4BUPA

A novel route to product specificity in the suv4-20 family of histone h4k20 methyltransferases
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
232
Chain Sequence
b'GSHMSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1
publication title A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 73
structure length 232
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bupA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4bupA02
2RFIA 1O9SA 4YNMA 4FMUA 3M55A 1PEGA 5KJKA 3MO2A 3CBPA 3K5KA 4J7IA 3CBOA 1XQHA 4I51A 3M54A 5EX0A 2O8JA 3M53A 3OXFA 4YPEA 3FPDA 3SW9A 4WUYA 5TTFA 4O6FA 5T0KA 1MVXA 4Z4PA 3S7FA 4JDSA 4BUPA 3F9WA 5ARFA 4QENA 1N3JA 3DALA 3QWVA 2BQZA 4H12A 3RU0A 2W5YA 2G46A 4NJ5A 3KMAA 4IJ8A 5CPRB 4J7FA 3DB5A 3QWPA 2JV0A 3KMTA 2R3AA 3M5AA 1ML9A 3OOIA 3MEKA 4J8OA 4QEOA 2QPWA 4NVQA 3M56A 3OXGA 4IJDA 3F9ZA 3RJWA 3MO0A 3S7JA 4J83A 5F6KC 5T5GA 4C1QA 5KJNA 4O30A 3PDNA 4QEPA 5LSXA 5JIYA 5T0MA 5HQ8A 4YNDA 3VUZA 1MUFA 3IHXA 1ZKKA 4LDGA 1N6CA 3M57A 5AYFA 3RAYA 5CCLA 2W5ZA 4RZ0A 5CCMA 5LSZA 3TG5A 5TEGA 3M58A 3RQ4A 3QWWA 5EG2A 4YPUA 1N6AA 3S8PA 5JHNA 3OS5A 4E47A 5JJ0A 3F9YA 3MO5A 4MI0A 5ARGA 3S7BA 5EX3A 3RIBA 2F69A 1H3IA 3M59A 1MVHA 4JLGA 3BO5A 3OXLA 3KMJA 1MT6A 4AU7A 5KJLA 3F9XA 3N71A 3VV0A 4YNPA 3CBMA 5F59A 5F6LA 2IGQA 5TH7A 5F5EA 5KJMA 5JINA 3SWCA 3EP0A 4MI5A 3TG4A 3OPEA 4YPAA 5HI7A 3HNAA 3S7DA
chains in the Genus database with same CATH superfamily
2OC6A 4IVNA 3OYMA 5HDNA 5GPAA 1YHQI 3CUQC 4OAZA 2HWVA 4W97A 1ETOA 2LR8A 4FE4A 1MSEC 1AHDP 2W4SA 1IO2A 1J2XA 4B47A 2FNPA 2X1DA 4ON0A 5FLXZ 4IRGA 4RGSA 5CLSA 2R7SA 1HXDA 2VBXA 1D5YA 1ON1A 3Q3SA 3RKQA 2MG4A 1FBUA 1HW1A 2JA5J 1GLNA 4WUYA 3K2AA 4Z6YA 3BR2A 5T0KA 4XOPA 4P55A 3IH4A 2G0EA 3BR6A 1R1UA 5LLQA 2MD5A 2HQ5A 3F9WA 3OYFA 1VQMI 4BKXA 3QWVA 3PL8A 2Y75A 3BZ6A 5HODA 1XGNA 4UUVA 2GAUA 4H12A 1EKEA 2W5YA 3PIOF 1SD6A 2IA1A 2NXNB 2RVCA 3KETA 1UG0A 2VKEA 4PJ0C 5JVTA 3I4PA 5CPRB 4DYRA 2MC3A 1IV6A 2DFIA 1G59A 4UUSB 3MMYB 2ZMEB 1D1CA 3KEOA 5ERIA 4FHTA 2JV0A 4YG2F 3S2WA 1U8BA 2CG4A 2R3AA 2E19A 1T39A 2FU4A 4B09A 2JRTA 5L3CA 2BW3B 3ZXSA 2MLGA 5JHFA 5GTHC 4A5MA 4IX7A 1OCCH 3TQNA 3JRBA 3KZYA 4FX0A 4KYWA 1BBYA 3Q0UA 1OCRH 4M3BA 1V4RA 3H9JA 4KICA 5EZGA 1FOWA 1XGMA 4BQOA 1B4AA 3G6EI 2FSWA 2Y30A 4BDZA 2ZJRF 1STZA 1HSJA 1YJWI 5L3BA 3M57A 4B4CA 3DQVC 3S15J 3GZNB 2DOAA 3SZTA 2DA3A 5CYVA 4AC0A 1XSVA 4M9SA 4EJUA 5CKTA 3SDBA 1IZ1A 3HL2A 4JX4A 4BEHB 2M7BA 5M3MJ 5JJ0A 2PI0A 2IEKA 5LHIA 2HFHA 2O7OA 4GGGA 3DV8A 2BHYA 3TGNA 4HF1A 1DDNA 5L3GA 3ZPLA 5FB2A 2JA7J 1ETKA 1TWCJ 3PSIA 5F59A 2YUSA 3SHFA 3DTEA 3E6DA 1LDJA 5F5EA 2K5CA 4C2TA 3MWMA 2EIMH 2QCOA 1LNWA 3JR9A 1MBKA 2A05A 3M1EA 1B72A 2JA6J 2ECBA 1IN8A 3CUQB 1YW7A 1IC8A 2C6YA 3K69A 3FK7A 1Z91A 3M8FA 4M73A 2CGPA 4IQJA 2WADA 3ZOBA 2JT1A 2R5YA 2CYYA 1ZG5A 5AONA 1PUFA 5D8LB 3ZQCA 4IHYA 3J7ZI 3U9GA 1OMIA 1XG1A 5M3FJ 2QEXI 5FFXA 1QPMA 2W00A 3A1YA 2H09A 3BPVA 2WWYA 2BY1A 2K9NA 3QU3A 4TV7A 2CO5A 1X1AA 4CZCA 2R3SA 4U7DA 1Z6TA 3LSRA 1TW3A 5D4SA 1MMDA 2CWEA 1W1WE 2X51A 3ECHA 1SAXA 4O3MA 2ZBKA 4O6FA 2DMUA 1TL8A 3FXMA 2FF4A 1OYIA 3OIQA 1B9NA 4DW6A 4OOIA 2M7AA 1S6LA 3HUGA 1VQOI 4A12A 1B8IB 3MKYB 2O61A 3LA3A 2GQQA 2HYJA 5HS9A 4L0ZB 3ZMDA 1OPCA 2XAGA 1EH7A 2KDOA 2VBWA 5CVVA 3W2AA 3CMMA 1F4KA 3ZQQA 3G1MA 3OYLA 2EA4A 3I59B 1BJZA 1MBHA 3QYBA 4OWRB 4S0HB 3MKWB 3L2VA 3F21A 2ACJA 1MDMA 3I4NJ 2R7TA 3OOIA 1WJ5A 4PFPA 4N0BA 1TT0A 4I09A 2UXNA 2RNGA 3M56A 3CCVI 1UCRA 3AFHA 3V7RA 1X3ZB 2Y48A 5C44J 3KYLA 2HDDA 4UB8C 1YW8A 4QEPA 3K4NA 3GCMA 2LLKA 1U8RA 1QO0D 3U1KA 1W0TA 2OCEA 4ZDPA 4DYCA 2DXIA 5CCLA 2A69F 2JJ7A 2XAHA 1WI9A 3DPLC 4BXXJ 5CCMA 3QOEA 3RQ4A 3B6CA 1XCBA 4XLAA 1SD5A 2WV0A 2XDVA 3CJTB 3EUHC 2CMPA 3GVAA 1VQ6I 2KFDA 2NNNA 3OS5A 4UV9A 1G3YA 3S93A 4B44A 4ESBA 4A3JJ 2ELKA 2LD5A 3S7BA 1YS7A 2KHMA 4KMFA 2E5ZA 2L2OA 3M7GA 5EZHA 3QPSA 4G7OF 1KA8A 2Z5UA 2HPIA 4XKWA 3TEDA 4F93B 5H6QA 2VUMJ 4E70A 1LB2A 3OXLA 3F9XA 3N97A 3V8JA 3LSKA 5B66C 3BC8A 2Q1ZB 4G8XA 2MW8A 3SXYA 5JFRA 2BBYA 1D1AA 1SMTA 2HXIA 3HTUA 3OSGA 1KU7A 3LSMA 3IAS2 2EK5A 5DYMA 2CFOA 4EVIA 3RTRA 1JUPA 2KIUA 3E97A 4WX9A 5HDGA 2JMWA 2BE5F 4HAMA 3BTCA 1MMGA 2E36A 2JWTA 3PO2J 4U0WA 5DV5A 2DCEA 3K6GA 1RKWA 3I4MJ 5GAEJ 2Y2ZA 2A6EF 1FMWA 3C2GA 1XCVA 3W6JB 5TRDA 2A6TA 4AD9A 5H6RA 5EX0A 2R7QA 1IG7A 3KEYA 2YX4A 4JX6A 2KZGA 1LUJB 3A0BC 3SFIA 1H0MA 4RB1A 5EEAA 3FPDA 2VKHA 2L9NA 1RKTA 3RZDJ 2E2JJ 4YIIA 3CP8A 4GDFA 3VSKA 1MD0A 3Q0WA 3ZQHA 1FZPB 3E5XA 5LGUA 2A3SA 4RGUA 3AL0C 2EILH 1S7OA 2VKVA 1ZRCA 1SEUA 2R7XA 1JUSA 2GOMA 3DWLE 2OD5A 2DK8A 3C18A 3L2WA 4A3MJ 1YX3A 2W57A 2R7UA 2GM4A 1IN5A 1N77A 2EJRA 4J8OA 1H9GA 4A3FJ 2K4BA 1ZG1A 2NVTJ 2ZNYA 3OXGA 1W5CC 2FNAA 1U5TA 4UB6C 5CVIA 1BR4A 3RJWA 1MNEA 2DA5A 3LMMA 4RGXA 1OFCX 3QQAA 4XRFA 2IGNA 2XROA 1BC7C 2MYSA 3E5UA 3E6MA 2IS1A 4Y3OA 5HLTA 3CC7I 3GTKJ 1DPUA 3ECOA 4XKCA 2QQ9A 3IAM2 4BDYA 4N4NB 4A0YA 1R7JA 1H8AC 3LSHA 1WWXA 3IH3A 5JHNA 4G7ZF 1FOKA 3F23A 1ZGJA 5J4YA 3CF2A 2P5LC 2XV4S 1FIPA 3IP4B 2COMA 2VLAA 4A3DJ 3KP3A 3ZR8X 1JE8A 2R93J 3KMJA 3CUOA 3SZGA 1G2HA 3GWZA 4M74A 3RCOA 2GWRA 2VBZA 5KCMA 1QRYA 3TDUC 4A6DA 5C4JJ 2DT5A 1PP7U 4ZYHA 4EQQA 2LREA 4Y52J 1WQ2A 2V9VA 1S8NA 3VDXA 2OV7A 2XRLA 4PDKA 3AG4H 5FD6A 1L0OC 2XGXA 1PP8F 2BY0A 1HW2A 2COBA 5BS6A 3A01A 1IAWA 3FZVA 4OMYA 2Y0SN 1X1BA 2NOJB 3C2BA 4I0BA 4U7BA 1TWFJ 2MD0A 2DAOA 2Q0OA 5CJ9A 4A3LJ 3GFIA 4V2FA 4A5NA 3CZ6A 4J7IA 4B1RA 4IKFA 4PCQA 3VPRA 2H8WA 4RB2C 2MH2A 4HDUA 4A0ZA 2LRDA 1DPRA 4FE7A 1MMSA 2HGCA 3AL0B 1WFXA 3JRIA 4IZZA 2RQQA 2K85A 3R0JA 1SFKA 1YOVB 3QPTA 3BR5A 2LYCA 4DYQA 4WXCA 3QP5A 3DLAA 1A31A 2HI3A 4Y4RA 5DD8A 4CDGA 2Y0SA 1ZAOA 2X6XA 1F1ZA 1W4MA 2F5FA 4XRSA 2NS8A 3W2VA 3GTGJ 3LSIA 1R36A 3DB5A 3WTXC 1CF7A 6PAXA 4P96A 1P7IA 3T5XA 5TJJA 2IGOA 3K4JA 1USTA 5EGOB 4S05A 4IEJA 4IRIA 1TNTA 1RZ4A 4XONA 1ZLJA 3MD2A 2KRCA 4QPQA 1Z3XA 2CU7A 1OYYA 1R5HA 3GTPJ 3F9ZA 4IJDA 2EV6A 4L5JA 4J00A 3I71A 1DUXC 1ZK8A 3GFMA 3K10A 1YFHA 4IHXA 3S2HJ 1MH3A 3ZRGA 4LG0A 1X19A 2VT2A 1VQLI 4FETA 2H94A 5D5VB 1ETYA 1KQ9A 3AG2H 3HZJA 1I1SA 2EIJH 3GX4X 3P9CA 1HW5A 4BXUA 3P7NA 2JSPA 4CYDA 2CV2A 3TG5A 3WTZA 2CRGA 1DP3A 4IF4A 3N4MA 2D1VA 2IPQX 3DLLF 3O3KA 4WCGA 3IUOA 5D6EA 5BMZA 2VQHA 5LFAA 1U2WA 1AU7A 1UELB 1KU3A 5IYCJ 1RIOH 1DU0A 3GUDA 2V9PA 3BR1A 3Q9SA 3S3MA 3EUKL 3O6BB 2DJIA 5CVUA 5H2FC 3WTYC 1R22A 3O8GA 5TH7A 4BE0A 2DA2A 5KJMA 4HRIA 2R7FA 2DT7B 1R1VA 4A2UA 4CA0A 3W6KB 2Z9OA 1KQ8A 5J1YA 3HYIA 3ISPA 4EGYA 1EF4A 4L9JA 2XKPA 4XOTA 3FXLA 3ZMVA 4AVZA 1LDKB 2H6CA 2FA5A 4R8HA 2BXZA 2VB6A 3CD6I 4LOCA 3S7DA 1LEAA 3D5RC 1V5FA 3EUAA 2DU9A 1BOBA 4HV6A 3S3NA 5F08A 2ADUA 4NQWA 1O4XA 1B59A 2KJBA 2M34A 2BXYA 3HRSA 1SFOJ 3REOA 2NS7A 1E2XA 1X3WB 2D45A 3VYRB 1P7JA 1DGRM 3RPQA 4ENMA 1NK3P 2R5ZA 3AAFA 4EATA 1R5ID 1JJ6C 2DTRA 2K9QA 4E7HA 4BJ5C 3NARA 2A07F 3L7WA 3H3VK 2LKSA 3GTMJ 1ZYRF 3S1NJ 1WJFA 2PMZN 2KP6A 2XAJA 3K4MA 4BBRJ 2XRNA 3DKWA 2CS3A 3D5LA 5J3LA 1LVKA 3DU6A 3NQOA 1HSTA 1UJ8A 5JLXA 2OUMA 1X1PA 3ZQIA 5DCMA 1IF1A 5LGNA 2EZHA 3IL2A 1YYVA 2R4GA 4A3EJ 3L2QA 4M6YA 4ANJA 4JX5A 2OZUA 1GUUA 1SFXA 2V1NA 3CDHA 1JT6A 2X0LA 3BG6A 4QEOA 2ME0A 2NVQJ 1SFUA 4OIQF 1T95A 1EH8A 2TRTA 4HX8A 1B72B 3HJEA 3SEZA 2FOWA 2VKDA 5D6FA 4E7IA 3FMQA 2GIVA 2R5YB 4C1QA 1ZELA 2TCTA 1X58A 1PUFB 3PDNA 5T0MA 1FC3A 1X2MA 2CQQA 2KISA 4YNDA 2GXBA 1MUFA 1YS6A 3IHXA 4LK1F 2NVXJ 4BQAA 2VQCA 4DBRA 1HQCA 1RNLA 2L4AA 4M3FA 2DPUA 4UVAA 1S7EA 2MH9A 3OWTA 5ARGA 3K2ZA 4OIPF 1LEBA 4QWQA 3U2RA 4YELA 3V7CA 2PJPA 5GADJ 2QSHX 1ONVA 4C2UA 5ICFA 2W7NA 2L9SA 1HKQA 1CGPA 5KJLA 1DQUA 2DFEA 5J40A 1REPC 1W7PD 2P7VB 3QPHA 2ZXJA 3K7AJ 4YEJA 1Z9CA 1I6HJ 5LRRA 2ZSIB 2M45A 1RESA 1TBXA 4HQMA 5JINA 1Z6RA 5TISC 3EP0A 4MI5A 2HR3A 1GXQA 3WU0A 2Y9ZA 3BLYA 1Z7UA 1R49A 1IJWC 2B63J 1SD4A 2L01A 4BY1J 1MDMB 4OIRF 2RAEA 2GA2A 1VQ4I 4E7SA 2YU9J 4ENJA 2DMQA 3TW7A 4HDVA 3T1BA 4YNMA 2K27A 2M4GA 3WE2A 1HLVA 1Y0NA 3L2CA 3FM3A 3ABTA 4ZH4F 4R79A 1PEGA 5KJKA 5FLXK 2IS2A 3MKZA 3CCYA 4XBFA 3JRAA 4V2GA 4D0PA 2M8EA 4JP0A 4BE2A 4LFUA 3M54A 1YLFA 1JKOC 1U5TC 2GXAA 3F8FA 2L7KA 2PX9A 2VT3A 2N8GA 1UMQA 3PNTA 3ABMH 3FISA 1A35A 3DEEA 1SAUA 1G3WA 3ERED 3DEUA 4BUPA 5ARFA 3CCLI 4QENA 1N3JA 3A02A 3P5JA 3GZ5A 2R0QC 2DFFA 3FIWA 1B9MA 2L7MP 3RKXA 3BJ6A 4BNCA 3DKYA 3FXQA 3PM1A 2H6BA 2XVCA 1WJCA 4NUBA 4UUTA 2CQ7A 1BM9A 3OOUA 2QBYA 4IJ8A 4DZJA 3GBGA 3H36A 1EV7A 3PUFA 4AUXA 1FYLA 2M8GX 4BHCA 3U1DA 4PK4A 4PGHA 3E6CC 1LPQA 2W85A 1FP2A 2HOEA 2L3DA 1C0WA 2IA2A 3E3VA 2E60A 4NDLA 3EQLF 3O8HA 3TW6A 3CCEI 1Z7LA 1K6YA 3S1QJ 3S17J 4HSTA 4PUSA 3SYTA 4M9ZA 5LSXA 3WU2C 4RB3C 2RV8A 2ECCA 3EYYA 1LJ9A 3A4CA 2DMNA 1WSUA 3MQ0A 4CCNA 1V5EA 3RYPA 2K7LA 1E3OC 1J09A 2EZLA 1WI3A 3KIOA 4OINF 1UAAA 2F5DA 2LOOA 4UY8I 4ZTJA 2ESHA 1KQ0A 3K9TA 4ZDOA 2WY7Q 2BY3A 3DFGA 2A68F 1H88C 1U6GA 2XPWA 3HOWJ 4HX4A 4C30A 4CXFA 4KDPA 1XDUA 4CYCB 1MT6A 4IHSA 3VFZA 4LG3A 1ON2A 4EV0A 5AIQA 3ERMA 2HNHA 1F9NA 5KAIC 4CCKA 3KFWX 3LQQA 3OIPA 3HM5A 3I53A 3BDDA 2HQAA 2A61A 1K61A 3TO9A 1ZGWA 5DTDA 3GTOJ 4XSZF 1RRJA 2RC4A 2ESNA 3JRHA 1AOYA 1FYKA 1MMAA 5KAFC 2BHZA 2IJLA 4OU0A 1A04A 2R7OA 4BACA 1YW9A 2YR2A 4MQVA 3OSFA 1TTYA 2ID6A 3S3OA 3KCCA 1LVAA 3BG7A 4ZYDA 1X2NA 2IXSA 4L5EA 5EYRA 3WGHA 1D8JA 1FEXA 2FMLA 3CTAA 5EEHA 1U5TB 2DW4A 5D5XB 3M55A 2ZXIA 1GDTA 3CC4I 2WA0A 4A93J 2JUCA 3HEFA 1J9IA 4P9FA 2EWNA 2XF7A 4OIOF 3HRMA 1W0UA 4E6KG 2BVMA 4KIFA 5E79C 1Y56A 2XASA 3GTQJ 2HKOA 1O3RA 4YFKF 1CQTA 4PJJA 3VYUB 3SW9A 1HBXG 2FE3A 3BJAA 2W84A 3OYCA 4YIFA 2WB1N 2XPVA 1LE8A 4N4OB 4NC7A 1E3PA 3RPUD 4JDSA 3KPHA 1MBGA 4DOZA 3LSPA 1X4PA 5E18F 2DQLA 4FCYA 3NWSA 1FLIA 4E7JA 3GW2A 3K70D 3HB9A 2DA6A 2ZJ2A 4H4KC 2XIGA 5JVGF 1ETVA 2M0CA 1HDPA 5K1YA 1W7PA 3VYSB 1FTTA 1SD7A 2HPMA 3P9IA 4YFNF 5HNHA 4HG2A 5IY5H 2IVMA 4LMYA 4DJAA 2X48A 4PSXA 3OYEA 4D7MA 1T56A 3FXRA 2OTJI 2E5NA 1XMXA 3SZPA 2JVHA 1SMYF 4XKBA 2QVOA 4RS8A 4BE1A 3FDYA 4XNFA 1BIBA 3VUZA 3MZ8A 5IPAA 3ZP5A 2F4MB 1Z0XA 5EG0A 5J47A 4ITVA 2ELJA 2Z1DA 3HC7A 2G7HA 5DUKA 3FHZA 4MGRA 1KU2A 2X1EA 2ID3A 3FK6A 3HKZN 5J8CA 5CQEA 3OIOA 4BQNA 1W36D 3QWWA 3C7JA 3WG9A 3V7SA 2YS9A 3CJNA 3B02A 1IXRC 2D2WA 5F64A 1JHHA 3S2DJ 1TW2A 2X1CA 1Y1VJ 3W6VA 1OLTA 1J5YA 4KIGA 1EA3A 2HVRA 5E1XA 2ISZA 2EFOA 1VQNI 2FQ3A 4NBQA 3CCSI 3KE2A 4RGRA 2PLYA 3V42A 3ZN1A 1VQKI 4DNCA 5DM6F 1S72I 4QTRA 1I3AA 3ROUA 1L3LA 1JTXA 2QKMB 1AKHB 2DDBA 1TZLA 4BHPA 3M3YJ 1XD7A 3TOAA 3OYJA 1GXPA 3T8RA 5F0CA 1CF7B 5E3NA 2STWA 1KYZA 2HYGD 3GLXA 4MHGA 2OTLI 1FBQA 1OISA 2OA4A 4KN7X 5E1WA 2QM3A 3ONQA 2UUZA 3DXJF 1BOAA 1R23A 3QPLA 5LD2C 2Y9YA 3K5KA 4XM3A 1D0XA 4AIKA 1NH3A 1IGNA 2A5YB 3EYIA 4EM0B 2RN7A 3LWFA 3Q0VA 5K5OA 3L2RA 4Q48A 2DTZA 1GHCA 4QPOA 4IOCF 1POGA 3OXFA 4X6AJ 4H0EA 4Y7NJ 1A6QA 3OYGA 4NNJA 4KITB 2QENA 1K7AA 3ML6A 3DALA 3PJRA 1WJAA 3H5AA 4IJAA 3SQNA 4F7ZA 4AVPA 4RA2A 3HOYJ 3JRFA 2H27A 3ESWB 5FKOA 1VQ9I 3KYDB 3FWEA 3PFYA 2DO7A 4I7HA 4KT5C 3RDIA 1WRJA 3F6OA 3H92A 2KKOA 2HTJA 4UNOA 5H20A 4KISA 2O8KA 3HPHA 5T5GA 2V79A 3OL3A 5D4RA 2VE9A 5IP9J 5JIYA 3HOZJ 1HA8A 2AXTC 2GA1A 5F1RA 4BYYA 3FMSA 1N6CA 2PMUA 1K79A 1T38A 1E17A 3RIRA 3BT9A 2DT6A 3GMEA 3CQZJ 4HSRA 1DU6A 2PEXA 2Z3YA 3I3LA 2BW3A 4RB0A 1D0YA 2L4MA 3TBIA 4L0YB 3J7AO 3OYDA 4M6VA 4X1EA 1BJAA 2MGQA 3F9YA 2MLKA 1FOYA 2KT0A 1WJEA 3IWFA 3WTTC 1TQMA 2CFXA 2HZDA 3NAUA 2Q2EB 1V55H 3CLQA 3L09A 1V54H 5FKMA 3HSEA 2BOLA 2LK2A 3RPUA 3HDDA 4A3BJ 5LEJA 1JKRC 3N71A 2L5QA 3HRTA 4X0GA 2HVSA 4L5IA 3G3ZA 5DCMB 2E71A 2UWMA 4KMUX 1E0EA 3NEUA 2M9HA 2R7DA 4HX7A 4AIJA 1SC7A 2EINH 2TDXA 2IGKA 4GO1A 4BH9A 2EV5A 2LG4A 4EJTA 2XGCA 1NHAA 3VSLA 2O8XA 2CQKA 3WE3A 1WPKA 4G12A 1ORKA 3K4KA 3TO6A 3TMOA 1ZKGA 2WY8Q 2K02A 1I27A 4M9XA 1FIAA 3MO2A 4RM2A 3W2WA 1VZ0A 5FFZA 5FO5A 1D8KA 4B3XA 4WXHA 4XSXF 1T0FA 3ZMZA 5J8FA 1IRGA 4CZZA 2QLZA 2VJJA 1XQHA 5TGTA 2FBIA 3IRRA 4L9NA 2XKOA 2KJCA 2YU3A 2DA7A 2LVSA 4MTEA 3RKYA 5KK1A 1ZARA 2AHQA 1QPIA 1SVOA 2X6YA 2VJ4A 3FX3A 4IL6C 1OQYA 1QVUA 1S3JA 3G71I 3ASNH 3GYHX 3V8LA 4CCOA 5L3FA 4YIRX 1R6RA 2LBFB 4DBQA 3ZCOA 2V4JC 4LLGF 3I58A 3OYHA 2XAFA 3H3UA 2KPMA 3DPTA 4HA8A 3CCMI 1R71A 3KMAA 2ME6A 2ZSHB 3WTSC 5GPCA 1UFMA 5A2QZ 3OV8A 4KFCA 2VASA 1BI0A 3FKJA 3KP6A 4ZZDA 3BP8A 1YRNB 3QWPA 1FJLA 2PN6A 3H35A 1WHUA 3E5QA 1XGOA 1UHMA 2QPWA 3JRCA 4L18B 4NVQA 4IHVA 4ESJA 3IV5A 1B8IA 3CF5F 1HF0A 3WTUC 2HVQA 2R7WA 2I10A 2V6EA 4HNTA 2ZB9A 2EPFA 3E0JB 3PIPF 2RGVA 2HEOA 2V26A 4CCJA 4ETSA 1MIJA 4II2A 4KIBA 4FTHA 1N25A 4MFDA 1ZKKA 3LAJA 2OQRA 1V5GA 3AG3H 3RAYA 2QSGX 4XICA 2KIQA 4EJWA 1RUOA 1R9TJ 5LSZA 2P0WA 3QYEA 1FX7A 2D1HA 2IAIA 2WAQN 3EDPA 2CV0A 1Z67A 5EG2A 2FMYA 2WAEA 2IA0A 4AYBN 2DOEA 2Q8KA 3LSJA 2E1NA 3OYAA 3HGYA 2ZFUA 1MZBA 4XORA 1Z77A 3FKIJ 2OZ6A 1I50J 4HNVA 2CW7A 2X9DA 3GO5A 1YG2A 2CSOA 2LFBA 3GF2A 5IYBJ 1IN7A 4XLPF 5HLIA 3MEXA 4KJZA 4EGZA 2HOSA 4DZPA 1USSA 4BGDA 4B43A 2QKLB 4Y13A 4RAZA 3CBMA 3FBNB 5LBQA 1TQPA 1JI8A 3D0SA 3H9QA 2QBYB 2ZXWH 1XN7A 3HOUJ 2IT0A 3B73A 4NC8A 3DP7A 1NK2P 4YPAA 2ZXHA 3IH2A 3LQRA 1W5TA 2V1XA 3LOCA 3C1DA 5DEQA 1MBFA 4PJLA 5DD4A 1KZHA 3HNAA 4UHTA 1YTYA 2W48A 2XSJC 1EJ9A 2EFWA 2GIZA 4A3GJ 1QQIA 3K1NA 1SFEA 2PG4A 4HW0A 3M8EA 1YIOA 3BOQA 3G73A 2QQBA 1H9TA 4HYEA 2Y69H 1BI2A 2QWWA 3BZKA 3OL4A 3KX2A 2L02A 1MJ9A 4XQFA 4B3AA 3H5NA 4YPEA 1I39A 2L7FP 2XB0X 2ZC2A 4RDUA 1G8XA 3LL7A 4QIWN 3K0LA 2JPBA 3PQJA 4HV5A 1VTNC 1R4MB 2HKXA 1XSDA 1JKPC 4A6EA 1A5JA 1MBEA 3BROA 4GFBA 2VOOA 1IXCA 1UB9A 5HLGA 1JKQC 1ZTRA 4HNUA 4EM2A 1GV5A 1Y8RB 5ED4A 3ABKH 3BR0A 5KHDA 1IUYA 1A6IA 1MGTA 4HZFA 3VWBA 3LNQA 2ZJQF 2PMHA 3KZIC 4E4HA 3VB2A 3M07A 4CUGA 1O3SA 2XB5A 3F22A 4HQEA 4Q4ZF 2VL8A 1Q1VA 4D5FA 5LRSA 2DMTA 2AXLA 3FXUA 4GYIA 5FKLA 4MLOA 3ZQ7A 1WZ2A 1FOXA 4ZDLA 1P4AA 2HS5A 4RAGA 4NB5A 5JR3A 2MBFA 4IQ4A 3ULQB 4Y15A 1XPXA 3GZ6A 5HQ8A 2F5VA 3UR3C 3ZMUA 4F91B 4BHBA 5FJ8J 2DQRA 4FISA 2RREA 4Y17A 3C2HA 3ZMSA 3LAPA 1UG2A 3CLOA 3K4CA 3S16J 3DU5A 3Q5FA 1IRFA 2M0MA 4PFOA 4S04A 2WTEA 5TEGA 3M58A 2XAUA 2OBPA 1RPWA 1TWHJ 1QU3A 2LP0A 1J0RA 3BG9A 4ASNA 1QBJA 4W1UA 5CVRA 2IRFG 3HOSA 3AKZA 1A36A 5ICCA 1HKTA 2M1BA 1ENHA 2ZKZA 3M59A 5E3OA 3R0AA 5B3SH 2PMZA 3M4OJ 1DGWY 2BZTA 4M3DA 3J7YJ 1LE8B 3RKWA 3BO5A 1FSHA 1APLC 2IS6A 3JAMK 4XLEA 2QYOA 1KONA 5K5QA 3SWCA 2JPCA 2WBMA 1WH5A 2Z2SB 1W7PB 2DBBA 2LNBA 1BC8C 2R92J 1R1TA 3OPEA 5HI7A 4MIMA 2E35A 2EFQA 1IW7F 4ZC3A 1OYWA 1Z05A 2FXAA 2LSOA 2QF7A 4XLCA 5HNFA 1YJNI 2M5WA 1G4DA 2ZFWA 2X6OA 2P6SA 2RKHA 2KMUA 3M8JA 3PSFA 4I6ZA 1TT5B 2LF8A 1GVDA 4O5VA 3HUGB 3L2UA 1P2FA 1WGXA 3QODA 5C3EJ 2I8DA 2DMPA 5EG0B 1WH7A 2VJIA 3CO6C 3JAMZ 3DBHB 4F52A 3BG5A 1ZLKA 2FD5A 1FT9A 5GAHJ 5TTFA 1G6NA 1AWCA 2ICWG 4ABZA 3HSRA 3HBLA 2DJNA 3HHHA 3TKYA 2CJJA 5GTIC 5B5EC 3H0GJ 5CQGA 2XSDC 2CQNA 3UNGC 1B1BA 3CCUI 1BR1A 1N78A 4NJ5A 3QOPA 2A5WA 4ZTFA 4GRIA 2IW5A 2HOAA 2JTVA 2QQ8A 1XDSA 2VBYA 5DS9A 3JRDA 2AS5F 4P9UA 2JA8J 2L9RA 4RLFA 3M5AA 4NHJA 2E1OA 2OF7A 3BJOA 9ANTA 4UXNA 1M1EB 2GLOA 2EZIA 3M9AA 2HQRA 4I99C 3S1MJ 4LB6B 1ZR4A 3K70C 3BZCA 3G1LA 3RSNA 3LFKA 5KJNA 5IOYA 3HHGA 5DM7F 1YX5A 3T8TA 2W25A 5HOOA 4PSWA 2JQ7A 1RR8C 1QA6A 5EGOA 2LF7A 4F92B 4G9YA 3R4KA 2VC0A 4GCVA 1MJBA 1U9OA 1WJBA 4E7ZA 2P4WA 1Y0UA 4EMSA 5DDGA 3MO5A 1MNDA 1ZREA 1QNTA 4JBAA 2FBHA 4PZJA 1XTAA 2X85A 1IN6A 1O3QA 1T0FC 3DBLB 4F3QA 3HGGA 1P6RA 2F2EA 4XR6A 4WWCA 4N9IA 1SVLA 4UVCA 1KYWA 1U3EM 5HDKA 2GXGA 1ACIA 3K4LA 4MFEA 4LD5A 3VEPA 2MFZA 2EA2A 2E7XA 3WGIA 4IHTA 1W36C 3DTKA 2QZ8A 4E7KA 4U0YA 2E2IJ 1ZH5A 1WJDA 2R7RA 3CDLA 4C3HJ 1PDNC 1Q1HA 2HTSA 1T08B 2B7EA 4PJNA 5E3MA 3CMAI 1UHWA 5K7HA 4BQQA 1FY7A 1K4TA 1O9SA 1ETXA 5EDNA 1D1BA 3G4SI 5HVQC 3L9FA 2HDWA 3OMYA 3GXOA 1K4SA 2VXZA 2KLOA 2WAFA 3HTSB 4EEFG 3WHBA 4BS9A 2RQPA 3JSOA 3F8CA 4HPQA 2M30A 5HLHA 4ENNA 4Z2YA 4CCMA 1FBSA 3IHUA 4UVBA 2HDCA 1D0ZA 2M87A 3ZQGA 1D3YA 3DCFA 3F6VA 4OAYA 5F27A 3JW4A 1F36A 3CDIA 5FLMJ 3FM5A 2MSYA 2IP2A 3QWLA 2L9VA 5M5WJ 1HDDC 5GP9A 4D1QA 2BY2A 4ENKA 3V8KA 3E7LA 1X4OA 2X6WA 2DDAA 2G46A 3ASOH 4G7HF 1BI1A 3GTJJ 2P5KA 1XX5A 2XUBA 2HXOA 2IBDA 2B0LA 4XRSG 2F5CA 3DBRB 5E20A 1ML9A 1K78A 4C3IJ 2KIMA 4F55A 1TQIA 1ZRFA 1T98A 2JK3A 2DA1A 2JVGA 5ILUA 2UZKA 4KN4X 4C3JJ 2E2HJ 1MBJA 1VQ8I 2VPRA 4P5OA 1ZG3A 3BG3A 2VODA 4CCLA 1I3QJ 2NAZA 5J1UA 4JQFA 4N9HA 1O57A 3JRGA 1SANA 3SJMA 1U0JA 3QP6A 2WV1A 5F0FA 2ELHA 5AYFA 2DFHA 3HPGA 4A0XA 4RM3A 3BTIA 2HZTA 1YIJI 2W82A 2BYVE 2OAZA 5E8IA 5FKNA 1FMVA 1QZYA 2J5PA 1OR7A 2R7VA 3TP3A 3DKXA 3SEQA 2K9SA 3BR3A 3LA2A 2P8TA 1QZEA 5FKKA 1VQ7I 3MN2A 5BNGA 5BOXA 4AM3A 4I02A 3EETA 4MEYF 2WB1A 1PVEA 2L7ZA 4BJTA 4IXAA 2DK5A 3GFJA 3A01B 3H9GA 1XSXA 3IKVA 3CJRB 4LB5A 3F3XA 3ZQLA 5DCFA 3RQIA 3A2KA 1UHSA 3I64A 3MVPA 3E6BA 5JHUA 2XGDA 3H0DA 2EIKH 3V4GA 3S1RJ 2DYRH 3KLNA 3J80K 3OYKA 3OR1C 4L9TA 1PYVA 2XF5A 1JJ8C 2LMDA 2EBIA 5J4VA 3BTLA 3PO3J 4EJVA 4J19A 3KP2A 2I5UA 3BPXA 4XIDA 3LSTA 1QZZA 2LH9A 1N75A 4WXDA 3F8NA 3FBIB 3FXJA 5J1RA 3I54A 4G6DA 2VI6A 3SFZA 5M5XJ 2MA3A 4L9VA 5GAGJ 2EFPA 4I2OA 2AQFA 2K9MA 2FEZA 3DF8A 5KVRA 1B6AA 4FASD 1RR7A 5EF6A 1D5VA 4M71A 4MNUA 4XL9A 3PNYA 4I76A 3HKZA 2ZJPF 2KIFA 3QYFA 3MZYA 3U21A 5IT9K 5E8GA 2A6HF 3RJPA 3J80Z 3GTLJ 1W5SA 1MVXA 4Z4PA 4EJOA 3HOXJ 1XS9A 1OCTC 1K83J 3G2BA 2JRMA 2P6TA 2PJRA 5K7ZA 1LDDA 4CHUA 1RUNA 2OU2A 3FMRA 5BPDA 5EEGA 4I01A 2JZYA 1RI7A 3MCZA 5J6XA 4PGGA 3CC2I 4GXOA 3NWTA 2OQGA 1R00A 2DYSH 1ZGAA 3BWGA 2ZCWA 4LG0B 4D9JA 2FBKA 2VPLA 2EZKA 3JTGA 3HXLA 2MABA 3MEKA 4Q47A 2DOFA 4R1HA 4ZYAA 2YSRA 4BAYA 3M1CA 2FQ4A 1P4WA 4LIVA 3IKTA 4BJ6C 4CSWA 3S7JA 1PUEE 1YQAA 2FOKA 2NNYA 5IT9Z 2XHKA 1JT0A 3H1CA 1K6OA 3CESA 5AIPA 2ZO4A 5ILVA 2NOGA 1O7FA 4MEXF 5D5UB 1ZRDA 2LKXA 1G3TA 3KP4A 4HF0A 3RI4A 2LTPA 1T6SA 4XLNF 3BY6A 3K4BA 2ISYA 3CMEI 3ZQFA 2IS4A 2KRHA 4D7NA 4YPUA 2QQAA 4NC6A 3S8PA 3GFLA 2QGUA 1TC3C 2YX7A 2O9LA 4DGWB 1TP4A 3I5UA 1H3IA 3WHCA 2LY9A 5HS7A 2FX0A 3GEZA 2GBYA 2K3PA 4B8XA 4U87A 2UV1A 2HQNA 4KT6A 5K5RA 4CH7A 2CUZA 1F43A 1XC5A 2F4OB 4UUSA 1R5GA 2ZMEA 4O6JA 3ZGKA 2H8RA 3TP0A 2IGQA 3VOEA 3IC7A 1ETQA 4NQWB 3CJQB 2F6CA 4PJMA 5ICEA 3BCBA 2JUGA 2P7CB 2E1MC 1IN4A 2E1CA 3W3CA 2FJ1A 1SVMA 2R5ZB 1H89C 2LDUA 1Z1DA 4CYCA 2ETHA 2RFIA 1I6XA 4M6XA 2W24A 2UXXA 3BQZA 4FMUA 3I0TA 1IV8A 3FXOA 4ZZLA 2VQGA 3LA7A 4RBOA 2M3AA 3F0CA 1S29A 3CCRI 3CBOA 4I51A 4HF2A 4J01A 3M53A 4IO9F 1WVRA 2K40A 4XN0A 4BEHA 1XMAA 3VODA 2EB7A 1ULYA 3TL4X 3A0HC 1V3FA 2FRHA 4U88A 5L3DA 1JGGA 2K9LA 1BR2A 2NVYJ 3FHNA 1S7AA 2JSCA 2V6CA 1ITYA 3DTIA 1F5TA 3J7AY 3D5SC 5L3EA 3I56I 2HYFA 2DA4A 3CO7C 1OCPA 5A2QK 3NRVA 2AQEA 4IHWA 3ZN0A 3KP7A 5KNLA 3KEQA 3F9KA 1ODDA 4RLQA 4XLFA 2V1DA 3CUQA 1IRXA 3OY9A 4II3A 3PNVA 1YO5C 2XF6A 3JTHA 4XKVA 2QA4I 3COAC 1P92A 4KA4A 5EJCA 5IOZA 3ELKA 3MO0A 2VXDA 3HG9A 5E3LA 2L54A 1QVTA 2P81A 4GYGA 4Q5SF 4O30A 1RETA 1HC8A 3S14J 4HLYA 1XGSA 3D1NI 3I55I 2KZVA 2FUG2 2NS0A 2V9KA 1O7LA 5F04A 4C2MJ 3BCAA 2F5EA 2NYXA 3QU6A 1BI3A 4CGZA 3LFUA 4I0AA 1JHFA 1OCOH 4MTDA 2CUEA 4G6QA 2R7ZJ 1N6AA 1MSFC 2LC2A 4MI0A 1FWZA 3KP5A 1Y8QB 1NG6A 4JK1X 5IP6A 3QRFF 1LFUP 1X1DA 3JSPA 2QUFA 4HEA2 2E1MB 2CV1A 4DQ2A 3ABLH 5F6LA 1Z21A 1MKMA 4HBLA 1BA5A 3I59A 1P4XA 5DUIA 2HOTA 1O3TA 1Y6IA 2KQRA 3R61A 1JUMA 3WGGA 1U78A 3GLLA 2VOPA 1X1CA 3TG4A 1BW6A 5BQTA 2VC1A 1S9HA 3N05A 4IOAF 1IRZA 4BU2A 2E7WA 2BEOA 4FQGA 1XB4A 4LGWA 4LITA 1YI2I 3LSGA 4FX4A 1KU9A 1TWGJ 4WF2A 3WODF 1LFBA 2YPRA 1FP1D 1FSEA 3PQKA 1EH6A 3CBPA 1AKHA 4G94A 4BY7J 3F8MA 3HOTA 5IP7J 2M4KA 4M3GA 3C3WA 2W1OA 2DI3A 1NTCA 3H3ZA 1FNNA 1WKMA 2O8JA 3OYNA 4MQ9F 2CW0F 4RAYA 4AIDA 3PFIA 4LIUA 2WAQA 1MNMC 4XK4A 3R6SA 4AYBA 3S7FA 4JYKA 2O3FA 3RYRA 3J81K 3WTWC 1OKRA 1QHHD 4JOMA 2KDZA 1ZQ3P 1VI0A 2O5RA 3EPZA 2BQZA 3KYCB 2PBIA 3R60A 1NG7A 1Y1WJ 2IGMA 3DPUA 3HIFA 2P5VA 1OR7C 2RNJA 2E34A 2BVLA 5E17F 1GVJA 1I1GA 4LJZF 2J5OA 5ILSA 4C9YA 4J7FA 2DODA 3IWZA 1LFPA 1QGPA 3WU1B 5M5YJ 1YJ9I 4HOBA 3L00A 1LKXA 4HLXA 2KL4A 3HRUA 3BTJA 1HCRA 1KGSA 2AO9A 2JA2A 4M3EA 4KNYA 1X3UA 4WK8F 1GV2A 4YRVA 3OR2C 2BV6A 4A69C 1MJAA 4J83A 4YFXF 2OJED 3G1OA 2LY1A 1E3HA 3RZOJ 2CQXA 5F6FA 4QSHA 5LEKA 2VN2A 1BN5A 5JI6A 3J81Z 4CO8A 4EM1A 2CUJA 2O0YA 5FRNA 1VQ5I 4UV8A 2Y0MA 3CMYA 1BW5A 1G3SA 2PFBA 5BPIA 4RZ0A 2Y31A 4A3IJ 1MMNA 2VIXA 2V1UA 1HOMA 2GOXB 2DPDA 5B1BH 3KZZA 5D8KB 4E7LA 4FT8A 2OPTA 3FXKA 4XMYA 2F69A 1TNSA 1BL0A 1IDYA 1QHGA 2D5VA 1FTZA 1GT0C 4BL0B 3MAJA 2F4IA 1OCZH 3OOPA 5FLVA 1UZCA 4YNPA 4OMZA 2M2EA 1T8IA 2EQRA 3FF5A 2CH0A 1Y39A 4XRMA 2LKPA 3AG1H 1YE9A 2CUFA 2DN0A 1FPQA 2K4JA 3WG7H 3OYBA 1PJRA 3JREA 4A3KJ 1TWAJ 5FGMA 1J59A 3OS2A 2Q2EA 2XPUA 3I9V2 5K7FA 1ETWA 3F8BA 1Z3YA 3E1SA 2K3FA 4CICA 1K78B 1VFCA 3OS1A 3CCJI 1RC9A 3EUHA 1IDZA 1IUFA 2K86A 3QAHA 4M72A 2ZNZA 3S32A 4BXFA 2F48A 3CCQI 2B9SA 3H5RA 5C4XJ 4LLNA 1JGSA 5E1ZB 2X4HA 1JTYA 2XAQA 5B1AH 3JCUC 2OCCH 1TLHB 1VF9A 2CW8A 3HSFA 4ZYEA 2Z33A 1JXSA 2HU9A 4IRHA 4RAFA 3TO7A 2Z99A 1R4NB 1S5LC 3Q9VA 3BQYA 5F1JA 4LK0F 4XLHA 4LLLA 5CVJA 3OS0A 3VYTB 4ESFA 1YITI 1WCMJ 2MC4A 1BIAA 2GZWA 1IXSB 3CP2A 3DEWA 2WC2A 2NRAC 1MH4A 1OJLA 2QSFX 3RU0A 2H1KA 1T33A 4ZJZA 4KUMA 1FYMA 5JLWA 2BGCA 5IT3A 3MKLA 1XMKA 2EH3A 5HS8A 3KMTA 3KLOA 2O6GE 2RDPA 2EFNA 2VJ5A 2JN6A 2V7FA 4D5CA 1DP7P 5FRMA 1I5ZA 2LBFA 4RMNA 3ABUA 4XN3A 1U9NA 3B6AA 2ZMEC 4I98B 1P9QC 2KRFA 3IRQA 2VONA 5F6KC 5F0HA 3TDZC 3K1MA 4AWXB 2PQ8A 5FD5A 2G9WA 4LDGA 1YRNA 1MW7A 4QLCU 2Z16A 4G6TB 1VQPI 2VQLA 3O2PE 2XC7A 2W5ZA 4B48A 5LHGA 4U0VA 4K2EA 4A3CJ 3A03A 1AA7A 5FROA 1LQ1A 4E47A 4V19K 3X2QH 3P9KA 3HOVJ 5EX3A 2LY2A 3SDGA 3RIBA 3ZMTA 1T2KA 1R58A 5ICGA 1MVHA 5D5WB 3T0YA 4BBSJ 4Y33A 2O03A 4JLGA 1J7KA 3TOBA 3L1PA 1ZHFA 3OYIA 4AU7A 2EV0A 2STTA 4P1WA 4DIQA 2G7UA 5LGTA 2DLLA 4MO7A 5LHHA 2L0KA 1J75A 1ERDA 2PJRB 3VV0A 3UKGA 2VE8A 5IYDJ 1HKSA 3WTVC 3F72A 3MFKA 1ZN2A 2XGEA 3PUBA 3MZHA 1ZR2A 2NVUB 2H1LA 3K1PA 4IPAA 4AIHA 1VNDA 4ZYGA
chains in the Genus database with same CATH topology
2OC6A 3OYMA 3K4KA 3TMOA 3D5RC 1V5FA 2WY8Q 3EUAA 2LH9A 1BOBA 3S3NA 1N75A 4OAZA 3FBIB 3MO2A 4RM2A 3W2WA 1VZ0A 2W4SA 4B3XA 3VYRB 4B47A 1DGRM 2X1DA 2AQFA 2K9MA 1XQHA 2VJJA 2R7SA 5TGTA 4FASD 4EATA 4XL9A 3PNYA 4E7HA 4BJ5C 3HKZA 3QYFA 4WUYA 1GLNA 2X6YA 2VJ4A 3U21A 5T0KA 4XOPA 1WJFA 2KP6A 1MVXA 4Z4PA 3K4MA 2CS3A 3D5LA 4CCOA 3OYFA 3F9WA 1LVKA 3DU6A 3G2BA 3QWVA 1R6RA 3PL8A 2LBFB 2PJRA 4DBQA 3ZCOA 4H12A 2V4JC 2OUMA 3OYHA 2W5YA 2KPMA 3DPTA 3KMAA 1UG0A 3NWTA 5CPRB 2ZSHB 1G59A 2R4GA 3L2QA 3MMYB 4D9JA 2VPLA 1D1CA 2VASA 3FKJA 3QWPA 4ANJA 2JV0A 2R3AA 3H35A 3HXLA 2MABA 2V1NA 3MEKA 3BG6A 4QEOA 4ZYAA 2QPWA 2BW3B 3ZXSA 5JHFA 4NVQA 3M1CA 1T95A 4IX7A 3SEZA 2VKDA 4LIVA 2HVQA 4BJ6C 4CSWA 2R7WA 3S7JA 4E7IA 2V6EA 4HNTA 3E0JB 4C1QA 3H9JA 4BQOA 4BDZA 1ZELA 2V26A 3CESA 4CCJA 3PDNA 4II2A 5T0MA 4YNDA 1MUFA 3IHXA 1ZKKA 3M57A 1V5GA 3DQVC 3RAYA 2DOAA 2VQCA 2P0WA 3K4BA 3QYEA 5LSZA 2IS4A 4DBRA 2KRHA 2CV0A 5CKTA 5EG2A 4YPUA 2WAEA 3SDBA 3S8PA 3OWTA 3HL2A 4BEHB 2M7BA 4DGWB 5ARGA 5JJ0A 3OYAA 4XORA 2ZFUA 1H3IA 2CW7A 4YELA 4C2UA 2W7NA 2K3PA 2L9SA 4KJZA 5KJLA 4U87A 2UV1A 1DQUA 4KT6A 4CH7A 4BGDA 2CUZA 4B43A 2QKLB 3ZGKA 3PSIA 3CBMA 4YEJA 5F59A 2IGQA 3FBNB 4NQWB 2ZSIB 3DTEA 1JI8A 3CJQB 5F5EA 2F6CA 5JINA 2K5CA 4C2TA 3H9QA 3EP0A 4MI5A 4PJMA 3BCBA 2JUGA 3BLYA 2E1MC 4NC8A 3W3CA 4IQJA 4YPAA 2WADA 2ZXHA 3HNAA 4E7SA 4PJLA 2RFIA 2XSJC 4YNMA 4FMUA 2M4GA 2VQGA 2M3AA 4R79A 3A1YA 2W00A 1PEGA 5KJKA 2IS2A 3MKZA 3CBOA 1X1AA 4CZCA 4I51A 3M54A 4BE2A 3OL4A 4J01A 3KX2A 4XQFA 3M53A 1MMDA 4BEHA 4XN0A 3H5NA 4YPEA 2L7KA 1G8XA 2X51A 3LL7A 3TL4X 4O6FA 3PNTA 2K9LA 1BR2A 3DEEA 3FHNA 3OIQA 1SAUA 2M7AA 3DTIA 4BUPA 5ARFA 3J7AY 4QENA 1N3JA 3D5SC 4HNUA 3MKYB 3DKYA 5KHDA 2AQEA 1WJCA 4NUBA 2KDOA 3OOUA 5KNLA 3VWBA 4IJ8A 3F9KA 3W2AA 3CMMA 3GBGA 4RLQA 4XLFA 3ZQQA 4E4HA 1IRXA 3OYLA 3OY9A 4CUGA 4II3A 3QYBA 4OWRB 3MKWB 3L2VA 2R7TA 3PNVA 4PK4A 3OOIA 2VL8A 2XF6A 1WJ5A 4PFPA 4XKVA 2E60A 1TT0A 4MLOA 2RNGA 3M56A 4ZDLA 3MO0A 2VXDA 3AFHA 3HG9A 1Z7LA 3KYLA 1K6YA 4HSTA 4PUSA 4IQ4A 3SYTA 4O30A 4QEPA 3K4NA 5LSXA 5HQ8A 2F5VA 2KZVA 3UR3C 4F91B 2FUG2 2V9KA 3A4CA 2RREA 3C2HA 4CCNA 3BCAA 4ZDPA 1V5EA 3K4CA 5CCLA 3DU5A 2DXIA 2M0MA 4PFOA 3DPLC 3LFUA 5CCMA 5TEGA 1J09A 3QOEA 3RQ4A 3M58A 2XAUA 4XLAA 3EUHC 2XDVA 1UAAA 2CMPA 2LOOA 1N6AA 4ZTJA 3OS5A 3S93A 4B44A 2LC2A 1QU3A 4MI0A 3S7BA 2KHMA 4ZDOA 2WY7Q 2E5ZA 2L2OA 3HOSA 3AKZA 1NG6A 3M59A 4C30A 2HPIA 4XKWA 2PMZA 4F93B 1X1DA 1DGWY 3BO5A 3OXLA 4HEA2 2E1MB 1MT6A 3F9XA 4LG3A 2CV1A 2HNHA 4CCKA 2IS6A 5F6LA 4XLEA 3LSKA 3OIPA 1Z21A 1KONA 3BC8A 2Q1ZB 3SWCA 2HQAA 1D1AA 1Y6IA 2KQRA 2WBMA 3LSMA 2Z2SB 3IAS2 1X1CA 3TG4A 1MMAA 2CFOA 1S9HA 3RTRA 3OPEA 3N05A 5HI7A 2R7OA 4BU2A 4BACA 4LITA 3LSGA 4ZC3A 3BG7A 3S3OA 1MMGA 2IXSA 5HNFA 4XLCA 2DCEA 3K6GA 3M55A 2ZXIA 2KMUA 2WA0A 3M8JA 3PSFA 3CBPA 3HUGB 3L2UA 1FMWA 2XF7A 3C2GA 3HOTA 3QODA 2I8DA 4E6KG 2A6TA 2M4KA 2BVMA 2W1OA 5EX0A 2R7QA 2VJIA 2O8JA 3KEYA 1Y56A 3OYNA 4F52A 4PJJA 3VYUB 3FPDA 3SW9A 2VKHA 4LIUA 5TTFA 2WAQA 2L9NA 3CP8A 3OYCA 4AYBA 3S7FA 3VSKA 4JDSA 4N4OB 4NC7A 3RPUD 1QHHD 4JOMA 4DOZA 1X4PA 2O5RA 3EPZA 3AL0C 3NWSA 2BQZA 4E7JA 2R7XA 5CQGA 3K70D 1NG7A 2GOMA 2IGMA 3DPUA 3DWLE 4H4KC 3UNGC 1BR1A 3L2WA 1OR7C 1N78A 4NJ5A 2A5WA 2BVLA 1YX3A 4ZTFA 4GRIA 4C9YA 3VYSB 4J7FA 2R7UA 2HPMA 1LFPA 5HNHA 4HG2A 4RLFA 3M5AA 4DJAA 1N77A 1LKXA 2KL4A 4J8OA 4PSXA 3OYEA 2JA2A 3OXGA 4YRVA 2E5NA 3OR2C 3RJWA 1BR4A 3K70C 1MNEA 3RSNA 2JVHA 4XKBA 4J83A 2LY1A 5KJNA 4BE1A 3LMMA 3FDYA 4XNFA 2IGNA 1YX5A 3VUZA 2MYSA 5HOOA 4PSWA 2IS1A 2CUJA 4ITVA 5FRNA 4Y3OA 2ELJA 5HLTA 2Z1DA 3HC7A 4XKCA 4F92B 3IAM2 4BDYA 2X1EA 4RZ0A 4N4NB 1MMNA 5CQEA 4BQNA 3QWWA 1W36D 2VIXA 1WJBA 4E7ZA 3LSHA 5JHNA 2GOXB 4E7LA 3MO5A 1MNDA 3CF2A 4XMYA 2F69A 2X1CA 2X85A 1OLTA 1QHGA 1T0FC 3IP4B 4F3QA 2VLAA 1EA3A 2HVRA 3ZR8X 4BL0B 4XR6A 3KMJA 3SZGA 2F4IA 3RCOA 4YNPA 3K4LA 5KCMA 3V42A 2MFZA 1W36C 3DTKA 2CH0A 4E7KA 2LREA 2QKMB 1TZLA 1YE9A 1WJDA 3OYBA 1PJRA 2R7RA 3VDXA 3OYJA 2OV7A 3OS2A 4PJNA 3I9V2 1Z3YA 3E1SA 3OS1A 4BQQA 1O9SA 1D1BA 5HVQC 2HDWA 1X1BA 2NOJB 3OMYA 4U7BA 2MD0A 2VXZA 2KLOA 2WAFA 3ONQA 3S32A 2UUZA 4BXFA 5LD2C 3CZ6A 3K5KA 4J7IA 4BS9A 4XM3A 1D0XA 3H5RA 4IKFA 4HPQA 2LRDA 3L2RA 4QPOA 2CW8A 3OXFA 4CCMA 3AL0B 2HU9A 1WFXA 4IZZA 2RQQA 1D0ZA 3OYGA 4NNJA 1SFKA 4KITB 4OAYA 2LYCA 4XLHA 3OS0A 3DALA 3VYTB 3PJRA 2MC4A 4D1QA 3DLAA 1WJAA 3CP2A 4Y4RA 3H5AA 2Y0SA 3RU0A 1X4OA 2X6XA 4ZJZA 2X6WA 2G46A 3W2VA 3LSIA 3DB5A 2IGOA 3K4JA 3KMTA 3PFYA 1ML9A 4XONA 2VJ5A 2V7FA 3MD2A 2KRCA 4QPQA 5FRMA 1Z3XA 2LBFA 4RMNA 4F55A 2JVGA 4XN3A 3F9ZA 4IJDA 4KISA 4J00A 1P9QC 4P5OA 3HPHA 5F6KC 3K10A 4CCLA 5T5GA 3OL3A 4JQFA 5JIYA 1HA8A 3ZRGA 1U0JA 1X19A 4LDGA 4FETA 1N6CA 1MW7A 5AYFA 2DT6A 2Z16A 3HPGA 4G6TB 2VQLA 4HSRA 2JSPA 4RM3A 2XC7A 2W5ZA 2CV2A 2W82A 4B48A 3I3LA 2BW3A 3TG5A 1DP3A 1D0YA 1FMVA 3TBIA 2R7VA 1AA7A 5FROA 3DKXA 3SEQA 3IUOA 3OYDA 4E47A 3F9YA 2VQHA 5LFAA 5EX3A 3RIBA 2LY2A 1WJEA 1UELB 2HZDA 1MVHA 2Q2EB 4Y33A 4JLGA 2BOLA 2WB1A 3OYIA 4BJTA 3S3MA 4AU7A 3EUKL 4P1WA 4DIQA 1ERDA 3H9GA 3N71A 3VV0A 3CJRB 2DJIA 2PJRB 2L5QA 5TH7A 4BE0A 4X0GA 2HVSA 3A2KA 5KJMA 4HRIA 2UWMA 2DT7B 3H0DA 4CA0A 1E0EA 3PUBA 3OYKA 3OR1C 2IGKA 1PYVA 2XF5A 4XOTA 2LG4A 4AVZA 1LDKB 2VB6A 3VSLA 3S7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFI A;  1O9S A;  4YNM A;  4FMU A;  3M55 A;  1PEG A;  5KJK A;  3MO2 A;  3CBP A;  3K5K A;  4J7I A;  3CBO A;  1XQH A;  4I51 A;  3M54 A;  5EX0 A;  2O8J A;  3M53 A;  3OXF A;  4YPE A;  3FPD A;  3SW9 A;  4WUY A;  5TTF A;  4O6F A;  5T0K A;  1MVX A;  4Z4P A;  3S7F A;  4JDS A;  4BUP A;  3F9W A;  5ARF A;  4QEN A;  1N3J A;  3DAL A;  3QWV A;  2BQZ A;  4H12 A;  3RU0 A;  2W5Y A;  2G46 A;  4NJ5 A;  3KMA A;  4IJ8 A;  5CPR B;  4J7F A;  3DB5 A;  3QWP A;  2JV0 A;  3KMT A;  2R3A A;  3M5A A;  1ML9 A;  3OOI A;  3MEK A;  4J8O A;  4QEO A;  2QPW A;  4NVQ A;  3M56 A;  3OXG A;  4IJD A;  3F9Z A;  3RJW A;  3MO0 A;  3S7J A;  4J83 A;  5F6K C;  5T5G A;  4C1Q A;  5KJN A;  4O30 A;  3PDN A;  4QEP A;  5LSX A;  5JIY A;  5T0M A;  5HQ8 A;  4YND A;  3VUZ A;  1MUF A;  3IHX A;  1ZKK A;  4LDG A;  1N6C A;  3M57 A;  5AYF A;  3RAY A;  5CCL A;  2W5Z A;  4RZ0 A;  5CCM A;  5LSZ A;  3TG5 A;  5TEG A;  3M58 A;  3RQ4 A;  3QWW A;  5EG2 A;  4YPU A;  1N6A A;  3S8P A;  5JHN A;  3OS5 A;  4E47 A;  5JJ0 A;  3F9Y A;  3MO5 A;  4MI0 A;  5ARG A;  3S7B A;  5EX3 A;  3RIB A;  2F69 A;  1H3I A;  3M59 A;  1MVH A;  4JLG A;  3BO5 A;  3OXL A;  3KMJ A;  1MT6 A;  4AU7 A;  5KJL A;  3F9X A;  3N71 A;  3VV0 A;  4YNP A;  3CBM A;  5F59 A;  5F6L A;  2IGQ A;  5TH7 A;  5F5E A;  5KJM A;  5JIN A;  3SWC A;  3EP0 A;  4MI5 A;  3TG4 A;  3OPE A;  4YPA A;  5HI7 A;  3HNA A;  3S7D A; 
#chains in the Genus database with same CATH topology
 2OC6 A;  4IVN A;  3OYM A;  5HDN A;  5GPA A;  1YHQ I;  3CUQ C;  4OAZ A;  2HWV A;  4W97 A;  1ETO A;  2LR8 A;  4FE4 A;  1MSE C;  1AHD P;  2W4S A;  1IO2 A;  1J2X A;  4B47 A;  2FNP A;  2X1D A;  4ON0 A;  5FLX Z;  4IRG A;  4RGS A;  5CLS A;  2R7S A;  1HXD A;  2VBX A;  1D5Y A;  1ON1 A;  3Q3S A;  3RKQ A;  2MG4 A;  1FBU A;  1HW1 A;  2JA5 J;  1GLN A;  4WUY A;  3K2A A;  4Z6Y A;  3BR2 A;  5T0K A;  4XOP A;  4P55 A;  3IH4 A;  2G0E A;  3BR6 A;  1R1U A;  5LLQ A;  2MD5 A;  2HQ5 A;  3F9W A;  3OYF A;  1VQM I;  4BKX A;  3QWV A;  3PL8 A;  2Y75 A;  3BZ6 A;  5HOD A;  1XGN A;  4UUV A;  2GAU A;  4H12 A;  1EKE A;  2W5Y A;  3PIO F;  1SD6 A;  2IA1 A;  2NXN B;  2RVC A;  3KET A;  1UG0 A;  2VKE A;  4PJ0 C;  5JVT A;  3I4P A;  5CPR B;  4DYR A;  2MC3 A;  1IV6 A;  2DFI A;  1G59 A;  4UUS B;  3MMY B;  2ZME B;  1D1C A;  3KEO A;  5ERI A;  4FHT A;  2JV0 A;  4YG2 F;  3S2W A;  1U8B A;  2CG4 A;  2R3A A;  2E19 A;  1T39 A;  2FU4 A;  4B09 A;  2JRT A;  5L3C A;  2BW3 B;  3ZXS A;  2MLG A;  5JHF A;  5GTH C;  4A5M A;  4IX7 A;  1OCC H;  3TQN A;  3JRB A;  3KZY A;  4FX0 A;  4KYW A;  1BBY A;  3Q0U A;  1OCR H;  4M3B A;  1V4R A;  3H9J A;  4KIC A;  5EZG A;  1FOW A;  1XGM A;  4BQO A;  1B4A A;  3G6E I;  2FSW A;  2Y30 A;  4BDZ A;  2ZJR F;  1STZ A;  1HSJ A;  1YJW I;  5L3B A;  3M57 A;  4B4C A;  3DQV C;  3S15 J;  3GZN B;  2DOA A;  3SZT A;  2DA3 A;  5CYV A;  4AC0 A;  1XSV A;  4M9S A;  4EJU A;  5CKT A;  3SDB A;  1IZ1 A;  3HL2 A;  4JX4 A;  4BEH B;  2M7B A;  5M3M J;  5JJ0 A;  2PI0 A;  2IEK A;  5LHI A;  2HFH A;  2O7O A;  4GGG A;  3DV8 A;  2BHY A;  3TGN A;  4HF1 A;  1DDN A;  5L3G A;  3ZPL A;  5FB2 A;  2JA7 J;  1ETK A;  1TWC J;  3PSI A;  5F59 A;  2YUS A;  3SHF A;  3DTE A;  3E6D A;  1LDJ A;  5F5E A;  2K5C A;  4C2T A;  3MWM A;  2EIM H;  2QCO A;  1LNW A;  3JR9 A;  1MBK A;  2A05 A;  3M1E A;  1B72 A;  2JA6 J;  2ECB A;  1IN8 A;  3CUQ B;  1YW7 A;  1IC8 A;  2C6Y A;  3K69 A;  3FK7 A;  1Z91 A;  3M8F A;  4M73 A;  2CGP A;  4IQJ A;  2WAD A;  3ZOB A;  2JT1 A;  2R5Y A;  2CYY A;  1ZG5 A;  5AON A;  1PUF A;  5D8L B;  3ZQC A;  4IHY A;  3J7Z I;  3U9G A;  1OMI A;  1XG1 A;  5M3F J;  2QEX I;  5FFX A;  1QPM A;  2W00 A;  3A1Y A;  2H09 A;  3BPV A;  2WWY A;  2BY1 A;  2K9N A;  3QU3 A;  4TV7 A;  2CO5 A;  1X1A A;  4CZC A;  2R3S A;  4U7D A;  1Z6T A;  3LSR A;  1TW3 A;  5D4S A;  1MMD A;  2CWE A;  1W1W E;  2X51 A;  3ECH A;  1SAX A;  4O3M A;  2ZBK A;  4O6F A;  2DMU A;  1TL8 A;  3FXM A;  2FF4 A;  1OYI A;  3OIQ A;  1B9N A;  4DW6 A;  4OOI A;  2M7A A;  1S6L A;  3HUG A;  1VQO I;  4A12 A;  1B8I B;  3MKY B;  2O61 A;  3LA3 A;  2GQQ A;  2HYJ A;  5HS9 A;  4L0Z B;  3ZMD A;  1OPC A;  2XAG A;  1EH7 A;  2KDO A;  2VBW A;  5CVV A;  3W2A A;  3CMM A;  1F4K A;  3ZQQ A;  3G1M A;  3OYL A;  2EA4 A;  3I59 B;  1BJZ A;  1MBH A;  3QYB A;  4OWR B;  4S0H B;  3MKW B;  3L2V A;  3F21 A;  2ACJ A;  1MDM A;  3I4N J;  2R7T A;  3OOI A;  1WJ5 A;  4PFP A;  4N0B A;  1TT0 A;  4I09 A;  2UXN A;  2RNG A;  3M56 A;  3CCV I;  1UCR A;  3AFH A;  3V7R A;  1X3Z B;  2Y48 A;  5C44 J;  3KYL A;  2HDD A;  4UB8 C;  1YW8 A;  4QEP A;  3K4N A;  3GCM A;  2LLK A;  1U8R A;  1QO0 D;  3U1K A;  1W0T A;  2OCE A;  4ZDP A;  4DYC A;  2DXI A;  5CCL A;  2A69 F;  2JJ7 A;  2XAH A;  1WI9 A;  3DPL C;  4BXX J;  5CCM A;  3QOE A;  3RQ4 A;  3B6C A;  1XCB A;  4XLA A;  1SD5 A;  2WV0 A;  2XDV A;  3CJT B;  3EUH C;  2CMP A;  3GVA A;  1VQ6 I;  2KFD A;  2NNN A;  3OS5 A;  4UV9 A;  1G3Y A;  3S93 A;  4B44 A;  4ESB A;  4A3J J;  2ELK A;  2LD5 A;  3S7B A;  1YS7 A;  2KHM A;  4KMF A;  2E5Z A;  2L2O A;  3M7G A;  5EZH A;  3QPS A;  4G7O F;  1KA8 A;  2Z5U A;  2HPI A;  4XKW A;  3TED A;  4F93 B;  5H6Q A;  2VUM J;  4E70 A;  1LB2 A;  3OXL A;  3F9X A;  3N97 A;  3V8J A;  3LSK A;  5B66 C;  3BC8 A;  2Q1Z B;  4G8X A;  2MW8 A;  3SXY A;  5JFR A;  2BBY A;  1D1A A;  1SMT A;  2HXI A;  3HTU A;  3OSG A;  1KU7 A;  3LSM A;  3IAS 2;  2EK5 A;  5DYM A;  2CFO A;  4EVI A;  3RTR A;  1JUP A;  2KIU A;  3E97 A;  4WX9 A;  5HDG A;  2JMW A;  2BE5 F;  4HAM A;  3BTC A;  1MMG A;  2E36 A;  2JWT A;  3PO2 J;  4U0W A;  5DV5 A;  2DCE A;  3K6G A;  1RKW A;  3I4M J;  5GAE J;  2Y2Z A;  2A6E F;  1FMW A;  3C2G A;  1XCV A;  3W6J B;  5TRD A;  2A6T A;  4AD9 A;  5H6R A;  5EX0 A;  2R7Q A;  1IG7 A;  3KEY A;  2YX4 A;  4JX6 A;  2KZG A;  1LUJ B;  3A0B C;  3SFI A;  1H0M A;  4RB1 A;  5EEA A;  3FPD A;  2VKH A;  2L9N A;  1RKT A;  3RZD J;  2E2J J;  4YII A;  3CP8 A;  4GDF A;  3VSK A;  1MD0 A;  3Q0W A;  3ZQH A;  1FZP B;  3E5X A;  5LGU A;  2A3S A;  4RGU A;  3AL0 C;  2EIL H;  1S7O A;  2VKV A;  1ZRC A;  1SEU A;  2R7X A;  1JUS A;  2GOM A;  3DWL E;  2OD5 A;  2DK8 A;  3C18 A;  3L2W A;  4A3M J;  1YX3 A;  2W57 A;  2R7U A;  2GM4 A;  1IN5 A;  1N77 A;  2EJR A;  4J8O A;  1H9G A;  4A3F J;  2K4B A;  1ZG1 A;  2NVT J;  2ZNY A;  3OXG A;  1W5C C;  2FNA A;  1U5T A;  4UB6 C;  5CVI A;  1BR4 A;  3RJW A;  1MNE A;  2DA5 A;  3LMM A;  4RGX A;  1OFC X;  3QQA A;  4XRF A;  2IGN A;  2XRO A;  1BC7 C;  2MYS A;  3E5U A;  3E6M A;  2IS1 A;  4Y3O A;  5HLT A;  3CC7 I;  3GTK J;  1DPU A;  3ECO A;  4XKC A;  2QQ9 A;  3IAM 2;  4BDY A;  4N4N B;  4A0Y A;  1R7J A;  1H8A C;  3LSH A;  1WWX A;  3IH3 A;  5JHN A;  4G7Z F;  1FOK A;  3F23 A;  1ZGJ A;  5J4Y A;  3CF2 A;  2P5L C;  2XV4 S;  1FIP A;  3IP4 B;  2COM A;  2VLA A;  4A3D J;  3KP3 A;  3ZR8 X;  1JE8 A;  2R93 J;  3KMJ A;  3CUO A;  3SZG A;  1G2H A;  3GWZ A;  4M74 A;  3RCO A;  2GWR A;  2VBZ A;  5KCM A;  1QRY A;  3TDU C;  4A6D A;  5C4J J;  2DT5 A;  1PP7 U;  4ZYH A;  4EQQ A;  2LRE A;  4Y52 J;  1WQ2 A;  2V9V A;  1S8N A;  3VDX A;  2OV7 A;  2XRL A;  4PDK A;  3AG4 H;  5FD6 A;  1L0O C;  2XGX A;  1PP8 F;  2BY0 A;  1HW2 A;  2COB A;  5BS6 A;  3A01 A;  1IAW A;  3FZV A;  4OMY A;  2Y0S N;  1X1B A;  2NOJ B;  3C2B A;  4I0B A;  4U7B A;  1TWF J;  2MD0 A;  2DAO A;  2Q0O A;  5CJ9 A;  4A3L J;  3GFI A;  4V2F A;  4A5N A;  3CZ6 A;  4J7I A;  4B1R A;  4IKF A;  4PCQ A;  3VPR A;  2H8W A;  4RB2 C;  2MH2 A;  4HDU A;  4A0Z A;  2LRD A;  1DPR A;  4FE7 A;  1MMS A;  2HGC A;  3AL0 B;  1WFX A;  3JRI A;  4IZZ A;  2RQQ A;  2K85 A;  3R0J A;  1SFK A;  1YOV B;  3QPT A;  3BR5 A;  2LYC A;  4DYQ A;  4WXC A;  3QP5 A;  3DLA A;  1A31 A;  2HI3 A;  4Y4R A;  5DD8 A;  4CDG A;  2Y0S A;  1ZAO A;  2X6X A;  1F1Z A;  1W4M A;  2F5F A;  4XRS A;  2NS8 A;  3W2V A;  3GTG J;  3LSI A;  1R36 A;  3DB5 A;  3WTX C;  1CF7 A;  6PAX A;  4P96 A;  1P7I A;  3T5X A;  5TJJ A;  2IGO A;  3K4J A;  1UST A;  5EGO B;  4S05 A;  4IEJ A;  4IRI A;  1TNT A;  1RZ4 A;  4XON A;  1ZLJ A;  3MD2 A;  2KRC A;  4QPQ A;  1Z3X A;  2CU7 A;  1OYY A;  1R5H A;  3GTP J;  3F9Z A;  4IJD A;  2EV6 A;  4L5J A;  4J00 A;  3I71 A;  1DUX C;  1ZK8 A;  3GFM A;  3K10 A;  1YFH A;  4IHX A;  3S2H J;  1MH3 A;  3ZRG A;  4LG0 A;  1X19 A;  2VT2 A;  1VQL I;  4FET A;  2H94 A;  5D5V B;  1ETY A;  1KQ9 A;  3AG2 H;  3HZJ A;  1I1S A;  2EIJ H;  3GX4 X;  3P9C A;  1HW5 A;  4BXU A;  3P7N A;  2JSP A;  4CYD A;  2CV2 A;  3TG5 A;  3WTZ A;  2CRG A;  1DP3 A;  4IF4 A;  3N4M A;  2D1V A;  2IPQ X;  3DLL F;  3O3K A;  4WCG A;  3IUO A;  5D6E A;  5BMZ A;  2VQH A;  5LFA A;  1U2W A;  1AU7 A;  1UEL B;  1KU3 A;  5IYC J;  1RIO H;  1DU0 A;  3GUD A;  2V9P A;  3BR1 A;  3Q9S A;  3S3M A;  3EUK L;  3O6B B;  2DJI A;  5CVU A;  5H2F C;  3WTY C;  1R22 A;  3O8G A;  5TH7 A;  4BE0 A;  2DA2 A;  5KJM A;  4HRI A;  2R7F A;  2DT7 B;  1R1V A;  4A2U A;  4CA0 A;  3W6K B;  2Z9O A;  1KQ8 A;  5J1Y A;  3HYI A;  3ISP A;  4EGY A;  1EF4 A;  4L9J A;  2XKP A;  4XOT A;  3FXL A;  3ZMV A;  4AVZ A;  1LDK B;  2H6C A;  2FA5 A;  4R8H A;  2BXZ A;  2VB6 A;  3CD6 I;  4LOC A;  3S7D A;  1LEA A;  3D5R C;  1V5F A;  3EUA A;  2DU9 A;  1BOB A;  4HV6 A;  3S3N A;  5F08 A;  2ADU A;  4NQW A;  1O4X A;  1B59 A;  2KJB A;  2M34 A;  2BXY A;  3HRS A;  1SFO J;  3REO A;  2NS7 A;  1E2X A;  1X3W B;  2D45 A;  3VYR B;  1P7J A;  1DGR M;  3RPQ A;  4ENM A;  1NK3 P;  2R5Z A;  3AAF A;  4EAT A;  1R5I D;  1JJ6 C;  2DTR A;  2K9Q A;  4E7H A;  4BJ5 C;  3NAR A;  2A07 F;  3L7W A;  3H3V K;  2LKS A;  3GTM J;  1ZYR F;  3S1N J;  1WJF A;  2PMZ N;  2KP6 A;  2XAJ A;  3K4M A;  4BBR J;  2XRN A;  3DKW A;  2CS3 A;  3D5L A;  5J3L A;  1LVK A;  3DU6 A;  3NQO A;  1HST A;  1UJ8 A;  5JLX A;  2OUM A;  1X1P A;  3ZQI A;  5DCM A;  1IF1 A;  5LGN A;  2EZH A;  3IL2 A;  1YYV A;  2R4G A;  4A3E J;  3L2Q A;  4M6Y A;  4ANJ A;  4JX5 A;  2OZU A;  1GUU A;  1SFX A;  2V1N A;  3CDH A;  1JT6 A;  2X0L A;  3BG6 A;  4QEO A;  2ME0 A;  2NVQ J;  1SFU A;  4OIQ F;  1T95 A;  1EH8 A;  2TRT A;  4HX8 A;  1B72 B;  3HJE A;  3SEZ A;  2FOW A;  2VKD A;  5D6F A;  4E7I A;  3FMQ A;  2GIV A;  2R5Y B;  4C1Q A;  1ZEL A;  2TCT A;  1X58 A;  1PUF B;  3PDN A;  5T0M A;  1FC3 A;  1X2M A;  2CQQ A;  2KIS A;  4YND A;  2GXB A;  1MUF A;  1YS6 A;  3IHX A;  4LK1 F;  2NVX J;  4BQA A;  2VQC A;  4DBR A;  1HQC A;  1RNL A;  2L4A A;  4M3F A;  2DPU A;  4UVA A;  1S7E A;  2MH9 A;  3OWT A;  5ARG A;  3K2Z A;  4OIP F;  1LEB A;  4QWQ A;  3U2R A;  4YEL A;  3V7C A;  2PJP A;  5GAD J;  2QSH X;  1ONV A;  4C2U A;  5ICF A;  2W7N A;  2L9S A;  1HKQ A;  1CGP A;  5KJL A;  1DQU A;  2DFE A;  5J40 A;  1REP C;  1W7P D;  2P7V B;  3QPH A;  2ZXJ A;  3K7A J;  4YEJ A;  1Z9C A;  1I6H J;  5LRR A;  2ZSI B;  2M45 A;  1RES A;  1TBX A;  4HQM A;  5JIN A;  1Z6R A;  5TIS C;  3EP0 A;  4MI5 A;  2HR3 A;  1GXQ A;  3WU0 A;  2Y9Z A;  3BLY A;  1Z7U A;  1R49 A;  1IJW C;  2B63 J;  1SD4 A;  2L01 A;  4BY1 J;  1MDM B;  4OIR F;  2RAE A;  2GA2 A;  1VQ4 I;  4E7S A;  2YU9 J;  4ENJ A;  2DMQ A;  3TW7 A;  4HDV A;  3T1B A;  4YNM A;  2K27 A;  2M4G A;  3WE2 A;  1HLV A;  1Y0N A;  3L2C A;  3FM3 A;  3ABT A;  4ZH4 F;  4R79 A;  1PEG A;  5KJK A;  5FLX K;  2IS2 A;  3MKZ A;  3CCY A;  4XBF A;  3JRA A;  4V2G A;  4D0P A;  2M8E A;  4JP0 A;  4BE2 A;  4LFU A;  3M54 A;  1YLF A;  1JKO C;  1U5T C;  2GXA A;  3F8F A;  2L7K A;  2PX9 A;  2VT3 A;  2N8G A;  1UMQ A;  3PNT A;  3ABM H;  3FIS A;  1A35 A;  3DEE A;  1SAU A;  1G3W A;  3ERE D;  3DEU A;  4BUP A;  5ARF A;  3CCL I;  4QEN A;  1N3J A;  3A02 A;  3P5J A;  3GZ5 A;  2R0Q C;  2DFF A;  3FIW A;  1B9M A;  2L7M P;  3RKX A;  3BJ6 A;  4BNC A;  3DKY A;  3FXQ A;  3PM1 A;  2H6B A;  2XVC A;  1WJC A;  4NUB A;  4UUT A;  2CQ7 A;  1BM9 A;  3OOU A;  2QBY A;  4IJ8 A;  4DZJ A;  3GBG A;  3H36 A;  1EV7 A;  3PUF A;  4AUX A;  1FYL A;  2M8G X;  4BHC A;  3U1D A;  4PK4 A;  4PGH A;  3E6C C;  1LPQ A;  2W85 A;  1FP2 A;  2HOE A;  2L3D A;  1C0W A;  2IA2 A;  3E3V A;  2E60 A;  4NDL A;  3EQL F;  3O8H A;  3TW6 A;  3CCE I;  1Z7L A;  1K6Y A;  3S1Q J;  3S17 J;  4HST A;  4PUS A;  3SYT A;  4M9Z A;  5LSX A;  3WU2 C;  4RB3 C;  2RV8 A;  2ECC A;  3EYY A;  1LJ9 A;  3A4C A;  2DMN A;  1WSU A;  3MQ0 A;  4CCN A;  1V5E A;  3RYP A;  2K7L A;  1E3O C;  1J09 A;  2EZL A;  1WI3 A;  3KIO A;  4OIN F;  1UAA A;  2F5D A;  2LOO A;  4UY8 I;  4ZTJ A;  2ESH A;  1KQ0 A;  3K9T A;  4ZDO A;  2WY7 Q;  2BY3 A;  3DFG A;  2A68 F;  1H88 C;  1U6G A;  2XPW A;  3HOW J;  4HX4 A;  4C30 A;  4CXF A;  4KDP A;  1XDU A;  4CYC B;  1MT6 A;  4IHS A;  3VFZ A;  4LG3 A;  1ON2 A;  4EV0 A;  5AIQ A;  3ERM A;  2HNH A;  1F9N A;  5KAI C;  4CCK A;  3KFW X;  3LQQ A;  3OIP A;  3HM5 A;  3I53 A;  3BDD A;  2HQA A;  2A61 A;  1K61 A;  3TO9 A;  1ZGW A;  5DTD A;  3GTO J;  4XSZ F;  1RRJ A;  2RC4 A;  2ESN A;  3JRH A;  1AOY A;  1FYK A;  1MMA A;  5KAF C;  2BHZ A;  2IJL A;  4OU0 A;  1A04 A;  2R7O A;  4BAC A;  1YW9 A;  2YR2 A;  4MQV A;  3OSF A;  1TTY A;  2ID6 A;  3S3O A;  3KCC A;  1LVA A;  3BG7 A;  4ZYD A;  1X2N A;  2IXS A;  4L5E A;  5EYR A;  3WGH A;  1D8J A;  1FEX A;  2FML A;  3CTA A;  5EEH A;  1U5T B;  2DW4 A;  5D5X B;  3M55 A;  2ZXI A;  1GDT A;  3CC4 I;  2WA0 A;  4A93 J;  2JUC A;  3HEF A;  1J9I A;  4P9F A;  2EWN A;  2XF7 A;  4OIO F;  3HRM A;  1W0U A;  4E6K G;  2BVM A;  4KIF A;  5E79 C;  1Y56 A;  2XAS A;  3GTQ J;  2HKO A;  1O3R A;  4YFK F;  1CQT A;  4PJJ A;  3VYU B;  3SW9 A;  1HBX G;  2FE3 A;  3BJA A;  2W84 A;  3OYC A;  4YIF A;  2WB1 N;  2XPV A;  1LE8 A;  4N4O B;  4NC7 A;  1E3P A;  3RPU D;  4JDS A;  3KPH A;  1MBG A;  4DOZ A;  3LSP A;  1X4P A;  5E18 F;  2DQL A;  4FCY A;  3NWS A;  1FLI A;  4E7J A;  3GW2 A;  3K70 D;  3HB9 A;  2DA6 A;  2ZJ2 A;  4H4K C;  2XIG A;  5JVG F;  1ETV A;  2M0C A;  1HDP A;  5K1Y A;  1W7P A;  3VYS B;  1FTT A;  1SD7 A;  2HPM A;  3P9I A;  4YFN F;  5HNH A;  4HG2 A;  5IY5 H;  2IVM A;  4LMY A;  4DJA A;  2X48 A;  4PSX A;  3OYE A;  4D7M A;  1T56 A;  3FXR A;  2OTJ I;  2E5N A;  1XMX A;  3SZP A;  2JVH A;  1SMY F;  4XKB A;  2QVO A;  4RS8 A;  4BE1 A;  3FDY A;  4XNF A;  1BIB A;  3VUZ A;  3MZ8 A;  5IPA A;  3ZP5 A;  2F4M B;  1Z0X A;  5EG0 A;  5J47 A;  4ITV A;  2ELJ A;  2Z1D A;  3HC7 A;  2G7H A;  5DUK A;  3FHZ A;  4MGR A;  1KU2 A;  2X1E A;  2ID3 A;  3FK6 A;  3HKZ N;  5J8C A;  5CQE A;  3OIO A;  4BQN A;  1W36 D;  3QWW A;  3C7J A;  3WG9 A;  3V7S A;  2YS9 A;  3CJN A;  3B02 A;  1IXR C;  2D2W A;  5F64 A;  1JHH A;  3S2D J;  1TW2 A;  2X1C A;  1Y1V J;  3W6V A;  1OLT A;  1J5Y A;  4KIG A;  1EA3 A;  2HVR A;  5E1X A;  2ISZ A;  2EFO A;  1VQN I;  2FQ3 A;  4NBQ A;  3CCS I;  3KE2 A;  4RGR A;  2PLY A;  3V42 A;  3ZN1 A;  1VQK I;  4DNC A;  5DM6 F;  1S72 I;  4QTR A;  1I3A A;  3ROU A;  1L3L A;  1JTX A;  2QKM B;  1AKH B;  2DDB A;  1TZL A;  4BHP A;  3M3Y J;  1XD7 A;  3TOA A;  3OYJ A;  1GXP A;  3T8R A;  5F0C A;  1CF7 B;  5E3N A;  2STW A;  1KYZ A;  2HYG D;  3GLX A;  4MHG A;  2OTL I;  1FBQ A;  1OIS A;  2OA4 A;  4KN7 X;  5E1W A;  2QM3 A;  3ONQ A;  2UUZ A;  3DXJ F;  1BOA A;  1R23 A;  3QPL A;  5LD2 C;  2Y9Y A;  3K5K A;  4XM3 A;  1D0X A;  4AIK A;  1NH3 A;  1IGN A;  2A5Y B;  3EYI A;  4EM0 B;  2RN7 A;  3LWF A;  3Q0V A;  5K5O A;  3L2R A;  4Q48 A;  2DTZ A;  1GHC A;  4QPO A;  4IOC F;  1POG A;  3OXF A;  4X6A J;  4H0E A;  4Y7N J;  1A6Q A;  3OYG A;  4NNJ A;  4KIT B;  2QEN A;  1K7A A;  3ML6 A;  3DAL A;  3PJR A;  1WJA A;  3H5A A;  4IJA A;  3SQN A;  4F7Z A;  4AVP A;  4RA2 A;  3HOY J;  3JRF A;  2H27 A;  3ESW B;  5FKO A;  1VQ9 I;  3KYD B;  3FWE A;  3PFY A;  2DO7 A;  4I7H A;  4KT5 C;  3RDI A;  1WRJ A;  3F6O A;  3H92 A;  2KKO A;  2HTJ A;  4UNO A;  5H20 A;  4KIS A;  2O8K A;  3HPH A;  5T5G A;  2V79 A;  3OL3 A;  5D4R A;  2VE9 A;  5IP9 J;  5JIY A;  3HOZ J;  1HA8 A;  2AXT C;  2GA1 A;  5F1R A;  4BYY A;  3FMS A;  1N6C A;  2PMU A;  1K79 A;  1T38 A;  1E17 A;  3RIR A;  3BT9 A;  2DT6 A;  3GME A;  3CQZ J;  4HSR A;  1DU6 A;  2PEX A;  2Z3Y A;  3I3L A;  2BW3 A;  4RB0 A;  1D0Y A;  2L4M A;  3TBI A;  4L0Y B;  3J7A O;  3OYD A;  4M6V A;  4X1E A;  1BJA A;  2MGQ A;  3F9Y A;  2MLK A;  1FOY A;  2KT0 A;  1WJE A;  3IWF A;  3WTT C;  1TQM A;  2CFX A;  2HZD A;  3NAU A;  2Q2E B;  1V55 H;  3CLQ A;  3L09 A;  1V54 H;  5FKM A;  3HSE A;  2BOL A;  2LK2 A;  3RPU A;  3HDD A;  4A3B J;  5LEJ A;  1JKR C;  3N71 A;  2L5Q A;  3HRT A;  4X0G A;  2HVS A;  4L5I A;  3G3Z A;  5DCM B;  2E71 A;  2UWM A;  4KMU X;  1E0E A;  3NEU A;  2M9H A;  2R7D A;  4HX7 A;  4AIJ A;  1SC7 A;  2EIN H;  2TDX A;  2IGK A;  4GO1 A;  4BH9 A;  2EV5 A;  2LG4 A;  4EJT A;  2XGC A;  1NHA A;  3VSL A;  2O8X A;  2CQK A;  3WE3 A;  1WPK A;  4G12 A;  1ORK A;  3K4K A;  3TO6 A;  3TMO A;  1ZKG A;  2WY8 Q;  2K02 A;  1I27 A;  4M9X A;  1FIA A;  3MO2 A;  4RM2 A;  3W2W A;  1VZ0 A;  5FFZ A;  5FO5 A;  1D8K A;  4B3X A;  4WXH A;  4XSX F;  1T0F A;  3ZMZ A;  5J8F A;  1IRG A;  4CZZ A;  2QLZ A;  2VJJ A;  1XQH A;  5TGT A;  2FBI A;  3IRR A;  4L9N A;  2XKO A;  2KJC A;  2YU3 A;  2DA7 A;  2LVS A;  4MTE A;  3RKY A;  5KK1 A;  1ZAR A;  2AHQ A;  1QPI A;  1SVO A;  2X6Y A;  2VJ4 A;  3FX3 A;  4IL6 C;  1OQY A;  1QVU A;  1S3J A;  3G71 I;  3ASN H;  3GYH X;  3V8L A;  4CCO A;  5L3F A;  4YIR X;  1R6R A;  2LBF B;  4DBQ A;  3ZCO A;  2V4J C;  4LLG F;  3I58 A;  3OYH A;  2XAF A;  3H3U A;  2KPM A;  3DPT A;  4HA8 A;  3CCM I;  1R71 A;  3KMA A;  2ME6 A;  2ZSH B;  3WTS C;  5GPC A;  1UFM A;  5A2Q Z;  3OV8 A;  4KFC A;  2VAS A;  1BI0 A;  3FKJ A;  3KP6 A;  4ZZD A;  3BP8 A;  1YRN B;  3QWP A;  1FJL A;  2PN6 A;  3H35 A;  1WHU A;  3E5Q A;  1XGO A;  1UHM A;  2QPW A;  3JRC A;  4L18 B;  4NVQ A;  4IHV A;  4ESJ A;  3IV5 A;  1B8I A;  3CF5 F;  1HF0 A;  3WTU C;  2HVQ A;  2R7W A;  2I10 A;  2V6E A;  4HNT A;  2ZB9 A;  2EPF A;  3E0J B;  3PIP F;  2RGV A;  2HEO A;  2V26 A;  4CCJ A;  4ETS A;  1MIJ A;  4II2 A;  4KIB A;  4FTH A;  1N25 A;  4MFD A;  1ZKK A;  3LAJ A;  2OQR A;  1V5G A;  3AG3 H;  3RAY A;  2QSG X;  4XIC A;  2KIQ A;  4EJW A;  1RUO A;  1R9T J;  5LSZ A;  2P0W A;  3QYE A;  1FX7 A;  2D1H A;  2IAI A;  2WAQ N;  3EDP A;  2CV0 A;  1Z67 A;  5EG2 A;  2FMY A;  2WAE A;  2IA0 A;  4AYB N;  2DOE A;  2Q8K A;  3LSJ A;  2E1N A;  3OYA A;  3HGY A;  2ZFU A;  1MZB A;  4XOR A;  1Z77 A;  3FKI J;  2OZ6 A;  1I50 J;  4HNV A;  2CW7 A;  2X9D A;  3GO5 A;  1YG2 A;  2CSO A;  2LFB A;  3GF2 A;  5IYB J;  1IN7 A;  4XLP F;  5HLI A;  3MEX A;  4KJZ A;  4EGZ A;  2HOS A;  4DZP A;  1USS A;  4BGD A;  4B43 A;  2QKL B;  4Y13 A;  4RAZ A;  3CBM A;  3FBN B;  5LBQ A;  1TQP A;  1JI8 A;  3D0S A;  3H9Q A;  2QBY B;  2ZXW H;  1XN7 A;  3HOU J;  2IT0 A;  3B73 A;  4NC8 A;  3DP7 A;  1NK2 P;  4YPA A;  2ZXH A;  3IH2 A;  3LQR A;  1W5T A;  2V1X A;  3LOC A;  3C1D A;  5DEQ A;  1MBF A;  4PJL A;  5DD4 A;  1KZH A;  3HNA A;  4UHT A;  1YTY A;  2W48 A;  2XSJ C;  1EJ9 A;  2EFW A;  2GIZ A;  4A3G J;  1QQI A;  3K1N A;  1SFE A;  2PG4 A;  4HW0 A;  3M8E A;  1YIO A;  3BOQ A;  3G73 A;  2QQB A;  1H9T A;  4HYE A;  2Y69 H;  1BI2 A;  2QWW A;  3BZK A;  3OL4 A;  3KX2 A;  2L02 A;  1MJ9 A;  4XQF A;  4B3A A;  3H5N A;  4YPE A;  1I39 A;  2L7F P;  2XB0 X;  2ZC2 A;  4RDU A;  1G8X A;  3LL7 A;  4QIW N;  3K0L A;  2JPB A;  3PQJ A;  4HV5 A;  1VTN C;  1R4M B;  2HKX A;  1XSD A;  1JKP C;  4A6E A;  1A5J A;  1MBE A;  3BRO A;  4GFB A;  2VOO A;  1IXC A;  1UB9 A;  5HLG A;  1JKQ C;  1ZTR A;  4HNU A;  4EM2 A;  1GV5 A;  1Y8R B;  5ED4 A;  3ABK H;  3BR0 A;  5KHD A;  1IUY A;  1A6I A;  1MGT A;  4HZF A;  3VWB A;  3LNQ A;  2ZJQ F;  2PMH A;  3KZI C;  4E4H A;  3VB2 A;  3M07 A;  4CUG A;  1O3S A;  2XB5 A;  3F22 A;  4HQE A;  4Q4Z F;  2VL8 A;  1Q1V A;  4D5F A;  5LRS A;  2DMT A;  2AXL A;  3FXU A;  4GYI A;  5FKL A;  4MLO A;  3ZQ7 A;  1WZ2 A;  1FOX A;  4ZDL A;  1P4A A;  2HS5 A;  4RAG A;  4NB5 A;  5JR3 A;  2MBF A;  4IQ4 A;  3ULQ B;  4Y15 A;  1XPX A;  3GZ6 A;  5HQ8 A;  2F5V A;  3UR3 C;  3ZMU A;  4F91 B;  4BHB A;  5FJ8 J;  2DQR A;  4FIS A;  2RRE A;  4Y17 A;  3C2H A;  3ZMS A;  3LAP A;  1UG2 A;  3CLO A;  3K4C A;  3S16 J;  3DU5 A;  3Q5F A;  1IRF A;  2M0M A;  4PFO A;  4S04 A;  2WTE A;  5TEG A;  3M58 A;  2XAU A;  2OBP A;  1RPW A;  1TWH J;  1QU3 A;  2LP0 A;  1J0R A;  3BG9 A;  4ASN A;  1QBJ A;  4W1U A;  5CVR A;  2IRF G;  3HOS A;  3AKZ A;  1A36 A;  5ICC A;  1HKT A;  2M1B A;  1ENH A;  2ZKZ A;  3M59 A;  5E3O A;  3R0A A;  5B3S H;  2PMZ A;  3M4O J;  1DGW Y;  2BZT A;  4M3D A;  3J7Y J;  1LE8 B;  3RKW A;  3BO5 A;  1FSH A;  1APL C;  2IS6 A;  3JAM K;  4XLE A;  2QYO A;  1KON A;  5K5Q A;  3SWC A;  2JPC A;  2WBM A;  1WH5 A;  2Z2S B;  1W7P B;  2DBB A;  2LNB A;  1BC8 C;  2R92 J;  1R1T A;  3OPE A;  5HI7 A;  4MIM A;  2E35 A;  2EFQ A;  1IW7 F;  4ZC3 A;  1OYW A;  1Z05 A;  2FXA A;  2LSO A;  2QF7 A;  4XLC A;  5HNF A;  1YJN I;  2M5W A;  1G4D A;  2ZFW A;  2X6O A;  2P6S A;  2RKH A;  2KMU A;  3M8J A;  3PSF A;  4I6Z A;  1TT5 B;  2LF8 A;  1GVD A;  4O5V A;  3HUG B;  3L2U A;  1P2F A;  1WGX A;  3QOD A;  5C3E J;  2I8D A;  2DMP A;  5EG0 B;  1WH7 A;  2VJI A;  3CO6 C;  3JAM Z;  3DBH B;  4F52 A;  3BG5 A;  1ZLK A;  2FD5 A;  1FT9 A;  5GAH J;  5TTF A;  1G6N A;  1AWC A;  2ICW G;  4ABZ A;  3HSR A;  3HBL A;  2DJN A;  3HHH A;  3TKY A;  2CJJ A;  5GTI C;  5B5E C;  3H0G J;  5CQG A;  2XSD C;  2CQN A;  3UNG C;  1B1B A;  3CCU I;  1BR1 A;  1N78 A;  4NJ5 A;  3QOP A;  2A5W A;  4ZTF A;  4GRI A;  2IW5 A;  2HOA A;  2JTV A;  2QQ8 A;  1XDS A;  2VBY A;  5DS9 A;  3JRD A;  2AS5 F;  4P9U A;  2JA8 J;  2L9R A;  4RLF A;  3M5A A;  4NHJ A;  2E1O A;  2OF7 A;  3BJO A;  9ANT A;  4UXN A;  1M1E B;  2GLO A;  2EZI A;  3M9A A;  2HQR A;  4I99 C;  3S1M J;  4LB6 B;  1ZR4 A;  3K70 C;  3BZC A;  3G1L A;  3RSN A;  3LFK A;  5KJN A;  5IOY A;  3HHG A;  5DM7 F;  1YX5 A;  3T8T A;  2W25 A;  5HOO A;  4PSW A;  2JQ7 A;  1RR8 C;  1QA6 A;  5EGO A;  2LF7 A;  4F92 B;  4G9Y A;  3R4K A;  2VC0 A;  4GCV A;  1MJB A;  1U9O A;  1WJB A;  4E7Z A;  2P4W A;  1Y0U A;  4EMS A;  5DDG A;  3MO5 A;  1MND A;  1ZRE A;  1QNT A;  4JBA A;  2FBH A;  4PZJ A;  1XTA A;  2X85 A;  1IN6 A;  1O3Q A;  1T0F C;  3DBL B;  4F3Q A;  3HGG A;  1P6R A;  2F2E A;  4XR6 A;  4WWC A;  4N9I A;  1SVL A;  4UVC A;  1KYW A;  1U3E M;  5HDK A;  2GXG A;  1ACI A;  3K4L A;  4MFE A;  4LD5 A;  3VEP A;  2MFZ A;  2EA2 A;  2E7X A;  3WGI A;  4IHT A;  1W36 C;  3DTK A;  2QZ8 A;  4E7K A;  4U0Y A;  2E2I J;  1ZH5 A;  1WJD A;  2R7R A;  3CDL A;  4C3H J;  1PDN C;  1Q1H A;  2HTS A;  1T08 B;  2B7E A;  4PJN A;  5E3M A;  3CMA I;  1UHW A;  5K7H A;  4BQQ A;  1FY7 A;  1K4T A;  1O9S A;  1ETX A;  5EDN A;  1D1B A;  3G4S I;  5HVQ C;  3L9F A;  2HDW A;  3OMY A;  3GXO A;  1K4S A;  2VXZ A;  2KLO A;  2WAF A;  3HTS B;  4EEF G;  3WHB A;  4BS9 A;  2RQP A;  3JSO A;  3F8C A;  4HPQ A;  2M30 A;  5HLH A;  4ENN A;  4Z2Y A;  4CCM A;  1FBS A;  3IHU A;  4UVB A;  2HDC A;  1D0Z A;  2M87 A;  3ZQG A;  1D3Y A;  3DCF A;  3F6V A;  4OAY A;  5F27 A;  3JW4 A;  1F36 A;  3CDI A;  5FLM J;  3FM5 A;  2MSY A;  2IP2 A;  3QWL A;  2L9V A;  5M5W J;  1HDD C;  5GP9 A;  4D1Q A;  2BY2 A;  4ENK A;  3V8K A;  3E7L A;  1X4O A;  2X6W A;  2DDA A;  2G46 A;  3ASO H;  4G7H F;  1BI1 A;  3GTJ J;  2P5K A;  1XX5 A;  2XUB A;  2HXO A;  2IBD A;  2B0L A;  4XRS G;  2F5C A;  3DBR B;  5E20 A;  1ML9 A;  1K78 A;  4C3I J;  2KIM A;  4F55 A;  1TQI A;  1ZRF A;  1T98 A;  2JK3 A;  2DA1 A;  2JVG A;  5ILU A;  2UZK A;  4KN4 X;  4C3J J;  2E2H J;  1MBJ A;  1VQ8 I;  2VPR A;  4P5O A;  1ZG3 A;  3BG3 A;  2VOD A;  4CCL A;  1I3Q J;  2NAZ A;  5J1U A;  4JQF A;  4N9H A;  1O57 A;  3JRG A;  1SAN A;  3SJM A;  1U0J A;  3QP6 A;  2WV1 A;  5F0F A;  2ELH A;  5AYF A;  2DFH A;  3HPG A;  4A0X A;  4RM3 A;  3BTI A;  2HZT A;  1YIJ I;  2W82 A;  2BYV E;  2OAZ A;  5E8I A;  5FKN A;  1FMV A;  1QZY A;  2J5P A;  1OR7 A;  2R7V A;  3TP3 A;  3DKX A;  3SEQ A;  2K9S A;  3BR3 A;  3LA2 A;  2P8T A;  1QZE A;  5FKK A;  1VQ7 I;  3MN2 A;  5BNG A;  5BOX A;  4AM3 A;  4I02 A;  3EET A;  4MEY F;  2WB1 A;  1PVE A;  2L7Z A;  4BJT A;  4IXA A;  2DK5 A;  3GFJ A;  3A01 B;  3H9G A;  1XSX A;  3IKV A;  3CJR B;  4LB5 A;  3F3X A;  3ZQL A;  5DCF A;  3RQI A;  3A2K A;  1UHS A;  3I64 A;  3MVP A;  3E6B A;  5JHU A;  2XGD A;  3H0D A;  2EIK H;  3V4G A;  3S1R J;  2DYR H;  3KLN A;  3J80 K;  3OYK A;  3OR1 C;  4L9T A;  1PYV A;  2XF5 A;  1JJ8 C;  2LMD A;  2EBI A;  5J4V A;  3BTL A;  3PO3 J;  4EJV A;  4J19 A;  3KP2 A;  2I5U A;  3BPX A;  4XID A;  3LST A;  1QZZ A;  2LH9 A;  1N75 A;  4WXD A;  3F8N A;  3FBI B;  3FXJ A;  5J1R A;  3I54 A;  4G6D A;  2VI6 A;  3SFZ A;  5M5X J;  2MA3 A;  4L9V A;  5GAG J;  2EFP A;  4I2O A;  2AQF A;  2K9M A;  2FEZ A;  3DF8 A;  5KVR A;  1B6A A;  4FAS D;  1RR7 A;  5EF6 A;  1D5V A;  4M71 A;  4MNU A;  4XL9 A;  3PNY A;  4I76 A;  3HKZ A;  2ZJP F;  2KIF A;  3QYF A;  3MZY A;  3U21 A;  5IT9 K;  5E8G A;  2A6H F;  3RJP A;  3J80 Z;  3GTL J;  1W5S A;  1MVX A;  4Z4P A;  4EJO A;  3HOX J;  1XS9 A;  1OCT C;  1K83 J;  3G2B A;  2JRM A;  2P6T A;  2PJR A;  5K7Z A;  1LDD A;  4CHU A;  1RUN A;  2OU2 A;  3FMR A;  5BPD A;  5EEG A;  4I01 A;  2JZY A;  1RI7 A;  3MCZ A;  5J6X A;  4PGG A;  3CC2 I;  4GXO A;  3NWT A;  2OQG A;  1R00 A;  2DYS H;  1ZGA A;  3BWG A;  2ZCW A;  4LG0 B;  4D9J A;  2FBK A;  2VPL A;  2EZK A;  3JTG A;  3HXL A;  2MAB A;  3MEK A;  4Q47 A;  2DOF A;  4R1H A;  4ZYA A;  2YSR A;  4BAY A;  3M1C A;  2FQ4 A;  1P4W A;  4LIV A;  3IKT A;  4BJ6 C;  4CSW A;  3S7J A;  1PUE E;  1YQA A;  2FOK A;  2NNY A;  5IT9 Z;  2XHK A;  1JT0 A;  3H1C A;  1K6O A;  3CES A;  5AIP A;  2ZO4 A;  5ILV A;  2NOG A;  1O7F A;  4MEX F;  5D5U B;  1ZRD A;  2LKX A;  1G3T A;  3KP4 A;  4HF0 A;  3RI4 A;  2LTP A;  1T6S A;  4XLN F;  3BY6 A;  3K4B A;  2ISY A;  3CME I;  3ZQF A;  2IS4 A;  2KRH A;  4D7N A;  4YPU A;  2QQA A;  4NC6 A;  3S8P A;  3GFL A;  2QGU A;  1TC3 C;  2YX7 A;  2O9L A;  4DGW B;  1TP4 A;  3I5U A;  1H3I A;  3WHC A;  2LY9 A;  5HS7 A;  2FX0 A;  3GEZ A;  2GBY A;  2K3P A;  4B8X A;  4U87 A;  2UV1 A;  2HQN A;  4KT6 A;  5K5R A;  4CH7 A;  2CUZ A;  1F43 A;  1XC5 A;  2F4O B;  4UUS A;  1R5G A;  2ZME A;  4O6J A;  3ZGK A;  2H8R A;  3TP0 A;  2IGQ A;  3VOE A;  3IC7 A;  1ETQ A;  4NQW B;  3CJQ B;  2F6C A;  4PJM A;  5ICE A;  3BCB A;  2JUG A;  2P7C B;  2E1M C;  1IN4 A;  2E1C A;  3W3C A;  2FJ1 A;  1SVM A;  2R5Z B;  1H89 C;  2LDU A;  1Z1D A;  4CYC A;  2ETH A;  2RFI A;  1I6X A;  4M6X A;  2W24 A;  2UXX A;  3BQZ A;  4FMU A;  3I0T A;  1IV8 A;  3FXO A;  4ZZL A;  2VQG A;  3LA7 A;  4RBO A;  2M3A A;  3F0C A;  1S29 A;  3CCR I;  3CBO A;  4I51 A;  4HF2 A;  4J01 A;  3M53 A;  4IO9 F;  1WVR A;  2K40 A;  4XN0 A;  4BEH A;  1XMA A;  3VOD A;  2EB7 A;  1ULY A;  3TL4 X;  3A0H C;  1V3F A;  2FRH A;  4U88 A;  5L3D A;  1JGG A;  2K9L A;  1BR2 A;  2NVY J;  3FHN A;  1S7A A;  2JSC A;  2V6C A;  1ITY A;  3DTI A;  1F5T A;  3J7A Y;  3D5S C;  5L3E A;  3I56 I;  2HYF A;  2DA4 A;  3CO7 C;  1OCP A;  5A2Q K;  3NRV A;  2AQE A;  4IHW A;  3ZN0 A;  3KP7 A;  5KNL A;  3KEQ A;  3F9K A;  1ODD A;  4RLQ A;  4XLF A;  2V1D A;  3CUQ A;  1IRX A;  3OY9 A;  4II3 A;  3PNV A;  1YO5 C;  2XF6 A;  3JTH A;  4XKV A;  2QA4 I;  3COA C;  1P92 A;  4KA4 A;  5EJC A;  5IOZ A;  3ELK A;  3MO0 A;  2VXD A;  3HG9 A;  5E3L A;  2L54 A;  1QVT A;  2P81 A;  4GYG A;  4Q5S F;  4O30 A;  1RET A;  1HC8 A;  3S14 J;  4HLY A;  1XGS A;  3D1N I;  3I55 I;  2KZV A;  2FUG 2;  2NS0 A;  2V9K A;  1O7L A;  5F04 A;  4C2M J;  3BCA A;  2F5E A;  2NYX A;  3QU6 A;  1BI3 A;  4CGZ A;  3LFU A;  4I0A A;  1JHF A;  1OCO H;  4MTD A;  2CUE A;  4G6Q A;  2R7Z J;  1N6A A;  1MSF C;  2LC2 A;  4MI0 A;  1FWZ A;  3KP5 A;  1Y8Q B;  1NG6 A;  4JK1 X;  5IP6 A;  3QRF F;  1LFU P;  1X1D A;  3JSP A;  2QUF A;  4HEA 2;  2E1M B;  2CV1 A;  4DQ2 A;  3ABL H;  5F6L A;  1Z21 A;  1MKM A;  4HBL A;  1BA5 A;  3I59 A;  1P4X A;  5DUI A;  2HOT A;  1O3T A;  1Y6I A;  2KQR A;  3R61 A;  1JUM A;  3WGG A;  1U78 A;  3GLL A;  2VOP A;  1X1C A;  3TG4 A;  1BW6 A;  5BQT A;  2VC1 A;  1S9H A;  3N05 A;  4IOA F;  1IRZ A;  4BU2 A;  2E7W A;  2BEO A;  4FQG A;  1XB4 A;  4LGW A;  4LIT A;  1YI2 I;  3LSG A;  4FX4 A;  1KU9 A;  1TWG J;  4WF2 A;  3WOD F;  1LFB A;  2YPR A;  1FP1 D;  1FSE A;  3PQK A;  1EH6 A;  3CBP A;  1AKH A;  4G94 A;  4BY7 J;  3F8M A;  3HOT A;  5IP7 J;  2M4K A;  4M3G A;  3C3W A;  2W1O A;  2DI3 A;  1NTC A;  3H3Z A;  1FNN A;  1WKM A;  2O8J A;  3OYN A;  4MQ9 F;  2CW0 F;  4RAY A;  4AID A;  3PFI A;  4LIU A;  2WAQ A;  1MNM C;  4XK4 A;  3R6S A;  4AYB A;  3S7F A;  4JYK A;  2O3F A;  3RYR A;  3J81 K;  3WTW C;  1OKR A;  1QHH D;  4JOM A;  2KDZ A;  1ZQ3 P;  1VI0 A;  2O5R A;  3EPZ A;  2BQZ A;  3KYC B;  2PBI A;  3R60 A;  1NG7 A;  1Y1W J;  2IGM A;  3DPU A;  3HIF A;  2P5V A;  1OR7 C;  2RNJ A;  2E34 A;  2BVL A;  5E17 F;  1GVJ A;  1I1G A;  4LJZ F;  2J5O A;  5ILS A;  4C9Y A;  4J7F A;  2DOD A;  3IWZ A;  1LFP A;  1QGP A;  3WU1 B;  5M5Y J;  1YJ9 I;  4HOB A;  3L00 A;  1LKX A;  4HLX A;  2KL4 A;  3HRU A;  3BTJ A;  1HCR A;  1KGS A;  2AO9 A;  2JA2 A;  4M3E A;  4KNY A;  1X3U A;  4WK8 F;  1GV2 A;  4YRV A;  3OR2 C;  2BV6 A;  4A69 C;  1MJA A;  4J83 A;  4YFX F;  2OJE D;  3G1O A;  2LY1 A;  1E3H A;  3RZO J;  2CQX A;  5F6F A;  4QSH A;  5LEK A;  2VN2 A;  1BN5 A;  5JI6 A;  3J81 Z;  4CO8 A;  4EM1 A;  2CUJ A;  2O0Y A;  5FRN A;  1VQ5 I;  4UV8 A;  2Y0M A;  3CMY A;  1BW5 A;  1G3S A;  2PFB A;  5BPI A;  4RZ0 A;  2Y31 A;  4A3I J;  1MMN A;  2VIX A;  2V1U A;  1HOM A;  2GOX B;  2DPD A;  5B1B H;  3KZZ A;  5D8K B;  4E7L A;  4FT8 A;  2OPT A;  3FXK A;  4XMY A;  2F69 A;  1TNS A;  1BL0 A;  1IDY A;  1QHG A;  2D5V A;  1FTZ A;  1GT0 C;  4BL0 B;  3MAJ A;  2F4I A;  1OCZ H;  3OOP A;  5FLV A;  1UZC A;  4YNP A;  4OMZ A;  2M2E A;  1T8I A;  2EQR A;  3FF5 A;  2CH0 A;  1Y39 A;  4XRM A;  2LKP A;  3AG1 H;  1YE9 A;  2CUF A;  2DN0 A;  1FPQ A;  2K4J A;  3WG7 H;  3OYB A;  1PJR A;  3JRE A;  4A3K J;  1TWA J;  5FGM A;  1J59 A;  3OS2 A;  2Q2E A;  2XPU A;  3I9V 2;  5K7F A;  1ETW A;  3F8B A;  1Z3Y A;  3E1S A;  2K3F A;  4CIC A;  1K78 B;  1VFC A;  3OS1 A;  3CCJ I;  1RC9 A;  3EUH A;  1IDZ A;  1IUF A;  2K86 A;  3QAH A;  4M72 A;  2ZNZ A;  3S32 A;  4BXF A;  2F48 A;  3CCQ I;  2B9S A;  3H5R A;  5C4X J;  4LLN A;  1JGS A;  5E1Z B;  2X4H A;  1JTY A;  2XAQ A;  5B1A H;  3JCU C;  2OCC H;  1TLH B;  1VF9 A;  2CW8 A;  3HSF A;  4ZYE A;  2Z33 A;  1JXS A;  2HU9 A;  4IRH A;  4RAF A;  3TO7 A;  2Z99 A;  1R4N B;  1S5L C;  3Q9V A;  3BQY A;  5F1J A;  4LK0 F;  4XLH A;  4LLL A;  5CVJ A;  3OS0 A;  3VYT B;  4ESF A;  1YIT I;  1WCM J;  2MC4 A;  1BIA A;  2GZW A;  1IXS B;  3CP2 A;  3DEW A;  2WC2 A;  2NRA C;  1MH4 A;  1OJL A;  2QSF X;  3RU0 A;  2H1K A;  1T33 A;  4ZJZ A;  4KUM A;  1FYM A;  5JLW A;  2BGC A;  5IT3 A;  3MKL A;  1XMK A;  2EH3 A;  5HS8 A;  3KMT A;  3KLO A;  2O6G E;  2RDP A;  2EFN A;  2VJ5 A;  2JN6 A;  2V7F A;  4D5C A;  1DP7 P;  5FRM A;  1I5Z A;  2LBF A;  4RMN A;  3ABU A;  4XN3 A;  1U9N A;  3B6A A;  2ZME C;  4I98 B;  1P9Q C;  2KRF A;  3IRQ A;  2VON A;  5F6K C;  5F0H A;  3TDZ C;  3K1M A;  4AWX B;  2PQ8 A;  5FD5 A;  2G9W A;  4LDG A;  1YRN A;  1MW7 A;  4QLC U;  2Z16 A;  4G6T B;  1VQP I;  2VQL A;  3O2P E;  2XC7 A;  2W5Z A;  4B48 A;  5LHG A;  4U0V A;  4K2E A;  4A3C J;  3A03 A;  1AA7 A;  5FRO A;  1LQ1 A;  4E47 A;  4V19 K;  3X2Q H;  3P9K A;  3HOV J;  5EX3 A;  2LY2 A;  3SDG A;  3RIB A;  3ZMT A;  1T2K A;  1R58 A;  5ICG A;  1MVH A;  5D5W B;  3T0Y A;  4BBS J;  4Y33 A;  2O03 A;  4JLG A;  1J7K A;  3TOB A;  3L1P A;  1ZHF A;  3OYI A;  4AU7 A;  2EV0 A;  2STT A;  4P1W A;  4DIQ A;  2G7U A;  5LGT A;  2DLL A;  4MO7 A;  5LHH A;  2L0K A;  1J75 A;  1ERD A;  2PJR B;  3VV0 A;  3UKG A;  2VE8 A;  5IYD J;  1HKS A;  3WTV C;  3F72 A;  3MFK A;  1ZN2 A;  2XGE A;  3PUB A;  3MZH A;  1ZR2 A;  2NVU B;  2H1L A;  3K1P A;  4IPA A;  4AIH A;  1VND A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 2OC6 A;  3OYM A;  3K4K A;  3TMO A;  3D5R C;  1V5F A;  2WY8 Q;  3EUA A;  2LH9 A;  1BOB A;  3S3N A;  1N75 A;  4OAZ A;  3FBI B;  3MO2 A;  4RM2 A;  3W2W A;  1VZ0 A;  2W4S A;  4B3X A;  3VYR B;  4B47 A;  1DGR M;  2X1D A;  2AQF A;  2K9M A;  1XQH A;  2VJJ A;  2R7S A;  5TGT A;  4FAS D;  4EAT A;  4XL9 A;  3PNY A;  4E7H A;  4BJ5 C;  3HKZ A;  3QYF A;  4WUY A;  1GLN A;  2X6Y A;  2VJ4 A;  3U21 A;  5T0K A;  4XOP A;  1WJF A;  2KP6 A;  1MVX A;  4Z4P A;  3K4M A;  2CS3 A;  3D5L A;  4CCO A;  3OYF A;  3F9W A;  1LVK A;  3DU6 A;  3G2B A;  3QWV A;  1R6R A;  3PL8 A;  2LBF B;  2PJR A;  4DBQ A;  3ZCO A;  4H12 A;  2V4J C;  2OUM A;  3OYH A;  2W5Y A;  2KPM A;  3DPT A;  3KMA A;  1UG0 A;  3NWT A;  5CPR B;  2ZSH B;  1G59 A;  2R4G A;  3L2Q A;  3MMY B;  4D9J A;  2VPL A;  1D1C A;  2VAS A;  3FKJ A;  3QWP A;  4ANJ A;  2JV0 A;  2R3A A;  3H35 A;  3HXL A;  2MAB A;  2V1N A;  3MEK A;  3BG6 A;  4QEO A;  4ZYA A;  2QPW A;  2BW3 B;  3ZXS A;  5JHF A;  4NVQ A;  3M1C A;  1T95 A;  4IX7 A;  3SEZ A;  2VKD A;  4LIV A;  2HVQ A;  4BJ6 C;  4CSW A;  2R7W A;  3S7J A;  4E7I A;  2V6E A;  4HNT A;  3E0J B;  4C1Q A;  3H9J A;  4BQO A;  4BDZ A;  1ZEL A;  2V26 A;  3CES A;  4CCJ A;  3PDN A;  4II2 A;  5T0M A;  4YND A;  1MUF A;  3IHX A;  1ZKK A;  3M57 A;  1V5G A;  3DQV C;  3RAY A;  2DOA A;  2VQC A;  2P0W A;  3K4B A;  3QYE A;  5LSZ A;  2IS4 A;  4DBR A;  2KRH A;  2CV0 A;  5CKT A;  5EG2 A;  4YPU A;  2WAE A;  3SDB A;  3S8P A;  3OWT A;  3HL2 A;  4BEH B;  2M7B A;  4DGW B;  5ARG A;  5JJ0 A;  3OYA A;  4XOR A;  2ZFU A;  1H3I A;  2CW7 A;  4YEL A;  4C2U A;  2W7N A;  2K3P A;  2L9S A;  4KJZ A;  5KJL A;  4U87 A;  2UV1 A;  1DQU A;  4KT6 A;  4CH7 A;  4BGD A;  2CUZ A;  4B43 A;  2QKL B;  3ZGK A;  3PSI A;  3CBM A;  4YEJ A;  5F59 A;  2IGQ A;  3FBN B;  4NQW B;  2ZSI B;  3DTE A;  1JI8 A;  3CJQ B;  5F5E A;  2F6C A;  5JIN A;  2K5C A;  4C2T A;  3H9Q A;  3EP0 A;  4MI5 A;  4PJM A;  3BCB A;  2JUG A;  3BLY A;  2E1M C;  4NC8 A;  3W3C A;  4IQJ A;  4YPA A;  2WAD A;  2ZXH A;  3HNA A;  4E7S A;  4PJL A;  2RFI A;  2XSJ C;  4YNM A;  4FMU A;  2M4G A;  2VQG A;  2M3A A;  4R79 A;  3A1Y A;  2W00 A;  1PEG A;  5KJK A;  2IS2 A;  3MKZ A;  3CBO A;  1X1A A;  4CZC A;  4I51 A;  3M54 A;  4BE2 A;  3OL4 A;  4J01 A;  3KX2 A;  4XQF A;  3M53 A;  1MMD A;  4BEH A;  4XN0 A;  3H5N A;  4YPE A;  2L7K A;  1G8X A;  2X51 A;  3LL7 A;  3TL4 X;  4O6F A;  3PNT A;  2K9L A;  1BR2 A;  3DEE A;  3FHN A;  3OIQ A;  1SAU A;  2M7A A;  3DTI A;  4BUP A;  5ARF A;  3J7A Y;  4QEN A;  1N3J A;  3D5S C;  4HNU A;  3MKY B;  3DKY A;  5KHD A;  2AQE A;  1WJC A;  4NUB A;  2KDO A;  3OOU A;  5KNL A;  3VWB A;  4IJ8 A;  3F9K A;  3W2A A;  3CMM A;  3GBG A;  4RLQ A;  4XLF A;  3ZQQ A;  4E4H A;  1IRX A;  3OYL A;  3OY9 A;  4CUG A;  4II3 A;  3QYB A;  4OWR B;  3MKW B;  3L2V A;  2R7T A;  3PNV A;  4PK4 A;  3OOI A;  2VL8 A;  2XF6 A;  1WJ5 A;  4PFP A;  4XKV A;  2E60 A;  1TT0 A;  4MLO A;  2RNG A;  3M56 A;  4ZDL A;  3MO0 A;  2VXD A;  3AFH A;  3HG9 A;  1Z7L A;  3KYL A;  1K6Y A;  4HST A;  4PUS A;  4IQ4 A;  3SYT A;  4O30 A;  4QEP A;  3K4N A;  5LSX A;  5HQ8 A;  2F5V A;  2KZV A;  3UR3 C;  4F91 B;  2FUG 2;  2V9K A;  3A4C A;  2RRE A;  3C2H A;  4CCN A;  3BCA A;  4ZDP A;  1V5E A;  3K4C A;  5CCL A;  3DU5 A;  2DXI A;  2M0M A;  4PFO A;  3DPL C;  3LFU A;  5CCM A;  5TEG A;  1J09 A;  3QOE A;  3RQ4 A;  3M58 A;  2XAU A;  4XLA A;  3EUH C;  2XDV A;  1UAA A;  2CMP A;  2LOO A;  1N6A A;  4ZTJ A;  3OS5 A;  3S93 A;  4B44 A;  2LC2 A;  1QU3 A;  4MI0 A;  3S7B A;  2KHM A;  4ZDO A;  2WY7 Q;  2E5Z A;  2L2O A;  3HOS A;  3AKZ A;  1NG6 A;  3M59 A;  4C30 A;  2HPI A;  4XKW A;  2PMZ A;  4F93 B;  1X1D A;  1DGW Y;  3BO5 A;  3OXL A;  4HEA 2;  2E1M B;  1MT6 A;  3F9X A;  4LG3 A;  2CV1 A;  2HNH A;  4CCK A;  2IS6 A;  5F6L A;  4XLE A;  3LSK A;  3OIP A;  1Z21 A;  1KON A;  3BC8 A;  2Q1Z B;  3SWC A;  2HQA A;  1D1A A;  1Y6I A;  2KQR A;  2WBM A;  3LSM A;  2Z2S B;  3IAS 2;  1X1C A;  3TG4 A;  1MMA A;  2CFO A;  1S9H A;  3RTR A;  3OPE A;  3N05 A;  5HI7 A;  2R7O A;  4BU2 A;  4BAC A;  4LIT A;  3LSG A;  4ZC3 A;  3BG7 A;  3S3O A;  1MMG A;  2IXS A;  5HNF A;  4XLC A;  2DCE A;  3K6G A;  3M55 A;  2ZXI A;  2KMU A;  2WA0 A;  3M8J A;  3PSF A;  3CBP A;  3HUG B;  3L2U A;  1FMW A;  2XF7 A;  3C2G A;  3HOT A;  3QOD A;  2I8D A;  4E6K G;  2A6T A;  2M4K A;  2BVM A;  2W1O A;  5EX0 A;  2R7Q A;  2VJI A;  2O8J A;  3KEY A;  1Y56 A;  3OYN A;  4F52 A;  4PJJ A;  3VYU B;  3FPD A;  3SW9 A;  2VKH A;  4LIU A;  5TTF A;  2WAQ A;  2L9N A;  3CP8 A;  3OYC A;  4AYB A;  3S7F A;  3VSK A;  4JDS A;  4N4O B;  4NC7 A;  3RPU D;  1QHH D;  4JOM A;  4DOZ A;  1X4P A;  2O5R A;  3EPZ A;  3AL0 C;  3NWS A;  2BQZ A;  4E7J A;  2R7X A;  5CQG A;  3K70 D;  1NG7 A;  2GOM A;  2IGM A;  3DPU A;  3DWL E;  4H4K C;  3UNG C;  1BR1 A;  3L2W A;  1OR7 C;  1N78 A;  4NJ5 A;  2A5W A;  2BVL A;  1YX3 A;  4ZTF A;  4GRI A;  4C9Y A;  3VYS B;  4J7F A;  2R7U A;  2HPM A;  1LFP A;  5HNH A;  4HG2 A;  4RLF A;  3M5A A;  4DJA A;  1N77 A;  1LKX A;  2KL4 A;  4J8O A;  4PSX A;  3OYE A;  2JA2 A;  3OXG A;  4YRV A;  2E5N A;  3OR2 C;  3RJW A;  1BR4 A;  3K70 C;  1MNE A;  3RSN A;  2JVH A;  4XKB A;  4J83 A;  2LY1 A;  5KJN A;  4BE1 A;  3LMM A;  3FDY A;  4XNF A;  2IGN A;  1YX5 A;  3VUZ A;  2MYS A;  5HOO A;  4PSW A;  2IS1 A;  2CUJ A;  4ITV A;  5FRN A;  4Y3O A;  2ELJ A;  5HLT A;  2Z1D A;  3HC7 A;  4XKC A;  4F92 B;  3IAM 2;  4BDY A;  2X1E A;  4RZ0 A;  4N4N B;  1MMN A;  5CQE A;  4BQN A;  3QWW A;  1W36 D;  2VIX A;  1WJB A;  4E7Z A;  3LSH A;  5JHN A;  2GOX B;  4E7L A;  3MO5 A;  1MND A;  3CF2 A;  4XMY A;  2F69 A;  2X1C A;  2X85 A;  1OLT A;  1QHG A;  1T0F C;  3IP4 B;  4F3Q A;  2VLA A;  1EA3 A;  2HVR A;  3ZR8 X;  4BL0 B;  4XR6 A;  3KMJ A;  3SZG A;  2F4I A;  3RCO A;  4YNP A;  3K4L A;  5KCM A;  3V42 A;  2MFZ A;  1W36 C;  3DTK A;  2CH0 A;  4E7K A;  2LRE A;  2QKM B;  1TZL A;  1YE9 A;  1WJD A;  3OYB A;  1PJR A;  2R7R A;  3VDX A;  3OYJ A;  2OV7 A;  3OS2 A;  4PJN A;  3I9V 2;  1Z3Y A;  3E1S A;  3OS1 A;  4BQQ A;  1O9S A;  1D1B A;  5HVQ C;  2HDW A;  1X1B A;  2NOJ B;  3OMY A;  4U7B A;  2MD0 A;  2VXZ A;  2KLO A;  2WAF A;  3ONQ A;  3S32 A;  2UUZ A;  4BXF A;  5LD2 C;  3CZ6 A;  3K5K A;  4J7I A;  4BS9 A;  4XM3 A;  1D0X A;  3H5R A;  4IKF A;  4HPQ A;  2LRD A;  3L2R A;  4QPO A;  2CW8 A;  3OXF A;  4CCM A;  3AL0 B;  2HU9 A;  1WFX A;  4IZZ A;  2RQQ A;  1D0Z A;  3OYG A;  4NNJ A;  1SFK A;  4KIT B;  4OAY A;  2LYC A;  4XLH A;  3OS0 A;  3DAL A;  3VYT B;  3PJR A;  2MC4 A;  4D1Q A;  3DLA A;  1WJA A;  3CP2 A;  4Y4R A;  3H5A A;  2Y0S A;  3RU0 A;  1X4O A;  2X6X A;  4ZJZ A;  2X6W A;  2G46 A;  3W2V A;  3LSI A;  3DB5 A;  2IGO A;  3K4J A;  3KMT A;  3PFY A;  1ML9 A;  4XON A;  2VJ5 A;  2V7F A;  3MD2 A;  2KRC A;  4QPQ A;  5FRM A;  1Z3X A;  2LBF A;  4RMN A;  4F55 A;  2JVG A;  4XN3 A;  3F9Z A;  4IJD A;  4KIS A;  4J00 A;  1P9Q C;  4P5O A;  3HPH A;  5F6K C;  3K10 A;  4CCL A;  5T5G A;  3OL3 A;  4JQF A;  5JIY A;  1HA8 A;  3ZRG A;  1U0J A;  1X19 A;  4LDG A;  4FET A;  1N6C A;  1MW7 A;  5AYF A;  2DT6 A;  2Z16 A;  3HPG A;  4G6T B;  2VQL A;  4HSR A;  2JSP A;  4RM3 A;  2XC7 A;  2W5Z A;  2CV2 A;  2W82 A;  4B48 A;  3I3L A;  2BW3 A;  3TG5 A;  1DP3 A;  1D0Y A;  1FMV A;  3TBI A;  2R7V A;  1AA7 A;  5FRO A;  3DKX A;  3SEQ A;  3IUO A;  3OYD A;  4E47 A;  3F9Y A;  2VQH A;  5LFA A;  5EX3 A;  3RIB A;  2LY2 A;  1WJE A;  1UEL B;  2HZD A;  1MVH A;  2Q2E B;  4Y33 A;  4JLG A;  2BOL A;  2WB1 A;  3OYI A;  4BJT A;  3S3M A;  4AU7 A;  3EUK L;  4P1W A;  4DIQ A;  1ERD A;  3H9G A;  3N71 A;  3VV0 A;  3CJR B;  2DJI A;  2PJR B;  2L5Q A;  5TH7 A;  4BE0 A;  4X0G A;  2HVS A;  3A2K A;  5KJM A;  4HRI A;  2UWM A;  2DT7 B;  3H0D A;  4CA0 A;  1E0E A;  3PUB A;  3OYK A;  3OR1 C;  2IGK A;  1PYV A;  2XF5 A;  4XOT A;  2LG4 A;  4AVZ A;  1LDK B;  2VB6 A;  3VSL A;  3S7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...