4BUPA

A novel route to product specificity in the suv4-20 family of histone h4k20 methyltransferases
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
232
Chain Sequence
GSHMSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1
publication title A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 73
structure length 232
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bupA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4bupA02
5KJMA 1MUFA 4IJ8A 4YNPA 5F6KC 5AYFA 4QEOA 2W5ZA 3S7DA 3QWVA 4IJDA 3CBOA 3IHXA 5T0KA 5TTFA 4O30A 5KJNA 3BO5A 1XQHA 2O8JA 4Z4PA 3CBMA 5EX3A 3DALA 3M54A 2BQZA 4YPUA 3KMJA 5TH7A 5JINA 4J8OA 4MI0A 3RJWA 5JHNA 1O9SA 2IGQA 1N3JA 4QEPA 3M58A 3S7JA 2F69A 1ZKKA 3N71A 4H12A 5T0MA 3OXFA 2JV0A 5JIYA 3HNAA 3M57A 4YNMA 4E47A 4LDGA 1ML9A 5F59A 5CCMA 3S8PA 4NJ5A 3RQ4A 3K5KA 3QWPA 3TG5A 4MI5A 5HQ8A 3QWWA 5T5GA 3PDNA 3RIBA 5TEGA 3FPDA 3RU0A 2W5YA 3MO2A 5KJLA 3F9WA 1N6CA 3OOIA 1PEGA 3MO0A 1MT6A 2G46A 4JDSA 4J7IA 3S7FA 3DB5A 4NVQA 3M5AA 5LSXA 1MVXA 4J83A 5KJKA 5EG2A 3CBPA 5ARGA 3EP0A 4BUPA 4YNDA 4J7FA 3S7BA 3TG4A 3OPEA 3OXLA 3SW9A 4JLGA 5LSZA 4O6FA 3SWCA 5CPRB 4I51A 3F9YA 3VV0A 2RFIA 4YPAA 1H3IA 5HI7A 3RAYA 3OS5A 1N6AA 4FMUA 3M55A 3M56A 3F9ZA 4RZ0A 5ARFA 5F5EA 3MO5A 5F6LA 5CCLA 3KMAA 3VUZA 4YPEA 3KMTA 4AU7A 3F9XA 1MVHA 2QPWA 5JJ0A 4QENA 3M59A 3MEKA 4C1QA 2R3AA 5EX0A 3M53A 4WUYA 3OXGA
chains in the Genus database with same CATH superfamily
1XS9A 1IJWC 2IGNA 2DMTA 2LP0A 3OR1C 3SXYA 2XPVA 4XQFA 4XIDA 2KZGA 2LYCA 3L2UA 3I0TA 2OZUA 4IJDA 2VN2A 4B8XA 2O7OA 3QPHA 1OCPA 2KJBA 4LLNA 1W5SA 4HX7A 1BJAA 2HYGD 5IT9K 2H27A 4IRGA 4PGHA 3BPXA 3H3VK 1G3SA 5HDNA 2NVYJ 1TW2A 4AUXA 4YRVA 4MNUA 3F8NA 3GFJA 3M7GA 1VQ8I 5FKMA 2E5NA 3R6SA 3HM5A 3HPHA 3OYCA 3ZQ7A 2HTSA 4JBAA 1SD7A 1B72B 5FO5A 2VXZA 3J7AY 1OQYA 2P0WA 3BOQA 1YX3A 4Q47A 2WBMA 1IUYA 2VI6A 3W2VA 3WODF 2IT0A 3I5UA 5DS9A 4BE0A 5J8FA 1F36A 1BI3A 3WE3A 4BHBA 4IVNA 4MEXF 2CS3A 2JWTA 1LJ9A 2LFBA 3W3CA 3V7RA 1O3RA 3LSMA 3HG9A 1JT6A 5F0FA 2HKXA 2XAQA 4A3IJ 2FQ4A 3PFIA 2FJ1A 4MTDA 4OMYA 1N6CA 1JKRC 2CG4A 4MLOA 1D1AA 4JDSA 1ON1A 2L4AA 3DXJF 3DB5A 4IF4A 1TNTA 3B6AA 3G3ZA 1Z6RA 4LG0A 4U0YA 5FKLA 3I55I 1BI2A 1YW8A 2DO7A 3PIOF 1ZHFA 1B9NA 4BUPA 4ESJA 2DYSH 2FQ3A 2ZJQF 3EDPA 3OXLA 2WC2A 4LLLA 4RS8A 1EH6A 4BS9A 2BVMA 4FX0A 4B3AA 1QHGA 3FHNA 1W5TA 3VSLA 1L3LA 1UMQA 5E3NA 1VQ6I 4UVCA 4LB5A 4IRHA 1DP3A 1BI0A 4DNCA 2R5ZB 2YU3A 2Z5UA 3LOCA 2ZSIB 3H5NA 4M6YA 3M56A 2NS8A 1S7EA 1J75A 3I56I 1K4SA 2CJJA 3SHFA 3VYTB 4RGXA 3BP8A 3CCUI 1T39A 2ZNZA 2JA2A 1Q1VA 2COBA 4W97A 2R3AA 3KEQA 3QWLA 3CUQA 3JSOA 2K9MA 3I59A 1I6HJ 2DA7A 1AWCA 5JVGF 1R22A 2ZFWA 3K7AJ 1R4NB 5JLWA 2LKPA 5C4JJ 2DOAA 2X6XA 1LQ1A 2DQRA 1PP8F 2QSGX 4BQQA 2W5ZA 4ENJA 2JVHA 5E8GA 2LBFB 2JT1A 1SD6A 3T1BA 2HOAA 2J5OA 3E3VA 1HKSA 1MGTA 1FOYA 5IPAA 4ITVA 2ZJRF 4F7ZA 1HSTA 2XGXA 5JI6A 1JGSA 4Z6YA 2VODA 4HNTA 4WXCA 2H1KA 4A3CJ 4WK8F 4C2MJ 3CLQA 1CGPA 2M7BA 4ZH4F 3GX4X 3VYSB 3T0YA 4YEJA 3SYTA 1IO2A 4CO8A 1SFXA 2VBXA 2HQ5A 2PMHA 3ZOBA 3NRVA 5B1BH 5F1RA 5HLTA 2PBIA 2B63J 4P1WA 3OS0A 4G7ZF 3CUOA 2DMQA 5L3EA 5BS6A 1YRNB 2XB0X 5JR3A 3BLYA 2MH9A 4W1UA 3S14J 3M57A 1P4WA 1O7LA 4BY7J 4AWXB 2DQLA 5CCMA 5M3FJ 2W25A 2KDOA 3TG5A 4MO7A 5LHGA 2KDZA 3ABUA 1LE8B 4ZDOA 3DLAA 2K85A 4LLGF 2ZJ2A 2KIUA 3L7WA 4ZTFA 3DKYA 1R5ID 2K7LA 2IS6A 2G9WA 1HCRA 4DYRA 1ZYRF 3DP7A 2P7VB 2CFXA 1UCRA 4A3GJ 2XAGA 5JVTA 5IYCJ 3HKZA 2OAZA 3ZXSA 5KJKA 1ETQA 1WI3A 1FEXA 1XD7A 2K9NA 3OMYA 5D8LB 1HXDA 1TWGJ 2QSHX 3SW9A 2MLGA 1P4AA 3PM1A 1ZQ3P 1RETA 3SWCA 2O5RA 3VYRB 4ENKA 2Q2EA 3JRBA 3H36A 3K69A 4J01A 1W0UA 1A36A 2E19A 1BR4A 4LK0F 5J6XA 1L0OC 3FMRA 2Z2SB 1X19A 5IP9J 4IZZA 1NK3P 3RAYA 3K4MA 3F9ZA 3S1MJ 5IP6A 2QZ8A 3LSTA 2GZWA 3TDZC 3F9XA 1REPC 1U3EM 2MW8A 1UAAA 2STTA 4U0VA 2O8XA 2GLOA 1KGSA 1W7PA 1FLIA 3L09A 2JPBA 4BBRJ 1FOWA 2DT5A 3BROA 4ESBA 2ZMEA 3TQNA 2XSDC 4DOZA 2E34A 2HVSA 1JUSA 3KE2A 2B9SA 1ZGAA 2KIQA 5BPIA 4HW0A 1RI7A 2V26A 3E6BA 3RJPA 3R0AA 4Y13A 2PMZA 1TQIA 4U87A 5ICEA 1MNDA 2XF6A 4A0XA 2CV1A 2X6YA 1TZLA 2Y9YA 3FXKA 4M72A 3TO6A 4A3JJ 1SC7A 1VQLI 1NHAA 3C2BA 3FXUA 3ZQQA 3Q9SA 1JI8A 5DDGA 3E5XA 5EEHA 3NQOA 4FISA 4TV7A 2QBYB 2IP2A 4BHPA 2DCEA 2R7VA 2ME0A 1DQUA 4PSWA 1NH3A 5EYRA 1MMGA 2IGQA 1SAXA 4LFUA 2X48A 1ITYA 3IWZA 1X3ZB 5K7HA 5GAGJ 2HYFA 4MIMA 2K4BA 1R49A 2ESNA 3DCFA 4H12A 4P9FA 4P9UA 1T2KA 5GPAA 2KPMA 3U1KA 1SVMA 4Q48A 4BY1J 4G6TB 3HNAA 3SZPA 4E47A 3KX2A 1I27A 3KZYA 4XKBA 1AHDP 4LG0B 2XGCA 5E79C 4G94A 3K2AA 1YG2A 2IRFG 5J1YA 3RKQA 1KZHA 1QA6A 4ZZLA 3L2WA 1ZRDA 1Y39A 3F0CA 1IDZA 5E1ZB 3F9WA 4UVAA 3E5QA 3RDIA 3MZYA 2PN6A 1FTTA 1FYMA 3S1NJ 2ZFUA 4I09A 4UUSA 2NAZA 5F0CA 3RKYA 2HOSA 3FK7A 3VSKA 5KNLA 1WJBA 2Y9ZA 3GO5A 3GMEA 4EJVA 3KP2A 3W6JB 2VQHA 4ETSA 1BJZA 4XLCA 5KVRA 3KEOA 1K78A 3TG4A 4IHVA 3DBLB 1YTYA 3S16J 1X1CA 3GFLA 3HRTA 1YI2I 4JX4A 2DOFA 1YHQI 1MSFC 3NWSA 2CUEA 3KZIC 5FRNA 1WJFA 2OA4A 1U9NA 4HQMA 3A02A 1HW5A 2DMUA 4I7HA 2V6EA 3IAS2 3K4KA 4ZJZA 4NHJA 1POGA 3CZ6A 4RZ0A 1O3SA 2RV8A 3MO5A 5F6LA 3ERMA 3K4JA 1DU6A 3H9QA 1V4RA 2I5UA 1WZ2A 4PGGA 4BE1A 4UNOA 4KICA 2XDVA 5DD8A 3IRRA 4HA8A 2TCTA 1S6LA 1STZA 1X2MA 2VC0A 5L3CA 3M53A 4P55A 2NS7A 4EJUA 2EZKA 3C1DA 2EWNA 5FD5A 3F6VA 1MUFA 2DYRH 2NVUB 4N9HA 3BG7A 4CH7A 4PJJA 1H88C 1WSUA 3K10A 1FP2A 1HDDC 3O3KA 1G2HA 5DCMB 1AKHA 2QEXI 2EV6A 2DA6A 2F4OB 5J1UA 4I01A 4OWRB 5EF6A 1OFCX 2K5CA 2Z33A 1I39A 2PX9A 4DYCA 3JRCA 2R5YB 2HYJA 2IGOA 4F52A 2CW8A 1WKMA 2LSOA 3MKLA 3ZN1A 1PVEA 5FJ8J 3KYLA 2DTZA 2HTJA 2E2HJ 2KJCA 1MH4A 3KP4A 4RB2C 5GAHJ 1MJBA 3WHCA 5DM7F 2MBFA 3S3NA 1ZKKA 2A5YB 3A1YA 1Z7LA 3KEYA 5T0MA 5TGTA 5JIYA 3L9FA 3J81K 3FK6A 5DTDA 2WV1A 3MKYB 2YU9J 2EFNA 2PFBA 2QLZA 1W36D 3CDLA 3V42A 2E7XA 2IAIA 3TO7A 2DLLA 4EVIA 5HDKA 3I3LA 3BJAA 4UY8I 1HA8A 1OR7A 2HQAA 2KL4A 4UXNA 2H1LA 2ECBA 1W5CC 1V3FA 3DEUA 3E7LA 5AIPA 1QVUA 4PSXA 4CYCB 4HF1A 5LHIA 3FXOA 2PLYA 1I1SA 1MJ9A 1FOKA 3QYFA 4XR6A 3ZMZA 3ELKA 1K7AA 2Y31A 4GDFA 1SFEA 4UUTA 2A61A 2F5FA 4M3DA 2XSJC 5CQEA 2AQEA 2R7FA 4U7BA 4Y52J 3M9AA 3KFWX 2X51A 1Z7UA 3KYDB 2V9KA 1FTZA 3HSRA 4MFEA 1VFCA 3G6EI 1B72A 4BQNA 4C2UA 2GA1A 5FFZA 3ZQLA 3K4LA 3CJTB 5DUIA 1ZKGA 4PJLA 4Y33A 3VYUB 4YPAA 3IUOA 1VQKI 2Z9OA 1R1TA 1X2NA 4HG2A 1MBHA 3DFGA 2NOGA 3MN2A 4YIRX 2LTPA 4B48A 1H89C 4KT6A 1TLHB 3WG9A 2Z16A 5BMZA 1QZEA 3V8KA 4YPEA 2HDCA 2EB7A 4AU7A 4EEFG 2IEKA 5KK1A 2AO9A 1MH3A 5F64A 3VWBA 5F27A 1BR1A 1TWFJ 1YQAA 2NS0A 2X1EA 3MVPA 2HPIA 3A0BC 5E17F 2GWRA 4IO9F 3J81Z 5KJMA 3ZMSA 3I4NJ 1FNNA 1EF4A 1TP4A 3VPRA 2UXXA 1I5ZA 1MMDA 4HAMA 1U6GA 1XGOA 2FRHA 1YIOA 1R7JA 3P9CA 3CBOA 3JTHA 2HVQA 3SQNA 3CUQC 4EM0B 4HSRA 1U5TB 2K27A 5KJNA 1T08B 2M8GX 4XOPA 3MWMA 3CCLI 1EA3A 2PJPA 4ZYHA 3HIFA 4E7JA 2M0CA 3M8FA 3CCEI 4BXFA 3FM5A 1R23A 3ABTA 3KMJA 2JZYA 2HDWA 3EETA 5JINA 2V79A 3B02A 1OYIA 4GXOA 3ZQHA 2CYYA 4U7DA 3FF5A 3ULQB 5EGOA 3SJMA 2R7TA 3BCBA 3WGIA 2EZLA 3V7SA 3GLLA 2JV0A 4IL6C 3GVAA 2DFFA 4YNMA 3I71A 5LHHA 1S7OA 1B6AA 1Y0NA 1ON2A 1XMAA 3MQ0A 4KISA 4DBQA 2ZB9A 5FLXZ 5T5GA 4L0YB 2W57A 2EILH 2LBFA 3I4MJ 3WTYC 4L5JA 2F5DA 2YUSA 3ZQCA 4JQFA 5JLXA 4ZTJA 4BXUA 5E1XA 2G0EA 2IW5A 3QRFF 3WGHA 1Z05A 3E5UA 5ICCA 4J7IA 5TISC 1USTA 4GFBA 3O8HA 2QKMB 2EINH 5HS7A 3LA7A 4ENNA 2WAQA 1ETKA 3ZMDA 4F92B 4H4KC 4LJZF 3VB2A 4OIRF 2L01A 1YIJI 2V9VA 3G1LA 4I98B 1D5VA 4RMNA 2ZKZA 3K1MA 4I99C 4Y3OA 1FJLA 1FZPB 2L0KA 5LGNA 3WE2A 2VQGA 2N8GA 3JRHA 2VUMJ 2QSFX 3LAPA 1YRNA 4Q5SF 1P4XA 2E7WA 5HI7A 2W84A 2XRNA 1R6RA 3GZ5A 4PJMA 1G8XA 2F5VA 4YFNF 2BW3B 2DTRA 1FYKA 3F9KA 5FRMA 5F5EA 2LREA 4CZCA 5CCLA 1F4KA 5DYMA 1LE8A 1RUOA 3N4MA 2O9LA 2OJED 1TQMA 1SD4A 2V1NA 2HWVA 4BNCA 3WTWC 3VEPA 2ZXWH 1ZH5A 4JP0A 1XB4A 1IXSB 3TBIA 4PZJA 2JTVA 3HRUA 1XPXA 4YNPA 1RKTA 2XAUA 3NARA 4F93B 1DP7P 4OOIA 5J4VA 5B3SH 5J8CA 3S7DA 3E0JB 3HBLA 3OIOA 3OSGA 3WU1B 2QVOA 2VKDA 1W36C 5FB2A 2LY9A 5J4YA 2NRAC 2FA5A 3ZGKA 3DPLC 1DU0A 1ZG1A 1R1VA 2ZMEC 3Q0WA 4RB1A 3KCCA 1WH5A 3FKIJ 4QSHA 3DBRB 1JGGA 1MW7A 1QO0D 1R5GA 4XL9A 1MIJA 2E1MB 1PJRA 3HSFA 4IPAA 3GTOJ 3OOPA 3OYJA 2CW7A 1WJEA 3OV8A 4MHGA 1R58A 4MQ9F 2QKLB 3SEQA 1TL8A 3O8GA 5HNHA 4KT5C 3HOSA 1TC3C 2CUFA 2JRMA 2LY2A 1TBXA 4M9SA 1LDJA 4XSZF 5LGUA 2GAUA 2K40A 2IA1A 1VQPI 3G1OA 4LIUA 4V2GA 2IBDA 3NEUA 2PQ8A 1TT5B 1X1DA 1WCMJ 2QYOA 2QUFA 2JUGA 1MBGA 3MO0A 2JA5J 3H35A 1GLNA 2CW0F 3CCSI 2VLAA 3CCQI 4NVQA 1HF0A 2ZXHA 3BTJA 3KYCB 3I4PA 1FP1D 5L3DA 5B1AH 2CH0A 1S72I 3OL3A 2QBYA 1YJWI 1VQ7I 1BC7C 2FX0A 2GA2A 9ANTA 4RDUA 4FQGA 3K4BA 4O6FA 1F43A 2X4HA 3ASNH 1GT0C 3PO2J 2JUCA 2RC4A 4ZDLA 4FX4A 2YS9A 2XB5A 4I02A 3RPQA 5IYDJ 1OYYA 3CQZJ 2CQNA 4WXDA 1EH7A 3OSFA 1W1WE 2R7OA 2A6TA 3BJ6A 4A3LJ 2KIFA 3M55A 5ARFA 3AKZA 2JK3A 4YG2F 2EFOA 2ISZA 4GYGA 2BEOA 3V8LA 4XLFA 2M45A 2CMPA 2ELHA 3ZQGA 4CCLA 5LLQA 4CXFA 2UV1A 1ONVA 1FIPA 3GYHX 2BY3A 1LVKA 2MD5A 4KJZA 1T98A 1E17A 4M3FA 3GWZA 2EIMH 3L2RA 5IOYA 3NWTA 2W82A 3A03A 4UVBA 1LFUP 5AYFA 3BCAA 2QENA 5E8IA 3GTKJ 1JUMA 3IC7A 1QZZA 1QGPA 2DA5A 3PQJA 4M6VA 4EJWA 3DU5A 3IHXA 1YW7A 5FKOA 2OBPA 1WHUA 2V4JC 2JN6A 3H3UA 5L3GA 5M5WJ 1A35A 4UB6C 5EGOB 3PSFA 2AQFA 2OCCH 4MGRA 3AFHA 2VJIA 3OIPA 1XMKA 4OMZA 1K4TA 4N0BA 4XBFA 1IW7F 4XLHA 4A0YA 2OF7A 3BJOA 3H0DA 1BIAA 4E7HA 2CO5A 2BV6A 4LG3A 3ZN0A 3CC7I 1B59A 4M71A 2XAJA 4L0ZB 2CGPA 3BR6A 3WTVC 1HKTA 4ZC3A 2DA4A 1DPRA 2RNJA 3QP5A 1R71A 2XKPA 3I58A 3GTJJ 1Q1HA 3HYIA 1KQ8A 4KA4A 3AL0C 2RDPA 1BR2A 1V5EA 1Z3YA 2RREA 1WJAA 4BU2A 4C30A 4D5CA 5HLGA 2WWYA 3QWWA 2KZVA 3PDNA 1T6SA 5IOZA 3OYHA 5DCMA 2O3FA 1F1ZA 1T8IA 1ETXA 3S3OA 4HZFA 2H8RA 1KYZA 3K70D 4NDLA 2KMUA 1FC3A 4DJAA 3PSIA 3ECOA 2VBYA 2AS5F 2R5YA 1YW9A 1VQMI 2X1DA 1TT0A 3LSKA 4Y15A 1R00A 3BR3A 4CZZA 1MDMB 4J7FA 3S7BA 2E71A 1UHWA 3RPUA 1DPUA 1Y1VJ 1FOXA 2CSOA 2QGUA 2VJ5A 5CPRB 3SFZA 3H5RA 3OYMA 1LPQA 2GOXB 3M1EA 1SMTA 4L9JA 2LD5A 1G3TA 3PJRA 3OL4A 3CCVI 4Z2YA 2EPFA 1QQIA 2V9PA 2HOTA 4KNYA 2Z99A 3K9TA 1O7FA 3BY6A 1P9QC 2EQRA 2FD5A 1F5TA 4HF0A 1WRJA 2ESHA 3KLNA 3H5AA 4E6KG 5CJ9A 3K4CA 2QPWA 4CICA 1ULYA 2QF7A 3A4CA 3R60A 2QA4I 1D5YA 4CYCA 2FU4A 4BYYA 1OCTC 4ESFA 2HI3A 1U8RA 2ZO4A 4GO1A 1U2WA 4YIIA 4IQJA 3HOXJ 3GUDA 4R79A 1BW6A 3FXRA 3H3ZA 3G4SI 3MD2A 4ENMA 1WQ2A 5EG0B 1H0MA 1YLFA 4JOMA 3V7CA 1Z9CA 1GVDA 3LL7A 3TKYA 3F22A 5EZHA 1VQNI 3GFMA 2I8DA 5K5QA 1BN5A 1XCBA 5C4XJ 3QPLA 5ICFA 3FIWA 1S9HA 4II2A 2K9LA 4RB3C 4O30A 3LSHA 2HVRA 1NTCA 3R4KA 1H9TA 1IN8A 3P5JA 2P5VA 5EEGA 2XRLA 2W24A 2V6CA 3DTIA 3BTCA 5GADJ 1DUXC 3HTSB 4MI0A 5FROA 3CMAI 1FBQA 4EGYA 1ETWA 4XOTA 1TWCJ 3OR2C 3PIPF 2RAEA 2VOPA 4G6QA 1I1GA 1YS6A 1EKEA 3MFKA 1MBFA 2CUZA 4HPQA 4LITA 2NVQJ 3CO7C 3ROUA 4NQWB 3JRGA 1IRZA 2DI3A 5F6FA 3MCZA 4E70A 2XHKA 3I53A 4M3GA 4O3MA 2WY8Q 3F8MA 4D5FA 2R7RA 1JE8A 4NJ5A 1K6YA 1UHMA 2EZIA 3WU0A 3LQRA 1UELB 2WTEA 3K4NA 4XLEA 5TEGA 4A2UA 2M3AA 2HQRA 1MMNA 2CWEA 2DMNA 2F5CA 4XKCA 2P5KA 2DK8A 2DXIA 1XX5A 1U5TA 4CYDA 2DPUA 5J1RA 2K4JA 3QYBA 4XLPF 2CQQA 3B73A 3BWGA 5LRRA 2L4MA 3GTPJ 3CCRI 4XK4A 2M1BA 3LSPA 1B8IB 3EUHA 1ENHA 2OCEA 6PAXA 4HNVA 2E5ZA 4GYIA 4R8HA 2Y2ZA 3FWEA 2BY2A 3IAM2 1WVRA 2FNPA 2M30A 5BQTA 1W0TA 3L2QA 1ZARA 1TNSA 2EFPA 3F3XA 5D5VB 2W1OA 4CCKA 3E1SA 4NC8A 1IZ1A 3UR3C 3FMQA 2OV7A 1IN4A 3H92A 4QIWN 3C2HA 3O6BB 4CCNA 1RIOH 2BY0A 4G6DA 4HF2A 3F21A 1ZR2A 2HS5A 4J19A 2OPTA 4Q4ZF 3F6OA 4QPQA 3TOBA 4C3IJ 2EA4A 3FHZA 5D8KB 1IAWA 2JSPA 1GUUA 1MVHA 3C2GA 1X3WB 2DFIA 4NNJA 3ONQA 3J7ZI 1JKOC 2ID6A 1J09A 4M6XA 4EMSA 2HPMA 1MBKA 3BQYA 2RKHA 4XNFA 4HLXA 4YFXF 3HOWJ 2DDAA 2L5QA 3VOEA 1OCOH 1N25A 2XPUA 3EPZA 2H09A 5CVIA 4IJ8A 1N77A 3QYEA 2LK2A 4IJAA 4IHSA 1MKMA 3F8BA 1J0RA 3S93A 3HSEA 4XRMA 2E1NA 3LWFA 2P7CB 1W4MA 4OIPF 1OCCH 2FBIA 3RPUD 1XQHA 1IRGA 3CMMA 4Z4PA 1U0JA 3CBMA 1ETYA 1D0YA 1UJ8A 2CQ7A 5D6FA 4EV0A 3H0GJ 4G7HF 3M54A 2XGEA 3BR0A 1SAUA 3IH3A 2VJ4A 1YJNI 1K61A 3K70C 2L54A 3AG4H 2BW3A 3KP7A 4IHTA 1O9SA 5IP7J 3BZKA 3Q0VA 1AOYA 2L7KA 2MFZA 1N3JA 2E35A 3DF8A 4PFOA 4RM2A 5E1WA 5HS8A 1GDTA 3LFKA 1VQ9I 1MBJA 2DDBA 1VNDA 1JXSA 1NK2P 3ZCOA 4N4OB 2O03A 1J9IA 2A07F 2HNHA 4KYWA 3HOVJ 2E2IJ 1FBSA 4J00A 3OYKA 3K5KA 5E18F 1KQ9A 3BG3A 1G4DA 3HZJA 4L18B 3RZOJ 4II3A 3ASOH 4G9YA 2ZCWA 3DKXA 4KMFA 3MO2A 5DUKA 4FCYA 3V8JA 5EJCA 3MKZA 1YJ9I 1X58A 4C3HJ 2GIVA 4F3QA 2IPQX 5ILVA 2W4SA 4HV6A 3EUKL 1D0XA 1OYWA 3QOEA 2IXSA 3GBGA 1A5JA 2DA1A 4ANJA 2A68F 2KLOA 3KP3A 2GBYA 1T95A 2ZJPF 2H6BA 2XKOA 5BPDA 1XGMA 2MC4A 3MZ8A 4A3DJ 1W7PD 1P7JA 4G12A 2ETHA 5F1JA 1JKPC 1PUEE 4B43A 2CV2A 2DJNA 2V1UA 4HNUA 1KA8A 2PG4A 1ERDA 3FXQA 5H6RA 2ACJA 1XGNA 2KHMA 2MYSA 4KN7X 3FXLA 1HLVA 2GXGA 3HRMA 4D1QA 4G8XA 4BJ6C 3ABMH 4AIHA 3S17J 1X3UA 3H9GA 4NC7A 4B4CA 3KMAA 2KKOA 1Y6IA 4IX7A 1O4XA 5M5XJ 1Z91A 2ZXIA 3ESWB 3CMEI 2DPDA 4HOBA 3CP8A 3PUBA 3HOTA 4B09A 2VPLA 1BOAA 4RAZA 3F23A 3MMYB 4E4HA 3U1DA 5A2QZ 4HSTA 5JHFA 1WPKA 1ACIA 4QEOA 1USSA 2DFHA 1RZ4A 1IDYA 5E20A 2A05A 4UHTA 1JTYA 2XASA 1P92A 2B0LA 5LBQA 2WAFA 2EFQA 4KIGA 2D5VA 3GTQJ 5T0KA 3TL4X 2P5LC 3I54A 1PP7U 1KU9A 4B1RA 1HSJA 5FLXK 2NOJB 2LOOA 3BO5A 2D2WA 3DPTA 1GXPA 2DJIA 2ECCA 4U88A 3WTUC 1CQTA 3LSJA 4M74A 2PEXA 1SVLA 1R5HA 2PMUA 4N4NB 4WCGA 1PYVA 2CRGA 4NC6A 2VPRA 4XONA 3WTSC 4ZYDA 3FXMA 2E1OA 1S3JA 4HV5A 1JKQC 2RQPA 2VXDA 4LD5A 4L9TA 4S0HB 1VTNC 2IA0A 4CUGA 1RNLA 1QRYA 4KIFA 3CESA 4BKXA 3JR9A 4X6AJ 1XGSA 1FPQA 1LDDA 1TWAJ 2F2EA 5HS9A 2VBWA 5CLSA 1LB2A 2LC2A 4XMYA 3RQ4A 3L2CA 4QTRA 1EV7A 2E1CA 3ZMTA 3ZRGA 1Z67A 2ELJA 2FF4A 3PUFA 2IS4A 2F48A 5D6EA 1R9TJ 2K86A 5H20A 2GOMA 5ILUA 3OOIA 3P7NA 4QPOA 2BVLA 2ZNYA 2FOWA 2FSWA 2VBZA 2W85A 5D5XB 4IOCF 4KMUX 2L2OA 3GEZA 3S7FA 5LGTA 2XROA 3S15J 1SFOJ 3ECHA 3N05A 2Y48A 4E7ZA 1G6NA 4HLYA 3D5SC 5ERIA 1Y56A 1IXRC 4XRSG 4B3XA 2M87A 1FSEA 4EM1A 2UZKA 5FKKA 3HHHA 4I2OA 2HFHA 2MD0A 3SDBA 2ZBKA 2QQAA 2Q1ZB 2Q0OA 3HOYJ 4NBQA 1JHHA 1H3IA 1D1BA 3HGYA 1X4PA 1PDNC 4R1HA 4KN4X 4A3EJ 1ZG3A 1SFKA 2MSYA 2R7QA 1DGWY 3RKWA 4N9IA 1OLTA 1WJ5A 3CLOA 3LQQA 2YR2A 3KMTA 4AYBN 4IOAF 2BXZA 1KYWA 4JX5A 5JJ0A 4QENA 1ETOA 1KONA 1YS7A 2R7DA 1V5FA 1ZGJA 3ZQFA 2QQBA 5M5YJ 1UG0A 3QODA 4FHTA 2WY7Q 4I0BA 1HW2A 2YX7A 4OAZA 3UKGA 2G7UA 1Z6TA 2BXYA 4XKWA 5K1YA 4B44A 2DU9A 2FOKA 4A5NA 1MDMA 3FISA 3ZPLA 4ZDPA 5LEKA 3JREA 3QU3A 2Y0SN 4A12A 4DBRA 1JUPA 1H8AC 3SFIA 1XCVA 4PK4A 4XSXF 1X1PA 3DQVC 5LRSA 4V2FA 2V7FA 3TDUC 2HEOA 1FMVA 4LOCA 4L9NA 2WB1N 3PO3J 2AXTC 5HDGA 3SEZA 2G7HA 4QEPA 1N78A 3P9KA 4I76A 3RCOA 3SZGA 4EM2A 4E7IA 2KRHA 3MAJA 2FBKA 4LMYA 1XSDA 4I6ZA 1SD5A 3CJNA 2A69F 3EYYA 3KPHA 4HDUA 1K79A 1Z3XA 4LDGA 2MH2A 1J59A 1P6RA 2Y75A 3CCMI 4ZYGA 3QWPA 2XC7A 5CVRA 1QNTA 4WX9A 3IRQA 1F9NA 2JVGA 5EG0A 4MI5A 3RIBA 2AXLA 2WA0A 5KJLA 2R7UA 3GTGJ 1PEGA 4JX6A 2KQRA 1MT6A 3D5RC 4BQAA 3N97A 1XDSA 3HC7A 4RM3A 2VT2A 2TRTA 5IY5H 2E36A 3B6CA 3UNGC 1HBXG 2OU2A 5EEAA 1XN7A 2YSRA 2O61A 5ARGA 3EP0A 2D1HA 2XV4S 3LA3A 1KU7A 1U78A 3L00A 3BG5A 2W7NA 1BL0A 1OCRH 1Y0UA 2L9RA 4BJTA 1U5TC 5LSZA 2M0MA 2HQNA 1K6OA 4L9VA 5GP9A 5E3LA 2UWMA 4BEHA 3HB9A 4JK1X 4C3JJ 1IG7A 4CA0A 3EUHC 3K1PA 2IGKA 1XMXA 4NQWA 4XORA 4M3EA 4PDKA 2DAOA 2Y69H 1NG6A 1YYVA 4D0PA 5TJJA 3QAHA 3HPGA 2L9VA 1A6QA 5D4SA 1VQ4I 2HKOA 4L5EA 3IKTA 4BBSJ 5DCFA 3PNTA 2HXOA 1BI1A 5TRDA 3FMSA 2ZC2A 2RQQA 2Y0MA 2R4GA 4A3KJ 3OYFA 2M5WA 3BZCA 5L3FA 5J47A 4M9ZA 3TW6A 1KU2A 1SANA 1QPMA 3S2WA 3CCJI 1B8IA 1EJ9A 3IKVA 5FGMA 1M1EB 4A3BJ 2A5WA 2KIMA 1G59A 2L3DA 2VOOA 2NYXA 4HYEA 1P7IA 1VF9A 3VDXA 1YO5C 1VQ5I 2R3SA 2HGCA 3A0HC 5IYBJ 2VB6A 4MQVA 1RKWA 3ZMUA 4DZJA 1IV6A 2HOEA 2KRFA 3HDDA 1RESA 1HKQA 1D0ZA 1GV2A 3W6KB 3U9GA 4A6DA 4RAGA 1RUNA 1A04A 5TH7A 2JSCA 2QWWA 2R93J 2RN7A 1D8KA 4PJ0C 4EQQA 2JA8J 2XPWA 1UFMA 3OYGA 1BW5A 3LA2A 5KHDA 4F55A 1GHCA 3KZZA 3N71A 1FY7A 4AIDA 1MSEC 2DN0A 5HVQC 1JJ8C 4MTEA 4P96A 2DK5A 3GF2A 1UB9A 3S2HJ 5GPCA 4WWCA 1VI0A 1PUFB 1ML9A 2PJRB 1V5GA 1MBEA 3MKWB 1Z21A 1WFXA 3W2AA 4FE7A 1ZTRA 4C9YA 5IT9Z 3E6DA 1OISA 2AHQA 3RU0A 5KCMA 3GZ6A 1IV8A 5D4RA 3M3YJ 5HLIA 4B47A 1EH8A 2G46A 3F72A 1AA7A 4DYQA 3QP6A 5D5WB 4UUVA 2A6EF 3M4OJ 2LF8A 1T0FA 3WU2C 3CTAA 1XC5A 2KT0A 4D9JA 3NAUA 5F0HA 5EG2A 1G3YA 2V1XA 4KITB 4LK1F 3S3MA 2V1DA 1FYLA 1D3YA 5K5OA 4QWQA 1QHHD 3OPEA 2ADUA 1X4OA 3PL8A 5C3EJ 2XAHA 1T56A 3RQIA 4AC0A 1LFPA 3OOUA 2R0QC 4RAFA 5FD6A 1LNWA 3GXOA 3ML6A 2VL8A 3F9YA 2HXIA 2RFIA 3WG7H 4BE2A 2E1MC 2P81A 4Y4RA 2CV0A 4S04A 1IN6A 5F08A 3OS5A 4D7MA 4FMUA 3OS2A 4EJTA 2XAFA 3COAC 5FLMJ 1R4MB 3VUZA 2M7AA 1OR7C 2GXBA 1V54H 3JRFA 2J5PA 1CF7B 3M8JA 3WTZA 2R7WA 3SDGA 2OTJI 1ZR4A 4A5MA 1SVOA 4H0EA 2LH9A 2P6TA 2X85A 2A6HF 3KETA 2R7XA 3AG1H 2ISYA 2Z1DA 1AU7A 2FXAA 3DEEA 4C1QA 3HUGA 2A3SA 2F6CA 4WUYA 4IXAA 2DOEA 3IV5A 5ED4A 3A01B 2K3PA 3IH4A 2ELKA 4C2TA 3PQKA 3U21A 3MEXA 3JAMK 3REOA 1BIBA 5DD4A 3TO9A 1BA5A 4MEYF 1IRFA 3GTLJ 1ZRCA 1MJAA 4ABZA 2O8KA 5J40A 3E6MA 4A3FJ 2EFWA 3HL2A 1S5LC 1IUFA 3IWFA 1S29A 5HOOA 2R92J 3LFUA 1IRXA 2BOLA 1RRJA 1APLC 2RNGA 1I50J 2DMPA 3D0SA 4HBLA 2BY1A 5JHNA 3X2QH 3ERED 4LB6B 2JJ7A 4UV9A 3PFYA 2GXAA 5CKTA 2LDUA 3M58A 3IP4B 3S7JA 2F69A 1WH7A 5CVVA 1ODDA 2WAEA 2ME6A 1ZAOA 1O3QA 2HU9A 1YE9A 2VJJA 3J7AO 3BPVA 1GVJA 1A31A 4XKVA 2LRDA 3CF2A 1E3OC 2IA2A 5F59A 4GRIA 1G3WA 1MNMC 2CFOA 3BTIA 1J7KA 2LLKA 3HJEA 2K3FA 3VFZA 2L9NA 2Q8KA 3FPDA 2W48A 5HNFA 3FM3A 2Y30A 3W2WA 2VKEA 1BOBA 3JRIA 3BG9A 4A0ZA 1GV5A 1OCZH 2VE8A 2K9QA 2OZ6A 2LNBA 4BEHB 2VASA 2C6YA 2X6WA 3HKZN 4RGSA 3S2DJ 1J5YA 4BDYA 3OIQA 5GTHC 3CCYA 3JAMZ 2EA2A 3BR2A 2BGCA 2NNYA 2I10A 1IXCA 4IHWA 4YIFA 5B5EC 4I51A 4GCVA 1XDUA 2OTLI 3FX3A 2LMDA 3TW7A 1R36A 3TEDA 1IF1A 1IN5A 2P6SA 4DQ2A 4NB5A 1WJDA 2BHZA 2E60A 3K2ZA 2MABA 3HRSA 1RC9A 2DBBA 2JPCA 3KP6A 3Q0UA 4KFCA 2KISA 3RKXA 2NXNB 2LG4A 4CSWA 1HOMA 2BE5F 3GW2A 2D45A 2VKHA 1ZG5A 2F5EA 3DEWA 4GGGA 1QZYA 3BG6A 3M59A 3MEKA 1C0WA 3TMOA 3LSRA 4FE4A 3OXGA 3CF5F 5HLHA 3CP2A 4BGDA 3A2KA 4NUBA 3BZ6A 2COMA 3RYRA 2EH3A 2UUZA 1JJ6C 2M4GA 3OWTA 4CGZA 2PMZN 3QPSA 4AIJA 1R1UA 2L7FP 3K1NA 3OYAA 2L02A 2ICWG 4L5IA 2YPRA 3R0JA 4OINF 1YOVB 2VC1A 5KAFC 3D5LA 2DA2A 1T33A 3ISPA 2FNAA 5GTIC 4P5OA 2BQZA 4BXXJ 2XF7A 4FETA 3HTUA 5EDNA 1RPWA 3TGNA 3HOZJ 1HC8A 1OJLA 3QPTA 3L2VA 1YX5A 1SEUA 4V19K 3WGGA 4ON0A 1LEAA 4RB0A 4XN0A 4OAYA 2MA3A 2M4KA 2VQCA 3AG2H 3ZP5A 3W6VA 1QVTA 2MC3A 4AIKA 2JA6J 3H1CA 1FT9A 2DFEA 2WADA 5LFAA 4HX8A 5E3OA 2EZHA 4AVPA 3LMMA 4RLFA 3LSGA 2IS2A 3FXJA 3BQZA 4AD9A 3HEFA 1YFHA 2CU7A 3RTRA 1XTAA 5DV5A 3S1QJ 2JQ7A 3BR1A 3G2BA 3CUQB 3I59B 3OYIA 2HR3A 3HGGA 1LEBA 2EJRA 1X1BA 1QU3A 3PNYA 2GIZA 1UZCA 3M5AA 1MVXA 3M1CA 5H6QA 1WI9A 4WF2A 4EJOA 3OYNA 2JA7J 4DGWB 5A2QK 4BL0B 4CHUA 1IC8A 4XLNF 4CCJA 2ZSHB 3I64A 4ZZDA 2NVXJ 3C7JA 3LNQA 4BH9A 3JRAA 3G1MA 3HHGA 5DEQA 4JLGA 1JT0A 3WHBA 4KUMA 1E3HA 3DTKA 3BT9A 5J3LA 1ZRFA 5K7ZA 5ILSA 3D1NI 3F8FA 3VV0A 2NNNA 1LVAA 2PI0A 1ZGWA 3TOAA 4ZYAA 3HOUJ 1DGRM 3HUGB 2NVTJ 1XG1A 2FUG2 4G7OF 2LKXA 1HDPA 1N6AA 1O3TA 3IHUA 1XSXA 1Z1DA 3M8EA 3DTEA 2M2EA 1NG7A 1JHFA 4XM3A 4PUSA 4HRIA 3KP5A 2IGMA 2D1VA 3CC4I 1E0EA 1U9OA 3DLLF 4AVZA 3EYIA 2H6CA 4KIBA 5BNGA 1FBUA 5L3BA 4EGZA 1SFUA 1ZN2A 2F4MB 4U0WA 4CDGA 5GAEJ 2OQGA 2VIXA 4X0GA 3QWVA 2KFDA 2BZTA 4HX4A 5CYVA 4A3MJ 5TTFA 1FSHA 1Y8RB 2IJLA 3QOPA 3E97A 2QM3A 2H94A 4E7LA 2O8JA 2KP6A 4FT8A 4DW6A 3G71I 2M9HA 2CUJA 2R7SA 4UV8A 5EX3A 5JHUA 2L9SA 2HZTA 3DWLE 2EV5A 4JYKA 4IEJA 3CDHA 3J7YJ 1P2FA 5IT3A 3G73A 4J8OA 3RJWA 2MLKA 3KLOA 3OY9A 1TQPA 3ZQIA 3AAFA 4X1EA 2Q2EB 2LKSA 1ZLKA 2XUBA 5C44J 4IKFA 3RSNA 1VZ0A 4PCQA 2K02A 2B7EA 3OS1A 4BJ5C 3GCMA 1QPIA 1ZREA 1I6XA 1MNEA 4LGWA 1E2XA 4HEA2 3SZTA 4A6EA 3OYEA 3FBIB 5HODA 4KDPA 2X0LA 4F91B 2WV0A 1HQCA 2M8EA 3FBNB 2X9DA 2DT6A 3S8PA 3RYPA 2FEZA 2OD5A 2EK5A 5H2FC 1B4AA 1ETVA 2M34A 3ABKH 4RGRA 5CVJA 5HQ8A 4HQEA 3EQLF 3TP0A 5D5UB 3JSPA 2W5YA 2K9SA 4D7NA 3LAJA 4OIOF 3IH2A 4WXHA 5FLVA 1W7PB 4CCMA 4PJNA 4OIQF 2DT7B 2ID3A 2F4IA 1SMYF 2JMWA 2ZMEB 3PNVA 2JRTA 1LUJB 2XGDA 3JW4A 1B9MA 1B1BA 2TDXA 3QQAA 5LSXA 1XSVA 4IRIA 2HZDA 3C3WA 2R7ZJ 3CBPA 3GLXA 4K2EA 3RZDJ 4HDVA 2BYVE 3DBHB 5JFRA 3RIRA 4MFDA 3MZHA 3FZVA 4PFPA 1IGNA 1LKXA 2EBIA 4E7KA 2VT3A 3O2PE 2IVMA 3U2RA 1I3AA 1T0FC 3T8RA 3RI4A 1YITI 3ZMVA 1Z0XA 2KRCA 5FKNA 4BAYA 2LVSA 1Y1WJ 3GTMJ 3OYLA 1A6IA 5AIQA 1PUFA 2PJRA 3KIOA 1RR7A 2ZXJA 3C18A 3F8CA 3CJQB 2QQ8A 3EUAA 4DZPA 1TTYA 1N75A 2EIKH 2P4WA 4AYBA 3AG3H 1WJCA 5LEJA 3J80K 3WTXC 3GFIA 4UB8C 3S32A 1ZELA 2Z3YA 2EV0A 2FBHA 5K5RA 1J2XA 2DA3A 2R5ZA 4BACA 4DIQA 2LF7A 4ZYEA 1S8NA 3ABLH 3OYBA 1H9GA 2OUMA 2LR8A 3I9V2 3K0LA 5F6KC 1TW3A 2BHYA 5KAIC 3DU6A 1FIAA 2CQKA 2UXNA 4EATA 4IHYA 1V55H 3DV8A 2FE3A 3T5XA 3ZR8X 1VQOI 1ZLJA 1Y8QB 4I0AA 1UHSA 2OQRA 2RVCA 2EIJH 2O0YA 3R61A 3VODA 4IHXA 4BQOA 3BTLA 1WGXA 2DW4A 2P8TA 2Y0SA 3LSIA 4UUSB 2YX4A 4O5VA 3DALA 3K6GA 4XN3A 2VONA 1S7AA 5CQGA 3CMYA 1D8JA 3QU6A 4CCOA 4YELA 4YPUA 4ASNA 1K78B 4BHCA 2WB1A 2FMLA 4RGUA 5K7FA 4LIVA 2OC6A 1UG2A 2E2JJ 1LDKB 5ICGA 2CQXA 1CF7A 1ORKA 3FDYA 1IN7A 3BC8A 5F04A 4RLQA 4XRFA 4M73A 5CVUA 3V4GA 3TP3A 3OXFA 2XIGA 4OU0A 3JRDA 1BC8C 2XVCA 2STWA 2GQQA 4O6JA 4FTHA 2GM4A 3CC2I 3A01A 5EZGA 2DODA 4A93J 3BR5A 3DKWA 1DDNA 2MG4A 4M9XA 1U8BA 5FFXA 3CDIA 4S05A 2L7MP 3JTGA 4BDZA 4FASD 3J80Z 3P9IA 4QLCU 4A69C 2L7ZA 3FKJA 3S1RJ 2LY1A 2H8WA 3E6CC 2VQLA 2X1CA 4RA2A 5DM6F 2W00A 4M3BA 4RAYA 1HW1A 5E3MA 1FMWA 4J83A 4Y17A 2O6GE 1JTXA 4Y7NJ 2WAQN 1TWHJ 4YNDA 3IL2A 1QBJA 1BBYA 1AKHB 1MZBA 1MD0A 3DPUA 2HDDA 4XRSA 2QQ9A 1FWZA 3BDDA 3OYDA 1I3QJ 1X1AA 2FMYA 2XF5A 3Q5FA 3CO6C 1KQ0A 2MGQA 1GXQA 1WWXA 4E7SA 1Z77A 1ZK8A 3Q9VA 5M3MJ 5LD2C 3CD6I 1RR8C 1OMIA 3T8TA 4RBOA 1D1CA 5BOXA 1O57A 1OKRA 3M07A 1BM9A 1E3PA 3CJRB 2RGVA 1K83J 1KU3A 2X6OA 1FX7A 3Q3SA 4AM3A 3AL0B 4YFKF 1LFBA 4XICA 3HXLA 3WTTC 2BBYA 4XLAA 3L1PA 2VE9A 3H9JA 4IQ4A 1MMSA 5AONA 2VKVA 1MMAA 3GZNB 5EX0A 3JCUC 1T38A 1OPCA 2IS1A 5B66C 2QCOA
chains in the Genus database with same CATH topology
2IGNA 4IJ8A 5KJMA 3OR1C 4XQFA 2K3PA 1N77A 3QYEA 4C2TA 3U21A 1MMDA 2LYCA 3L2UA 3S93A 4IJDA 3CBOA 2HVQA 4HSRA 5KJNA 4XOPA 3RPUD 3HL2A 1XQHA 1EA3A 3CMMA 4Z4PA 1U0JA 4E7JA 3CBMA 4YRVA 5HOOA 1D0YA 1IRXA 2BOLA 3LFUA 3M54A 2E5NA 2RNGA 1SAUA 4BXFA 3HPHA 3OYCA 2VJ4A 3KMJA 2HDWA 3K70C 5JHNA 5JINA 2BW3A 1O9SA 2VXZA 3J7AY 2L7KA 2MFZA 1N3JA 3PFYA 4PFOA 5CKTA 2P0WA 4RM2A 3IP4B 3M58A 3S7JA 2F69A 2R7TA 1YX3A 2WAEA 3BCBA 2WBMA 2HU9A 3ZCOA 4N4OB 1YE9A 2VJJA 2JV0A 2HNHA 4XKVA 3W2VA 4YNMA 2LRDA 3CF2A 4J00A 3OYKA 5F59A 4GRIA 4BE0A 2CFOA 3K5KA 2CS3A 3W3CA 2L9NA 4KISA 3LSMA 4II3A 3HG9A 4DBQA 5T5GA 3DKXA 3FPDA 3MO2A 2LBFA 5HNFA 3W2WA 1BOBA 3MKZA 1N6CA 4JQFA 4ZTJA 4MLOA 1D1AA 4F3QA 4JDSA 2W4SA 2VASA 4BEHB 3EUKL 2X6WA 3DB5A 1D0XA 4J7IA 3QOEA 2QKMB 2IXSA 4BDYA 3GBGA 4ANJA 2KLOA 2WAQA 3OIQA 1T95A 4BUPA 4H4KC 4F92B 2MC4A 4RMNA 3OXLA 4BS9A 2BVMA 4B43A 4Y3OA 2CV2A 1QHGA 3FHNA 4HNUA 1ERDA 4I51A 3VSLA 2VQGA 2KHMA 1DP3A 2MYSA 4D1QA 5HI7A 4BJ6C 1R6RA 4PJMA 3H5NA 1G8XA 2ZSIB 2F5VA 1WJDA 3M56A 2BW3B 5F5EA 3F9KA 5FRMA 2E60A 2LREA 3H9GA 2MABA 4NC7A 4CZCA 5CCLA 3KMAA 1Y6IA 3VYTB 2LG4A 4CSWA 4IX7A 2ZXIA 2JA2A 3CP8A 2VKHA 3PUBA 3HOTA 2VPLA 3BG6A 3M59A 3MEKA 2V1NA 3TMOA 2R3AA 3MMYB 4E4HA 2K9MA 3TBIA 3OXGA 4HSTA 5JHFA 3CP2A 4YNPA 2XAUA 4F93B 4BGDA 2DOAA 2X6XA 4QEOA 3A2KA 4NUBA 4BQQA 2W5ZA 3S7DA 3E0JB 2UUZA 2JVHA 2LBFB 2M4GA 2VKDA 2WAFA 3OWTA 1W36C 5T0KA 3TL4X 3ZGKA 3DPLC 3OYAA 4ITVA 2NOJB 2LOOA 3BO5A 3DPTA 2DJIA 3D5LA 4HNTA 2BQZA 4P5OA 1MW7A 4XL9A 2M7BA 2E1MB 4N4NB 1PJRA 3VYSB 2XF7A 4FETA 1PYVA 4YEJA 3SYTA 3OYJA 2CW7A 1WJEA 4XONA 3SEQA 5HLTA 2QKLB 3L2VA 1YX5A 2VXDA 4P1WA 3OS0A 5HNHA 4XN0A 4OAYA 2M4KA 2VQCA 3HOSA 4CUGA 2LY2A 3BLYA 3CESA 5LFAA 2WADA 3M57A 5CCMA 4LIUA 3LMMA 2LC2A 4XMYA 4RLFA 3RQ4A 2KDOA 3LSGA 3TG5A 2IS2A 3ZRGA 2ELJA 2IS4A 1X1DA 4ZDOA 3DLAA 3RTRA 4ZTFA 2IS6A 2GOMA 3DKYA 2JUGA 3OOIA 3MO0A 3G2BA 3H35A 2BVLA 4QPOA 3OYIA 1GLNA 2VLAA 2L2OA 1X1BA 3HKZA 3S7FA 1QU3A 3PNYA 4NVQA 3M5AA 2ZXHA 3ZXSA 3N05A 1MVXA 3M1CA 5KJKA 4E7ZA 2CH0A 3OL3A 3OYNA 4DGWB 4BL0B 3D5SC 1Y56A 2ZSHB 4CCJA 3OMYA 4B3XA 3SW9A 4JLGA 3K4BA 4O6FA 3DTKA 2O5RA 3VYRB 3SWCA 2MD0A 3SDBA 4J01A 4ZDLA 2Q1ZB 3VV0A 1BR4A 1H3IA 1D1BA 4ZYAA 1DGRM 1X4PA 3HUGB 2FUG2 2Z2SB 1X19A 4IZZA 3RAYA 1N6AA 2R7OA 1SFKA 2A6TA 3K4MA 3F9ZA 3M55A 5ARFA 3AKZA 2R7QA 1DGWY 1OLTA 3DTEA 1NG7A 1WJ5A 4XLFA 3KMTA 4XM3A 2CMPA 3F9XA 4PUSA 4CCLA 4HRIA 5JJ0A 1UAAA 2UV1A 2IGMA 4QENA 1KONA 1E0EA 2IS1A 1V5FA 1LVKA 4AVZA 4KJZA 1UG0A 3QODA 2WY7Q 3L2RA 3NWTA 4DOZA 2W82A 2HVSA 4OAZA 5AYFA 2VIXA 3BCAA 4XKWA 4X0GA 3QWVA 2V26A 4B44A 2PMZA 3DU5A 4U87A 3IHXA 1MNDA 2XF6A 2CV1A 2X6YA 1TZLA 5TTFA 2V4JC 4ZDPA 3ZQQA 4E7LA 1JI8A 2O8JA 2KP6A 3PSFA 2AQFA 2CUJA 2R7SA 5EX3A 4DBRA 2L9SA 4PK4A 3AFHA 2VJIA 3DQVC 3DWLE 3OIPA 2DCEA 2V7FA 2R7VA 1FMVA 4J8OA 3RJWA 4XLHA 1DQUA 4PSWA 3OY9A 3H0DA 1MMGA 3SEZA 2IGQA 4E7HA 2Q2EB 4QEPA 4IKFA 4LG3A 1N78A 3RSNA 1VZ0A 3RCOA 3SZGA 3OS1A 4BJ5C 4E7IA 4H12A 1MNEA 2KRHA 4HEA2 2KPMA 3OYEA 3FBIB 4ZC3A 4G6TB 3HNAA 4F91B 4E47A 1Z3XA 4LDGA 3KX2A 3FBNB 4XKBA 2DT6A 3S8PA 3AL0C 1BR2A 1V5EA 1Z3YA 3QWPA 2RREA 2XC7A 1WJAA 4BU2A 2JVGA 4C30A 3QWWA 4MI5A 5HQ8A 2KZVA 3PDNA 3RIBA 3OYHA 3L2WA 2W5YA 2WA0A 5KJLA 2R7UA 3F9WA 1PEGA 2KQRA 4CCMA 4PJNA 3S3OA 3D5RC 2DT7B 1MT6A 2F4IA 3K70D 3HC7A 4RM3A 2ZFUA 2KMUA 3PNVA 3UNGC 4DJAA 3PSIA 5LSXA 3VSKA 5KNLA 1WJBA 2HZDA 3CBPA 5ARGA 3EP0A 2X1DA 2VQHA 1TT0A 3LSKA 4XLCA 2W7NA 4J7FA 3S7BA 3TG4A 4PFPA 1LKXA 4BJTA 5LSZA 4E7KA 1X1CA 2M0MA 2VJ5A 5CPRB 3H5RA 3OYMA 2UWMA 1T0FC 4BEHA 3NWSA 4CA0A 2GOXB 5FRNA 1WJFA 3EUHC 2IGKA 2KRCA 3PJRA 2V6EA 3OL4A 4XORA 3IAS2 3K4KA 4ZJZA 3OYLA 1NG6A 3CZ6A 4RZ0A 2PJRA 3HPGA 3MO5A 5F6LA 1P9QC 3CJQB 3K4JA 3H9QA 3EUAA 1N75A 4AYBA 4E6KG 4BE1A 2XDVA 3H5AA 1WJCA 3K4CA 2QPWA 3PNTA 3A4CA 3S32A 1ZELA 2RQQA 2R4GA 3M53A 4BACA 4DIQA 3OYFA 4IQJA 3OYBA 4R79A 3I9V2 2OUMA 1MUFA 5F6KC 3BG7A 3MD2A 3DU6A 4CH7A 4PJJA 3K10A 4JOMA 4EATA 3ZR8X 2A5WA 1G59A 3LL7A 2I8DA 3VDXA 4OWRB 4II2A 1S9HA 2K5CA 2K9LA 4BQOA 4O30A 3LSIA 2Y0SA 2VB6A 3LSHA 2HVRA 3DALA 3K6GA 4XN3A 2IGOA 5CQGA 4F52A 2CW8A 1D0ZA 4CCOA 3KYLA 4YELA 4YPUA 3DTIA 5TH7A 2WB1A 4MI0A 5FROA 4XOTA 3OR2C 4LIVA 2OC6A 1LDKB 3OYGA 3S3NA 5KHDA 1ZKKA 4F55A 3FDYA 3A1YA 3BC8A 1Z7LA 2CUZA 3KEYA 4HPQA 4LITA 3N71A 5HVQC 5T0MA 4RLQA 3OXFA 4NQWB 5TGTA 5JIYA 3MKYB 1W36D 3V42A 1ML9A 2WY8Q 2PJRB 1V5GA 3MKWB 2R7RA 1Z21A 1WFXA 3W2AA 4NJ5A 1K6YA 3I3LA 4C9YA 1HA8A 1UELB 2HQAA 2KL4A 4XLEA 3K4NA 5TEGA 5KCMA 3RU0A 2M3AA 4BDZA 4PSXA 1MMNA 4FASD 4XKCA 4B47A 2DXIA 3FKJA 2G46A 2LY1A 1AA7A 3QYFA 2VQLA 4XR6A 3QYBA 2X1CA 2W00A 5CQEA 2XSJC 4D9JA 2AQEA 4U7BA 1FMWA 4J83A 5EG2A 4KITB 3S3MA 4YNDA 2X51A 2E5ZA 2V9KA 3IAM2 1QHHD 3OPEA 1X4OA 3DPUA 3PL8A 4BQNA 4C2UA 1LFPA 3OOUA 3OYDA 3L2QA 3K4LA 1X1AA 2XF5A 4PJLA 3F9YA 2VL8A 4Y33A 3VYUB 2W1OA 4CCKA 4E7SA 3E1SA 2RFIA 4YPAA 5LD2C 3IUOA 4NC8A 3UR3C 4BE2A 2E1MC 2OV7A 4HG2A 1D1CA 4Y4RA 2CV0A 3C2HA 3OS5A 3CJRB 4FMUA 3OS2A 4B48A 4CCNA 4KT6A 2Z16A 3AL0B 3VUZA 2M7AA 1OR7C 4QPQA 4YPEA 3HXLA 4AU7A 3M8JA 2R7WA 2JSPA 1MVHA 4XLAA 3C2GA 4NNJA 3ONQA 3VWBA 2LH9A 3H9JA 4IQ4A 2X85A 1BR1A 1J09A 2R7XA 1MMAA 2HPMA 2Z1DA 4C1QA 2X1EA 3DEEA 5EX0A 2HPIA 4XNFA 2F6CA 2L5QA 4WUYA 3EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJM A;  1MUF A;  4IJ8 A;  4YNP A;  5F6K C;  5AYF A;  4QEO A;  2W5Z A;  3S7D A;  3QWV A;  4IJD A;  3CBO A;  3IHX A;  5T0K A;  5TTF A;  4O30 A;  5KJN A;  3BO5 A;  1XQH A;  2O8J A;  4Z4P A;  3CBM A;  5EX3 A;  3DAL A;  3M54 A;  2BQZ A;  4YPU A;  3KMJ A;  5TH7 A;  5JIN A;  4J8O A;  4MI0 A;  3RJW A;  5JHN A;  1O9S A;  2IGQ A;  1N3J A;  4QEP A;  3M58 A;  3S7J A;  2F69 A;  1ZKK A;  3N71 A;  4H12 A;  5T0M A;  3OXF A;  2JV0 A;  5JIY A;  3HNA A;  3M57 A;  4YNM A;  4E47 A;  4LDG A;  1ML9 A;  5F59 A;  5CCM A;  3S8P A;  4NJ5 A;  3RQ4 A;  3K5K A;  3QWP A;  3TG5 A;  4MI5 A;  5HQ8 A;  3QWW A;  5T5G A;  3PDN A;  3RIB A;  5TEG A;  3FPD A;  3RU0 A;  2W5Y A;  3MO2 A;  5KJL A;  3F9W A;  1N6C A;  3OOI A;  1PEG A;  3MO0 A;  1MT6 A;  2G46 A;  4JDS A;  4J7I A;  3S7F A;  3DB5 A;  4NVQ A;  3M5A A;  5LSX A;  1MVX A;  4J83 A;  5KJK A;  5EG2 A;  3CBP A;  5ARG A;  3EP0 A;  4BUP A;  4YND A;  4J7F A;  3S7B A;  3TG4 A;  3OPE A;  3OXL A;  3SW9 A;  4JLG A;  5LSZ A;  4O6F A;  3SWC A;  5CPR B;  4I51 A;  3F9Y A;  3VV0 A;  2RFI A;  4YPA A;  1H3I A;  5HI7 A;  3RAY A;  3OS5 A;  1N6A A;  4FMU A;  3M55 A;  3M56 A;  3F9Z A;  4RZ0 A;  5ARF A;  5F5E A;  3MO5 A;  5F6L A;  5CCL A;  3KMA A;  3VUZ A;  4YPE A;  3KMT A;  4AU7 A;  3F9X A;  1MVH A;  2QPW A;  5JJ0 A;  4QEN A;  3M59 A;  3MEK A;  4C1Q A;  2R3A A;  5EX0 A;  3M53 A;  4WUY A;  3OXG A; 
#chains in the Genus database with same CATH topology
 1XS9 A;  1IJW C;  2IGN A;  2DMT A;  2LP0 A;  3OR1 C;  3SXY A;  2XPV A;  4XQF A;  4XID A;  2KZG A;  2LYC A;  3L2U A;  3I0T A;  2OZU A;  4IJD A;  2VN2 A;  4B8X A;  2O7O A;  3QPH A;  1OCP A;  2KJB A;  4LLN A;  1W5S A;  4HX7 A;  1BJA A;  2HYG D;  5IT9 K;  2H27 A;  4IRG A;  4PGH A;  3BPX A;  3H3V K;  1G3S A;  5HDN A;  2NVY J;  1TW2 A;  4AUX A;  4YRV A;  4MNU A;  3F8N A;  3GFJ A;  3M7G A;  1VQ8 I;  5FKM A;  2E5N A;  3R6S A;  3HM5 A;  3HPH A;  3OYC A;  3ZQ7 A;  2HTS A;  4JBA A;  1SD7 A;  1B72 B;  5FO5 A;  2VXZ A;  3J7A Y;  1OQY A;  2P0W A;  3BOQ A;  1YX3 A;  4Q47 A;  2WBM A;  1IUY A;  2VI6 A;  3W2V A;  3WOD F;  2IT0 A;  3I5U A;  5DS9 A;  4BE0 A;  5J8F A;  1F36 A;  1BI3 A;  3WE3 A;  4BHB A;  4IVN A;  4MEX F;  2CS3 A;  2JWT A;  1LJ9 A;  2LFB A;  3W3C A;  3V7R A;  1O3R A;  3LSM A;  3HG9 A;  1JT6 A;  5F0F A;  2HKX A;  2XAQ A;  4A3I J;  2FQ4 A;  3PFI A;  2FJ1 A;  4MTD A;  4OMY A;  1N6C A;  1JKR C;  2CG4 A;  4MLO A;  1D1A A;  4JDS A;  1ON1 A;  2L4A A;  3DXJ F;  3DB5 A;  4IF4 A;  1TNT A;  3B6A A;  3G3Z A;  1Z6R A;  4LG0 A;  4U0Y A;  5FKL A;  3I55 I;  1BI2 A;  1YW8 A;  2DO7 A;  3PIO F;  1ZHF A;  1B9N A;  4BUP A;  4ESJ A;  2DYS H;  2FQ3 A;  2ZJQ F;  3EDP A;  3OXL A;  2WC2 A;  4LLL A;  4RS8 A;  1EH6 A;  4BS9 A;  2BVM A;  4FX0 A;  4B3A A;  1QHG A;  3FHN A;  1W5T A;  3VSL A;  1L3L A;  1UMQ A;  5E3N A;  1VQ6 I;  4UVC A;  4LB5 A;  4IRH A;  1DP3 A;  1BI0 A;  4DNC A;  2R5Z B;  2YU3 A;  2Z5U A;  3LOC A;  2ZSI B;  3H5N A;  4M6Y A;  3M56 A;  2NS8 A;  1S7E A;  1J75 A;  3I56 I;  1K4S A;  2CJJ A;  3SHF A;  3VYT B;  4RGX A;  3BP8 A;  3CCU I;  1T39 A;  2ZNZ A;  2JA2 A;  1Q1V A;  2COB A;  4W97 A;  2R3A A;  3KEQ A;  3QWL A;  3CUQ A;  3JSO A;  2K9M A;  3I59 A;  1I6H J;  2DA7 A;  1AWC A;  5JVG F;  1R22 A;  2ZFW A;  3K7A J;  1R4N B;  5JLW A;  2LKP A;  5C4J J;  2DOA A;  2X6X A;  1LQ1 A;  2DQR A;  1PP8 F;  2QSG X;  4BQQ A;  2W5Z A;  4ENJ A;  2JVH A;  5E8G A;  2LBF B;  2JT1 A;  1SD6 A;  3T1B A;  2HOA A;  2J5O A;  3E3V A;  1HKS A;  1MGT A;  1FOY A;  5IPA A;  4ITV A;  2ZJR F;  4F7Z A;  1HST A;  2XGX A;  5JI6 A;  1JGS A;  4Z6Y A;  2VOD A;  4HNT A;  4WXC A;  2H1K A;  4A3C J;  4WK8 F;  4C2M J;  3CLQ A;  1CGP A;  2M7B A;  4ZH4 F;  3GX4 X;  3VYS B;  3T0Y A;  4YEJ A;  3SYT A;  1IO2 A;  4CO8 A;  1SFX A;  2VBX A;  2HQ5 A;  2PMH A;  3ZOB A;  3NRV A;  5B1B H;  5F1R A;  5HLT A;  2PBI A;  2B63 J;  4P1W A;  3OS0 A;  4G7Z F;  3CUO A;  2DMQ A;  5L3E A;  5BS6 A;  1YRN B;  2XB0 X;  5JR3 A;  3BLY A;  2MH9 A;  4W1U A;  3S14 J;  3M57 A;  1P4W A;  1O7L A;  4BY7 J;  4AWX B;  2DQL A;  5CCM A;  5M3F J;  2W25 A;  2KDO A;  3TG5 A;  4MO7 A;  5LHG A;  2KDZ A;  3ABU A;  1LE8 B;  4ZDO A;  3DLA A;  2K85 A;  4LLG F;  2ZJ2 A;  2KIU A;  3L7W A;  4ZTF A;  3DKY A;  1R5I D;  2K7L A;  2IS6 A;  2G9W A;  1HCR A;  4DYR A;  1ZYR F;  3DP7 A;  2P7V B;  2CFX A;  1UCR A;  4A3G J;  2XAG A;  5JVT A;  5IYC J;  3HKZ A;  2OAZ A;  3ZXS A;  5KJK A;  1ETQ A;  1WI3 A;  1FEX A;  1XD7 A;  2K9N A;  3OMY A;  5D8L B;  1HXD A;  1TWG J;  2QSH X;  3SW9 A;  2MLG A;  1P4A A;  3PM1 A;  1ZQ3 P;  1RET A;  3SWC A;  2O5R A;  3VYR B;  4ENK A;  2Q2E A;  3JRB A;  3H36 A;  3K69 A;  4J01 A;  1W0U A;  1A36 A;  2E19 A;  1BR4 A;  4LK0 F;  5J6X A;  1L0O C;  3FMR A;  2Z2S B;  1X19 A;  5IP9 J;  4IZZ A;  1NK3 P;  3RAY A;  3K4M A;  3F9Z A;  3S1M J;  5IP6 A;  2QZ8 A;  3LST A;  2GZW A;  3TDZ C;  3F9X A;  1REP C;  1U3E M;  2MW8 A;  1UAA A;  2STT A;  4U0V A;  2O8X A;  2GLO A;  1KGS A;  1W7P A;  1FLI A;  3L09 A;  2JPB A;  4BBR J;  1FOW A;  2DT5 A;  3BRO A;  4ESB A;  2ZME A;  3TQN A;  2XSD C;  4DOZ A;  2E34 A;  2HVS A;  1JUS A;  3KE2 A;  2B9S A;  1ZGA A;  2KIQ A;  5BPI A;  4HW0 A;  1RI7 A;  2V26 A;  3E6B A;  3RJP A;  3R0A A;  4Y13 A;  2PMZ A;  1TQI A;  4U87 A;  5ICE A;  1MND A;  2XF6 A;  4A0X A;  2CV1 A;  2X6Y A;  1TZL A;  2Y9Y A;  3FXK A;  4M72 A;  3TO6 A;  4A3J J;  1SC7 A;  1VQL I;  1NHA A;  3C2B A;  3FXU A;  3ZQQ A;  3Q9S A;  1JI8 A;  5DDG A;  3E5X A;  5EEH A;  3NQO A;  4FIS A;  4TV7 A;  2QBY B;  2IP2 A;  4BHP A;  2DCE A;  2R7V A;  2ME0 A;  1DQU A;  4PSW A;  1NH3 A;  5EYR A;  1MMG A;  2IGQ A;  1SAX A;  4LFU A;  2X48 A;  1ITY A;  3IWZ A;  1X3Z B;  5K7H A;  5GAG J;  2HYF A;  4MIM A;  2K4B A;  1R49 A;  2ESN A;  3DCF A;  4H12 A;  4P9F A;  4P9U A;  1T2K A;  5GPA A;  2KPM A;  3U1K A;  1SVM A;  4Q48 A;  4BY1 J;  4G6T B;  3HNA A;  3SZP A;  4E47 A;  3KX2 A;  1I27 A;  3KZY A;  4XKB A;  1AHD P;  4LG0 B;  2XGC A;  5E79 C;  4G94 A;  3K2A A;  1YG2 A;  2IRF G;  5J1Y A;  3RKQ A;  1KZH A;  1QA6 A;  4ZZL A;  3L2W A;  1ZRD A;  1Y39 A;  3F0C A;  1IDZ A;  5E1Z B;  3F9W A;  4UVA A;  3E5Q A;  3RDI A;  3MZY A;  2PN6 A;  1FTT A;  1FYM A;  3S1N J;  2ZFU A;  4I09 A;  4UUS A;  2NAZ A;  5F0C A;  3RKY A;  2HOS A;  3FK7 A;  3VSK A;  5KNL A;  1WJB A;  2Y9Z A;  3GO5 A;  3GME A;  4EJV A;  3KP2 A;  3W6J B;  2VQH A;  4ETS A;  1BJZ A;  4XLC A;  5KVR A;  3KEO A;  1K78 A;  3TG4 A;  4IHV A;  3DBL B;  1YTY A;  3S16 J;  1X1C A;  3GFL A;  3HRT A;  1YI2 I;  4JX4 A;  2DOF A;  1YHQ I;  1MSF C;  3NWS A;  2CUE A;  3KZI C;  5FRN A;  1WJF A;  2OA4 A;  1U9N A;  4HQM A;  3A02 A;  1HW5 A;  2DMU A;  4I7H A;  2V6E A;  3IAS 2;  3K4K A;  4ZJZ A;  4NHJ A;  1POG A;  3CZ6 A;  4RZ0 A;  1O3S A;  2RV8 A;  3MO5 A;  5F6L A;  3ERM A;  3K4J A;  1DU6 A;  3H9Q A;  1V4R A;  2I5U A;  1WZ2 A;  4PGG A;  4BE1 A;  4UNO A;  4KIC A;  2XDV A;  5DD8 A;  3IRR A;  4HA8 A;  2TCT A;  1S6L A;  1STZ A;  1X2M A;  2VC0 A;  5L3C A;  3M53 A;  4P55 A;  2NS7 A;  4EJU A;  2EZK A;  3C1D A;  2EWN A;  5FD5 A;  3F6V A;  1MUF A;  2DYR H;  2NVU B;  4N9H A;  3BG7 A;  4CH7 A;  4PJJ A;  1H88 C;  1WSU A;  3K10 A;  1FP2 A;  1HDD C;  3O3K A;  1G2H A;  5DCM B;  1AKH A;  2QEX I;  2EV6 A;  2DA6 A;  2F4O B;  5J1U A;  4I01 A;  4OWR B;  5EF6 A;  1OFC X;  2K5C A;  2Z33 A;  1I39 A;  2PX9 A;  4DYC A;  3JRC A;  2R5Y B;  2HYJ A;  2IGO A;  4F52 A;  2CW8 A;  1WKM A;  2LSO A;  3MKL A;  3ZN1 A;  1PVE A;  5FJ8 J;  3KYL A;  2DTZ A;  2HTJ A;  2E2H J;  2KJC A;  1MH4 A;  3KP4 A;  4RB2 C;  5GAH J;  1MJB A;  3WHC A;  5DM7 F;  2MBF A;  3S3N A;  1ZKK A;  2A5Y B;  3A1Y A;  1Z7L A;  3KEY A;  5T0M A;  5TGT A;  5JIY A;  3L9F A;  3J81 K;  3FK6 A;  5DTD A;  2WV1 A;  3MKY B;  2YU9 J;  2EFN A;  2PFB A;  2QLZ A;  1W36 D;  3CDL A;  3V42 A;  2E7X A;  2IAI A;  3TO7 A;  2DLL A;  4EVI A;  5HDK A;  3I3L A;  3BJA A;  4UY8 I;  1HA8 A;  1OR7 A;  2HQA A;  2KL4 A;  4UXN A;  2H1L A;  2ECB A;  1W5C C;  1V3F A;  3DEU A;  3E7L A;  5AIP A;  1QVU A;  4PSX A;  4CYC B;  4HF1 A;  5LHI A;  3FXO A;  2PLY A;  1I1S A;  1MJ9 A;  1FOK A;  3QYF A;  4XR6 A;  3ZMZ A;  3ELK A;  1K7A A;  2Y31 A;  4GDF A;  1SFE A;  4UUT A;  2A61 A;  2F5F A;  4M3D A;  2XSJ C;  5CQE A;  2AQE A;  2R7F A;  4U7B A;  4Y52 J;  3M9A A;  3KFW X;  2X51 A;  1Z7U A;  3KYD B;  2V9K A;  1FTZ A;  3HSR A;  4MFE A;  1VFC A;  3G6E I;  1B72 A;  4BQN A;  4C2U A;  2GA1 A;  5FFZ A;  3ZQL A;  3K4L A;  3CJT B;  5DUI A;  1ZKG A;  4PJL A;  4Y33 A;  3VYU B;  4YPA A;  3IUO A;  1VQK I;  2Z9O A;  1R1T A;  1X2N A;  4HG2 A;  1MBH A;  3DFG A;  2NOG A;  3MN2 A;  4YIR X;  2LTP A;  4B48 A;  1H89 C;  4KT6 A;  1TLH B;  3WG9 A;  2Z16 A;  5BMZ A;  1QZE A;  3V8K A;  4YPE A;  2HDC A;  2EB7 A;  4AU7 A;  4EEF G;  2IEK A;  5KK1 A;  2AO9 A;  1MH3 A;  5F64 A;  3VWB A;  5F27 A;  1BR1 A;  1TWF J;  1YQA A;  2NS0 A;  2X1E A;  3MVP A;  2HPI A;  3A0B C;  5E17 F;  2GWR A;  4IO9 F;  3J81 Z;  5KJM A;  3ZMS A;  3I4N J;  1FNN A;  1EF4 A;  1TP4 A;  3VPR A;  2UXX A;  1I5Z A;  1MMD A;  4HAM A;  1U6G A;  1XGO A;  2FRH A;  1YIO A;  1R7J A;  3P9C A;  3CBO A;  3JTH A;  2HVQ A;  3SQN A;  3CUQ C;  4EM0 B;  4HSR A;  1U5T B;  2K27 A;  5KJN A;  1T08 B;  2M8G X;  4XOP A;  3MWM A;  3CCL I;  1EA3 A;  2PJP A;  4ZYH A;  3HIF A;  4E7J A;  2M0C A;  3M8F A;  3CCE I;  4BXF A;  3FM5 A;  1R23 A;  3ABT A;  3KMJ A;  2JZY A;  2HDW A;  3EET A;  5JIN A;  2V79 A;  3B02 A;  1OYI A;  4GXO A;  3ZQH A;  2CYY A;  4U7D A;  3FF5 A;  3ULQ B;  5EGO A;  3SJM A;  2R7T A;  3BCB A;  3WGI A;  2EZL A;  3V7S A;  3GLL A;  2JV0 A;  4IL6 C;  3GVA A;  2DFF A;  4YNM A;  3I71 A;  5LHH A;  1S7O A;  1B6A A;  1Y0N A;  1ON2 A;  1XMA A;  3MQ0 A;  4KIS A;  4DBQ A;  2ZB9 A;  5FLX Z;  5T5G A;  4L0Y B;  2W57 A;  2EIL H;  2LBF A;  3I4M J;  3WTY C;  4L5J A;  2F5D A;  2YUS A;  3ZQC A;  4JQF A;  5JLX A;  4ZTJ A;  4BXU A;  5E1X A;  2G0E A;  2IW5 A;  3QRF F;  3WGH A;  1Z05 A;  3E5U A;  5ICC A;  4J7I A;  5TIS C;  1UST A;  4GFB A;  3O8H A;  2QKM B;  2EIN H;  5HS7 A;  3LA7 A;  4ENN A;  2WAQ A;  1ETK A;  3ZMD A;  4F92 B;  4H4K C;  4LJZ F;  3VB2 A;  4OIR F;  2L01 A;  1YIJ I;  2V9V A;  3G1L A;  4I98 B;  1D5V A;  4RMN A;  2ZKZ A;  3K1M A;  4I99 C;  4Y3O A;  1FJL A;  1FZP B;  2L0K A;  5LGN A;  3WE2 A;  2VQG A;  2N8G A;  3JRH A;  2VUM J;  2QSF X;  3LAP A;  1YRN A;  4Q5S F;  1P4X A;  2E7W A;  5HI7 A;  2W84 A;  2XRN A;  1R6R A;  3GZ5 A;  4PJM A;  1G8X A;  2F5V A;  4YFN F;  2BW3 B;  2DTR A;  1FYK A;  3F9K A;  5FRM A;  5F5E A;  2LRE A;  4CZC A;  5CCL A;  1F4K A;  5DYM A;  1LE8 A;  1RUO A;  3N4M A;  2O9L A;  2OJE D;  1TQM A;  1SD4 A;  2V1N A;  2HWV A;  4BNC A;  3WTW C;  3VEP A;  2ZXW H;  1ZH5 A;  4JP0 A;  1XB4 A;  1IXS B;  3TBI A;  4PZJ A;  2JTV A;  3HRU A;  1XPX A;  4YNP A;  1RKT A;  2XAU A;  3NAR A;  4F93 B;  1DP7 P;  4OOI A;  5J4V A;  5B3S H;  5J8C A;  3S7D A;  3E0J B;  3HBL A;  3OIO A;  3OSG A;  3WU1 B;  2QVO A;  2VKD A;  1W36 C;  5FB2 A;  2LY9 A;  5J4Y A;  2NRA C;  2FA5 A;  3ZGK A;  3DPL C;  1DU0 A;  1ZG1 A;  1R1V A;  2ZME C;  3Q0W A;  4RB1 A;  3KCC A;  1WH5 A;  3FKI J;  4QSH A;  3DBR B;  1JGG A;  1MW7 A;  1QO0 D;  1R5G A;  4XL9 A;  1MIJ A;  2E1M B;  1PJR A;  3HSF A;  4IPA A;  3GTO J;  3OOP A;  3OYJ A;  2CW7 A;  1WJE A;  3OV8 A;  4MHG A;  1R58 A;  4MQ9 F;  2QKL B;  3SEQ A;  1TL8 A;  3O8G A;  5HNH A;  4KT5 C;  3HOS A;  1TC3 C;  2CUF A;  2JRM A;  2LY2 A;  1TBX A;  4M9S A;  1LDJ A;  4XSZ F;  5LGU A;  2GAU A;  2K40 A;  2IA1 A;  1VQP I;  3G1O A;  4LIU A;  4V2G A;  2IBD A;  3NEU A;  2PQ8 A;  1TT5 B;  1X1D A;  1WCM J;  2QYO A;  2QUF A;  2JUG A;  1MBG A;  3MO0 A;  2JA5 J;  3H35 A;  1GLN A;  2CW0 F;  3CCS I;  2VLA A;  3CCQ I;  4NVQ A;  1HF0 A;  2ZXH A;  3BTJ A;  3KYC B;  3I4P A;  1FP1 D;  5L3D A;  5B1A H;  2CH0 A;  1S72 I;  3OL3 A;  2QBY A;  1YJW I;  1VQ7 I;  1BC7 C;  2FX0 A;  2GA2 A;  9ANT A;  4RDU A;  4FQG A;  3K4B A;  4O6F A;  1F43 A;  2X4H A;  3ASN H;  1GT0 C;  3PO2 J;  2JUC A;  2RC4 A;  4ZDL A;  4FX4 A;  2YS9 A;  2XB5 A;  4I02 A;  3RPQ A;  5IYD J;  1OYY A;  3CQZ J;  2CQN A;  4WXD A;  1EH7 A;  3OSF A;  1W1W E;  2R7O A;  2A6T A;  3BJ6 A;  4A3L J;  2KIF A;  3M55 A;  5ARF A;  3AKZ A;  2JK3 A;  4YG2 F;  2EFO A;  2ISZ A;  4GYG A;  2BEO A;  3V8L A;  4XLF A;  2M45 A;  2CMP A;  2ELH A;  3ZQG A;  4CCL A;  5LLQ A;  4CXF A;  2UV1 A;  1ONV A;  1FIP A;  3GYH X;  2BY3 A;  1LVK A;  2MD5 A;  4KJZ A;  1T98 A;  1E17 A;  4M3F A;  3GWZ A;  2EIM H;  3L2R A;  5IOY A;  3NWT A;  2W82 A;  3A03 A;  4UVB A;  1LFU P;  5AYF A;  3BCA A;  2QEN A;  5E8I A;  3GTK J;  1JUM A;  3IC7 A;  1QZZ A;  1QGP A;  2DA5 A;  3PQJ A;  4M6V A;  4EJW A;  3DU5 A;  3IHX A;  1YW7 A;  5FKO A;  2OBP A;  1WHU A;  2V4J C;  2JN6 A;  3H3U A;  5L3G A;  5M5W J;  1A35 A;  4UB6 C;  5EGO B;  3PSF A;  2AQF A;  2OCC H;  4MGR A;  3AFH A;  2VJI A;  3OIP A;  1XMK A;  4OMZ A;  1K4T A;  4N0B A;  4XBF A;  1IW7 F;  4XLH A;  4A0Y A;  2OF7 A;  3BJO A;  3H0D A;  1BIA A;  4E7H A;  2CO5 A;  2BV6 A;  4LG3 A;  3ZN0 A;  3CC7 I;  1B59 A;  4M71 A;  2XAJ A;  4L0Z B;  2CGP A;  3BR6 A;  3WTV C;  1HKT A;  4ZC3 A;  2DA4 A;  1DPR A;  2RNJ A;  3QP5 A;  1R71 A;  2XKP A;  3I58 A;  3GTJ J;  1Q1H A;  3HYI A;  1KQ8 A;  4KA4 A;  3AL0 C;  2RDP A;  1BR2 A;  1V5E A;  1Z3Y A;  2RRE A;  1WJA A;  4BU2 A;  4C30 A;  4D5C A;  5HLG A;  2WWY A;  3QWW A;  2KZV A;  3PDN A;  1T6S A;  5IOZ A;  3OYH A;  5DCM A;  2O3F A;  1F1Z A;  1T8I A;  1ETX A;  3S3O A;  4HZF A;  2H8R A;  1KYZ A;  3K70 D;  4NDL A;  2KMU A;  1FC3 A;  4DJA A;  3PSI A;  3ECO A;  2VBY A;  2AS5 F;  2R5Y A;  1YW9 A;  1VQM I;  2X1D A;  1TT0 A;  3LSK A;  4Y15 A;  1R00 A;  3BR3 A;  4CZZ A;  1MDM B;  4J7F A;  3S7B A;  2E71 A;  1UHW A;  3RPU A;  1DPU A;  1Y1V J;  1FOX A;  2CSO A;  2QGU A;  2VJ5 A;  5CPR B;  3SFZ A;  3H5R A;  3OYM A;  1LPQ A;  2GOX B;  3M1E A;  1SMT A;  4L9J A;  2LD5 A;  1G3T A;  3PJR A;  3OL4 A;  3CCV I;  4Z2Y A;  2EPF A;  1QQI A;  2V9P A;  2HOT A;  4KNY A;  2Z99 A;  3K9T A;  1O7F A;  3BY6 A;  1P9Q C;  2EQR A;  2FD5 A;  1F5T A;  4HF0 A;  1WRJ A;  2ESH A;  3KLN A;  3H5A A;  4E6K G;  5CJ9 A;  3K4C A;  2QPW A;  4CIC A;  1ULY A;  2QF7 A;  3A4C A;  3R60 A;  2QA4 I;  1D5Y A;  4CYC A;  2FU4 A;  4BYY A;  1OCT C;  4ESF A;  2HI3 A;  1U8R A;  2ZO4 A;  4GO1 A;  1U2W A;  4YII A;  4IQJ A;  3HOX J;  3GUD A;  4R79 A;  1BW6 A;  3FXR A;  3H3Z A;  3G4S I;  3MD2 A;  4ENM A;  1WQ2 A;  5EG0 B;  1H0M A;  1YLF A;  4JOM A;  3V7C A;  1Z9C A;  1GVD A;  3LL7 A;  3TKY A;  3F22 A;  5EZH A;  1VQN I;  3GFM A;  2I8D A;  5K5Q A;  1BN5 A;  1XCB A;  5C4X J;  3QPL A;  5ICF A;  3FIW A;  1S9H A;  4II2 A;  2K9L A;  4RB3 C;  4O30 A;  3LSH A;  2HVR A;  1NTC A;  3R4K A;  1H9T A;  1IN8 A;  3P5J A;  2P5V A;  5EEG A;  2XRL A;  2W24 A;  2V6C A;  3DTI A;  3BTC A;  5GAD J;  1DUX C;  3HTS B;  4MI0 A;  5FRO A;  3CMA I;  1FBQ A;  4EGY A;  1ETW A;  4XOT A;  1TWC J;  3OR2 C;  3PIP F;  2RAE A;  2VOP A;  4G6Q A;  1I1G A;  1YS6 A;  1EKE A;  3MFK A;  1MBF A;  2CUZ A;  4HPQ A;  4LIT A;  2NVQ J;  3CO7 C;  3ROU A;  4NQW B;  3JRG A;  1IRZ A;  2DI3 A;  5F6F A;  3MCZ A;  4E70 A;  2XHK A;  3I53 A;  4M3G A;  4O3M A;  2WY8 Q;  3F8M A;  4D5F A;  2R7R A;  1JE8 A;  4NJ5 A;  1K6Y A;  1UHM A;  2EZI A;  3WU0 A;  3LQR A;  1UEL B;  2WTE A;  3K4N A;  4XLE A;  5TEG A;  4A2U A;  2M3A A;  2HQR A;  1MMN A;  2CWE A;  2DMN A;  2F5C A;  4XKC A;  2P5K A;  2DK8 A;  2DXI A;  1XX5 A;  1U5T A;  4CYD A;  2DPU A;  5J1R A;  2K4J A;  3QYB A;  4XLP F;  2CQQ A;  3B73 A;  3BWG A;  5LRR A;  2L4M A;  3GTP J;  3CCR I;  4XK4 A;  2M1B A;  3LSP A;  1B8I B;  3EUH A;  1ENH A;  2OCE A;  6PAX A;  4HNV A;  2E5Z A;  4GYI A;  4R8H A;  2Y2Z A;  3FWE A;  2BY2 A;  3IAM 2;  1WVR A;  2FNP A;  2M30 A;  5BQT A;  1W0T A;  3L2Q A;  1ZAR A;  1TNS A;  2EFP A;  3F3X A;  5D5V B;  2W1O A;  4CCK A;  3E1S A;  4NC8 A;  1IZ1 A;  3UR3 C;  3FMQ A;  2OV7 A;  1IN4 A;  3H92 A;  4QIW N;  3C2H A;  3O6B B;  4CCN A;  1RIO H;  2BY0 A;  4G6D A;  4HF2 A;  3F21 A;  1ZR2 A;  2HS5 A;  4J19 A;  2OPT A;  4Q4Z F;  3F6O A;  4QPQ A;  3TOB A;  4C3I J;  2EA4 A;  3FHZ A;  5D8K B;  1IAW A;  2JSP A;  1GUU A;  1MVH A;  3C2G A;  1X3W B;  2DFI A;  4NNJ A;  3ONQ A;  3J7Z I;  1JKO C;  2ID6 A;  1J09 A;  4M6X A;  4EMS A;  2HPM A;  1MBK A;  3BQY A;  2RKH A;  4XNF A;  4HLX A;  4YFX F;  3HOW J;  2DDA A;  2L5Q A;  3VOE A;  1OCO H;  1N25 A;  2XPU A;  3EPZ A;  2H09 A;  5CVI A;  4IJ8 A;  1N77 A;  3QYE A;  2LK2 A;  4IJA A;  4IHS A;  1MKM A;  3F8B A;  1J0R A;  3S93 A;  3HSE A;  4XRM A;  2E1N A;  3LWF A;  2P7C B;  1W4M A;  4OIP F;  1OCC H;  2FBI A;  3RPU D;  1XQH A;  1IRG A;  3CMM A;  4Z4P A;  1U0J A;  3CBM A;  1ETY A;  1D0Y A;  1UJ8 A;  2CQ7 A;  5D6F A;  4EV0 A;  3H0G J;  4G7H F;  3M54 A;  2XGE A;  3BR0 A;  1SAU A;  3IH3 A;  2VJ4 A;  1YJN I;  1K61 A;  3K70 C;  2L54 A;  3AG4 H;  2BW3 A;  3KP7 A;  4IHT A;  1O9S A;  5IP7 J;  3BZK A;  3Q0V A;  1AOY A;  2L7K A;  2MFZ A;  1N3J A;  2E35 A;  3DF8 A;  4PFO A;  4RM2 A;  5E1W A;  5HS8 A;  1GDT A;  3LFK A;  1VQ9 I;  1MBJ A;  2DDB A;  1VND A;  1JXS A;  1NK2 P;  3ZCO A;  4N4O B;  2O03 A;  1J9I A;  2A07 F;  2HNH A;  4KYW A;  3HOV J;  2E2I J;  1FBS A;  4J00 A;  3OYK A;  3K5K A;  5E18 F;  1KQ9 A;  3BG3 A;  1G4D A;  3HZJ A;  4L18 B;  3RZO J;  4II3 A;  3ASO H;  4G9Y A;  2ZCW A;  3DKX A;  4KMF A;  3MO2 A;  5DUK A;  4FCY A;  3V8J A;  5EJC A;  3MKZ A;  1YJ9 I;  1X58 A;  4C3H J;  2GIV A;  4F3Q A;  2IPQ X;  5ILV A;  2W4S A;  4HV6 A;  3EUK L;  1D0X A;  1OYW A;  3QOE A;  2IXS A;  3GBG A;  1A5J A;  2DA1 A;  4ANJ A;  2A68 F;  2KLO A;  3KP3 A;  2GBY A;  1T95 A;  2ZJP F;  2H6B A;  2XKO A;  5BPD A;  1XGM A;  2MC4 A;  3MZ8 A;  4A3D J;  1W7P D;  1P7J A;  4G12 A;  2ETH A;  5F1J A;  1JKP C;  1PUE E;  4B43 A;  2CV2 A;  2DJN A;  2V1U A;  4HNU A;  1KA8 A;  2PG4 A;  1ERD A;  3FXQ A;  5H6R A;  2ACJ A;  1XGN A;  2KHM A;  2MYS A;  4KN7 X;  3FXL A;  1HLV A;  2GXG A;  3HRM A;  4D1Q A;  4G8X A;  4BJ6 C;  3ABM H;  4AIH A;  3S17 J;  1X3U A;  3H9G A;  4NC7 A;  4B4C A;  3KMA A;  2KKO A;  1Y6I A;  4IX7 A;  1O4X A;  5M5X J;  1Z91 A;  2ZXI A;  3ESW B;  3CME I;  2DPD A;  4HOB A;  3CP8 A;  3PUB A;  3HOT A;  4B09 A;  2VPL A;  1BOA A;  4RAZ A;  3F23 A;  3MMY B;  4E4H A;  3U1D A;  5A2Q Z;  4HST A;  5JHF A;  1WPK A;  1ACI A;  4QEO A;  1USS A;  2DFH A;  1RZ4 A;  1IDY A;  5E20 A;  2A05 A;  4UHT A;  1JTY A;  2XAS A;  1P92 A;  2B0L A;  5LBQ A;  2WAF A;  2EFQ A;  4KIG A;  2D5V A;  3GTQ J;  5T0K A;  3TL4 X;  2P5L C;  3I54 A;  1PP7 U;  1KU9 A;  4B1R A;  1HSJ A;  5FLX K;  2NOJ B;  2LOO A;  3BO5 A;  2D2W A;  3DPT A;  1GXP A;  2DJI A;  2ECC A;  4U88 A;  3WTU C;  1CQT A;  3LSJ A;  4M74 A;  2PEX A;  1SVL A;  1R5H A;  2PMU A;  4N4N B;  4WCG A;  1PYV A;  2CRG A;  4NC6 A;  2VPR A;  4XON A;  3WTS C;  4ZYD A;  3FXM A;  2E1O A;  1S3J A;  4HV5 A;  1JKQ C;  2RQP A;  2VXD A;  4LD5 A;  4L9T A;  4S0H B;  1VTN C;  2IA0 A;  4CUG A;  1RNL A;  1QRY A;  4KIF A;  3CES A;  4BKX A;  3JR9 A;  4X6A J;  1XGS A;  1FPQ A;  1LDD A;  1TWA J;  2F2E A;  5HS9 A;  2VBW A;  5CLS A;  1LB2 A;  2LC2 A;  4XMY A;  3RQ4 A;  3L2C A;  4QTR A;  1EV7 A;  2E1C A;  3ZMT A;  3ZRG A;  1Z67 A;  2ELJ A;  2FF4 A;  3PUF A;  2IS4 A;  2F48 A;  5D6E A;  1R9T J;  2K86 A;  5H20 A;  2GOM A;  5ILU A;  3OOI A;  3P7N A;  4QPO A;  2BVL A;  2ZNY A;  2FOW A;  2FSW A;  2VBZ A;  2W85 A;  5D5X B;  4IOC F;  4KMU X;  2L2O A;  3GEZ A;  3S7F A;  5LGT A;  2XRO A;  3S15 J;  1SFO J;  3ECH A;  3N05 A;  2Y48 A;  4E7Z A;  1G6N A;  4HLY A;  3D5S C;  5ERI A;  1Y56 A;  1IXR C;  4XRS G;  4B3X A;  2M87 A;  1FSE A;  4EM1 A;  2UZK A;  5FKK A;  3HHH A;  4I2O A;  2HFH A;  2MD0 A;  3SDB A;  2ZBK A;  2QQA A;  2Q1Z B;  2Q0O A;  3HOY J;  4NBQ A;  1JHH A;  1H3I A;  1D1B A;  3HGY A;  1X4P A;  1PDN C;  4R1H A;  4KN4 X;  4A3E J;  1ZG3 A;  1SFK A;  2MSY A;  2R7Q A;  1DGW Y;  3RKW A;  4N9I A;  1OLT A;  1WJ5 A;  3CLO A;  3LQQ A;  2YR2 A;  3KMT A;  4AYB N;  4IOA F;  2BXZ A;  1KYW A;  4JX5 A;  5JJ0 A;  4QEN A;  1ETO A;  1KON A;  1YS7 A;  2R7D A;  1V5F A;  1ZGJ A;  3ZQF A;  2QQB A;  5M5Y J;  1UG0 A;  3QOD A;  4FHT A;  2WY7 Q;  4I0B A;  1HW2 A;  2YX7 A;  4OAZ A;  3UKG A;  2G7U A;  1Z6T A;  2BXY A;  4XKW A;  5K1Y A;  4B44 A;  2DU9 A;  2FOK A;  4A5N A;  1MDM A;  3FIS A;  3ZPL A;  4ZDP A;  5LEK A;  3JRE A;  3QU3 A;  2Y0S N;  4A12 A;  4DBR A;  1JUP A;  1H8A C;  3SFI A;  1XCV A;  4PK4 A;  4XSX F;  1X1P A;  3DQV C;  5LRS A;  4V2F A;  2V7F A;  3TDU C;  2HEO A;  1FMV A;  4LOC A;  4L9N A;  2WB1 N;  3PO3 J;  2AXT C;  5HDG A;  3SEZ A;  2G7H A;  4QEP A;  1N78 A;  3P9K A;  4I76 A;  3RCO A;  3SZG A;  4EM2 A;  4E7I A;  2KRH A;  3MAJ A;  2FBK A;  4LMY A;  1XSD A;  4I6Z A;  1SD5 A;  3CJN A;  2A69 F;  3EYY A;  3KPH A;  4HDU A;  1K79 A;  1Z3X A;  4LDG A;  2MH2 A;  1J59 A;  1P6R A;  2Y75 A;  3CCM I;  4ZYG A;  3QWP A;  2XC7 A;  5CVR A;  1QNT A;  4WX9 A;  3IRQ A;  1F9N A;  2JVG A;  5EG0 A;  4MI5 A;  3RIB A;  2AXL A;  2WA0 A;  5KJL A;  2R7U A;  3GTG J;  1PEG A;  4JX6 A;  2KQR A;  1MT6 A;  3D5R C;  4BQA A;  3N97 A;  1XDS A;  3HC7 A;  4RM3 A;  2VT2 A;  2TRT A;  5IY5 H;  2E36 A;  3B6C A;  3UNG C;  1HBX G;  2OU2 A;  5EEA A;  1XN7 A;  2YSR A;  2O61 A;  5ARG A;  3EP0 A;  2D1H A;  2XV4 S;  3LA3 A;  1KU7 A;  1U78 A;  3L00 A;  3BG5 A;  2W7N A;  1BL0 A;  1OCR H;  1Y0U A;  2L9R A;  4BJT A;  1U5T C;  5LSZ A;  2M0M A;  2HQN A;  1K6O A;  4L9V A;  5GP9 A;  5E3L A;  2UWM A;  4BEH A;  3HB9 A;  4JK1 X;  4C3J J;  1IG7 A;  4CA0 A;  3EUH C;  3K1P A;  2IGK A;  1XMX A;  4NQW A;  4XOR A;  4M3E A;  4PDK A;  2DAO A;  2Y69 H;  1NG6 A;  1YYV A;  4D0P A;  5TJJ A;  3QAH A;  3HPG A;  2L9V A;  1A6Q A;  5D4S A;  1VQ4 I;  2HKO A;  4L5E A;  3IKT A;  4BBS J;  5DCF A;  3PNT A;  2HXO A;  1BI1 A;  5TRD A;  3FMS A;  2ZC2 A;  2RQQ A;  2Y0M A;  2R4G A;  4A3K J;  3OYF A;  2M5W A;  3BZC A;  5L3F A;  5J47 A;  4M9Z A;  3TW6 A;  1KU2 A;  1SAN A;  1QPM A;  3S2W A;  3CCJ I;  1B8I A;  1EJ9 A;  3IKV A;  5FGM A;  1M1E B;  4A3B J;  2A5W A;  2KIM A;  1G59 A;  2L3D A;  2VOO A;  2NYX A;  4HYE A;  1P7I A;  1VF9 A;  3VDX A;  1YO5 C;  1VQ5 I;  2R3S A;  2HGC A;  3A0H C;  5IYB J;  2VB6 A;  4MQV A;  1RKW A;  3ZMU A;  4DZJ A;  1IV6 A;  2HOE A;  2KRF A;  3HDD A;  1RES A;  1HKQ A;  1D0Z A;  1GV2 A;  3W6K B;  3U9G A;  4A6D A;  4RAG A;  1RUN A;  1A04 A;  5TH7 A;  2JSC A;  2QWW A;  2R93 J;  2RN7 A;  1D8K A;  4PJ0 C;  4EQQ A;  2JA8 J;  2XPW A;  1UFM A;  3OYG A;  1BW5 A;  3LA2 A;  5KHD A;  4F55 A;  1GHC A;  3KZZ A;  3N71 A;  1FY7 A;  4AID A;  1MSE C;  2DN0 A;  5HVQ C;  1JJ8 C;  4MTE A;  4P96 A;  2DK5 A;  3GF2 A;  1UB9 A;  3S2H J;  5GPC A;  4WWC A;  1VI0 A;  1PUF B;  1ML9 A;  2PJR B;  1V5G A;  1MBE A;  3MKW B;  1Z21 A;  1WFX A;  3W2A A;  4FE7 A;  1ZTR A;  4C9Y A;  5IT9 Z;  3E6D A;  1OIS A;  2AHQ A;  3RU0 A;  5KCM A;  3GZ6 A;  1IV8 A;  5D4R A;  3M3Y J;  5HLI A;  4B47 A;  1EH8 A;  2G46 A;  3F72 A;  1AA7 A;  4DYQ A;  3QP6 A;  5D5W B;  4UUV A;  2A6E F;  3M4O J;  2LF8 A;  1T0F A;  3WU2 C;  3CTA A;  1XC5 A;  2KT0 A;  4D9J A;  3NAU A;  5F0H A;  5EG2 A;  1G3Y A;  2V1X A;  4KIT B;  4LK1 F;  3S3M A;  2V1D A;  1FYL A;  1D3Y A;  5K5O A;  4QWQ A;  1QHH D;  3OPE A;  2ADU A;  1X4O A;  3PL8 A;  5C3E J;  2XAH A;  1T56 A;  3RQI A;  4AC0 A;  1LFP A;  3OOU A;  2R0Q C;  4RAF A;  5FD6 A;  1LNW A;  3GXO A;  3ML6 A;  2VL8 A;  3F9Y A;  2HXI A;  2RFI A;  3WG7 H;  4BE2 A;  2E1M C;  2P81 A;  4Y4R A;  2CV0 A;  4S04 A;  1IN6 A;  5F08 A;  3OS5 A;  4D7M A;  4FMU A;  3OS2 A;  4EJT A;  2XAF A;  3COA C;  5FLM J;  1R4M B;  3VUZ A;  2M7A A;  1OR7 C;  2GXB A;  1V54 H;  3JRF A;  2J5P A;  1CF7 B;  3M8J A;  3WTZ A;  2R7W A;  3SDG A;  2OTJ I;  1ZR4 A;  4A5M A;  1SVO A;  4H0E A;  2LH9 A;  2P6T A;  2X85 A;  2A6H F;  3KET A;  2R7X A;  3AG1 H;  2ISY A;  2Z1D A;  1AU7 A;  2FXA A;  3DEE A;  4C1Q A;  3HUG A;  2A3S A;  2F6C A;  4WUY A;  4IXA A;  2DOE A;  3IV5 A;  5ED4 A;  3A01 B;  2K3P A;  3IH4 A;  2ELK A;  4C2T A;  3PQK A;  3U21 A;  3MEX A;  3JAM K;  3REO A;  1BIB A;  5DD4 A;  3TO9 A;  1BA5 A;  4MEY F;  1IRF A;  3GTL J;  1ZRC A;  1MJA A;  4ABZ A;  2O8K A;  5J40 A;  3E6M A;  4A3F J;  2EFW A;  3HL2 A;  1S5L C;  1IUF A;  3IWF A;  1S29 A;  5HOO A;  2R92 J;  3LFU A;  1IRX A;  2BOL A;  1RRJ A;  1APL C;  2RNG A;  1I50 J;  2DMP A;  3D0S A;  4HBL A;  2BY1 A;  5JHN A;  3X2Q H;  3ERE D;  4LB6 B;  2JJ7 A;  4UV9 A;  3PFY A;  2GXA A;  5CKT A;  2LDU A;  3M58 A;  3IP4 B;  3S7J A;  2F69 A;  1WH7 A;  5CVV A;  1ODD A;  2WAE A;  2ME6 A;  1ZAO A;  1O3Q A;  2HU9 A;  1YE9 A;  2VJJ A;  3J7A O;  3BPV A;  1GVJ A;  1A31 A;  4XKV A;  2LRD A;  3CF2 A;  1E3O C;  2IA2 A;  5F59 A;  4GRI A;  1G3W A;  1MNM C;  2CFO A;  3BTI A;  1J7K A;  2LLK A;  3HJE A;  2K3F A;  3VFZ A;  2L9N A;  2Q8K A;  3FPD A;  2W48 A;  5HNF A;  3FM3 A;  2Y30 A;  3W2W A;  2VKE A;  1BOB A;  3JRI A;  3BG9 A;  4A0Z A;  1GV5 A;  1OCZ H;  2VE8 A;  2K9Q A;  2OZ6 A;  2LNB A;  4BEH B;  2VAS A;  2C6Y A;  2X6W A;  3HKZ N;  4RGS A;  3S2D J;  1J5Y A;  4BDY A;  3OIQ A;  5GTH C;  3CCY A;  3JAM Z;  2EA2 A;  3BR2 A;  2BGC A;  2NNY A;  2I10 A;  1IXC A;  4IHW A;  4YIF A;  5B5E C;  4I51 A;  4GCV A;  1XDU A;  2OTL I;  3FX3 A;  2LMD A;  3TW7 A;  1R36 A;  3TED A;  1IF1 A;  1IN5 A;  2P6S A;  4DQ2 A;  4NB5 A;  1WJD A;  2BHZ A;  2E60 A;  3K2Z A;  2MAB A;  3HRS A;  1RC9 A;  2DBB A;  2JPC A;  3KP6 A;  3Q0U A;  4KFC A;  2KIS A;  3RKX A;  2NXN B;  2LG4 A;  4CSW A;  1HOM A;  2BE5 F;  3GW2 A;  2D45 A;  2VKH A;  1ZG5 A;  2F5E A;  3DEW A;  4GGG A;  1QZY A;  3BG6 A;  3M59 A;  3MEK A;  1C0W A;  3TMO A;  3LSR A;  4FE4 A;  3OXG A;  3CF5 F;  5HLH A;  3CP2 A;  4BGD A;  3A2K A;  4NUB A;  3BZ6 A;  2COM A;  3RYR A;  2EH3 A;  2UUZ A;  1JJ6 C;  2M4G A;  3OWT A;  4CGZ A;  2PMZ N;  3QPS A;  4AIJ A;  1R1U A;  2L7F P;  3K1N A;  3OYA A;  2L02 A;  2ICW G;  4L5I A;  2YPR A;  3R0J A;  4OIN F;  1YOV B;  2VC1 A;  5KAF C;  3D5L A;  2DA2 A;  1T33 A;  3ISP A;  2FNA A;  5GTI C;  4P5O A;  2BQZ A;  4BXX J;  2XF7 A;  4FET A;  3HTU A;  5EDN A;  1RPW A;  3TGN A;  3HOZ J;  1HC8 A;  1OJL A;  3QPT A;  3L2V A;  1YX5 A;  1SEU A;  4V19 K;  3WGG A;  4ON0 A;  1LEA A;  4RB0 A;  4XN0 A;  4OAY A;  2MA3 A;  2M4K A;  2VQC A;  3AG2 H;  3ZP5 A;  3W6V A;  1QVT A;  2MC3 A;  4AIK A;  2JA6 J;  3H1C A;  1FT9 A;  2DFE A;  2WAD A;  5LFA A;  4HX8 A;  5E3O A;  2EZH A;  4AVP A;  3LMM A;  4RLF A;  3LSG A;  2IS2 A;  3FXJ A;  3BQZ A;  4AD9 A;  3HEF A;  1YFH A;  2CU7 A;  3RTR A;  1XTA A;  5DV5 A;  3S1Q J;  2JQ7 A;  3BR1 A;  3G2B A;  3CUQ B;  3I59 B;  3OYI A;  2HR3 A;  3HGG A;  1LEB A;  2EJR A;  1X1B A;  1QU3 A;  3PNY A;  2GIZ A;  1UZC A;  3M5A A;  1MVX A;  3M1C A;  5H6Q A;  1WI9 A;  4WF2 A;  4EJO A;  3OYN A;  2JA7 J;  4DGW B;  5A2Q K;  4BL0 B;  4CHU A;  1IC8 A;  4XLN F;  4CCJ A;  2ZSH B;  3I64 A;  4ZZD A;  2NVX J;  3C7J A;  3LNQ A;  4BH9 A;  3JRA A;  3G1M A;  3HHG A;  5DEQ A;  4JLG A;  1JT0 A;  3WHB A;  4KUM A;  1E3H A;  3DTK A;  3BT9 A;  5J3L A;  1ZRF A;  5K7Z A;  5ILS A;  3D1N I;  3F8F A;  3VV0 A;  2NNN A;  1LVA A;  2PI0 A;  1ZGW A;  3TOA A;  4ZYA A;  3HOU J;  1DGR M;  3HUG B;  2NVT J;  1XG1 A;  2FUG 2;  4G7O F;  2LKX A;  1HDP A;  1N6A A;  1O3T A;  3IHU A;  1XSX A;  1Z1D A;  3M8E A;  3DTE A;  2M2E A;  1NG7 A;  1JHF A;  4XM3 A;  4PUS A;  4HRI A;  3KP5 A;  2IGM A;  2D1V A;  3CC4 I;  1E0E A;  1U9O A;  3DLL F;  4AVZ A;  3EYI A;  2H6C A;  4KIB A;  5BNG A;  1FBU A;  5L3B A;  4EGZ A;  1SFU A;  1ZN2 A;  2F4M B;  4U0W A;  4CDG A;  5GAE J;  2OQG A;  2VIX A;  4X0G A;  3QWV A;  2KFD A;  2BZT A;  4HX4 A;  5CYV A;  4A3M J;  5TTF A;  1FSH A;  1Y8R B;  2IJL A;  3QOP A;  3E97 A;  2QM3 A;  2H94 A;  4E7L A;  2O8J A;  2KP6 A;  4FT8 A;  4DW6 A;  3G71 I;  2M9H A;  2CUJ A;  2R7S A;  4UV8 A;  5EX3 A;  5JHU A;  2L9S A;  2HZT A;  3DWL E;  2EV5 A;  4JYK A;  4IEJ A;  3CDH A;  3J7Y J;  1P2F A;  5IT3 A;  3G73 A;  4J8O A;  3RJW A;  2MLK A;  3KLO A;  3OY9 A;  1TQP A;  3ZQI A;  3AAF A;  4X1E A;  2Q2E B;  2LKS A;  1ZLK A;  2XUB A;  5C44 J;  4IKF A;  3RSN A;  1VZ0 A;  4PCQ A;  2K02 A;  2B7E A;  3OS1 A;  4BJ5 C;  3GCM A;  1QPI A;  1ZRE A;  1I6X A;  1MNE A;  4LGW A;  1E2X A;  4HEA 2;  3SZT A;  4A6E A;  3OYE A;  3FBI B;  5HOD A;  4KDP A;  2X0L A;  4F91 B;  2WV0 A;  1HQC A;  2M8E A;  3FBN B;  2X9D A;  2DT6 A;  3S8P A;  3RYP A;  2FEZ A;  2OD5 A;  2EK5 A;  5H2F C;  1B4A A;  1ETV A;  2M34 A;  3ABK H;  4RGR A;  5CVJ A;  5HQ8 A;  4HQE A;  3EQL F;  3TP0 A;  5D5U B;  3JSP A;  2W5Y A;  2K9S A;  4D7N A;  3LAJ A;  4OIO F;  3IH2 A;  4WXH A;  5FLV A;  1W7P B;  4CCM A;  4PJN A;  4OIQ F;  2DT7 B;  2ID3 A;  2F4I A;  1SMY F;  2JMW A;  2ZME B;  3PNV A;  2JRT A;  1LUJ B;  2XGD A;  3JW4 A;  1B9M A;  1B1B A;  2TDX A;  3QQA A;  5LSX A;  1XSV A;  4IRI A;  2HZD A;  3C3W A;  2R7Z J;  3CBP A;  3GLX A;  4K2E A;  3RZD J;  4HDV A;  2BYV E;  3DBH B;  5JFR A;  3RIR A;  4MFD A;  3MZH A;  3FZV A;  4PFP A;  1IGN A;  1LKX A;  2EBI A;  4E7K A;  2VT3 A;  3O2P E;  2IVM A;  3U2R A;  1I3A A;  1T0F C;  3T8R A;  3RI4 A;  1YIT I;  3ZMV A;  1Z0X A;  2KRC A;  5FKN A;  4BAY A;  2LVS A;  1Y1W J;  3GTM J;  3OYL A;  1A6I A;  5AIQ A;  1PUF A;  2PJR A;  3KIO A;  1RR7 A;  2ZXJ A;  3C18 A;  3F8C A;  3CJQ B;  2QQ8 A;  3EUA A;  4DZP A;  1TTY A;  1N75 A;  2EIK H;  2P4W A;  4AYB A;  3AG3 H;  1WJC A;  5LEJ A;  3J80 K;  3WTX C;  3GFI A;  4UB8 C;  3S32 A;  1ZEL A;  2Z3Y A;  2EV0 A;  2FBH A;  5K5R A;  1J2X A;  2DA3 A;  2R5Z A;  4BAC A;  4DIQ A;  2LF7 A;  4ZYE A;  1S8N A;  3ABL H;  3OYB A;  1H9G A;  2OUM A;  2LR8 A;  3I9V 2;  3K0L A;  5F6K C;  1TW3 A;  2BHY A;  5KAI C;  3DU6 A;  1FIA A;  2CQK A;  2UXN A;  4EAT A;  4IHY A;  1V55 H;  3DV8 A;  2FE3 A;  3T5X A;  3ZR8 X;  1VQO I;  1ZLJ A;  1Y8Q B;  4I0A A;  1UHS A;  2OQR A;  2RVC A;  2EIJ H;  2O0Y A;  3R61 A;  3VOD A;  4IHX A;  4BQO A;  3BTL A;  1WGX A;  2DW4 A;  2P8T A;  2Y0S A;  3LSI A;  4UUS B;  2YX4 A;  4O5V A;  3DAL A;  3K6G A;  4XN3 A;  2VON A;  1S7A A;  5CQG A;  3CMY A;  1D8J A;  3QU6 A;  4CCO A;  4YEL A;  4YPU A;  4ASN A;  1K78 B;  4BHC A;  2WB1 A;  2FML A;  4RGU A;  5K7F A;  4LIV A;  2OC6 A;  1UG2 A;  2E2J J;  1LDK B;  5ICG A;  2CQX A;  1CF7 A;  1ORK A;  3FDY A;  1IN7 A;  3BC8 A;  5F04 A;  4RLQ A;  4XRF A;  4M73 A;  5CVU A;  3V4G A;  3TP3 A;  3OXF A;  2XIG A;  4OU0 A;  3JRD A;  1BC8 C;  2XVC A;  2STW A;  2GQQ A;  4O6J A;  4FTH A;  2GM4 A;  3CC2 I;  3A01 A;  5EZG A;  2DOD A;  4A93 J;  3BR5 A;  3DKW A;  1DDN A;  2MG4 A;  4M9X A;  1U8B A;  5FFX A;  3CDI A;  4S05 A;  2L7M P;  3JTG A;  4BDZ A;  4FAS D;  3J80 Z;  3P9I A;  4QLC U;  4A69 C;  2L7Z A;  3FKJ A;  3S1R J;  2LY1 A;  2H8W A;  3E6C C;  2VQL A;  2X1C A;  4RA2 A;  5DM6 F;  2W00 A;  4M3B A;  4RAY A;  1HW1 A;  5E3M A;  1FMW A;  4J83 A;  4Y17 A;  2O6G E;  1JTX A;  4Y7N J;  2WAQ N;  1TWH J;  4YND A;  3IL2 A;  1QBJ A;  1BBY A;  1AKH B;  1MZB A;  1MD0 A;  3DPU A;  2HDD A;  4XRS A;  2QQ9 A;  1FWZ A;  3BDD A;  3OYD A;  1I3Q J;  1X1A A;  2FMY A;  2XF5 A;  3Q5F A;  3CO6 C;  1KQ0 A;  2MGQ A;  1GXQ A;  1WWX A;  4E7S A;  1Z77 A;  1ZK8 A;  3Q9V A;  5M3M J;  5LD2 C;  3CD6 I;  1RR8 C;  1OMI A;  3T8T A;  4RBO A;  1D1C A;  5BOX A;  1O57 A;  1OKR A;  3M07 A;  1BM9 A;  1E3P A;  3CJR B;  2RGV A;  1K83 J;  1KU3 A;  2X6O A;  1FX7 A;  3Q3S A;  4AM3 A;  3AL0 B;  4YFK F;  1LFB A;  4XIC A;  3HXL A;  3WTT C;  2BBY A;  4XLA A;  3L1P A;  2VE9 A;  3H9J A;  4IQ4 A;  1MMS A;  5AON A;  2VKV A;  1MMA A;  3GZN B;  5EX0 A;  3JCU C;  1T38 A;  1OPC A;  2IS1 A;  5B66 C;  2QCO A; 
#chains in the Genus database with same CATH homology
 2IGN A;  4IJ8 A;  5KJM A;  3OR1 C;  4XQF A;  2K3P A;  1N77 A;  3QYE A;  4C2T A;  3U21 A;  1MMD A;  2LYC A;  3L2U A;  3S93 A;  4IJD A;  3CBO A;  2HVQ A;  4HSR A;  5KJN A;  4XOP A;  3RPU D;  3HL2 A;  1XQH A;  1EA3 A;  3CMM A;  4Z4P A;  1U0J A;  4E7J A;  3CBM A;  4YRV A;  5HOO A;  1D0Y A;  1IRX A;  2BOL A;  3LFU A;  3M54 A;  2E5N A;  2RNG A;  1SAU A;  4BXF A;  3HPH A;  3OYC A;  2VJ4 A;  3KMJ A;  2HDW A;  3K70 C;  5JHN A;  5JIN A;  2BW3 A;  1O9S A;  2VXZ A;  3J7A Y;  2L7K A;  2MFZ A;  1N3J A;  3PFY A;  4PFO A;  5CKT A;  2P0W A;  4RM2 A;  3IP4 B;  3M58 A;  3S7J A;  2F69 A;  2R7T A;  1YX3 A;  2WAE A;  3BCB A;  2WBM A;  2HU9 A;  3ZCO A;  4N4O B;  1YE9 A;  2VJJ A;  2JV0 A;  2HNH A;  4XKV A;  3W2V A;  4YNM A;  2LRD A;  3CF2 A;  4J00 A;  3OYK A;  5F59 A;  4GRI A;  4BE0 A;  2CFO A;  3K5K A;  2CS3 A;  3W3C A;  2L9N A;  4KIS A;  3LSM A;  4II3 A;  3HG9 A;  4DBQ A;  5T5G A;  3DKX A;  3FPD A;  3MO2 A;  2LBF A;  5HNF A;  3W2W A;  1BOB A;  3MKZ A;  1N6C A;  4JQF A;  4ZTJ A;  4MLO A;  1D1A A;  4F3Q A;  4JDS A;  2W4S A;  2VAS A;  4BEH B;  3EUK L;  2X6W A;  3DB5 A;  1D0X A;  4J7I A;  3QOE A;  2QKM B;  2IXS A;  4BDY A;  3GBG A;  4ANJ A;  2KLO A;  2WAQ A;  3OIQ A;  1T95 A;  4BUP A;  4H4K C;  4F92 B;  2MC4 A;  4RMN A;  3OXL A;  4BS9 A;  2BVM A;  4B43 A;  4Y3O A;  2CV2 A;  1QHG A;  3FHN A;  4HNU A;  1ERD A;  4I51 A;  3VSL A;  2VQG A;  2KHM A;  1DP3 A;  2MYS A;  4D1Q A;  5HI7 A;  4BJ6 C;  1R6R A;  4PJM A;  3H5N A;  1G8X A;  2ZSI B;  2F5V A;  1WJD A;  3M56 A;  2BW3 B;  5F5E A;  3F9K A;  5FRM A;  2E60 A;  2LRE A;  3H9G A;  2MAB A;  4NC7 A;  4CZC A;  5CCL A;  3KMA A;  1Y6I A;  3VYT B;  2LG4 A;  4CSW A;  4IX7 A;  2ZXI A;  2JA2 A;  3CP8 A;  2VKH A;  3PUB A;  3HOT A;  2VPL A;  3BG6 A;  3M59 A;  3MEK A;  2V1N A;  3TMO A;  2R3A A;  3MMY B;  4E4H A;  2K9M A;  3TBI A;  3OXG A;  4HST A;  5JHF A;  3CP2 A;  4YNP A;  2XAU A;  4F93 B;  4BGD A;  2DOA A;  2X6X A;  4QEO A;  3A2K A;  4NUB A;  4BQQ A;  2W5Z A;  3S7D A;  3E0J B;  2UUZ A;  2JVH A;  2LBF B;  2M4G A;  2VKD A;  2WAF A;  3OWT A;  1W36 C;  5T0K A;  3TL4 X;  3ZGK A;  3DPL C;  3OYA A;  4ITV A;  2NOJ B;  2LOO A;  3BO5 A;  3DPT A;  2DJI A;  3D5L A;  4HNT A;  2BQZ A;  4P5O A;  1MW7 A;  4XL9 A;  2M7B A;  2E1M B;  4N4N B;  1PJR A;  3VYS B;  2XF7 A;  4FET A;  1PYV A;  4YEJ A;  3SYT A;  3OYJ A;  2CW7 A;  1WJE A;  4XON A;  3SEQ A;  5HLT A;  2QKL B;  3L2V A;  1YX5 A;  2VXD A;  4P1W A;  3OS0 A;  5HNH A;  4XN0 A;  4OAY A;  2M4K A;  2VQC A;  3HOS A;  4CUG A;  2LY2 A;  3BLY A;  3CES A;  5LFA A;  2WAD A;  3M57 A;  5CCM A;  4LIU A;  3LMM A;  2LC2 A;  4XMY A;  4RLF A;  3RQ4 A;  2KDO A;  3LSG A;  3TG5 A;  2IS2 A;  3ZRG A;  2ELJ A;  2IS4 A;  1X1D A;  4ZDO A;  3DLA A;  3RTR A;  4ZTF A;  2IS6 A;  2GOM A;  3DKY A;  2JUG A;  3OOI A;  3MO0 A;  3G2B A;  3H35 A;  2BVL A;  4QPO A;  3OYI A;  1GLN A;  2VLA A;  2L2O A;  1X1B A;  3HKZ A;  3S7F A;  1QU3 A;  3PNY A;  4NVQ A;  3M5A A;  2ZXH A;  3ZXS A;  3N05 A;  1MVX A;  3M1C A;  5KJK A;  4E7Z A;  2CH0 A;  3OL3 A;  3OYN A;  4DGW B;  4BL0 B;  3D5S C;  1Y56 A;  2ZSH B;  4CCJ A;  3OMY A;  4B3X A;  3SW9 A;  4JLG A;  3K4B A;  4O6F A;  3DTK A;  2O5R A;  3VYR B;  3SWC A;  2MD0 A;  3SDB A;  4J01 A;  4ZDL A;  2Q1Z B;  3VV0 A;  1BR4 A;  1H3I A;  1D1B A;  4ZYA A;  1DGR M;  1X4P A;  3HUG B;  2FUG 2;  2Z2S B;  1X19 A;  4IZZ A;  3RAY A;  1N6A A;  2R7O A;  1SFK A;  2A6T A;  3K4M A;  3F9Z A;  3M55 A;  5ARF A;  3AKZ A;  2R7Q A;  1DGW Y;  1OLT A;  3DTE A;  1NG7 A;  1WJ5 A;  4XLF A;  3KMT A;  4XM3 A;  2CMP A;  3F9X A;  4PUS A;  4CCL A;  4HRI A;  5JJ0 A;  1UAA A;  2UV1 A;  2IGM A;  4QEN A;  1KON A;  1E0E A;  2IS1 A;  1V5F A;  1LVK A;  4AVZ A;  4KJZ A;  1UG0 A;  3QOD A;  2WY7 Q;  3L2R A;  3NWT A;  4DOZ A;  2W82 A;  2HVS A;  4OAZ A;  5AYF A;  2VIX A;  3BCA A;  4XKW A;  4X0G A;  3QWV A;  2V26 A;  4B44 A;  2PMZ A;  3DU5 A;  4U87 A;  3IHX A;  1MND A;  2XF6 A;  2CV1 A;  2X6Y A;  1TZL A;  5TTF A;  2V4J C;  4ZDP A;  3ZQQ A;  4E7L A;  1JI8 A;  2O8J A;  2KP6 A;  3PSF A;  2AQF A;  2CUJ A;  2R7S A;  5EX3 A;  4DBR A;  2L9S A;  4PK4 A;  3AFH A;  2VJI A;  3DQV C;  3DWL E;  3OIP A;  2DCE A;  2V7F A;  2R7V A;  1FMV A;  4J8O A;  3RJW A;  4XLH A;  1DQU A;  4PSW A;  3OY9 A;  3H0D A;  1MMG A;  3SEZ A;  2IGQ A;  4E7H A;  2Q2E B;  4QEP A;  4IKF A;  4LG3 A;  1N78 A;  3RSN A;  1VZ0 A;  3RCO A;  3SZG A;  3OS1 A;  4BJ5 C;  4E7I A;  4H12 A;  1MNE A;  2KRH A;  4HEA 2;  2KPM A;  3OYE A;  3FBI B;  4ZC3 A;  4G6T B;  3HNA A;  4F91 B;  4E47 A;  1Z3X A;  4LDG A;  3KX2 A;  3FBN B;  4XKB A;  2DT6 A;  3S8P A;  3AL0 C;  1BR2 A;  1V5E A;  1Z3Y A;  3QWP A;  2RRE A;  2XC7 A;  1WJA A;  4BU2 A;  2JVG A;  4C30 A;  3QWW A;  4MI5 A;  5HQ8 A;  2KZV A;  3PDN A;  3RIB A;  3OYH A;  3L2W A;  2W5Y A;  2WA0 A;  5KJL A;  2R7U A;  3F9W A;  1PEG A;  2KQR A;  4CCM A;  4PJN A;  3S3O A;  3D5R C;  2DT7 B;  1MT6 A;  2F4I A;  3K70 D;  3HC7 A;  4RM3 A;  2ZFU A;  2KMU A;  3PNV A;  3UNG C;  4DJA A;  3PSI A;  5LSX A;  3VSK A;  5KNL A;  1WJB A;  2HZD A;  3CBP A;  5ARG A;  3EP0 A;  2X1D A;  2VQH A;  1TT0 A;  3LSK A;  4XLC A;  2W7N A;  4J7F A;  3S7B A;  3TG4 A;  4PFP A;  1LKX A;  4BJT A;  5LSZ A;  4E7K A;  1X1C A;  2M0M A;  2VJ5 A;  5CPR B;  3H5R A;  3OYM A;  2UWM A;  1T0F C;  4BEH A;  3NWS A;  4CA0 A;  2GOX B;  5FRN A;  1WJF A;  3EUH C;  2IGK A;  2KRC A;  3PJR A;  2V6E A;  3OL4 A;  4XOR A;  3IAS 2;  3K4K A;  4ZJZ A;  3OYL A;  1NG6 A;  3CZ6 A;  4RZ0 A;  2PJR A;  3HPG A;  3MO5 A;  5F6L A;  1P9Q C;  3CJQ B;  3K4J A;  3H9Q A;  3EUA A;  1N75 A;  4AYB A;  4E6K G;  4BE1 A;  2XDV A;  3H5A A;  1WJC A;  3K4C A;  2QPW A;  3PNT A;  3A4C A;  3S32 A;  1ZEL A;  2RQQ A;  2R4G A;  3M53 A;  4BAC A;  4DIQ A;  3OYF A;  4IQJ A;  3OYB A;  4R79 A;  3I9V 2;  2OUM A;  1MUF A;  5F6K C;  3BG7 A;  3MD2 A;  3DU6 A;  4CH7 A;  4PJJ A;  3K10 A;  4JOM A;  4EAT A;  3ZR8 X;  2A5W A;  1G59 A;  3LL7 A;  2I8D A;  3VDX A;  4OWR B;  4II2 A;  1S9H A;  2K5C A;  2K9L A;  4BQO A;  4O30 A;  3LSI A;  2Y0S A;  2VB6 A;  3LSH A;  2HVR A;  3DAL A;  3K6G A;  4XN3 A;  2IGO A;  5CQG A;  4F52 A;  2CW8 A;  1D0Z A;  4CCO A;  3KYL A;  4YEL A;  4YPU A;  3DTI A;  5TH7 A;  2WB1 A;  4MI0 A;  5FRO A;  4XOT A;  3OR2 C;  4LIV A;  2OC6 A;  1LDK B;  3OYG A;  3S3N A;  5KHD A;  1ZKK A;  4F55 A;  3FDY A;  3A1Y A;  3BC8 A;  1Z7L A;  2CUZ A;  3KEY A;  4HPQ A;  4LIT A;  3N71 A;  5HVQ C;  5T0M A;  4RLQ A;  3OXF A;  4NQW B;  5TGT A;  5JIY A;  3MKY B;  1W36 D;  3V42 A;  1ML9 A;  2WY8 Q;  2PJR B;  1V5G A;  3MKW B;  2R7R A;  1Z21 A;  1WFX A;  3W2A A;  4NJ5 A;  1K6Y A;  3I3L A;  4C9Y A;  1HA8 A;  1UEL B;  2HQA A;  2KL4 A;  4XLE A;  3K4N A;  5TEG A;  5KCM A;  3RU0 A;  2M3A A;  4BDZ A;  4PSX A;  1MMN A;  4FAS D;  4XKC A;  4B47 A;  2DXI A;  3FKJ A;  2G46 A;  2LY1 A;  1AA7 A;  3QYF A;  2VQL A;  4XR6 A;  3QYB A;  2X1C A;  2W00 A;  5CQE A;  2XSJ C;  4D9J A;  2AQE A;  4U7B A;  1FMW A;  4J83 A;  5EG2 A;  4KIT B;  3S3M A;  4YND A;  2X51 A;  2E5Z A;  2V9K A;  3IAM 2;  1QHH D;  3OPE A;  1X4O A;  3DPU A;  3PL8 A;  4BQN A;  4C2U A;  1LFP A;  3OOU A;  3OYD A;  3L2Q A;  3K4L A;  1X1A A;  2XF5 A;  4PJL A;  3F9Y A;  2VL8 A;  4Y33 A;  3VYU B;  2W1O A;  4CCK A;  4E7S A;  3E1S A;  2RFI A;  4YPA A;  5LD2 C;  3IUO A;  4NC8 A;  3UR3 C;  4BE2 A;  2E1M C;  2OV7 A;  4HG2 A;  1D1C A;  4Y4R A;  2CV0 A;  3C2H A;  3OS5 A;  3CJR B;  4FMU A;  3OS2 A;  4B48 A;  4CCN A;  4KT6 A;  2Z16 A;  3AL0 B;  3VUZ A;  2M7A A;  1OR7 C;  4QPQ A;  4YPE A;  3HXL A;  4AU7 A;  3M8J A;  2R7W A;  2JSP A;  1MVH A;  4XLA A;  3C2G A;  4NNJ A;  3ONQ A;  3VWB A;  2LH9 A;  3H9J A;  4IQ4 A;  2X85 A;  1BR1 A;  1J09 A;  2R7X A;  1MMA A;  2HPM A;  2Z1D A;  4C1Q A;  2X1E A;  3DEE A;  5EX0 A;  2HPI A;  4XNF A;  2F6C A;  2L5Q A;  4WUY A;  3EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...