4BUPA

A novel route to product specificity in the suv4-20 family of histone h4k20 methyltransferases
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
232
Chain Sequence
GSHMSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1
total genus 73
structure length 232
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bupA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4bupA02
4YPUA 3RJWA 2F69A 4NJ5A 1O9SA 3M53A 2W5YA 4QEOA 3OXLA 4MI0A 1N3JA 5KJKA 4H12A 3S8PA 4QEPA 5CPRB 3HNAA 4E47A 4FMUA 4J7IA 3KMJA 3QWWA 3M55A 3CBPA 3M58A 5F59A 4BUPA 5LSXA 3OXGA 1ZKKA 3S7FA 5T0KA 4C1QA 5CCLA 1PEGA 3F9WA 3SW9A 5AYFA 5JINA 3F9ZA 1N6AA 3TG5A 3KMTA 3RAYA 4YNDA 3BO5A 3VV0A 4NVQA 4JDSA 1MVXA 3DALA 3M57A 2BQZA 3CBOA 3PDNA 4O6FA 4YNPA 3F9YA 3DB5A 3MEKA 2O8JA 3SWCA 5EX3A 1H3IA 3M5AA 3N71A 3K5KA 5EX0A 1XQHA 2G46A 4YNMA 2W5ZA 3S7DA 5ARFA 4I51A 5JIYA 5F6LA 4J83A 3MO0A 3OOIA 3CBMA 5F5EA 3S7BA 5CCMA 3OS5A 3MO2A 3IHXA 3RQ4A 5HQ8A 2JV0A 3FPDA 3QWVA 1ML9A 5EG2A 1N6CA 3S7JA 5JHNA 1MVHA 4RZ0A 5F6KC 5TTFA 4O30A 4QENA 5KJMA 3RIBA 3TG4A 2RFIA 3KMAA 5ARGA 5LSZA 3OXFA 4IJ8A 4WUYA 3EP0A 3M56A 2R3AA 4YPEA 4J7FA 4AU7A 5HI7A 3M59A 5TH7A 4JLGA 3MO5A 4MI5A 1MUFA 5T0MA 4Z4PA 5T5GA 5KJLA 3OPEA 2IGQA 3QWPA 4YPAA 3VUZA 4IJDA 5KJNA 2QPWA 4LDGA 3M54A 1MT6A 5JJ0A 3F9XA 5TEGA 4J8OA 3RU0A
chains in the Genus database with same CATH superfamily
2D2WA 1X1BA 5AIPA 5LRRA 1SANA 2R7VA 2V1NA 5L3CA 4CHUA 2VQGA 1FTTA 3Q9SA 5K5OA 3JSPA 3EUHC 5A2QK 2A6TA 1IRZA 4LLNA 5LHIA 3ZMTA 2IPQX 1N3JA 2LKSA 2DPUA 4KMUX 4Y52J 3L7WA 4UNOA 4UB6C 2ZNYA 3MAJA 3CCJI 4LLLA 4A2UA 3HHGA 1W5CC 2BHZA 3CBPA 2MG4A 3S7FA 3TW7A 5H20A 1AOYA 1LUJB 3FXJA 1VQLI 1SMTA 5BOXA 2JRMA 3DBLB 2Q2EB 5HLGA 4EM1A 2WAFA 1ZRDA 5DM7F 1ZLKA 5EEHA 3H3VK 1QU3A 4LG0A 3FK6A 1PUFB 1TT5B 3HBLA 2QSGX 5DYMA 3JRDA 3RTRA 1KONA 1PUFA 2A68F 2K4BA 4IRHA 3SZTA 1EF4A 2DFIA 4FHTA 3KZIC 4V2GA 4BYYA 3VB2A 3TBIA 2BV6A 3DB5A 2Y30A 3BCAA 1FYLA 3O3KA 3KP6A 2Q1ZB 5GTIC 1TNTA 5LLQA 1S7EA 2FF4A 1IDZA 5L3EA 1EH8A 2CQ7A 2IA0A 1OYWA 3DFGA 3EYYA 3ZXSA 2QM3A 2MLGA 2LKXA 1M1EB 3DQVC 3RZDJ 5E3OA 2VBZA 2XGDA 3E6DA 3HXLA 1F9NA 5J4VA 1OJLA 3WTXC 1N75A 4XSZF 1TWAJ 3OOPA 1Z05A 4IKFA 5JLXA 3H5AA 4J00A 2X51A 2JWTA 1Z9CA 1GDTA 2FBHA 2GXAA 1ZKGA 1SD6A 2BY3A 2LP0A 3K9TA 1FLIA 1LVAA 3ZQLA 4QLCU 1XX5A 2F4MB 2FBIA 2BY0A 4DYCA 2D5VA 1X1AA 4CDGA 2B0LA 2Z3YA 2IXSA 4FE7A 2RQPA 4DJAA 4LLGF 2KLOA 3FXRA 5ILSA 3HTUA 3NAUA 4BBRJ 4EJUA 1ZGWA 1FBUA 4HG2A 3F8MA 2K27A 4HYEA 2XB0X 4A12A 4F92B 5KJNA 2QPWA 2F4OB 3K4NA 2R93J 5HNFA 1IUFA 2E35A 2LH9A 1PDNC 1ORKA 1RUNA 3AKZA 3AL0C 2HPMA 3FK7A 2DK8A 3KPHA 2P5LC 2FJ1A 3OYLA 3D5SC 4KYWA 1G8XA 1Z3XA 5IPAA 5BPIA 4XLNF 2HVSA 4XR6A 1KYWA 5JVGF 1V5FA 4F3QA 4HQEA 1ETXA 3GUDA 1ZLJA 5CQGA 4RB3C 4CICA 4HQMA 5D6FA 4ESJA 3KEOA 1MNEA 2UXXA 5LSXA 5HS8A 4IQJA 3I59B 1QZYA 1MSEC 3GWZA 4JQFA 3IKVA 1DGWY 4RGSA 3F9KA 1ZARA 4N9IA 1S5LC 5GAGJ 1SMYF 5L3FA 4RAGA 5D5WB 5FGMA 1BM9A 4GFBA 4YNDA 2KPMA 5EZHA 2XF7A 4BHBA 5B3SH 2NAZA 4XBFA 4B3AA 4A3GJ 5LHGA 1LFUP 1YFHA 2X6XA 3K4KA 2DW4A 2XSDC 3TP0A 5J6XA 3QWLA 1MMDA 1R1UA 2E2IJ 1K4SA 3QPLA 3F9YA 3SWCA 2OQRA 1JJ6C 3GFMA 2OZUA 4JX5A 2GBYA 3ZMSA 2LR8A 3A0BC 4J19A 5HOOA 2Z16A 4Y13A 4A0XA 2W84A 1GHCA 3SFIA 2VQLA 3QOEA 2E2HJ 3DTKA 4Q48A 4C3JJ 1YX3A 2V1XA 3CJRB 3RSNA 3BDDA 2XPVA 1LEAA 1FMWA 2VJ5A 1DP3A 1YHQI 4O5VA 4DNCA 1IG7A 2UV1A 2HTJA 3CO6C 3FPDA 4PGHA 5F1JA 3I4PA 4HA8A 4XLCA 1FBSA 1WJDA 3TEDA 4HF1A 4U87A 3LSIA 1VQKI 4G6QA 2VN2A 2NVQJ 2HPIA 4O6JA 3MEXA 2OQGA 2H27A 2DMTA 3KMAA 2YU3A 5F27A 3L2WA 2IS2A 5FRMA 3GLXA 3HG9A 3GTPJ 3PNTA 3RYPA 2L4MA 3KYDB 4RGXA 5HI7A 1T38A 3OYCA 4A3EJ 4UVCA 1SEUA 3G1OA 3UKGA 4I7HA 4BJ5C 2DN0A 4E7KA 2VB6A 4QIWN 2IGQA 4DYQA 4IJDA 3ECOA 2OAZA 1XB4A 1V5GA 3PSIA 4FCYA 1IXRC 5LEKA 3M54A 1C0WA 2ZJ2A 3EETA 2DQLA 2E19A 2YX7A 2VE9A 3CCEI 3RJWA 2F69A 2QEXI 1B8IB 4MEYF 1Z6RA 4XN3A 3VYUB 1SAXA 2ZXHA 1O7LA 3OYAA 2PQ8A 3FXUA 2WB1N 1IO2A 3WTWC 2Y48A 1SVOA 1P4WA 2ELJA 5E1XA 3FM3A 3HOYJ 3P9KA 3CF2A 3RQIA 1J0RA 4BJ6C 4ZH4F 5KHDA 3CTAA 1U6GA 1FBQA 1U2WA 2XF6A 1UHWA 2W7NA 4IVNA 2V26A 4P1WA 3HSRA 4BUPA 2BW3A 3E5XA 2DI3A 2EB7A 1K79A 1P92A 3CCUI 2FMYA 3LSHA 2HTSA 2J5PA 4XLHA 1MDMB 3QOPA 3WODF 3RAYA 3FWEA 1Q1VA 3TP3A 3I3LA 2BOLA 2VXZA 1OFCX 4E70A 3ABKH 3DF8A 4IOCF 2LOOA 3DALA 5H6RA 4BQAA 2D1HA 2CV1A 4DIQA 3QPSA 4BDZA 2EIKH 4Q47A 3E0JB 3EPZA 3MWMA 2VE8A 2GQQA 2LYCA 2MGQA 5CLSA 4WX9A 2MFZA 3S17J 1X1CA 4Z2YA 2K9SA 3K5KA 3DKWA 1YJNI 2A3SA 2G46A 3OYNA 2R3SA 1JJ8C 4HLYA 1WH5A 4AYBA 2QQBA 4HLXA 4IQ4A 4BL0B 1Y8RB 4DYRA 5DM6F 3OIPA 3HHHA 3P5JA 4NHJA 3HRUA 2EV0A 3OV8A 3B6CA 3OYEA 2DJIA 2W82A 5IYCJ 1SFOJ 4IL6C 1S7AA 1QVTA 2DQRA 5BQTA 2DT5A 4E4HA 4G7OF 5JHNA 2YS9A 2CW0F 4BXFA 4I2OA 4RZ0A 1KYZA 4HNTA 1VF9A 1K61A 1UFMA 3LAJA 3S1NJ 1YRNA 1F5TA 1ETOA 2DMNA 1F1ZA 1WKMA 3BTIA 4L5IA 2TRTA 1GV2A 5IOZA 1YTYA 3HOWJ 2PI0A 2A6EF 4AU7A 5DUIA 2CQNA 4PFPA 1LQ1A 2VXDA 1QRYA 4CCOA 1TTYA 2ELKA 1R7JA 4UUTA 4O3MA 2VC0A 2LDUA 1Z6TA 4Z4PA 2MYSA 3GTJJ 3CUOA 3OWTA 4M9ZA 1T8IA 1KU9A 3K1MA 3RI4A 2KHMA 1IZ1A 9ANTA 3NRVA 2LY1A 3TW6A 1S29A 1WI3A 2FXAA 3V4GA 1RESA 3E3VA 2YX4A 1MBKA 1Y0UA 1ZRFA 4ON0A 3ZQCA 3V8LA 2WADA 1D0YA 3REOA 3QRFF 2PMZN 2P6SA 3EUKL 4HX8A 3I71A 4KUMA 2CW8A 2L9VA 3ZN1A 5ED4A 5M3FJ 3B6AA 4WXCA 4G12A 3K70C 2JZYA 4B8XA 2JRTA 2QWWA 4RLQA 5F0CA 2PMHA 1VQOI 1LJ9A 3F22A 3KMTA 1J7KA 4ITVA 4M6VA 3OYFA 3JW4A 1ACIA 3C18A 2B9SA 1ETVA 1QQIA 1B59A 5HODA 2R5ZB 1JUPA 3DPTA 3ISPA 2H6CA 3TOAA 2BBYA 3H5NA 2EZHA 5CVUA 2BGCA 4RB2C 3WHCA 1LFBA 4JK1X 1QA6A 3ONQA 2WY7Q 1OR7A 3H3UA 4CO8A 3HOUJ 2HI3A 2RAEA 2Q8KA 2OZ6A 3H36A 1MGTA 3BLYA 3MVPA 1Z67A 5J3LA 3DLLF 1TW3A 3HOSA 4H0EA 1FY7A 3CJNA 4PJ0C 3BG3A 4LIVA 2IBDA 1JI8A 3VSLA 2KFDA 1BIAA 4AIKA 2K9NA 2WY8Q 1X4PA 1XS9A 3S1QJ 3CBMA 4I0BA 3S32A 5D5UB 1OISA 4MFDA 1KQ8A 2EFOA 3KP5A 3CMEI 4XRSA 4M9SA 5EG0B 1XGOA 3MFKA 2FQ3A 4KICA 2W1OA 2P8TA 4HPQA 5LEJA 3HOTA 3VPRA 4XLFA 1SD4A 1TT0A 3GEZA 1XSDA 2JT1A 4LD5A 3VEPA 3HSEA 1MBFA 2MBFA 1FC3A 2QVOA 5JFRA 1OQYA 4ETSA 2EFWA 4EGYA 1W36D 1UJ8A 1CF7A 4EJTA 3WGHA 2KDOA 3I64A 4CA0A 5LSZA 3OXFA 5TRDA 1APLC 3CUQB 1T33A 2R92J 2NS0A 3BR0A 3U9GA 2K85A 1YIOA 4YPEA 1D3YA 3LMMA 1SD7A 1K4TA 1Z7LA 2BHYA 5TH7A 3ZMVA 2HKXA 2JA8J 4MI5A 2Q2EA 3OL3A 2DFFA 4A5NA 3JRGA 2P5KA 4EQQA 2NVXJ 4LG0B 4EM2A 4EMSA 3OL4A 1POGA 3S14J 1JHFA 1BI2A 2Y31A 4II3A 3KETA 4A93J 4UB8C 2ISYA 3T0YA 2JSPA 3GZNB 2QCOA 5DUKA 6PAXA 1VQ6I 4RGUA 4CZCA 5LBQA 2AO9A 5KJKA 4H12A 3QU3A 1G2HA 5CQEA 3B02A 1T6SA 4NC6A 3M7GA 5F1RA 3CF5F 4MHGA 1XG1A 4BS9A 2CYYA 3K7AJ 3WG7H 2EV5A 2RNGA 1WFXA 2L9NA 1K78B 5FO5A 1USSA 1UELB 5AIQA 1WVRA 2FBKA 3FZVA 1BW6A 3JRCA 4XOTA 3OS2A 1QZZA 1WJ5A 1Y8QB 5EDNA 2O0YA 4MQ9F 3S1MJ 1YLFA 3ZPLA 3E5UA 1IN5A 3H5RA 3V7CA 1D1AA 1SVLA 2DA3A 1ZGAA 3FKJA 1IW7F 4V2FA 2Q0OA 1S8NA 4MO7A 4ZYAA 3G1LA 1U5TA 4ANJA 1R49A 3BY6A 1IRXA 4E7HA 4F93B 5DD8A 3R0AA 3FIWA 1FX7A 2FQ4A 3KX2A 1WJBA 1ZH5A 1FP2A 4RS8A 2XKOA 1MBHA 3CP8A 1R4NB 4FQGA 4OIOF 1GVDA 4C2UA 1MKMA 1VZ0A 3TO9A 3S7DA 4KT6A 1G3WA 3ZR8X 4PJMA 3T8TA 3VODA 1JXSA 2FNAA 2NOGA 3QPTA 1MNMC 3MZ8A 4N4NB 3H9GA 1I1SA 3CJTB 2RQQA 3BP8A 5DCFA 3RQ4A 1HXDA 5IT3A 2JV0A 2A5YB 5ICGA 1KQ0A 1MJAA 4M6XA 4HEA2 1DUXC 4D7NA 3QWVA 1P7IA 2Z99A 2M7BA 2PJRA 1OLTA 4GDFA 3WU0A 2MD0A 3TQNA 2FOWA 1AWCA 5KJMA 4UUSB 2JPCA 3CDLA 3Q0UA 4A5MA 1WZ2A 3M56A 1G3SA 4M73A 3FMQA 2CGPA 5IY5H 1REPC 3L2QA 4FTHA 2GOXB 2ZMEA 2KZGA 3E1SA 3K4CA 3TO6A 2W4SA 3KCCA 5D8KB 4U7DA 3I9V2 3Q5FA 1VQ7I 1MUFA 3ERED 3PQKA 2CQKA 5JHFA 4OU0A 4MEXF 2DA4A 3K4JA 5E1WA 5DTDA 2EIMH 2X1EA 2GLOA 3CCQI 4J01A 1MJBA 1R9TJ 1CQTA 3GZ5A 4YFXF 4RLFA 1RR7A 1Z0XA 4ENMA 1XSXA 1MMNA 3DCFA 4J8OA 2EH3A 4L0ZB 4LITA 3L00A 1YW7A 3GX4X 2JK3A 2GIZA 4BU2A 3HOVJ 4CYCB 2HQ5A 4I98B 3PNYA 1RI7A 4QPQA 4WXHA 3RJPA 4AVZA 3M53A 3A01A 3TO7A 3F6VA 1RR8C 1R4MB 5HVQC 3D1NI 1T95A 5EYRA 1U8RA 2DPDA 2MC3A 3ABTA 1WRJA 3OYMA 4E47A 3F8BA 4W97A 4YFNF 4IX7A 4MTDA 5FLVA 3NWSA 3RPQA 4IHYA 3VYSB 2M5WA 2E7XA 5EGOA 1ZELA 4CCJA 3RKYA 2NS8A 3PL8A 2OTJI 4A0ZA 1FYKA 1IN4A 4C1QA 1JTYA 2IS4A 3OOUA 2KRFA 3LNQA 3GCMA 2C6YA 5HLHA 1SFEA 5EJCA 4EM0B 2GM4A 1JKRC 3BOQA 3L1PA 2L4AA 4NB5A 2QBYA 2P5VA 3E6MA 3G73A 3F23A 3M1CA 3ZQGA 4KISA 3M57A 4M3DA 3CBOA 1WCMJ 2BY2A 2JUGA 2KDZA 5ILVA 4D5FA 2VLAA 4BGDA 2V4JC 4A0YA 2XSJC 4HF2A 4A3BJ 3PNVA 1O57A 1B9MA 4HX7A 3WU1B 2DFEA 1U0JA 1OKRA 3IWZA 5LGTA 3M4OJ 5EX0A 2P4WA 3J80K 2UUZA 1WSUA 2L01A 1P4AA 2K9MA 4PJNA 3ZGKA 4CH7A 1HC8A 3ASNH 4PCQA 5F04A 4KDPA 3SDBA 1XCVA 3BT9A 1JE8A 2RKHA 1NK3P 3BC8A 2HDDA 1ZK8A 5CCMA 2NVYJ 2FX0A 4XRSG 1TQPA 4DOZA 1QVUA 3CCYA 3PFYA 3OIOA 2HOAA 4CZZA 2KRHA 2I8DA 2ZXWH 3NWTA 1FJLA 3CC7I 2PLYA 2JA6J 4LMYA 4EJOA 5C4XJ 2K7LA 1I3QJ 4LG3A 3AL0B 3GTMJ 1YITI 4BXUA 2CH0A 4Y15A 2A61A 1BR4A 1OYYA 3EP0A 5JI6A 4G6DA 4B48A 2CU7A 2VKVA 4HSTA 2PJPA 5E1ZB 3RKXA 4JLGA 2XAHA 1ZG3A 1U9OA 2CRGA 2V1DA 1BIBA 1KQ9A 3OYDA 1FP1D 4LGWA 4GYIA 1XDSA 4KN4X 1HQCA 4GYGA 1VQNI 1R5ID 3G1MA 1YRNB 4YPUA 1W7PA 1MH3A 4PFOA 2R7SA 3MN2A 3CP2A 2CUZA 2M2EA 3K2AA 3LSJA 2RVCA 1R6RA 3M3YJ 5HDGA 3AAFA 4OMYA 4NBQA 1FIPA 1HKTA 3OR1C 2WBMA 3NARA 5HLTA 3LSRA 1HCRA 4MI0A 2VOOA 1BOAA 1R1TA 3RDIA 3U21A 3C2GA 3S3OA 3QWWA 1BR1A 2M3AA 1QZEA 2STWA 3WTTC 4TV7A 3H1CA 4MGRA 4L0YB 2HOSA 2WAEA 1ZKKA 1UG2A 1J59A 3N97A 3DTIA 2HYJA 2VODA 3V8JA 2H09A 1H8AC 3F9ZA 3FXOA 1N6AA 5J8FA 4PZJA 1YIJI 3FBIB 1FPQA 3JSOA 1GV5A 3TMOA 5B1AH 4BBSJ 1U5TB 3S15J 3PDNA 3NQOA 1JT0A 1PYVA 5LGUA 2NNYA 5DS9A 2CV0A 1A36A 1HDDC 5K5QA 4E7JA 2E7WA 1WJEA 2P0WA 4V19K 2BE5F 4XLPF 3CZ6A 3BCBA 4S05A 4RBOA 1GUUA 3G2BA 4AIJA 4CGZA 2FU4A 3QQAA 5JIYA 3GVAA 4ZZLA 5CVVA 4B4CA 3M8FA 4ESBA 2X0LA 3KZYA 2LBFB 1ETWA 5B1BH 1D1BA 4JP0A 2GAUA 3BPVA 2G0EA 4L9JA 3S2WA 3G4SI 1ITYA 1ETKA 2GIVA 3LWFA 3MZYA 1TLHB 2M8GX 3S16J 4N0BA 5M5XJ 2L54A 2FRHA 5EG2A 5JLWA 5JHUA 1V4RA 3HB9A 4A3MJ 1ZHFA 2KKOA 4O30A 4I02A 2TCTA 2CO5A 2DOAA 3L2VA 4IHSA 2EV6A 1J2XA 1QPMA 1N78A 2OD5A 1ZTRA 2FNPA 4IJ8A 3K1NA 2QSFX 2L02A 5GPAA 2ADUA 2XAUA 3U1KA 1FOXA 4LOCA 2OTLI 3PIPF 1HSJA 1XMAA 2JSCA 1A04A 1BI1A 3T1BA 1D8JA 4P9UA 3FMSA 5H6QA 1Y39A 3FISA 2LK2A 5CJ9A 4YFKF 1OR7C 4BDYA 4RDUA 4HOBA 4G7HF 4ZTFA 3ZN0A 1PJRA 1TWFJ 2A05A 4K2EA 1OMIA 5TEGA 1XC5A 2HYFA 3EUAA 2DYSH 3B73A 1UAAA 2QF7A 2KIQA 1T39A 1K6OA 4P96A 2ME6A 1IN7A 2UWMA 2XROA 2JVHA 2W57A 3BG6A 1QPIA 1WH7A 2XDVA 2DMQA 2PX9A 1F36A 2I10A 4G6TB 1S6LA 3ABMH 4J7IA 4YIRX 3C7JA 1I5ZA 1IV6A 3MKWB 3OXGA 1OCZH 1I6HJ 1LNWA 5HDNA 3R6SA 2ZMEB 1IN8A 4LIUA 3H92A 2Y0SA 3I4MJ 2CWEA 1IC8A 1DGRM 3LFUA 1MZBA 4AIHA 3VV0A 1WJCA 2CJJA 2DU9A 3KEQA 4C3HJ 3LA7A 2VT3A 1DU6A 3BTLA 2LMDA 2XVCA 3U2RA 3HEFA 2KMUA 3W2WA 3TL4X 2ZBKA 2CS3A 2JA5J 4YNPA 3QYFA 2IRFG 5FJ8J 4OAZA 1HW2A 2IS1A 2HEOA 4PJJA 2K3PA 4UUSA 3KYCB 5FROA 2WC2A 2EZLA 5E8IA 2O8KA 2ZNZA 5F64A 5E8GA 4AWXB 3MO0A 4Y33A 2HVRA 4KMFA 1XGNA 3LSPA 3ABLH 1IN6A 3GYHX 2OBPA 3I55I 1DPUA 3A0HC 4DGWB 1BR2A 2HDWA 2XAJA 2O61A 3A2KA 3RIRA 2R7QA 2XAGA 3BZ6A 3MD2A 5FD5A 5JVTA 3S7JA 4RAFA 3I4NJ 3KLNA 1QNTA 5TTFA 4S0HB 3CDIA 2IJLA 3RKQA 1X2MA 1H9GA 3S3MA 4B44A 5M5YJ 2IS6A 5E79C 2RV8A 2VONA 4NC8A 2DODA 1J09A 1XGMA 4F52A 3BG7A 4M3EA 2L7KA 4IZZA 2DXIA 3ML6A 3EDPA 3FHZA 4I76A 2CQQA 4FT8A 2W24A 1B1BA 3QPHA 4PUSA 1V54H 3SQNA 3J7YJ 3W6VA 5C4JJ 1XSVA 1ZRCA 4PGGA 5D6EA 2ZCWA 3PQJA 2KT0A 4MQVA 4ENKA 3OYJA 2R7UA 3I59A 4NJ5A 4YRVA 3HYIA 2AXTC 2DJNA 2F5CA 2CFOA 5KK1A 2G9WA 4QEOA 3KP2A 5FLMJ 3LFKA 5FFZA 3BZCA 3GO5A 3QU6A 5GAEJ 5JR3A 4WF2A 2DA5A 4I99C 2NVUB 1W5TA 1XTAA 2XHKA 2JA7J 3H9QA 1U5TC 3GTLJ 1IRFA 1MIJA 1AHDP 3PJRA 4BE2A 2YPRA 4BNCA 4RGRA 2EK5A 2WV1A 5LRSA 1AKHA 5FRNA 3SW9A 2IVMA 1OYIA 1WGXA 5J40A 5DCMA 4CXFA 4C3IJ 2QUFA 3FXQA 3G3ZA 2ESNA 3K10A 2DT7B 4NQWA 4RAZA 3ZMUA 1IXCA 1JGGA 1FZPB 4JDSA 2LVSA 5AONA 3PM1A 5F08A 3ESWB 5ICFA 4C30A 4FISA 4U0YA 3ZQQA 1EA3A 1A5JA 2RNJA 1ZREA 1YS6A 2DYRH 4IXAA 4O6FA 1JKPC 5GPCA 2MD5A 1MSFC 4ZDOA 2RN7A 1H3IA 1K6YA 2NS7A 5BS6A 2QGUA 2R5ZA 1QBJA 2V6EA 2M7AA 3E97A 2ICWG 1MMAA 2W5ZA 4I09A 5ARFA 1TBXA 4HF0A 3O2PE 4X1EA 3C2HA 4BY1J 3BROA 3DP7A 3K70D 3CLQA 2RGVA 1RRJA 2XRLA 2VJIA 2MH2A 4BE0A 4XL9A 2M87A 1W5SA 2LLKA 2LY9A 1I6XA 3HTSB 4M6YA 4CCMA 2LREA 5HQ8A 3I53A 3N4MA 3GTOJ 4GGGA 2BZTA 2ZJPF 2DO7A 3LA2A 4L9VA 1FOYA 4HZFA 2VKDA 5HLIA 3SZPA 4ABZA 4D9JA 2X85A 2H1KA 3VDXA 4HV6A 1SFXA 1PP7U 3EUHA 4RM3A 3IH4A 4IHVA 5GTHC 3JREA 2HS5A 1LE8A 1JGSA 4E7IA 5T5GA 2R4GA 4AVPA 3A03A 3K6GA 1TQIA 4IEJA 3JRAA 3W2AA 3CJQB 3F9XA 2X9DA 3HM5A 2OUMA 4RAYA 1ETQA 3OY9A 1YX5A 2IGMA 1AA7A 1FNNA 1TC3C 3DWLE 1STZA 4HDVA 3PO3J 1D5YA 5CVJA 3DKXA 2VUMJ 1PUEE 4XK4A 4D7MA 4Q4ZF 5E3MA 4DW6A 1RZ4A 1BJZA 2L9SA 2UZKA 1VTNC 1JT6A 2JA2A 4LK0F 5J47A 4CCLA 4FMUA 3ABUA 2XPWA 1K7AA 4II2A 3V42A 3P7NA 2ECCA 1G4DA 2DOEA 1X2NA 1YW9A 1W7PD 4FETA 1R71A 1TP4A 2ECBA 4I01A 2L7ZA 2HQRA 3Q9VA 3HDDA 1H88C 3WTZA 5AYFA 1YJ9I 1D0XA 1WPKA 3CESA 2O8XA 2HVQA 2IW5A 2M8EA 3PIOF 1H0MA 4L9TA 1DDNA 4EEFG 4JYKA 3HL2A 4EJVA 3V7SA 2ZSIB 2ID6A 4UV8A 2L3DA 2EZIA 1FWZA 4M9XA 2K3FA 5BPDA 3DU5A 5ICCA 3MEKA 3GXOA 2M0CA 5K7FA 3A1YA 1CGPA 2P7CB 2F48A 3F3XA 3Q0VA 1I50J 1W0TA 3HRMA 4HNUA 2ZXIA 1BBYA 1HKSA 4Y7NJ 1VQ4I 5GP9A 2HU9A 1E2XA 3WE3A 3LAPA 1O3RA 1DPRA 1MBEA 4J83A 5ERIA 2JJ7A 3TDZC 2DMPA 2DDAA 1HA8A 2O6GE 1S3JA 3CMAI 3GFLA 1YYVA 2IEKA 2GXBA 1P6RA 3I56I 3OS5A 1YS7A 5FFXA 2IA2A 3VFZA 2XB5A 3IHXA 3FDYA 1YO5C 4ZDLA 4AUXA 4CCNA 3S1RJ 2VQHA 2Y9YA 3DTEA 1NTCA 3KP7A 2NRAC 3W6JB 3GF2A 1J75A 3IH2A 2QA4I 1R23A 2V9PA 3GTKJ 3H35A 1MJ9A 5D5XB 4BH9A 4RB0A 5E18F 5A2QZ 3MKLA 2R7TA 4IHTA 2M30A 4BHPA 5C3EJ 1D5VA 4Y4RA 1U8BA 1NG7A 3V8KA 4XRFA 3HUGA 1IGNA 2X6YA 1LDKB 1SAUA 3BQYA 1J5YA 4A6EA 4LDGA 5D4RA 3CQZJ 3IHUA 2DAOA 3HGYA 2H8WA 4UVAA 4WXDA 3IC7A 2G7HA 2E1MC 2FOKA 4NUBA 2W5YA 3HZJA 4XKVA 2CMPA 3GW2A 3DV8A 2FD5A 2WWYA 2Z9OA 4PJLA 2AHQA 2K9QA 4A3FJ 2EZKA 3R60A 5C44J 2MW8A 4FE4A 2VI6A 3HIFA 3MKZA 5D4SA 2XV4S 1WJAA 2K02A 2LBFA 3LL7A 1Z7UA 3KMJA 2X48A 3IKTA 4IF4A 1ZGJA 1X3UA 1YQAA 4A3DJ 2QSHX 2KP6A 4PK4A 4MTEA 4EVIA 4ZDPA 5ICEA 3A01B 2F5DA 4U7BA 2KIUA 2Y0MA 1LDJA 2R7OA 1RETA 1ON2A 3WTSC 3LQQA 1R36A 1JUMA 1SD5A 1R58A 4AC0A 4I0AA 1UCRA 3HUGB 4ZYHA 4M74A 1OCRH 4HW0A 1LKXA 4A69C 2ZKZA 5EGOB 3SZGA 2BQZA 2NNNA 2Z33A 3J7AY 1EJ9A 1A6IA 4UXNA 4NDLA 3L2RA 1KZHA 4B09A 3HGGA 1U78A 1O7FA 4A3IJ 2F6CA 2R7DA 5E20A 4KIFA 1XQHA 3PO2J 1E3OC 5HS7A 1D0ZA 3K1PA 2NOJB 3IV5A 1TWCJ 2OC6A 3CO7C 4OIPF 4E7LA 3CD6I 3IUOA 2DA6A 4DBRA 5BMZA 5M5WJ 1MBGA 2R5YB 2IA1A 3VOEA 3F21A 3MO2A 4Q5SF 4MLOA 2ISZA 5D8LB 1UHSA 1KA8A 4X6AJ 1MH4A 3RPUD 4QTRA 2L9RA 2X4HA 2F2EA 4R8HA 1ONVA 1X1PA 1W0UA 2L7FP 1WQ2A 3OYBA 4OINF 1KGSA 4ASNA 2D45A 2MC4A 1D1CA 1JUSA 1JKQC 5FLXZ 1LFPA 4KJZA 3UR3C 3CC4I 3TDUC 5E3NA 5EG0A 1B9NA 1X58A 2BXYA 2IP2A 2X6WA 1HLVA 4LB5A 3M59A 4RA2A 1I27A 2ZXJA 2UXNA 1YOVB 3A4CA 3HSFA 1LDDA 3ZRGA 3GFJA 1LE8B 2DA1A 3BQZA 2X1DA 1ERDA 2Z1DA 3RPUA 3ROUA 4G8XA 3GLLA 1X3WB 3GTGJ 4NNJA 4A3KJ 3DU6A 3C3WA 4UHTA 5KAIC 3FBNB 2A6HF 5F6FA 4P5OA 2H94A 2MSYA 4IHXA 1NK2P 1EH6A 4M3BA 3KP4A 2HZDA 3PSFA 1XDUA 3KFWX 4M3FA 2VJJA 3O8HA 1BC7C 2QQ9A 1GT0C 3SEZA 4AYBN 3OYHA 3J7ZI 1EV7A 2G7UA 1UHMA 4YEJA 3S8PA 2EFQA 4XQFA 5CPRB 4P55A 4OMZA 3SXYA 4XN0A 4HBLA 4LB6B 5J1RA 3CCMI 1IUYA 1XPXA 4BHCA 2IT0A 3C1DA 3BR1A 4JX4A 2W48A 2ACJA 1W4MA 1FMVA 5T0KA 2ZC2A 2LD5A 5E17F 1I39A 2KJBA 2EILH 3AFHA 3ASOH 3COAC 2VL8A 1O3SA 4YIIA 1IF1A 3AG2H 4BKXA 2E5ZA 1KU2A 2CUFA 3FMRA 4JX6A 2E1MB 2W00A 3SFZA 1SC7A 4IRGA 1WJFA 4EJWA 1XD7A 4ZTJA 3M07A 5FKNA 3EQLF 3HRSA 2AS5F 1UMQA 2LC2A 2H6BA 5KVRA 2HZTA 3GFIA 3CMYA 2F4IA 3BJ6A 5IT9K 1VNDA 1NHAA 3S3NA 5F0FA 5HNHA 1MDMA 1J9IA 1TZLA 2O8JA 4ZJZA 4PSWA 4B43A 3F0CA 5DCMB 3M5AA 2VBWA 3E5QA 1TNSA 2QENA 4XKBA 1JKOC 3ZQFA 2E36A 4I51A 4KA4A 4HRIA 1GVJA 2JTVA 2DTRA 1N25A 4KT5C 3QODA 3WG9A 5F5EA 4FX0A 2ETHA 2ZO4A 2LTPA 3ZQIA 3I0TA 4CCKA 5IYDJ 5IYBJ 4C2MJ 1TL8A 2N8GA 3BPXA 3S7BA 2FSWA 2NYXA 1BN5A 4EV0A 2O03A 3SDGA 4HSRA 1XN7A 3ERMA 3IAM2 2QKMB 5D5VB 3L2CA 2Z5UA 2QBYB 1SVMA 1N6CA 1R22A 4PDKA 5F6KC 4CYCA 4Y3OA 2JPBA 4EGZA 2MABA 1T08B 4BQOA 2HWVA 1IAWA 2FA5A 3DEEA 4WUYA 1V5EA 2HQNA 4C9YA 4B47A 5HDKA 1U9NA 2WTEA 2W85A 2M45A 3IWFA 5EZGA 1UG0A 4DBQA 4F7ZA 5K5RA 2PN6A 2PEXA 2DLLA 1T56A 2YSRA 1RIOH 4B1RA 1TW2A 1UZCA 3JRFA 1VQPI 2L7MP 5L3DA 3KP3A 1ZG5A 1VI0A 4FASD 3K4LA 4BACA 3IRRA 2LNBA 4QPOA 2OV7A 2XAFA 4ESFA 4PSXA 2B63J 5FKLA 3WHBA 1DQUA 3WTUC 3FM5A 2DA7A 3M8JA 1KU3A 3OYGA 2KIMA 3PUBA 1EKEA 1K83J 1VQ9I 3LSTA 3ZMZA 4E6KG 4YG2F 3CCRI 3MZHA 5FB2A 4AD9A 1GXQA 3GTQJ 1YE9A 3LA3A 4UY8I 3OMYA 2HKOA 4IO9F 4XLEA 2M4KA 3AG4H 1P2FA 4QEPA 1VQ5I 3HNAA 3F6OA 4QSHA 1H89C 4OOIA 3OR2C 4BE1A 2OA4A 3FF5A 5GAHJ 2FEZA 1N77A 2COMA 1X4OA 2VT2A 1HDPA 1ZQ3P 3BWGA 2STTA 2XPUA 3PUFA 3T8RA 4M72A 2R5YA 3K4MA 3X2QH 1P9QC 3F9WA 1B72B 2R7RA 2ZSHB 3VYTB 2MLKA 1V3FA 4HV5A 4RM2A 3TG5A 2ESHA 4D0PA 2D1VA 1G59A 3BO5A 3EYIA 3MQ0A 1TQMA 5KNLA 3J7AO 5K7HA 1R00A 4E7ZA 2PMUA 2IGNA 5B66C 1LEBA 4YELA 2JQ7A 3HJEA 2A5WA 1I3AA 1XMXA 4EATA 4ENJA 2IGOA 3LSGA 5HS9A 1A35A 2PG4A 2PFBA 4Z6YA 1PVEA 2E71A 1OCTC 3R4KA 1WI9A 5EX3A 3SEQA 2Y69H 2MA3A 3RYRA 2K4JA 3IL2A 2P81A 4XONA 4A3LJ 3MMYB 1FT9A 1ODDA 2ME0A 3G71I 3JR9A 2AQEA 5F6LA 5FLXK 3HPGA 2E34A 3ELKA 4AM3A 3DLAA 4CYDA 3I54A 2ID3A 3AG3H 5CKTA 2Y9ZA 1T0FA 2XIGA 2TDXA 3K0LA 4R1HA 3CCVI 2YUSA 4GXOA 2HNHA 3DPUA 2QKLB 3CLOA 3V7RA 3WU2C 3DEWA 2KISA 3LOCA 1G3TA 3BZKA 3P9CA 4MNUA 5DV5A 3S2HJ 1DU0A 2E1CA 2DMUA 3JRHA 2DDBA 4BJTA 2BYVE 1X1DA 4MFEA 1FYMA 1VFCA 5ARGA 3WGGA 2XASA 4KIGA 3JAMK 1HW5A 2CQXA 3HRTA 1USTA 2H8RA 4J7FA 3DBHB 3FKIJ 1B8IA 1Y1VJ 4ZZDA 4KIBA 3U1DA 2HYGD 5EEAA 1ULYA 2LF7A 5ILUA 4ZYDA 5T0MA 5GADJ 1X19A 3R61A 4XKCA 3QWPA 1Y1WJ 3VUZA 3L2UA 1A31A 3CUQC 4L18B 4G94A 2HR3A 2I5UA 4U88A 1MT6A 2V9KA 2M1BA 3HKZN 3KE2A 1X3ZB 4X0GA 1K78A 3WE2A 3OYIA 1RKTA 1WHUA 2HFHA 3FHNA 2CUJA 2VIXA 1O9SA 2X6OA 1RPWA 3JRIA 3NEUA 1ZAOA 4N9HA 3JRBA 4XOPA 2ZFWA 2M0MA 3GMEA 1MW7A 4QWQA 4FX4A 2HXIA 4H4KC 1P4XA 1YW8A 2EIJH 1RKWA 2EFPA 2WV0A 3KEYA 3J81Z 4DZJA 5IT9Z 2ZJRF 2QZ8A 4XICA 2OPTA 1S7OA 3M55A 3M58A 5F59A 2B7EA 3C2BA 4KITB 2K9LA 4IHWA 3K4BA 1KU7A 5CCLA 2VKHA 1PEGA 1O3TA 4R79A 1SFKA 4U0VA 2YU9J 3H0DA 2QQAA 3AG1H 4OIQF 1A6QA 4YIFA 4D5CA 3BG5A 5LD2C 4LJZF 3JAMZ 3L09A 2O7OA 4BEHA 3SHFA 1T0FC 2M9HA 4L9NA 2ZMEC 2F5FA 3BTCA 3JCUC 1MVXA 4MIMA 3CMMA 3Q0WA 1LB2A 3JTHA 2DCEA 2GWRA 3KZZA 2DK5A 1CF7B 2W25A 2EFNA 2DA2A 1R5GA 3H9JA 1IRGA 2HQAA 1IDYA 3CUQA 4UUVA 1OCOH 3F8CA 2BEOA 4IJAA 3D5LA 2KRCA 1FSEA 2CV2A 3HC7A 2KIFA 1ZR2A 1BL0A 3K69A 2PJRB 1Z21A 4UV9A 4DQ2A 5J1YA 2E1NA 4RB1A 1Z77A 2WB1A 5K1YA 1G6NA 5KCMA 4W1UA 4NC7A 2XKPA 3I5UA 1U3EM 2Z2SB 3BJOA 3R0JA 2Y0SN 2BXZA 2HOEA 3K2ZA 4M71A 3ULQB 3E7LA 4Y17A 3S2DJ 2XGCA 3QP5A 3HOZJ 1F4KA 1G3YA 2DTZA 2R7ZJ 1QHHD 3ZQ7A 2FMLA 3J81K 5TJJA 1UB9A 5DDGA 2VJ4A 1MNDA 2EPFA 2MH9A 1QGPA 2Y2ZA 4BEHB 4GCVA 2RFIA 1W36C 2VKEA 2RDPA 2XF5A 1IXSB 1YG2A 2JMWA 2R3AA 2EA4A 1AU7A 1BJAA 2CG4A 4GRIA 3BR2A 4HDUA 1L0OC 1ETYA 3N05A 4KN7X 3G6EI 2AQFA 3FX3A 2EQRA 4LFUA 5FD6A 3OYKA 3VSKA 4BQNA 3QYBA 1HF0A 5KJLA 2WAQN 3QYEA 2H1LA 2CUEA 5M3MJ 3P9IA 3PFIA 1BA5A 2M34A 2K86A 3QP6A 5JJ0A 1ON1A 2XRNA 4XLAA 1JHHA 1YJWI 1MBJA 2HOTA 3BR5A 3ZMDA 5L3BA 1TWGJ 4BQQA 5K7ZA 3DPLC 2PMZA 1B4AA 3T5XA 5B5EC 5KAFC 4P9FA 2VPLA 1VQ8I 3OXLA 3DEUA 4ZYGA 2R7FA 3Q3SA 2O3FA 3IRQA 2KQRA 2M4GA 3O8GA 3E6BA 2JVGA 4GO1A 3OIQA 5IP6A 3RKWA 3CCLI 4XNFA 4HNVA 1Y0NA 2COBA 2LSOA 2LY2A 5F0HA 3A02A 2YR2A 3HOXJ 3E6CC 2LFBA 1BI3A 1XGSA 2XUBA 4A3JJ 2CSOA 2LRDA 3D0SA 2KZVA 2O5RA 1XCBA 1HKQA 5J1UA 3O6BB 5JINA 1B72A 1HW1A 3BTJA 3HKZA 1T2KA 4OAYA 2KJCA 3I58A 3M1EA 5FKMA 3TKYA 3OS1A 5IP7J 2ZJQF 4BXXJ 1XMKA 1HBXG 5E3LA 1OCPA 1OPCA 2E60A 2L5QA 2VOPA 3OSFA 2LF8A 3ZP5A 1BC8C 2LKPA 2DFHA 4L5EA 2NXNB 3BG9A 1BOBA 3DKYA 1BI0A 1MD0A 2VQCA 1B6AA 3H0GJ 3SJMA 3VWBA 1O3QA 3N71A 3W3CA 5CYVA 4G7ZF 4HAMA 2K40A 4AIDA 3JTGA 1Y6IA 1O4XA 3W2VA 4YNMA 2DT6A 4KFCA 3F8NA 3OOIA 2L0KA 3IAS2 4U0WA 4WWCA 3LSKA 5IP9J 3RZOJ 1FOKA 4XSXF 2BW3B 3BR3A 3KLOA 2IGKA 1Z1DA 3S93A 2XAQA 2ELHA 4KNYA 5FKKA 1Z91A 2IAIA 3LSMA 1ZR4A 4C2TA 3WGIA 4D1QA 1WWXA 1E3PA 3DXJF 4L5JA 3CCSI 4OIRF 1S9HA 4ENNA 1YI2I 2JN6A 2RC4A 4I6ZA 3RIBA 3TG4A 2ZB9A 2BY1A 1OCCH 1QHGA 3OSGA 2OJED 3MO5A 3GBGA 1RUOA 3BR6A 1HSTA 2K5CA 4UVBA 3IH3A 3UNGC 2F5EA 2XGEA 4YPAA 2EWNA 1E17A 2HXOA 4N4OB 2R0QC 2EINH 2LG4A 2NVTJ 1IV8A 5J4YA 1AKHB 4XIDA 2GOMA 2OCEA 4NQWB 3ZQHA 1L3LA 3D5RC 1FTZA 1R1VA 3CC2I 4XM3A 2QQ8A 4XMYA 2VPRA 3ZOBA 2V7FA 4WK8F 4BAYA 4IPAA 3TOBA 2EBIA 5TGTA 2HDCA 4F91B 1NH3A 2J5OA 2XGXA 2P7VB 1ENHA 2EJRA 5LFAA 3F8FA 1GXPA 5IOYA 4ZC3A 4LK1F 2ZFUA 2JUCA 3HPHA 4IRIA 3M9AA 4A3CJ 5LGNA 2WAQA 2A07F 1P7JA 5J8CA 2EA2A 3J80Z 2PBIA 4JBAA 4S04A 4BY7J 3L9FA 1VQMI 1Y56A 4XORA 1RNLA 5CVRA 4WCGA 2WA0A 1R5HA 3GZ6A 4CSWA 1H9TA 3MKYB 1I1GA 4NVQA 1FOWA 3QAHA 2VC1A 2DOFA 1JTXA 2GA2A 3WTVC 1LVKA 4JOMA 5FKOA 2R7WA 1DP7P 1IJWC 1FEXA 3KIOA 4DZPA 2VBXA 2L2OA 2XC7A 5TISC 1SFUA 4F55A 3WTYC 3MCZA 5BNGA 2R7XA 1EH7A 2E5NA 3SYTA 3ZCOA 4E7SA 3OS0A 2P6TA 1QO0D 2QLZA 3DBRB 1MMGA 2V9VA 3FXKA 5CVIA 5DD4A 2V79A 2VASA 4XRMA 4RMNA 2V1UA 2BVLA 5LHHA 2AXLA 2KL4A 2GXGA 3FXMA 3F72A 4OWRB 1E0EA 3FXLA 2OU2A 1W7PB 3IP4B 3RCOA 1ZYRF 4IOAF 3KYLA 1F43A 1RC9A 2GZWA 2OF7A 1W1WE 5H2FC 1S72I 2DBBA 2V6CA 1NG6A 1MMSA 2F5VA 1ZG1A 1FSHA 1ML9A 2E1OA 5EEGA 1BW5A 2A69F 1ZN2A 2CFXA 1MVHA 3BJAA 2VBYA 4QENA 3H3ZA 4CUGA 2GA1A 5DEQA 1PP8F 3W6KB 2FUG2 3M8EA 3VYRB 3LQRA 2HGCA 4A6DA 1E3HA 2RREA 4XKWA 2Y75A 4HX4A 1T98A 1TWHJ 3TGNA 2BVMA 2E2JJ 2X1CA 4B3XA 1V55H 2FE3A 3ECHA 1Z3YA 3OPEA 5EF6A 2O9LA 1LPQA 4ZYEA 1Q1HA 2CW7A 4M3GA 1FIAA 2OCCH 4G9YA 2QYOA 5L3GA 1HOMA 1D8KA 1GLNA 3CDHA 3RU0A
chains in the Genus database with same CATH topology
1DQUA 1X1BA 3OYJA 3M8JA 2R7VA 3OYGA 3PUBA 2JSPA 2R7UA 4NJ5A 4YRVA 2V1NA 2VQGA 4E6KG 2CFOA 4QEOA 3EUHC 1YE9A 4CZCA 2A6TA 3OMYA 4XLEA 2M4KA 1N3JA 4H12A 5KJKA 5CQEA 4QEPA 3HNAA 3OR2C 4BE1A 4BS9A 3H9QA 1N77A 2RNGA 1WFXA 1X4OA 2L9NA 3CBPA 3PJRA 1UELB 4BE2A 3S7FA 3K4MA 4XOTA 1P9QC 3OS2A 3F9WA 5FRNA 3SW9A 1WJ5A 2R7RA 2ZSHB 3VYTB 2Q2EB 4RM2A 3TG5A 2WAFA 3H5RA 1G59A 3K10A 2DT7B 3BO5A 1D1AA 3FKJA 1QU3A 5KNLA 4JDSA 4ZYAA 4ANJA 4E7ZA 4C30A 1IRXA 2IGNA 3RTRA 3ZQQA 1KONA 4F93B 1EA3A 4E7HA 4YELA 4O6FA 3KX2A 1WJBA 2A5WA 4EATA 3TBIA 3LSGA 2IGOA 4ZDOA 3CP8A 3DB5A 5EX3A 3SEQA 1H3IA 3BCAA 1K6YA 4C2UA 1VZ0A 4XONA 2Q1ZB 3MMYB 2V6EA 2M7AA 1MMAA 2W5ZA 5ARFA 3S7DA 4KT6A 2AQEA 5F6LA 3HPGA 3ZR8X 3C2HA 4PJMA 3DLAA 3ZXSA 3K70D 3DQVC 2VJIA 5CKTA 4BE0A 4N4NB 3HXLA 4XL9A 3H9GA 2HNHA 3DPUA 2QKLB 1N75A 4CCMA 2LREA 3RQ4A 2RQQA 5HQ8A 2JV0A 4IKFA 3H5AA 4J00A 2X51A 4HEA2 3QWVA 2M7BA 2PJRA 1OLTA 2MD0A 5KJMA 4BJTA 1X1DA 5ARGA 2VKDA 4D9JA 3M56A 2X85A 1X1AA 3VDXA 4J7FA 3L2QA 2GOXB 2IXSA 3E1SA 3K4CA 4DJAA 2W4SA 2KLOA 3I9V2 4RM3A 1MUFA 5JHFA 4HG2A 4E7IA 5T0MA 1X19A 5T5GA 4XKCA 3K4JA 3QWPA 3VUZA 3L2UA 2R4GA 2X1EA 5KJNA 3K6GA 4F92B 4J01A 2QPWA 4RLFA 1MT6A 2V9KA 3W2AA 3CJQB 3F9XA 4X0GA 3K4NA 1MMNA 4J8OA 2OUMA 4LITA 5HNFA 2LH9A 3OY9A 3OYIA 4BU2A 3AKZA 3AL0C 1YX5A 3FHNA 2HPMA 2IGMA 2CUJA 3PNYA 1AA7A 2VIXA 4QPQA 3DWLE 3D5SC 4AVZA 3OYLA 1O9SA 3M53A 1G8XA 3DKXA 4XOPA 1Z3XA 5HVQC 1T95A 2M0MA 1MW7A 2HVSA 2L9SA 4XR6A 1V5FA 4H4KC 2JA2A 4F3QA 3OYMA 4CCLA 4E47A 5CQGA 4FMUA 3KEYA 4IX7A 4II2A 3NWSA 3V42A 3VYSB 1MNEA 3M55A 3M58A 4IQJA 5F59A 5LSXA 1ZELA 4FETA 4CCJA 4KITB 2K9LA 3PL8A 4JQFA 4C1QA 3K4BA 5CCLA 1DGWY 2VKHA 1PEGA 2IS4A 4R79A 1SFKA 3F9KA 3OOUA 3H0DA 5AYFA 1D0XA 3CESA 5LD2C 2HVQA 4YNDA 2KPMA 2XF7A 4BEHA 1T0FC 1MVXA 3HL2A 2X6XA 3CMMA 3K4KA 3M1CA 4KISA 2DCEA 3M57A 2ZSIB 3CBOA 2JUGA 2VLAA 4BGDA 2V4JC 1MMDA 3H9JA 2XSJC 2HQAA 3PNVA 3DU5A 3F9YA 3MEKA 3SWCA 3A1YA 3D5LA 2KRCA 4HNUA 1U0JA 2ZXIA 2CV2A 3HC7A 5EX0A 2HU9A 2UUZA 5HOOA 2Z16A 2PJRB 2K9MA 1Z21A 4PJNA 3ZGKA 4CH7A 4J83A 2WB1A 5KCMA 2VQLA 3QOEA 3SDBA 1HA8A 3DTKA 4NC7A 2Z2SB 3BC8A 1YX3A 2IS1A 3CJRB 5CCMA 3OS5A 3RSNA 4DOZA 3IHXA 3FDYA 3PFYA 4ZDLA 1FMWA 4CCNA 2KRHA 2I8DA 3NWTA 2VJ5A 1QHHD 1DP3A 3FPDA 2VQHA 2UV1A 2VJ4A 3DTEA 1MNDA 4XLCA 1WJDA 4LG3A 3AL0B 4U87A 3LSIA 4BEHB 2HPIA 2CH0A 1BR4A 2RFIA 3KMAA 3H35A 1W36C 3L2WA 2IS2A 2XF5A 5FRMA 3HG9A 3EP0A 3PNTA 2R3AA 4B48A 4HSTA 4GRIA 5HI7A 4JLGA 2R7TA 3N05A 3OYCA 2AQFA 4Y4RA 4BJ5C 4E7KA 3OYKA 2VB6A 3VSKA 4BQNA 1NG7A 3QYBA 5KJLA 3OYDA 3QYEA 2IGQA 2X6YA 4IJDA 1LDKB 1SAUA 1V5GA 3PSIA 3M54A 4LDGA 5JJ0A 4XLAA 4YPUA 3RJWA 4PFOA 2F69A 4XN3A 2E1MC 3VYUB 3CP2A 2CUZA 4BQQA 3DPLC 2PMZA 2ZXHA 2R7SA 1R6RA 4NUBA 3OYAA 2VPLA 2W5YA 4XKVA 2CMPA 3OXLA 3OR1C 2WBMA 5HLTA 2ELJA 4PJLA 4MI0A 2KQRA 2M4GA 2JVGA 3CF2A 3OIQA 4BJ6C 5KHDA 3MKZA 4XNFA 1WJAA 2LY2A 2LBFA 3LL7A 3U21A 3KMJA 2XF6A 3C2GA 3S3OA 3QWWA 1BR1A 2W7NA 2V26A 2M3AA 4P1WA 4BUPA 2BW3A 2KP6A 4PK4A 4ZDPA 2LRDA 2WAEA 4U7BA 1ZKKA 2KZVA 2O5RA 3DTIA 3LSHA 2R7OA 4XLHA 5JINA 3F9ZA 1N6AA 3RAYA 3HKZA 4OAYA 3OS1A 3FBIB 3I3LA 2BOLA 3HUGB 2VXZA 1LKXA 3DALA 2E60A 2LOOA 2L5QA 3TMOA 3SZGA 2CV1A 4DIQA 2BQZA 3PDNA 3J7AY 4BDZA 1PYVA 1BOBA 3DKYA 3E0JB 3EPZA 3L2RA 2CV0A 2LYCA 2VQCA 3VWBA 2MFZA 4E7JA 1X1CA 1WJEA 2P0WA 3CZ6A 3N71A 2F6CA 3W3CA 3K5KA 3BCBA 1XQHA 3G2BA 1Y6IA 2G46A 3W2VA 4YNMA 1D0ZA 2NOJB 5JIYA 2DT6A 2OC6A 3OYNA 3OOIA 3IAS2 4E7LA 3IUOA 2LBFB 4AYBA 4IQ4A 1D1BA 4BL0B 3LSKA 3OIPA 4DBRA 2BW3B 3MO2A 4MLOA 3OYEA 2DJIA 2W82A 2IGKA 3S93A 3RPUD 3LSMA 4C2TA 5EG2A 4E4HA 4D1QA 3OYBA 5JHNA 4BXFA 4RZ0A 4O30A 4HNTA 2DOAA 1S9HA 3L2VA 1N78A 3RIBA 3TG4A 2MC4A 4IJ8A 1D1CA 1LFPA 4KJZA 3UR3C 1QHGA 4AU7A 2X6WA 4PFPA 3M59A 3MO5A 2VXDA 2XAUA 3GBGA 4CCOA 3A4CA 2K5CA 3ZRGA 4Z4PA 3UNGC 1OR7C 2MYSA 2X1DA 4BDYA 1ERDA 4YPAA 2Z1DA 3OWTA 4ZTFA 1PJRA 4N4OB 2KHMA 2LG4A 4NNJA 2LY1A 3DU6A 5TEGA 3FBNB 4P5OA 3EUAA 2GOMA 1UAAA 2HZDA 3PSFA 4NQWB 3D5RC 2VJJA 2UWMA 2JVHA 4XM3A 3SEZA 3OYHA 4XMYA 2WADA 1D0YA 3BG6A 3EUKL 2V7FA 4YEJA 3S8PA 5TGTA 4XQFA 2CW8A 4F91B 2XDVA 5CPRB 4G6TB 5LFAA 4J7IA 4XN0A 4ZC3A 2ZFUA 3HPHA 3K70C 3MKWB 3OXGA 1FMVA 5T0KA 2WAQA 4LIUA 3AFHA 2Y0SA 2VL8A 4RLQA 1DGRM 3LFUA 3KMTA 4ITVA 3OYFA 1Y56A 2E5ZA 4XORA 3VV0A 1WJCA 2E1MB 2WA0A 2W00A 4CSWA 4NVQA 3MKYB 1WJFA 4ZTJA 3DPTA 1LVKA 3H5NA 4JOMA 2R7WA 2LC2A 3ONQA 2KMUA 2WY7Q 3W2WA 2F4IA 2L2OA 2XC7A 3TL4X 4F55A 2CS3A 4YNPA 3BLYA 3QYFA 5HNHA 3S3NA 2R7XA 2O8JA 1TZLA 2E5NA 4OAZA 4PSWA 3SYTA 4B43A 3ZCOA 4PJJA 2K3PA 4ZJZA 3HOSA 3M5AA 4E7SA 5FROA 3OS0A 4XKBA 4LIVA 1JI8A 1MMGA 3VSLA 2WY8Q 4I51A 4HRIA 2VASA 1X4PA 3MO0A 3CBMA 4RMNA 4Y33A 3QODA 3S32A 2HVRA 2BVLA 5F5EA 2KL4A 4CCKA 3S7BA 4OWRB 1E0EA 4DGWB 3IP4B 1BR2A 2HDWA 3RCOA 2W1OA 3KYLA 3A2KA 4HPQA 2R7QA 4HSRA 3HOTA 3IAM2 2QKMB 4XLFA 1NG6A 2F5VA 3MD2A 1TT0A 1ML9A 1N6CA 3S7JA 1MVHA 5F6KC 5TTFA 4Y3OA 4QENA 1W36D 4CUGA 2MABA 2KDOA 4BQOA 4CA0A 3S3MA 4B44A 3OXFA 5LSZA 2FUG2 3VYRB 4WUYA 3DEEA 2IS6A 1V5EA 4C9YA 4NC8A 4B47A 4YPEA 1J09A 3LMMA 2RREA 4XKWA 3BG7A 4F52A 2L7KA 1Z7LA 5TH7A 4IZZA 2DXIA 4MI5A 1UG0A 4DBQA 3OL3A 2BVMA 2X1CA 4B3XA 4PUSA 1Z3YA 3OPEA 3OL4A 2CW7A 4FASD 3K4LA 4BACA 4II3A 4QPOA 2OV7A 4PSXA 1GLNA 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPU A;  3RJW A;  2F69 A;  4NJ5 A;  1O9S A;  3M53 A;  2W5Y A;  4QEO A;  3OXL A;  4MI0 A;  1N3J A;  5KJK A;  4H12 A;  3S8P A;  4QEP A;  5CPR B;  3HNA A;  4E47 A;  4FMU A;  4J7I A;  3KMJ A;  3QWW A;  3M55 A;  3CBP A;  3M58 A;  5F59 A;  4BUP A;  5LSX A;  3OXG A;  1ZKK A;  3S7F A;  5T0K A;  4C1Q A;  5CCL A;  1PEG A;  3F9W A;  3SW9 A;  5AYF A;  5JIN A;  3F9Z A;  1N6A A;  3TG5 A;  3KMT A;  3RAY A;  4YND A;  3BO5 A;  3VV0 A;  4NVQ A;  4JDS A;  1MVX A;  3DAL A;  3M57 A;  2BQZ A;  3CBO A;  3PDN A;  4O6F A;  4YNP A;  3F9Y A;  3DB5 A;  3MEK A;  2O8J A;  3SWC A;  5EX3 A;  1H3I A;  3M5A A;  3N71 A;  3K5K A;  5EX0 A;  1XQH A;  2G46 A;  4YNM A;  2W5Z A;  3S7D A;  5ARF A;  4I51 A;  5JIY A;  5F6L A;  4J83 A;  3MO0 A;  3OOI A;  3CBM A;  5F5E A;  3S7B A;  5CCM A;  3OS5 A;  3MO2 A;  3IHX A;  3RQ4 A;  5HQ8 A;  2JV0 A;  3FPD A;  3QWV A;  1ML9 A;  5EG2 A;  1N6C A;  3S7J A;  5JHN A;  1MVH A;  4RZ0 A;  5F6K C;  5TTF A;  4O30 A;  4QEN A;  5KJM A;  3RIB A;  3TG4 A;  2RFI A;  3KMA A;  5ARG A;  5LSZ A;  3OXF A;  4IJ8 A;  4WUY A;  3EP0 A;  3M56 A;  2R3A A;  4YPE A;  4J7F A;  4AU7 A;  5HI7 A;  3M59 A;  5TH7 A;  4JLG A;  3MO5 A;  4MI5 A;  1MUF A;  5T0M A;  4Z4P A;  5T5G A;  5KJL A;  3OPE A;  2IGQ A;  3QWP A;  4YPA A;  3VUZ A;  4IJD A;  5KJN A;  2QPW A;  4LDG A;  3M54 A;  1MT6 A;  5JJ0 A;  3F9X A;  5TEG A;  4J8O A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 2D2W A;  1X1B A;  5AIP A;  5LRR A;  1SAN A;  2R7V A;  2V1N A;  5L3C A;  4CHU A;  2VQG A;  1FTT A;  3Q9S A;  5K5O A;  3JSP A;  3EUH C;  5A2Q K;  2A6T A;  1IRZ A;  4LLN A;  5LHI A;  3ZMT A;  2IPQ X;  1N3J A;  2LKS A;  2DPU A;  4KMU X;  4Y52 J;  3L7W A;  4UNO A;  4UB6 C;  2ZNY A;  3MAJ A;  3CCJ I;  4LLL A;  4A2U A;  3HHG A;  1W5C C;  2BHZ A;  3CBP A;  2MG4 A;  3S7F A;  3TW7 A;  5H20 A;  1AOY A;  1LUJ B;  3FXJ A;  1VQL I;  1SMT A;  5BOX A;  2JRM A;  3DBL B;  2Q2E B;  5HLG A;  4EM1 A;  2WAF A;  1ZRD A;  5DM7 F;  1ZLK A;  5EEH A;  3H3V K;  1QU3 A;  4LG0 A;  3FK6 A;  1PUF B;  1TT5 B;  3HBL A;  2QSG X;  5DYM A;  3JRD A;  3RTR A;  1KON A;  1PUF A;  2A68 F;  2K4B A;  4IRH A;  3SZT A;  1EF4 A;  2DFI A;  4FHT A;  3KZI C;  4V2G A;  4BYY A;  3VB2 A;  3TBI A;  2BV6 A;  3DB5 A;  2Y30 A;  3BCA A;  1FYL A;  3O3K A;  3KP6 A;  2Q1Z B;  5GTI C;  1TNT A;  5LLQ A;  1S7E A;  2FF4 A;  1IDZ A;  5L3E A;  1EH8 A;  2CQ7 A;  2IA0 A;  1OYW A;  3DFG A;  3EYY A;  3ZXS A;  2QM3 A;  2MLG A;  2LKX A;  1M1E B;  3DQV C;  3RZD J;  5E3O A;  2VBZ A;  2XGD A;  3E6D A;  3HXL A;  1F9N A;  5J4V A;  1OJL A;  3WTX C;  1N75 A;  4XSZ F;  1TWA J;  3OOP A;  1Z05 A;  4IKF A;  5JLX A;  3H5A A;  4J00 A;  2X51 A;  2JWT A;  1Z9C A;  1GDT A;  2FBH A;  2GXA A;  1ZKG A;  1SD6 A;  2BY3 A;  2LP0 A;  3K9T A;  1FLI A;  1LVA A;  3ZQL A;  4QLC U;  1XX5 A;  2F4M B;  2FBI A;  2BY0 A;  4DYC A;  2D5V A;  1X1A A;  4CDG A;  2B0L A;  2Z3Y A;  2IXS A;  4FE7 A;  2RQP A;  4DJA A;  4LLG F;  2KLO A;  3FXR A;  5ILS A;  3HTU A;  3NAU A;  4BBR J;  4EJU A;  1ZGW A;  1FBU A;  4HG2 A;  3F8M A;  2K27 A;  4HYE A;  2XB0 X;  4A12 A;  4F92 B;  5KJN A;  2QPW A;  2F4O B;  3K4N A;  2R93 J;  5HNF A;  1IUF A;  2E35 A;  2LH9 A;  1PDN C;  1ORK A;  1RUN A;  3AKZ A;  3AL0 C;  2HPM A;  3FK7 A;  2DK8 A;  3KPH A;  2P5L C;  2FJ1 A;  3OYL A;  3D5S C;  4KYW A;  1G8X A;  1Z3X A;  5IPA A;  5BPI A;  4XLN F;  2HVS A;  4XR6 A;  1KYW A;  5JVG F;  1V5F A;  4F3Q A;  4HQE A;  1ETX A;  3GUD A;  1ZLJ A;  5CQG A;  4RB3 C;  4CIC A;  4HQM A;  5D6F A;  4ESJ A;  3KEO A;  1MNE A;  2UXX A;  5LSX A;  5HS8 A;  4IQJ A;  3I59 B;  1QZY A;  1MSE C;  3GWZ A;  4JQF A;  3IKV A;  1DGW Y;  4RGS A;  3F9K A;  1ZAR A;  4N9I A;  1S5L C;  5GAG J;  1SMY F;  5L3F A;  4RAG A;  5D5W B;  5FGM A;  1BM9 A;  4GFB A;  4YND A;  2KPM A;  5EZH A;  2XF7 A;  4BHB A;  5B3S H;  2NAZ A;  4XBF A;  4B3A A;  4A3G J;  5LHG A;  1LFU P;  1YFH A;  2X6X A;  3K4K A;  2DW4 A;  2XSD C;  3TP0 A;  5J6X A;  3QWL A;  1MMD A;  1R1U A;  2E2I J;  1K4S A;  3QPL A;  3F9Y A;  3SWC A;  2OQR A;  1JJ6 C;  3GFM A;  2OZU A;  4JX5 A;  2GBY A;  3ZMS A;  2LR8 A;  3A0B C;  4J19 A;  5HOO A;  2Z16 A;  4Y13 A;  4A0X A;  2W84 A;  1GHC A;  3SFI A;  2VQL A;  3QOE A;  2E2H J;  3DTK A;  4Q48 A;  4C3J J;  1YX3 A;  2V1X A;  3CJR B;  3RSN A;  3BDD A;  2XPV A;  1LEA A;  1FMW A;  2VJ5 A;  1DP3 A;  1YHQ I;  4O5V A;  4DNC A;  1IG7 A;  2UV1 A;  2HTJ A;  3CO6 C;  3FPD A;  4PGH A;  5F1J A;  3I4P A;  4HA8 A;  4XLC A;  1FBS A;  1WJD A;  3TED A;  4HF1 A;  4U87 A;  3LSI A;  1VQK I;  4G6Q A;  2VN2 A;  2NVQ J;  2HPI A;  4O6J A;  3MEX A;  2OQG A;  2H27 A;  2DMT A;  3KMA A;  2YU3 A;  5F27 A;  3L2W A;  2IS2 A;  5FRM A;  3GLX A;  3HG9 A;  3GTP J;  3PNT A;  3RYP A;  2L4M A;  3KYD B;  4RGX A;  5HI7 A;  1T38 A;  3OYC A;  4A3E J;  4UVC A;  1SEU A;  3G1O A;  3UKG A;  4I7H A;  4BJ5 C;  2DN0 A;  4E7K A;  2VB6 A;  4QIW N;  2IGQ A;  4DYQ A;  4IJD A;  3ECO A;  2OAZ A;  1XB4 A;  1V5G A;  3PSI A;  4FCY A;  1IXR C;  5LEK A;  3M54 A;  1C0W A;  2ZJ2 A;  3EET A;  2DQL A;  2E19 A;  2YX7 A;  2VE9 A;  3CCE I;  3RJW A;  2F69 A;  2QEX I;  1B8I B;  4MEY F;  1Z6R A;  4XN3 A;  3VYU B;  1SAX A;  2ZXH A;  1O7L A;  3OYA A;  2PQ8 A;  3FXU A;  2WB1 N;  1IO2 A;  3WTW C;  2Y48 A;  1SVO A;  1P4W A;  2ELJ A;  5E1X A;  3FM3 A;  3HOY J;  3P9K A;  3CF2 A;  3RQI A;  1J0R A;  4BJ6 C;  4ZH4 F;  5KHD A;  3CTA A;  1U6G A;  1FBQ A;  1U2W A;  2XF6 A;  1UHW A;  2W7N A;  4IVN A;  2V26 A;  4P1W A;  3HSR A;  4BUP A;  2BW3 A;  3E5X A;  2DI3 A;  2EB7 A;  1K79 A;  1P92 A;  3CCU I;  2FMY A;  3LSH A;  2HTS A;  2J5P A;  4XLH A;  1MDM B;  3QOP A;  3WOD F;  3RAY A;  3FWE A;  1Q1V A;  3TP3 A;  3I3L A;  2BOL A;  2VXZ A;  1OFC X;  4E70 A;  3ABK H;  3DF8 A;  4IOC F;  2LOO A;  3DAL A;  5H6R A;  4BQA A;  2D1H A;  2CV1 A;  4DIQ A;  3QPS A;  4BDZ A;  2EIK H;  4Q47 A;  3E0J B;  3EPZ A;  3MWM A;  2VE8 A;  2GQQ A;  2LYC A;  2MGQ A;  5CLS A;  4WX9 A;  2MFZ A;  3S17 J;  1X1C A;  4Z2Y A;  2K9S A;  3K5K A;  3DKW A;  1YJN I;  2A3S A;  2G46 A;  3OYN A;  2R3S A;  1JJ8 C;  4HLY A;  1WH5 A;  4AYB A;  2QQB A;  4HLX A;  4IQ4 A;  4BL0 B;  1Y8R B;  4DYR A;  5DM6 F;  3OIP A;  3HHH A;  3P5J A;  4NHJ A;  3HRU A;  2EV0 A;  3OV8 A;  3B6C A;  3OYE A;  2DJI A;  2W82 A;  5IYC J;  1SFO J;  4IL6 C;  1S7A A;  1QVT A;  2DQR A;  5BQT A;  2DT5 A;  4E4H A;  4G7O F;  5JHN A;  2YS9 A;  2CW0 F;  4BXF A;  4I2O A;  4RZ0 A;  1KYZ A;  4HNT A;  1VF9 A;  1K61 A;  1UFM A;  3LAJ A;  3S1N J;  1YRN A;  1F5T A;  1ETO A;  2DMN A;  1F1Z A;  1WKM A;  3BTI A;  4L5I A;  2TRT A;  1GV2 A;  5IOZ A;  1YTY A;  3HOW J;  2PI0 A;  2A6E F;  4AU7 A;  5DUI A;  2CQN A;  4PFP A;  1LQ1 A;  2VXD A;  1QRY A;  4CCO A;  1TTY A;  2ELK A;  1R7J A;  4UUT A;  4O3M A;  2VC0 A;  2LDU A;  1Z6T A;  4Z4P A;  2MYS A;  3GTJ J;  3CUO A;  3OWT A;  4M9Z A;  1T8I A;  1KU9 A;  3K1M A;  3RI4 A;  2KHM A;  1IZ1 A;  9ANT A;  3NRV A;  2LY1 A;  3TW6 A;  1S29 A;  1WI3 A;  2FXA A;  3V4G A;  1RES A;  3E3V A;  2YX4 A;  1MBK A;  1Y0U A;  1ZRF A;  4ON0 A;  3ZQC A;  3V8L A;  2WAD A;  1D0Y A;  3REO A;  3QRF F;  2PMZ N;  2P6S A;  3EUK L;  4HX8 A;  3I71 A;  4KUM A;  2CW8 A;  2L9V A;  3ZN1 A;  5ED4 A;  5M3F J;  3B6A A;  4WXC A;  4G12 A;  3K70 C;  2JZY A;  4B8X A;  2JRT A;  2QWW A;  4RLQ A;  5F0C A;  2PMH A;  1VQO I;  1LJ9 A;  3F22 A;  3KMT A;  1J7K A;  4ITV A;  4M6V A;  3OYF A;  3JW4 A;  1ACI A;  3C18 A;  2B9S A;  1ETV A;  1QQI A;  1B59 A;  5HOD A;  2R5Z B;  1JUP A;  3DPT A;  3ISP A;  2H6C A;  3TOA A;  2BBY A;  3H5N A;  2EZH A;  5CVU A;  2BGC A;  4RB2 C;  3WHC A;  1LFB A;  4JK1 X;  1QA6 A;  3ONQ A;  2WY7 Q;  1OR7 A;  3H3U A;  4CO8 A;  3HOU J;  2HI3 A;  2RAE A;  2Q8K A;  2OZ6 A;  3H36 A;  1MGT A;  3BLY A;  3MVP A;  1Z67 A;  5J3L A;  3DLL F;  1TW3 A;  3HOS A;  4H0E A;  1FY7 A;  3CJN A;  4PJ0 C;  3BG3 A;  4LIV A;  2IBD A;  1JI8 A;  3VSL A;  2KFD A;  1BIA A;  4AIK A;  2K9N A;  2WY8 Q;  1X4P A;  1XS9 A;  3S1Q J;  3CBM A;  4I0B A;  3S32 A;  5D5U B;  1OIS A;  4MFD A;  1KQ8 A;  2EFO A;  3KP5 A;  3CME I;  4XRS A;  4M9S A;  5EG0 B;  1XGO A;  3MFK A;  2FQ3 A;  4KIC A;  2W1O A;  2P8T A;  4HPQ A;  5LEJ A;  3HOT A;  3VPR A;  4XLF A;  1SD4 A;  1TT0 A;  3GEZ A;  1XSD A;  2JT1 A;  4LD5 A;  3VEP A;  3HSE A;  1MBF A;  2MBF A;  1FC3 A;  2QVO A;  5JFR A;  1OQY A;  4ETS A;  2EFW A;  4EGY A;  1W36 D;  1UJ8 A;  1CF7 A;  4EJT A;  3WGH A;  2KDO A;  3I64 A;  4CA0 A;  5LSZ A;  3OXF A;  5TRD A;  1APL C;  3CUQ B;  1T33 A;  2R92 J;  2NS0 A;  3BR0 A;  3U9G A;  2K85 A;  1YIO A;  4YPE A;  1D3Y A;  3LMM A;  1SD7 A;  1K4T A;  1Z7L A;  2BHY A;  5TH7 A;  3ZMV A;  2HKX A;  2JA8 J;  4MI5 A;  2Q2E A;  3OL3 A;  2DFF A;  4A5N A;  3JRG A;  2P5K A;  4EQQ A;  2NVX J;  4LG0 B;  4EM2 A;  4EMS A;  3OL4 A;  1POG A;  3S14 J;  1JHF A;  1BI2 A;  2Y31 A;  4II3 A;  3KET A;  4A93 J;  4UB8 C;  2ISY A;  3T0Y A;  2JSP A;  3GZN B;  2QCO A;  5DUK A;  6PAX A;  1VQ6 I;  4RGU A;  4CZC A;  5LBQ A;  2AO9 A;  5KJK A;  4H12 A;  3QU3 A;  1G2H A;  5CQE A;  3B02 A;  1T6S A;  4NC6 A;  3M7G A;  5F1R A;  3CF5 F;  4MHG A;  1XG1 A;  4BS9 A;  2CYY A;  3K7A J;  3WG7 H;  2EV5 A;  2RNG A;  1WFX A;  2L9N A;  1K78 B;  5FO5 A;  1USS A;  1UEL B;  5AIQ A;  1WVR A;  2FBK A;  3FZV A;  1BW6 A;  3JRC A;  4XOT A;  3OS2 A;  1QZZ A;  1WJ5 A;  1Y8Q B;  5EDN A;  2O0Y A;  4MQ9 F;  3S1M J;  1YLF A;  3ZPL A;  3E5U A;  1IN5 A;  3H5R A;  3V7C A;  1D1A A;  1SVL A;  2DA3 A;  1ZGA A;  3FKJ A;  1IW7 F;  4V2F A;  2Q0O A;  1S8N A;  4MO7 A;  4ZYA A;  3G1L A;  1U5T A;  4ANJ A;  1R49 A;  3BY6 A;  1IRX A;  4E7H A;  4F93 B;  5DD8 A;  3R0A A;  3FIW A;  1FX7 A;  2FQ4 A;  3KX2 A;  1WJB A;  1ZH5 A;  1FP2 A;  4RS8 A;  2XKO A;  1MBH A;  3CP8 A;  1R4N B;  4FQG A;  4OIO F;  1GVD A;  4C2U A;  1MKM A;  1VZ0 A;  3TO9 A;  3S7D A;  4KT6 A;  1G3W A;  3ZR8 X;  4PJM A;  3T8T A;  3VOD A;  1JXS A;  2FNA A;  2NOG A;  3QPT A;  1MNM C;  3MZ8 A;  4N4N B;  3H9G A;  1I1S A;  3CJT B;  2RQQ A;  3BP8 A;  5DCF A;  3RQ4 A;  1HXD A;  5IT3 A;  2JV0 A;  2A5Y B;  5ICG A;  1KQ0 A;  1MJA A;  4M6X A;  4HEA 2;  1DUX C;  4D7N A;  3QWV A;  1P7I A;  2Z99 A;  2M7B A;  2PJR A;  1OLT A;  4GDF A;  3WU0 A;  2MD0 A;  3TQN A;  2FOW A;  1AWC A;  5KJM A;  4UUS B;  2JPC A;  3CDL A;  3Q0U A;  4A5M A;  1WZ2 A;  3M56 A;  1G3S A;  4M73 A;  3FMQ A;  2CGP A;  5IY5 H;  1REP C;  3L2Q A;  4FTH A;  2GOX B;  2ZME A;  2KZG A;  3E1S A;  3K4C A;  3TO6 A;  2W4S A;  3KCC A;  5D8K B;  4U7D A;  3I9V 2;  3Q5F A;  1VQ7 I;  1MUF A;  3ERE D;  3PQK A;  2CQK A;  5JHF A;  4OU0 A;  4MEX F;  2DA4 A;  3K4J A;  5E1W A;  5DTD A;  2EIM H;  2X1E A;  2GLO A;  3CCQ I;  4J01 A;  1MJB A;  1R9T J;  1CQT A;  3GZ5 A;  4YFX F;  4RLF A;  1RR7 A;  1Z0X A;  4ENM A;  1XSX A;  1MMN A;  3DCF A;  4J8O A;  2EH3 A;  4L0Z B;  4LIT A;  3L00 A;  1YW7 A;  3GX4 X;  2JK3 A;  2GIZ A;  4BU2 A;  3HOV J;  4CYC B;  2HQ5 A;  4I98 B;  3PNY A;  1RI7 A;  4QPQ A;  4WXH A;  3RJP A;  4AVZ A;  3M53 A;  3A01 A;  3TO7 A;  3F6V A;  1RR8 C;  1R4M B;  5HVQ C;  3D1N I;  1T95 A;  5EYR A;  1U8R A;  2DPD A;  2MC3 A;  3ABT A;  1WRJ A;  3OYM A;  4E47 A;  3F8B A;  4W97 A;  4YFN F;  4IX7 A;  4MTD A;  5FLV A;  3NWS A;  3RPQ A;  4IHY A;  3VYS B;  2M5W A;  2E7X A;  5EGO A;  1ZEL A;  4CCJ A;  3RKY A;  2NS8 A;  3PL8 A;  2OTJ I;  4A0Z A;  1FYK A;  1IN4 A;  4C1Q A;  1JTY A;  2IS4 A;  3OOU A;  2KRF A;  3LNQ A;  3GCM A;  2C6Y A;  5HLH A;  1SFE A;  5EJC A;  4EM0 B;  2GM4 A;  1JKR C;  3BOQ A;  3L1P A;  2L4A A;  4NB5 A;  2QBY A;  2P5V A;  3E6M A;  3G73 A;  3F23 A;  3M1C A;  3ZQG A;  4KIS A;  3M57 A;  4M3D A;  3CBO A;  1WCM J;  2BY2 A;  2JUG A;  2KDZ A;  5ILV A;  4D5F A;  2VLA A;  4BGD A;  2V4J C;  4A0Y A;  2XSJ C;  4HF2 A;  4A3B J;  3PNV A;  1O57 A;  1B9M A;  4HX7 A;  3WU1 B;  2DFE A;  1U0J A;  1OKR A;  3IWZ A;  5LGT A;  3M4O J;  5EX0 A;  2P4W A;  3J80 K;  2UUZ A;  1WSU A;  2L01 A;  1P4A A;  2K9M A;  4PJN A;  3ZGK A;  4CH7 A;  1HC8 A;  3ASN H;  4PCQ A;  5F04 A;  4KDP A;  3SDB A;  1XCV A;  3BT9 A;  1JE8 A;  2RKH A;  1NK3 P;  3BC8 A;  2HDD A;  1ZK8 A;  5CCM A;  2NVY J;  2FX0 A;  4XRS G;  1TQP A;  4DOZ A;  1QVU A;  3CCY A;  3PFY A;  3OIO A;  2HOA A;  4CZZ A;  2KRH A;  2I8D A;  2ZXW H;  3NWT A;  1FJL A;  3CC7 I;  2PLY A;  2JA6 J;  4LMY A;  4EJO A;  5C4X J;  2K7L A;  1I3Q J;  4LG3 A;  3AL0 B;  3GTM J;  1YIT I;  4BXU A;  2CH0 A;  4Y15 A;  2A61 A;  1BR4 A;  1OYY A;  3EP0 A;  5JI6 A;  4G6D A;  4B48 A;  2CU7 A;  2VKV A;  4HST A;  2PJP A;  5E1Z B;  3RKX A;  4JLG A;  2XAH A;  1ZG3 A;  1U9O A;  2CRG A;  2V1D A;  1BIB A;  1KQ9 A;  3OYD A;  1FP1 D;  4LGW A;  4GYI A;  1XDS A;  4KN4 X;  1HQC A;  4GYG A;  1VQN I;  1R5I D;  3G1M A;  1YRN B;  4YPU A;  1W7P A;  1MH3 A;  4PFO A;  2R7S A;  3MN2 A;  3CP2 A;  2CUZ A;  2M2E A;  3K2A A;  3LSJ A;  2RVC A;  1R6R A;  3M3Y J;  5HDG A;  3AAF A;  4OMY A;  4NBQ A;  1FIP A;  1HKT A;  3OR1 C;  2WBM A;  3NAR A;  5HLT A;  3LSR A;  1HCR A;  4MI0 A;  2VOO A;  1BOA A;  1R1T A;  3RDI A;  3U21 A;  3C2G A;  3S3O A;  3QWW A;  1BR1 A;  2M3A A;  1QZE A;  2STW A;  3WTT C;  4TV7 A;  3H1C A;  4MGR A;  4L0Y B;  2HOS A;  2WAE A;  1ZKK A;  1UG2 A;  1J59 A;  3N97 A;  3DTI A;  2HYJ A;  2VOD A;  3V8J A;  2H09 A;  1H8A C;  3F9Z A;  3FXO A;  1N6A A;  5J8F A;  4PZJ A;  1YIJ I;  3FBI B;  1FPQ A;  3JSO A;  1GV5 A;  3TMO A;  5B1A H;  4BBS J;  1U5T B;  3S15 J;  3PDN A;  3NQO A;  1JT0 A;  1PYV A;  5LGU A;  2NNY A;  5DS9 A;  2CV0 A;  1A36 A;  1HDD C;  5K5Q A;  4E7J A;  2E7W A;  1WJE A;  2P0W A;  4V19 K;  2BE5 F;  4XLP F;  3CZ6 A;  3BCB A;  4S05 A;  4RBO A;  1GUU A;  3G2B A;  4AIJ A;  4CGZ A;  2FU4 A;  3QQA A;  5JIY A;  3GVA A;  4ZZL A;  5CVV A;  4B4C A;  3M8F A;  4ESB A;  2X0L A;  3KZY A;  2LBF B;  1ETW A;  5B1B H;  1D1B A;  4JP0 A;  2GAU A;  3BPV A;  2G0E A;  4L9J A;  3S2W A;  3G4S I;  1ITY A;  1ETK A;  2GIV A;  3LWF A;  3MZY A;  1TLH B;  2M8G X;  3S16 J;  4N0B A;  5M5X J;  2L54 A;  2FRH A;  5EG2 A;  5JLW A;  5JHU A;  1V4R A;  3HB9 A;  4A3M J;  1ZHF A;  2KKO A;  4O30 A;  4I02 A;  2TCT A;  2CO5 A;  2DOA A;  3L2V A;  4IHS A;  2EV6 A;  1J2X A;  1QPM A;  1N78 A;  2OD5 A;  1ZTR A;  2FNP A;  4IJ8 A;  3K1N A;  2QSF X;  2L02 A;  5GPA A;  2ADU A;  2XAU A;  3U1K A;  1FOX A;  4LOC A;  2OTL I;  3PIP F;  1HSJ A;  1XMA A;  2JSC A;  1A04 A;  1BI1 A;  3T1B A;  1D8J A;  4P9U A;  3FMS A;  5H6Q A;  1Y39 A;  3FIS A;  2LK2 A;  5CJ9 A;  4YFK F;  1OR7 C;  4BDY A;  4RDU A;  4HOB A;  4G7H F;  4ZTF A;  3ZN0 A;  1PJR A;  1TWF J;  2A05 A;  4K2E A;  1OMI A;  5TEG A;  1XC5 A;  2HYF A;  3EUA A;  2DYS H;  3B73 A;  1UAA A;  2QF7 A;  2KIQ A;  1T39 A;  1K6O A;  4P96 A;  2ME6 A;  1IN7 A;  2UWM A;  2XRO A;  2JVH A;  2W57 A;  3BG6 A;  1QPI A;  1WH7 A;  2XDV A;  2DMQ A;  2PX9 A;  1F36 A;  2I10 A;  4G6T B;  1S6L A;  3ABM H;  4J7I A;  4YIR X;  3C7J A;  1I5Z A;  1IV6 A;  3MKW B;  3OXG A;  1OCZ H;  1I6H J;  1LNW A;  5HDN A;  3R6S A;  2ZME B;  1IN8 A;  4LIU A;  3H92 A;  2Y0S A;  3I4M J;  2CWE A;  1IC8 A;  1DGR M;  3LFU A;  1MZB A;  4AIH A;  3VV0 A;  1WJC A;  2CJJ A;  2DU9 A;  3KEQ A;  4C3H J;  3LA7 A;  2VT3 A;  1DU6 A;  3BTL A;  2LMD A;  2XVC A;  3U2R A;  3HEF A;  2KMU A;  3W2W A;  3TL4 X;  2ZBK A;  2CS3 A;  2JA5 J;  4YNP A;  3QYF A;  2IRF G;  5FJ8 J;  4OAZ A;  1HW2 A;  2IS1 A;  2HEO A;  4PJJ A;  2K3P A;  4UUS A;  3KYC B;  5FRO A;  2WC2 A;  2EZL A;  5E8I A;  2O8K A;  2ZNZ A;  5F64 A;  5E8G A;  4AWX B;  3MO0 A;  4Y33 A;  2HVR A;  4KMF A;  1XGN A;  3LSP A;  3ABL H;  1IN6 A;  3GYH X;  2OBP A;  3I55 I;  1DPU A;  3A0H C;  4DGW B;  1BR2 A;  2HDW A;  2XAJ A;  2O61 A;  3A2K A;  3RIR A;  2R7Q A;  2XAG A;  3BZ6 A;  3MD2 A;  5FD5 A;  5JVT A;  3S7J A;  4RAF A;  3I4N J;  3KLN A;  1QNT A;  5TTF A;  4S0H B;  3CDI A;  2IJL A;  3RKQ A;  1X2M A;  1H9G A;  3S3M A;  4B44 A;  5M5Y J;  2IS6 A;  5E79 C;  2RV8 A;  2VON A;  4NC8 A;  2DOD A;  1J09 A;  1XGM A;  4F52 A;  3BG7 A;  4M3E A;  2L7K A;  4IZZ A;  2DXI A;  3ML6 A;  3EDP A;  3FHZ A;  4I76 A;  2CQQ A;  4FT8 A;  2W24 A;  1B1B A;  3QPH A;  4PUS A;  1V54 H;  3SQN A;  3J7Y J;  3W6V A;  5C4J J;  1XSV A;  1ZRC A;  4PGG A;  5D6E A;  2ZCW A;  3PQJ A;  2KT0 A;  4MQV A;  4ENK A;  3OYJ A;  2R7U A;  3I59 A;  4NJ5 A;  4YRV A;  3HYI A;  2AXT C;  2DJN A;  2F5C A;  2CFO A;  5KK1 A;  2G9W A;  4QEO A;  3KP2 A;  5FLM J;  3LFK A;  5FFZ A;  3BZC A;  3GO5 A;  3QU6 A;  5GAE J;  5JR3 A;  4WF2 A;  2DA5 A;  4I99 C;  2NVU B;  1W5T A;  1XTA A;  2XHK A;  2JA7 J;  3H9Q A;  1U5T C;  3GTL J;  1IRF A;  1MIJ A;  1AHD P;  3PJR A;  4BE2 A;  2YPR A;  4BNC A;  4RGR A;  2EK5 A;  2WV1 A;  5LRS A;  1AKH A;  5FRN A;  3SW9 A;  2IVM A;  1OYI A;  1WGX A;  5J40 A;  5DCM A;  4CXF A;  4C3I J;  2QUF A;  3FXQ A;  3G3Z A;  2ESN A;  3K10 A;  2DT7 B;  4NQW A;  4RAZ A;  3ZMU A;  1IXC A;  1JGG A;  1FZP B;  4JDS A;  2LVS A;  5AON A;  3PM1 A;  5F08 A;  3ESW B;  5ICF A;  4C30 A;  4FIS A;  4U0Y A;  3ZQQ A;  1EA3 A;  1A5J A;  2RNJ A;  1ZRE A;  1YS6 A;  2DYR H;  4IXA A;  4O6F A;  1JKP C;  5GPC A;  2MD5 A;  1MSF C;  4ZDO A;  2RN7 A;  1H3I A;  1K6Y A;  2NS7 A;  5BS6 A;  2QGU A;  2R5Z A;  1QBJ A;  2V6E A;  2M7A A;  3E97 A;  2ICW G;  1MMA A;  2W5Z A;  4I09 A;  5ARF A;  1TBX A;  4HF0 A;  3O2P E;  4X1E A;  3C2H A;  4BY1 J;  3BRO A;  3DP7 A;  3K70 D;  3CLQ A;  2RGV A;  1RRJ A;  2XRL A;  2VJI A;  2MH2 A;  4BE0 A;  4XL9 A;  2M87 A;  1W5S A;  2LLK A;  2LY9 A;  1I6X A;  3HTS B;  4M6Y A;  4CCM A;  2LRE A;  5HQ8 A;  3I53 A;  3N4M A;  3GTO J;  4GGG A;  2BZT A;  2ZJP F;  2DO7 A;  3LA2 A;  4L9V A;  1FOY A;  4HZF A;  2VKD A;  5HLI A;  3SZP A;  4ABZ A;  4D9J A;  2X85 A;  2H1K A;  3VDX A;  4HV6 A;  1SFX A;  1PP7 U;  3EUH A;  4RM3 A;  3IH4 A;  4IHV A;  5GTH C;  3JRE A;  2HS5 A;  1LE8 A;  1JGS A;  4E7I A;  5T5G A;  2R4G A;  4AVP A;  3A03 A;  3K6G A;  1TQI A;  4IEJ A;  3JRA A;  3W2A A;  3CJQ B;  3F9X A;  2X9D A;  3HM5 A;  2OUM A;  4RAY A;  1ETQ A;  3OY9 A;  1YX5 A;  2IGM A;  1AA7 A;  1FNN A;  1TC3 C;  3DWL E;  1STZ A;  4HDV A;  3PO3 J;  1D5Y A;  5CVJ A;  3DKX A;  2VUM J;  1PUE E;  4XK4 A;  4D7M A;  4Q4Z F;  5E3M A;  4DW6 A;  1RZ4 A;  1BJZ A;  2L9S A;  2UZK A;  1VTN C;  1JT6 A;  2JA2 A;  4LK0 F;  5J47 A;  4CCL A;  4FMU A;  3ABU A;  2XPW A;  1K7A A;  4II2 A;  3V42 A;  3P7N A;  2ECC A;  1G4D A;  2DOE A;  1X2N A;  1YW9 A;  1W7P D;  4FET A;  1R71 A;  1TP4 A;  2ECB A;  4I01 A;  2L7Z A;  2HQR A;  3Q9V A;  3HDD A;  1H88 C;  3WTZ A;  5AYF A;  1YJ9 I;  1D0X A;  1WPK A;  3CES A;  2O8X A;  2HVQ A;  2IW5 A;  2M8E A;  3PIO F;  1H0M A;  4L9T A;  1DDN A;  4EEF G;  4JYK A;  3HL2 A;  4EJV A;  3V7S A;  2ZSI B;  2ID6 A;  4UV8 A;  2L3D A;  2EZI A;  1FWZ A;  4M9X A;  2K3F A;  5BPD A;  3DU5 A;  5ICC A;  3MEK A;  3GXO A;  2M0C A;  5K7F A;  3A1Y A;  1CGP A;  2P7C B;  2F48 A;  3F3X A;  3Q0V A;  1I50 J;  1W0T A;  3HRM A;  4HNU A;  2ZXI A;  1BBY A;  1HKS A;  4Y7N J;  1VQ4 I;  5GP9 A;  2HU9 A;  1E2X A;  3WE3 A;  3LAP A;  1O3R A;  1DPR A;  1MBE A;  4J83 A;  5ERI A;  2JJ7 A;  3TDZ C;  2DMP A;  2DDA A;  1HA8 A;  2O6G E;  1S3J A;  3CMA I;  3GFL A;  1YYV A;  2IEK A;  2GXB A;  1P6R A;  3I56 I;  3OS5 A;  1YS7 A;  5FFX A;  2IA2 A;  3VFZ A;  2XB5 A;  3IHX A;  3FDY A;  1YO5 C;  4ZDL A;  4AUX A;  4CCN A;  3S1R J;  2VQH A;  2Y9Y A;  3DTE A;  1NTC A;  3KP7 A;  2NRA C;  3W6J B;  3GF2 A;  1J75 A;  3IH2 A;  2QA4 I;  1R23 A;  2V9P A;  3GTK J;  3H35 A;  1MJ9 A;  5D5X B;  4BH9 A;  4RB0 A;  5E18 F;  5A2Q Z;  3MKL A;  2R7T A;  4IHT A;  2M30 A;  4BHP A;  5C3E J;  1D5V A;  4Y4R A;  1U8B A;  1NG7 A;  3V8K A;  4XRF A;  3HUG A;  1IGN A;  2X6Y A;  1LDK B;  1SAU A;  3BQY A;  1J5Y A;  4A6E A;  4LDG A;  5D4R A;  3CQZ J;  3IHU A;  2DAO A;  3HGY A;  2H8W A;  4UVA A;  4WXD A;  3IC7 A;  2G7H A;  2E1M C;  2FOK A;  4NUB A;  2W5Y A;  3HZJ A;  4XKV A;  2CMP A;  3GW2 A;  3DV8 A;  2FD5 A;  2WWY A;  2Z9O A;  4PJL A;  2AHQ A;  2K9Q A;  4A3F J;  2EZK A;  3R60 A;  5C44 J;  2MW8 A;  4FE4 A;  2VI6 A;  3HIF A;  3MKZ A;  5D4S A;  2XV4 S;  1WJA A;  2K02 A;  2LBF A;  3LL7 A;  1Z7U A;  3KMJ A;  2X48 A;  3IKT A;  4IF4 A;  1ZGJ A;  1X3U A;  1YQA A;  4A3D J;  2QSH X;  2KP6 A;  4PK4 A;  4MTE A;  4EVI A;  4ZDP A;  5ICE A;  3A01 B;  2F5D A;  4U7B A;  2KIU A;  2Y0M A;  1LDJ A;  2R7O A;  1RET A;  1ON2 A;  3WTS C;  3LQQ A;  1R36 A;  1JUM A;  1SD5 A;  1R58 A;  4AC0 A;  4I0A A;  1UCR A;  3HUG B;  4ZYH A;  4M74 A;  1OCR H;  4HW0 A;  1LKX A;  4A69 C;  2ZKZ A;  5EGO B;  3SZG A;  2BQZ A;  2NNN A;  2Z33 A;  3J7A Y;  1EJ9 A;  1A6I A;  4UXN A;  4NDL A;  3L2R A;  1KZH A;  4B09 A;  3HGG A;  1U78 A;  1O7F A;  4A3I J;  2F6C A;  2R7D A;  5E20 A;  4KIF A;  1XQH A;  3PO2 J;  1E3O C;  5HS7 A;  1D0Z A;  3K1P A;  2NOJ B;  3IV5 A;  1TWC J;  2OC6 A;  3CO7 C;  4OIP F;  4E7L A;  3CD6 I;  3IUO A;  2DA6 A;  4DBR A;  5BMZ A;  5M5W J;  1MBG A;  2R5Y B;  2IA1 A;  3VOE A;  3F21 A;  3MO2 A;  4Q5S F;  4MLO A;  2ISZ A;  5D8L B;  1UHS A;  1KA8 A;  4X6A J;  1MH4 A;  3RPU D;  4QTR A;  2L9R A;  2X4H A;  2F2E A;  4R8H A;  1ONV A;  1X1P A;  1W0U A;  2L7F P;  1WQ2 A;  3OYB A;  4OIN F;  1KGS A;  4ASN A;  2D45 A;  2MC4 A;  1D1C A;  1JUS A;  1JKQ C;  5FLX Z;  1LFP A;  4KJZ A;  3UR3 C;  3CC4 I;  3TDU C;  5E3N A;  5EG0 A;  1B9N A;  1X58 A;  2BXY A;  2IP2 A;  2X6W A;  1HLV A;  4LB5 A;  3M59 A;  4RA2 A;  1I27 A;  2ZXJ A;  2UXN A;  1YOV B;  3A4C A;  3HSF A;  1LDD A;  3ZRG A;  3GFJ A;  1LE8 B;  2DA1 A;  3BQZ A;  2X1D A;  1ERD A;  2Z1D A;  3RPU A;  3ROU A;  4G8X A;  3GLL A;  1X3W B;  3GTG J;  4NNJ A;  4A3K J;  3DU6 A;  3C3W A;  4UHT A;  5KAI C;  3FBN B;  2A6H F;  5F6F A;  4P5O A;  2H94 A;  2MSY A;  4IHX A;  1NK2 P;  1EH6 A;  4M3B A;  3KP4 A;  2HZD A;  3PSF A;  1XDU A;  3KFW X;  4M3F A;  2VJJ A;  3O8H A;  1BC7 C;  2QQ9 A;  1GT0 C;  3SEZ A;  4AYB N;  3OYH A;  3J7Z I;  1EV7 A;  2G7U A;  1UHM A;  4YEJ A;  3S8P A;  2EFQ A;  4XQF A;  5CPR B;  4P55 A;  4OMZ A;  3SXY A;  4XN0 A;  4HBL A;  4LB6 B;  5J1R A;  3CCM I;  1IUY A;  1XPX A;  4BHC A;  2IT0 A;  3C1D A;  3BR1 A;  4JX4 A;  2W48 A;  2ACJ A;  1W4M A;  1FMV A;  5T0K A;  2ZC2 A;  2LD5 A;  5E17 F;  1I39 A;  2KJB A;  2EIL H;  3AFH A;  3ASO H;  3COA C;  2VL8 A;  1O3S A;  4YII A;  1IF1 A;  3AG2 H;  4BKX A;  2E5Z A;  1KU2 A;  2CUF A;  3FMR A;  4JX6 A;  2E1M B;  2W00 A;  3SFZ A;  1SC7 A;  4IRG A;  1WJF A;  4EJW A;  1XD7 A;  4ZTJ A;  3M07 A;  5FKN A;  3EQL F;  3HRS A;  2AS5 F;  1UMQ A;  2LC2 A;  2H6B A;  5KVR A;  2HZT A;  3GFI A;  3CMY A;  2F4I A;  3BJ6 A;  5IT9 K;  1VND A;  1NHA A;  3S3N A;  5F0F A;  5HNH A;  1MDM A;  1J9I A;  1TZL A;  2O8J A;  4ZJZ A;  4PSW A;  4B43 A;  3F0C A;  5DCM B;  3M5A A;  2VBW A;  3E5Q A;  1TNS A;  2QEN A;  4XKB A;  1JKO C;  3ZQF A;  2E36 A;  4I51 A;  4KA4 A;  4HRI A;  1GVJ A;  2JTV A;  2DTR A;  1N25 A;  4KT5 C;  3QOD A;  3WG9 A;  5F5E A;  4FX0 A;  2ETH A;  2ZO4 A;  2LTP A;  3ZQI A;  3I0T A;  4CCK A;  5IYD J;  5IYB J;  4C2M J;  1TL8 A;  2N8G A;  3BPX A;  3S7B A;  2FSW A;  2NYX A;  1BN5 A;  4EV0 A;  2O03 A;  3SDG A;  4HSR A;  1XN7 A;  3ERM A;  3IAM 2;  2QKM B;  5D5V B;  3L2C A;  2Z5U A;  2QBY B;  1SVM A;  1N6C A;  1R22 A;  4PDK A;  5F6K C;  4CYC A;  4Y3O A;  2JPB A;  4EGZ A;  2MAB A;  1T08 B;  4BQO A;  2HWV A;  1IAW A;  2FA5 A;  3DEE A;  4WUY A;  1V5E A;  2HQN A;  4C9Y A;  4B47 A;  5HDK A;  1U9N A;  2WTE A;  2W85 A;  2M45 A;  3IWF A;  5EZG A;  1UG0 A;  4DBQ A;  4F7Z A;  5K5R A;  2PN6 A;  2PEX A;  2DLL A;  1T56 A;  2YSR A;  1RIO H;  4B1R A;  1TW2 A;  1UZC A;  3JRF A;  1VQP I;  2L7M P;  5L3D A;  3KP3 A;  1ZG5 A;  1VI0 A;  4FAS D;  3K4L A;  4BAC A;  3IRR A;  2LNB A;  4QPO A;  2OV7 A;  2XAF A;  4ESF A;  4PSX A;  2B63 J;  5FKL A;  3WHB A;  1DQU A;  3WTU C;  3FM5 A;  2DA7 A;  3M8J A;  1KU3 A;  3OYG A;  2KIM A;  3PUB A;  1EKE A;  1K83 J;  1VQ9 I;  3LST A;  3ZMZ A;  4E6K G;  4YG2 F;  3CCR I;  3MZH A;  5FB2 A;  4AD9 A;  1GXQ A;  3GTQ J;  1YE9 A;  3LA3 A;  4UY8 I;  3OMY A;  2HKO A;  4IO9 F;  4XLE A;  2M4K A;  3AG4 H;  1P2F A;  4QEP A;  1VQ5 I;  3HNA A;  3F6O A;  4QSH A;  1H89 C;  4OOI A;  3OR2 C;  4BE1 A;  2OA4 A;  3FF5 A;  5GAH J;  2FEZ A;  1N77 A;  2COM A;  1X4O A;  2VT2 A;  1HDP A;  1ZQ3 P;  3BWG A;  2STT A;  2XPU A;  3PUF A;  3T8R A;  4M72 A;  2R5Y A;  3K4M A;  3X2Q H;  1P9Q C;  3F9W A;  1B72 B;  2R7R A;  2ZSH B;  3VYT B;  2MLK A;  1V3F A;  4HV5 A;  4RM2 A;  3TG5 A;  2ESH A;  4D0P A;  2D1V A;  1G59 A;  3BO5 A;  3EYI A;  3MQ0 A;  1TQM A;  5KNL A;  3J7A O;  5K7H A;  1R00 A;  4E7Z A;  2PMU A;  2IGN A;  5B66 C;  1LEB A;  4YEL A;  2JQ7 A;  3HJE A;  2A5W A;  1I3A A;  1XMX A;  4EAT A;  4ENJ A;  2IGO A;  3LSG A;  5HS9 A;  1A35 A;  2PG4 A;  2PFB A;  4Z6Y A;  1PVE A;  2E71 A;  1OCT C;  3R4K A;  1WI9 A;  5EX3 A;  3SEQ A;  2Y69 H;  2MA3 A;  3RYR A;  2K4J A;  3IL2 A;  2P81 A;  4XON A;  4A3L J;  3MMY B;  1FT9 A;  1ODD A;  2ME0 A;  3G71 I;  3JR9 A;  2AQE A;  5F6L A;  5FLX K;  3HPG A;  2E34 A;  3ELK A;  4AM3 A;  3DLA A;  4CYD A;  3I54 A;  2ID3 A;  3AG3 H;  5CKT A;  2Y9Z A;  1T0F A;  2XIG A;  2TDX A;  3K0L A;  4R1H A;  3CCV I;  2YUS A;  4GXO A;  2HNH A;  3DPU A;  2QKL B;  3CLO A;  3V7R A;  3WU2 C;  3DEW A;  2KIS A;  3LOC A;  1G3T A;  3BZK A;  3P9C A;  4MNU A;  5DV5 A;  3S2H J;  1DU0 A;  2E1C A;  2DMU A;  3JRH A;  2DDB A;  4BJT A;  2BYV E;  1X1D A;  4MFE A;  1FYM A;  1VFC A;  5ARG A;  3WGG A;  2XAS A;  4KIG A;  3JAM K;  1HW5 A;  2CQX A;  3HRT A;  1UST A;  2H8R A;  4J7F A;  3DBH B;  3FKI J;  1B8I A;  1Y1V J;  4ZZD A;  4KIB A;  3U1D A;  2HYG D;  5EEA A;  1ULY A;  2LF7 A;  5ILU A;  4ZYD A;  5T0M A;  5GAD J;  1X19 A;  3R61 A;  4XKC A;  3QWP A;  1Y1W J;  3VUZ A;  3L2U A;  1A31 A;  3CUQ C;  4L18 B;  4G94 A;  2HR3 A;  2I5U A;  4U88 A;  1MT6 A;  2V9K A;  2M1B A;  3HKZ N;  3KE2 A;  1X3Z B;  4X0G A;  1K78 A;  3WE2 A;  3OYI A;  1RKT A;  1WHU A;  2HFH A;  3FHN A;  2CUJ A;  2VIX A;  1O9S A;  2X6O A;  1RPW A;  3JRI A;  3NEU A;  1ZAO A;  4N9H A;  3JRB A;  4XOP A;  2ZFW A;  2M0M A;  3GME A;  1MW7 A;  4QWQ A;  4FX4 A;  2HXI A;  4H4K C;  1P4X A;  1YW8 A;  2EIJ H;  1RKW A;  2EFP A;  2WV0 A;  3KEY A;  3J81 Z;  4DZJ A;  5IT9 Z;  2ZJR F;  2QZ8 A;  4XIC A;  2OPT A;  1S7O A;  3M55 A;  3M58 A;  5F59 A;  2B7E A;  3C2B A;  4KIT B;  2K9L A;  4IHW A;  3K4B A;  1KU7 A;  5CCL A;  2VKH A;  1PEG A;  1O3T A;  4R79 A;  1SFK A;  4U0V A;  2YU9 J;  3H0D A;  2QQA A;  3AG1 H;  4OIQ F;  1A6Q A;  4YIF A;  4D5C A;  3BG5 A;  5LD2 C;  4LJZ F;  3JAM Z;  3L09 A;  2O7O A;  4BEH A;  3SHF A;  1T0F C;  2M9H A;  4L9N A;  2ZME C;  2F5F A;  3BTC A;  3JCU C;  1MVX A;  4MIM A;  3CMM A;  3Q0W A;  1LB2 A;  3JTH A;  2DCE A;  2GWR A;  3KZZ A;  2DK5 A;  1CF7 B;  2W25 A;  2EFN A;  2DA2 A;  1R5G A;  3H9J A;  1IRG A;  2HQA A;  1IDY A;  3CUQ A;  4UUV A;  1OCO H;  3F8C A;  2BEO A;  4IJA A;  3D5L A;  2KRC A;  1FSE A;  2CV2 A;  3HC7 A;  2KIF A;  1ZR2 A;  1BL0 A;  3K69 A;  2PJR B;  1Z21 A;  4UV9 A;  4DQ2 A;  5J1Y A;  2E1N A;  4RB1 A;  1Z77 A;  2WB1 A;  5K1Y A;  1G6N A;  5KCM A;  4W1U A;  4NC7 A;  2XKP A;  3I5U A;  1U3E M;  2Z2S B;  3BJO A;  3R0J A;  2Y0S N;  2BXZ A;  2HOE A;  3K2Z A;  4M71 A;  3ULQ B;  3E7L A;  4Y17 A;  3S2D J;  2XGC A;  3QP5 A;  3HOZ J;  1F4K A;  1G3Y A;  2DTZ A;  2R7Z J;  1QHH D;  3ZQ7 A;  2FML A;  3J81 K;  5TJJ A;  1UB9 A;  5DDG A;  2VJ4 A;  1MND A;  2EPF A;  2MH9 A;  1QGP A;  2Y2Z A;  4BEH B;  4GCV A;  2RFI A;  1W36 C;  2VKE A;  2RDP A;  2XF5 A;  1IXS B;  1YG2 A;  2JMW A;  2R3A A;  2EA4 A;  1AU7 A;  1BJA A;  2CG4 A;  4GRI A;  3BR2 A;  4HDU A;  1L0O C;  1ETY A;  3N05 A;  4KN7 X;  3G6E I;  2AQF A;  3FX3 A;  2EQR A;  4LFU A;  5FD6 A;  3OYK A;  3VSK A;  4BQN A;  3QYB A;  1HF0 A;  5KJL A;  2WAQ N;  3QYE A;  2H1L A;  2CUE A;  5M3M J;  3P9I A;  3PFI A;  1BA5 A;  2M34 A;  2K86 A;  3QP6 A;  5JJ0 A;  1ON1 A;  2XRN A;  4XLA A;  1JHH A;  1YJW I;  1MBJ A;  2HOT A;  3BR5 A;  3ZMD A;  5L3B A;  1TWG J;  4BQQ A;  5K7Z A;  3DPL C;  2PMZ A;  1B4A A;  3T5X A;  5B5E C;  5KAF C;  4P9F A;  2VPL A;  1VQ8 I;  3OXL A;  3DEU A;  4ZYG A;  2R7F A;  3Q3S A;  2O3F A;  3IRQ A;  2KQR A;  2M4G A;  3O8G A;  3E6B A;  2JVG A;  4GO1 A;  3OIQ A;  5IP6 A;  3RKW A;  3CCL I;  4XNF A;  4HNV A;  1Y0N A;  2COB A;  2LSO A;  2LY2 A;  5F0H A;  3A02 A;  2YR2 A;  3HOX J;  3E6C C;  2LFB A;  1BI3 A;  1XGS A;  2XUB A;  4A3J J;  2CSO A;  2LRD A;  3D0S A;  2KZV A;  2O5R A;  1XCB A;  1HKQ A;  5J1U A;  3O6B B;  5JIN A;  1B72 A;  1HW1 A;  3BTJ A;  3HKZ A;  1T2K A;  4OAY A;  2KJC A;  3I58 A;  3M1E A;  5FKM A;  3TKY A;  3OS1 A;  5IP7 J;  2ZJQ F;  4BXX J;  1XMK A;  1HBX G;  5E3L A;  1OCP A;  1OPC A;  2E60 A;  2L5Q A;  2VOP A;  3OSF A;  2LF8 A;  3ZP5 A;  1BC8 C;  2LKP A;  2DFH A;  4L5E A;  2NXN B;  3BG9 A;  1BOB A;  3DKY A;  1BI0 A;  1MD0 A;  2VQC A;  1B6A A;  3H0G J;  3SJM A;  3VWB A;  1O3Q A;  3N71 A;  3W3C A;  5CYV A;  4G7Z F;  4HAM A;  2K40 A;  4AID A;  3JTG A;  1Y6I A;  1O4X A;  3W2V A;  4YNM A;  2DT6 A;  4KFC A;  3F8N A;  3OOI A;  2L0K A;  3IAS 2;  4U0W A;  4WWC A;  3LSK A;  5IP9 J;  3RZO J;  1FOK A;  4XSX F;  2BW3 B;  3BR3 A;  3KLO A;  2IGK A;  1Z1D A;  3S93 A;  2XAQ A;  2ELH A;  4KNY A;  5FKK A;  1Z91 A;  2IAI A;  3LSM A;  1ZR4 A;  4C2T A;  3WGI A;  4D1Q A;  1WWX A;  1E3P A;  3DXJ F;  4L5J A;  3CCS I;  4OIR F;  1S9H A;  4ENN A;  1YI2 I;  2JN6 A;  2RC4 A;  4I6Z A;  3RIB A;  3TG4 A;  2ZB9 A;  2BY1 A;  1OCC H;  1QHG A;  3OSG A;  2OJE D;  3MO5 A;  3GBG A;  1RUO A;  3BR6 A;  1HST A;  2K5C A;  4UVB A;  3IH3 A;  3UNG C;  2F5E A;  2XGE A;  4YPA A;  2EWN A;  1E17 A;  2HXO A;  4N4O B;  2R0Q C;  2EIN H;  2LG4 A;  2NVT J;  1IV8 A;  5J4Y A;  1AKH B;  4XID A;  2GOM A;  2OCE A;  4NQW B;  3ZQH A;  1L3L A;  3D5R C;  1FTZ A;  1R1V A;  3CC2 I;  4XM3 A;  2QQ8 A;  4XMY A;  2VPR A;  3ZOB A;  2V7F A;  4WK8 F;  4BAY A;  4IPA A;  3TOB A;  2EBI A;  5TGT A;  2HDC A;  4F91 B;  1NH3 A;  2J5O A;  2XGX A;  2P7V B;  1ENH A;  2EJR A;  5LFA A;  3F8F A;  1GXP A;  5IOY A;  4ZC3 A;  4LK1 F;  2ZFU A;  2JUC A;  3HPH A;  4IRI A;  3M9A A;  4A3C J;  5LGN A;  2WAQ A;  2A07 F;  1P7J A;  5J8C A;  2EA2 A;  3J80 Z;  2PBI A;  4JBA A;  4S04 A;  4BY7 J;  3L9F A;  1VQM I;  1Y56 A;  4XOR A;  1RNL A;  5CVR A;  4WCG A;  2WA0 A;  1R5H A;  3GZ6 A;  4CSW A;  1H9T A;  3MKY B;  1I1G A;  4NVQ A;  1FOW A;  3QAH A;  2VC1 A;  2DOF A;  1JTX A;  2GA2 A;  3WTV C;  1LVK A;  4JOM A;  5FKO A;  2R7W A;  1DP7 P;  1IJW C;  1FEX A;  3KIO A;  4DZP A;  2VBX A;  2L2O A;  2XC7 A;  5TIS C;  1SFU A;  4F55 A;  3WTY C;  3MCZ A;  5BNG A;  2R7X A;  1EH7 A;  2E5N A;  3SYT A;  3ZCO A;  4E7S A;  3OS0 A;  2P6T A;  1QO0 D;  2QLZ A;  3DBR B;  1MMG A;  2V9V A;  3FXK A;  5CVI A;  5DD4 A;  2V79 A;  2VAS A;  4XRM A;  4RMN A;  2V1U A;  2BVL A;  5LHH A;  2AXL A;  2KL4 A;  2GXG A;  3FXM A;  3F72 A;  4OWR B;  1E0E A;  3FXL A;  2OU2 A;  1W7P B;  3IP4 B;  3RCO A;  1ZYR F;  4IOA F;  3KYL A;  1F43 A;  1RC9 A;  2GZW A;  2OF7 A;  1W1W E;  5H2F C;  1S72 I;  2DBB A;  2V6C A;  1NG6 A;  1MMS A;  2F5V A;  1ZG1 A;  1FSH A;  1ML9 A;  2E1O A;  5EEG A;  1BW5 A;  2A69 F;  1ZN2 A;  2CFX A;  1MVH A;  3BJA A;  2VBY A;  4QEN A;  3H3Z A;  4CUG A;  2GA1 A;  5DEQ A;  1PP8 F;  3W6K B;  2FUG 2;  3M8E A;  3VYR B;  3LQR A;  2HGC A;  4A6D A;  1E3H A;  2RRE A;  4XKW A;  2Y75 A;  4HX4 A;  1T98 A;  1TWH J;  3TGN A;  2BVM A;  2E2J J;  2X1C A;  4B3X A;  1V55 H;  2FE3 A;  3ECH A;  1Z3Y A;  3OPE A;  5EF6 A;  2O9L A;  1LPQ A;  4ZYE A;  1Q1H A;  2CW7 A;  4M3G A;  1FIA A;  2OCC H;  4G9Y A;  2QYO A;  5L3G A;  1HOM A;  1D8K A;  1GLN A;  3CDH A;  3RU0 A; 
#chains in the Genus database with same CATH homology
 1DQU A;  1X1B A;  3OYJ A;  3M8J A;  2R7V A;  3OYG A;  3PUB A;  2JSP A;  2R7U A;  4NJ5 A;  4YRV A;  2V1N A;  2VQG A;  4E6K G;  2CFO A;  4QEO A;  3EUH C;  1YE9 A;  4CZC A;  2A6T A;  3OMY A;  4XLE A;  2M4K A;  1N3J A;  4H12 A;  5KJK A;  5CQE A;  4QEP A;  3HNA A;  3OR2 C;  4BE1 A;  4BS9 A;  3H9Q A;  1N77 A;  2RNG A;  1WFX A;  1X4O A;  2L9N A;  3CBP A;  3PJR A;  1UEL B;  4BE2 A;  3S7F A;  3K4M A;  4XOT A;  1P9Q C;  3OS2 A;  3F9W A;  5FRN A;  3SW9 A;  1WJ5 A;  2R7R A;  2ZSH B;  3VYT B;  2Q2E B;  4RM2 A;  3TG5 A;  2WAF A;  3H5R A;  1G59 A;  3K10 A;  2DT7 B;  3BO5 A;  1D1A A;  3FKJ A;  1QU3 A;  5KNL A;  4JDS A;  4ZYA A;  4ANJ A;  4E7Z A;  4C30 A;  1IRX A;  2IGN A;  3RTR A;  3ZQQ A;  1KON A;  4F93 B;  1EA3 A;  4E7H A;  4YEL A;  4O6F A;  3KX2 A;  1WJB A;  2A5W A;  4EAT A;  3TBI A;  3LSG A;  2IGO A;  4ZDO A;  3CP8 A;  3DB5 A;  5EX3 A;  3SEQ A;  1H3I A;  3BCA A;  1K6Y A;  4C2U A;  1VZ0 A;  4XON A;  2Q1Z B;  3MMY B;  2V6E A;  2M7A A;  1MMA A;  2W5Z A;  5ARF A;  3S7D A;  4KT6 A;  2AQE A;  5F6L A;  3HPG A;  3ZR8 X;  3C2H A;  4PJM A;  3DLA A;  3ZXS A;  3K70 D;  3DQV C;  2VJI A;  5CKT A;  4BE0 A;  4N4N B;  3HXL A;  4XL9 A;  3H9G A;  2HNH A;  3DPU A;  2QKL B;  1N75 A;  4CCM A;  2LRE A;  3RQ4 A;  2RQQ A;  5HQ8 A;  2JV0 A;  4IKF A;  3H5A A;  4J00 A;  2X51 A;  4HEA 2;  3QWV A;  2M7B A;  2PJR A;  1OLT A;  2MD0 A;  5KJM A;  4BJT A;  1X1D A;  5ARG A;  2VKD A;  4D9J A;  3M56 A;  2X85 A;  1X1A A;  3VDX A;  4J7F A;  3L2Q A;  2GOX B;  2IXS A;  3E1S A;  3K4C A;  4DJA A;  2W4S A;  2KLO A;  3I9V 2;  4RM3 A;  1MUF A;  5JHF A;  4HG2 A;  4E7I A;  5T0M A;  1X19 A;  5T5G A;  4XKC A;  3K4J A;  3QWP A;  3VUZ A;  3L2U A;  2R4G A;  2X1E A;  5KJN A;  3K6G A;  4F92 B;  4J01 A;  2QPW A;  4RLF A;  1MT6 A;  2V9K A;  3W2A A;  3CJQ B;  3F9X A;  4X0G A;  3K4N A;  1MMN A;  4J8O A;  2OUM A;  4LIT A;  5HNF A;  2LH9 A;  3OY9 A;  3OYI A;  4BU2 A;  3AKZ A;  3AL0 C;  1YX5 A;  3FHN A;  2HPM A;  2IGM A;  2CUJ A;  3PNY A;  1AA7 A;  2VIX A;  4QPQ A;  3DWL E;  3D5S C;  4AVZ A;  3OYL A;  1O9S A;  3M53 A;  1G8X A;  3DKX A;  4XOP A;  1Z3X A;  5HVQ C;  1T95 A;  2M0M A;  1MW7 A;  2HVS A;  2L9S A;  4XR6 A;  1V5F A;  4H4K C;  2JA2 A;  4F3Q A;  3OYM A;  4CCL A;  4E47 A;  5CQG A;  4FMU A;  3KEY A;  4IX7 A;  4II2 A;  3NWS A;  3V42 A;  3VYS B;  1MNE A;  3M55 A;  3M58 A;  4IQJ A;  5F59 A;  5LSX A;  1ZEL A;  4FET A;  4CCJ A;  4KIT B;  2K9L A;  3PL8 A;  4JQF A;  4C1Q A;  3K4B A;  5CCL A;  1DGW Y;  2VKH A;  1PEG A;  2IS4 A;  4R79 A;  1SFK A;  3F9K A;  3OOU A;  3H0D A;  5AYF A;  1D0X A;  3CES A;  5LD2 C;  2HVQ A;  4YND A;  2KPM A;  2XF7 A;  4BEH A;  1T0F C;  1MVX A;  3HL2 A;  2X6X A;  3CMM A;  3K4K A;  3M1C A;  4KIS A;  2DCE A;  3M57 A;  2ZSI B;  3CBO A;  2JUG A;  2VLA A;  4BGD A;  2V4J C;  1MMD A;  3H9J A;  2XSJ C;  2HQA A;  3PNV A;  3DU5 A;  3F9Y A;  3MEK A;  3SWC A;  3A1Y A;  3D5L A;  2KRC A;  4HNU A;  1U0J A;  2ZXI A;  2CV2 A;  3HC7 A;  5EX0 A;  2HU9 A;  2UUZ A;  5HOO A;  2Z16 A;  2PJR B;  2K9M A;  1Z21 A;  4PJN A;  3ZGK A;  4CH7 A;  4J83 A;  2WB1 A;  5KCM A;  2VQL A;  3QOE A;  3SDB A;  1HA8 A;  3DTK A;  4NC7 A;  2Z2S B;  3BC8 A;  1YX3 A;  2IS1 A;  3CJR B;  5CCM A;  3OS5 A;  3RSN A;  4DOZ A;  3IHX A;  3FDY A;  3PFY A;  4ZDL A;  1FMW A;  4CCN A;  2KRH A;  2I8D A;  3NWT A;  2VJ5 A;  1QHH D;  1DP3 A;  3FPD A;  2VQH A;  2UV1 A;  2VJ4 A;  3DTE A;  1MND A;  4XLC A;  1WJD A;  4LG3 A;  3AL0 B;  4U87 A;  3LSI A;  4BEH B;  2HPI A;  2CH0 A;  1BR4 A;  2RFI A;  3KMA A;  3H35 A;  1W36 C;  3L2W A;  2IS2 A;  2XF5 A;  5FRM A;  3HG9 A;  3EP0 A;  3PNT A;  2R3A A;  4B48 A;  4HST A;  4GRI A;  5HI7 A;  4JLG A;  2R7T A;  3N05 A;  3OYC A;  2AQF A;  4Y4R A;  4BJ5 C;  4E7K A;  3OYK A;  2VB6 A;  3VSK A;  4BQN A;  1NG7 A;  3QYB A;  5KJL A;  3OYD A;  3QYE A;  2IGQ A;  2X6Y A;  4IJD A;  1LDK B;  1SAU A;  1V5G A;  3PSI A;  3M54 A;  4LDG A;  5JJ0 A;  4XLA A;  4YPU A;  3RJW A;  4PFO A;  2F69 A;  4XN3 A;  2E1M C;  3VYU B;  3CP2 A;  2CUZ A;  4BQQ A;  3DPL C;  2PMZ A;  2ZXH A;  2R7S A;  1R6R A;  4NUB A;  3OYA A;  2VPL A;  2W5Y A;  4XKV A;  2CMP A;  3OXL A;  3OR1 C;  2WBM A;  5HLT A;  2ELJ A;  4PJL A;  4MI0 A;  2KQR A;  2M4G A;  2JVG A;  3CF2 A;  3OIQ A;  4BJ6 C;  5KHD A;  3MKZ A;  4XNF A;  1WJA A;  2LY2 A;  2LBF A;  3LL7 A;  3U21 A;  3KMJ A;  2XF6 A;  3C2G A;  3S3O A;  3QWW A;  1BR1 A;  2W7N A;  2V26 A;  2M3A A;  4P1W A;  4BUP A;  2BW3 A;  2KP6 A;  4PK4 A;  4ZDP A;  2LRD A;  2WAE A;  4U7B A;  1ZKK A;  2KZV A;  2O5R A;  3DTI A;  3LSH A;  2R7O A;  4XLH A;  5JIN A;  3F9Z A;  1N6A A;  3RAY A;  3HKZ A;  4OAY A;  3OS1 A;  3FBI B;  3I3L A;  2BOL A;  3HUG B;  2VXZ A;  1LKX A;  3DAL A;  2E60 A;  2LOO A;  2L5Q A;  3TMO A;  3SZG A;  2CV1 A;  4DIQ A;  2BQZ A;  3PDN A;  3J7A Y;  4BDZ A;  1PYV A;  1BOB A;  3DKY A;  3E0J B;  3EPZ A;  3L2R A;  2CV0 A;  2LYC A;  2VQC A;  3VWB A;  2MFZ A;  4E7J A;  1X1C A;  1WJE A;  2P0W A;  3CZ6 A;  3N71 A;  2F6C A;  3W3C A;  3K5K A;  3BCB A;  1XQH A;  3G2B A;  1Y6I A;  2G46 A;  3W2V A;  4YNM A;  1D0Z A;  2NOJ B;  5JIY A;  2DT6 A;  2OC6 A;  3OYN A;  3OOI A;  3IAS 2;  4E7L A;  3IUO A;  2LBF B;  4AYB A;  4IQ4 A;  1D1B A;  4BL0 B;  3LSK A;  3OIP A;  4DBR A;  2BW3 B;  3MO2 A;  4MLO A;  3OYE A;  2DJI A;  2W82 A;  2IGK A;  3S93 A;  3RPU D;  3LSM A;  4C2T A;  5EG2 A;  4E4H A;  4D1Q A;  3OYB A;  5JHN A;  4BXF A;  4RZ0 A;  4O30 A;  4HNT A;  2DOA A;  1S9H A;  3L2V A;  1N78 A;  3RIB A;  3TG4 A;  2MC4 A;  4IJ8 A;  1D1C A;  1LFP A;  4KJZ A;  3UR3 C;  1QHG A;  4AU7 A;  2X6W A;  4PFP A;  3M59 A;  3MO5 A;  2VXD A;  2XAU A;  3GBG A;  4CCO A;  3A4C A;  2K5C A;  3ZRG A;  4Z4P A;  3UNG C;  1OR7 C;  2MYS A;  2X1D A;  4BDY A;  1ERD A;  4YPA A;  2Z1D A;  3OWT A;  4ZTF A;  1PJR A;  4N4O B;  2KHM A;  2LG4 A;  4NNJ A;  2LY1 A;  3DU6 A;  5TEG A;  3FBN B;  4P5O A;  3EUA A;  2GOM A;  1UAA A;  2HZD A;  3PSF A;  4NQW B;  3D5R C;  2VJJ A;  2UWM A;  2JVH A;  4XM3 A;  3SEZ A;  3OYH A;  4XMY A;  2WAD A;  1D0Y A;  3BG6 A;  3EUK L;  2V7F A;  4YEJ A;  3S8P A;  5TGT A;  4XQF A;  2CW8 A;  4F91 B;  2XDV A;  5CPR B;  4G6T B;  5LFA A;  4J7I A;  4XN0 A;  4ZC3 A;  2ZFU A;  3HPH A;  3K70 C;  3MKW B;  3OXG A;  1FMV A;  5T0K A;  2WAQ A;  4LIU A;  3AFH A;  2Y0S A;  2VL8 A;  4RLQ A;  1DGR M;  3LFU A;  3KMT A;  4ITV A;  3OYF A;  1Y56 A;  2E5Z A;  4XOR A;  3VV0 A;  1WJC A;  2E1M B;  2WA0 A;  2W00 A;  4CSW A;  4NVQ A;  3MKY B;  1WJF A;  4ZTJ A;  3DPT A;  1LVK A;  3H5N A;  4JOM A;  2R7W A;  2LC2 A;  3ONQ A;  2KMU A;  2WY7 Q;  3W2W A;  2F4I A;  2L2O A;  2XC7 A;  3TL4 X;  4F55 A;  2CS3 A;  4YNP A;  3BLY A;  3QYF A;  5HNH A;  3S3N A;  2R7X A;  2O8J A;  1TZL A;  2E5N A;  4OAZ A;  4PSW A;  3SYT A;  4B43 A;  3ZCO A;  4PJJ A;  2K3P A;  4ZJZ A;  3HOS A;  3M5A A;  4E7S A;  5FRO A;  3OS0 A;  4XKB A;  4LIV A;  1JI8 A;  1MMG A;  3VSL A;  2WY8 Q;  4I51 A;  4HRI A;  2VAS A;  1X4P A;  3MO0 A;  3CBM A;  4RMN A;  4Y33 A;  3QOD A;  3S32 A;  2HVR A;  2BVL A;  5F5E A;  2KL4 A;  4CCK A;  3S7B A;  4OWR B;  1E0E A;  4DGW B;  3IP4 B;  1BR2 A;  2HDW A;  3RCO A;  2W1O A;  3KYL A;  3A2K A;  4HPQ A;  2R7Q A;  4HSR A;  3HOT A;  3IAM 2;  2QKM B;  4XLF A;  1NG6 A;  2F5V A;  3MD2 A;  1TT0 A;  1ML9 A;  1N6C A;  3S7J A;  1MVH A;  5F6K C;  5TTF A;  4Y3O A;  4QEN A;  1W36 D;  4CUG A;  2MAB A;  2KDO A;  4BQO A;  4CA0 A;  3S3M A;  4B44 A;  3OXF A;  5LSZ A;  2FUG 2;  3VYR B;  4WUY A;  3DEE A;  2IS6 A;  1V5E A;  4C9Y A;  4NC8 A;  4B47 A;  4YPE A;  1J09 A;  3LMM A;  2RRE A;  4XKW A;  3BG7 A;  4F52 A;  2L7K A;  1Z7L A;  5TH7 A;  4IZZ A;  2DXI A;  4MI5 A;  1UG0 A;  4DBQ A;  3OL3 A;  2BVM A;  2X1C A;  4B3X A;  4PUS A;  1Z3Y A;  3OPE A;  3OL4 A;  2CW7 A;  4FAS D;  3K4L A;  4BAC A;  4II3 A;  4QPO A;  2OV7 A;  4PSX A;  1GLN A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...