V1N A;  4F3Q A;  3OOU A;  3RQ4 A;  4BQN A;  3AFH A;  4OAY A;  2E5N A;  4P5O A;  2LH9 A;  5KJL A;  4PFP A;  4DGW B;  4BJT A;  1X19 A;  3K6G A;  4HPQ A;  4R79 A;  1ZKK A;  2P0W A;  3DTE A;  4RM3 A;  4E7Z A;  4D9J A;  3M54 A;  1MMN A;  3QWP A;  2FUG 2;  3S32 A;  1W36 C;  3IAS 2;  1LDK B;  1SFK A;  4RMN A;  4QPQ A;  2NOJ B;  1IRX A;  4P1W A;  2HVQ A;  5LSX A;  4NJ5 A;  3QWV A;  4IJD A;  2GOX B;  3HPG A;  2MD0 A;  4Y3O A;  4ZJZ A;  3ZQQ A;  3RCO A;  2O5R A;  2JV0 A;  3OOI A;  5ARF A;  4FET A;  4CCJ A;  1MND A;  2BVM A;  4AYB A;  1H3I A;  3KMA A;  3PUB A;  2MAB A;  5FRN A;  3OL3 A;  2G46 A;  3OWT A;  2MC4 A;  1BR1 A;  1KON A;  3N71 A;  3L2Q A;  3OYH A;  3H9Q A;  3N05 A;  1HA8 A;  4IKF A;  2KQR A;  3VWB A;  4PJJ A;  3K4C A;  3BC8 A;  1U0J A;  3J7A Y;  2IXS A;  4MLO A;  1D0Y A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...