4BUPA

A novel route to product specificity in the suv4-20 family of histone h4k20 methyltransferases
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
270
structure length
232
Chain Sequence
GSHMSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRQEELKEVIERFKKDEHLEKAFKCLTSLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1
total genus 73
structure length 232
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bupA01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4bupA02
3F9ZA 3SWCA 5F5EA 3MO5A 5TH7A 3OXFA 3PDNA 4O30A 1MT6A 3CBOA 2IGQA 5JHNA 3OS5A 4QEPA 4I51A 5KJLA 4YPAA 4WUYA 3MO2A 1N6CA 3M57A 3RQ4A 4MI0A 4C1QA 2QPWA 4H12A 5LSXA 3F9YA 3OPEA 4YPEA 5ARGA 3RU0A 3TG4A 2W5YA 3F9XA 5HQ8A 1N6AA 3S7JA 3M59A 1H3IA 3S7DA 5T5GA 4YNDA 5ARFA 3DB5A 3MEKA 4LDGA 2W5ZA 3DALA 5JIYA 3K5KA 5KJNA 3M55A 3RIBA 4NVQA 3N71A 3KMJA 4J8OA 3S7FA 3M56A 5JINA 1PEGA 5AYFA 3OOIA 3M58A 4Z4PA 2G46A 4YNMA 5LSZA 4J7FA 5EX3A 5F6KC 3CBMA 3M5AA 3OXGA 3OXLA 1O9SA 1XQHA 4JDSA 5TEGA 1MVHA 1N3JA 3M53A 5T0KA 2BQZA 4IJ8A 4BUPA 5EX0A 5F59A 4J83A 2O8JA 3QWPA 4RZ0A 5T0MA 3CBPA 3VV0A 5JJ0A 1ZKKA 2RFIA 3F9WA 5CCMA 4JLGA 2R3AA 5HI7A 4FMUA 4E47A 4YPUA 3QWVA 2JV0A 2F69A 5CPRB 3HNAA 3RJWA 1MUFA 4NJ5A 5F6LA 4QEOA 4QENA 4IJDA 3EP0A 3BO5A 3KMTA 3SW9A 4J7IA 5KJMA 5CCLA 3IHXA 3S8PA 5KJKA 3M54A 4MI5A 1ML9A 3KMAA 3RAYA 4AU7A 5TTFA 3FPDA 3MO0A 3QWWA 3VUZA 3TG5A 5EG2A 4YNPA 1MVXA 4O6FA 3S7BA
chains in the Genus database with same CATH superfamily
2DOFA 3F8NA 2VE9A 5LFAA 4C2TA 3U1DA 2CUJA 3DF8A 3DU6A 4CGZA 2EIMH 1HQCA 2H94A 3NEUA 1P6RA 2XAFA 4AIJA 4G7HF 2CQXA 2W1OA 3H0GJ 3CBOA 1MBGA 3AG1H 5HS9A 3VYRB 5JHNA 3ECOA 3QPTA 5JI6A 4MEYF 4DW6A 2VKVA 2GXBA 1FEXA 4WUYA 4ABZA 1GVJA 5E79C 3TGNA 1HF0A 4OWRB 4ENKA 4XSZF 1U2WA 2DFIA 2R93J 3F23A 1ZREA 1XSVA 4KNYA 1A6IA 3FZVA 3GZNB 3U1KA 5HQ8A 2HVRA 1MMDA 3ZN1A 4E70A 4ETSA 2A6EF 3LNQA 1KU7A 2XROA 3KPHA 3QAHA 2Z2SB 1E3OC 3QPLA 5AIPA 5DD4A 2HTSA 3A03A 4FX0A 1NHAA 3S1RJ 1HKSA 3BDDA 3BJ6A 2E1MB 2EV5A 3V8KA 1WZ2A 2F5VA 3MKZA 3G3ZA 2EA4A 1USSA 2ZXJA 3BCAA 3CO6C 1BI3A 4IOCF 2UXXA 5E18F 2X6YA 3SZPA 3ASNH 3R4KA 5M3FJ 3KP2A 1WJEA 2FNPA 2MBFA 5M5WJ 4A6DA 1KU9A 2K4JA 3VOEA 5KAFC 4XIDA 5F6KC 4RB1A 5DM7F 1OLTA 2KIFA 1O9SA 3U2RA 3N97A 4LIVA 2CJJA 3ABUA 1H88C 4B3XA 1SD4A 2IAIA 5K7HA 2CH0A 4XN3A 5H6QA 1FJLA 3E7LA 4XSXF 4GFBA 3TO9A 2FBIA 3FHZA 1XGSA 3HB9A 2QVOA 3JRCA 4XRFA 2KFDA 5E3OA 3GXOA 2MH2A 2M34A 2CU7A 2HR3A 1IXSB 3P9KA 3K6GA 5C3EJ 2R5ZA 1WPKA 3KEQA 1JI8A 3PUFA 2K86A 1MSEC 3GTKJ 4QEOA 3LQRA 2FMYA 4BAYA 2X9DA 2I10A 1ETWA 1J2XA 4KT6A 4BL0B 2XDVA 1BOBA 3GTQJ 1OQYA 5GPAA 4XK4A 5E20A 2R7DA 2JT1A 3VSKA 3M4OJ 2I8DA 2XPUA 3TG5A 1REPC 4D7MA 1JJ6C 3FXUA 2YUSA 2VE8A 1ONVA 3C3WA 1ZR2A 1RIOH 1SD7A 3K7AJ 3CCEI 1D1AA 3NAUA 2CYYA 3TQNA 1QQIA 1S6LA 5J8CA 5J8FA 3W6JB 4OAYA 1Y39A 2WB1N 1BI2A 1GVDA 5EG0B 3RKQA 4X6AJ 1XSDA 2DOEA 4B8XA 4FE7A 3DKWA 1QO0D 4ITVA 5E1XA 1EJ9A 2P81A 5HLTA 5JVTA 2O8KA 2KZGA 4DYCA 1BR4A 1SANA 2RQQA 3S2WA 3DTKA 2HOSA 2P5VA 1DU0A 1T56A 4RB0A 3F9XA 4UB8C 4AD9A 1I39A 2EWNA 3ERED 3OYCA 3TOBA 2OU2A 2DK5A 2EQRA 1FOYA 2L54A 2PQ8A 2L2OA 3SQNA 2HKOA 1S7EA 1A5JA 1XDUA 5ICCA 3K5KA 5CQGA 2HFHA 2BBYA 1MW7A 3DEEA 3FXLA 4EVIA 2OTLI 1JKRC 3FK6A 1MBHA 2ZCWA 4E6KG 5ICEA 4M6YA 1MJ9A 1R1VA 1PEGA 3Q5FA 3CCUI 2K85A 4RM3A 1IN8A 1IJWC 5J1YA 1FY7A 2WY8Q 4NNJA 4D9JA 3BLYA 1OJLA 2V1DA 3C18A 3JRDA 1OFCX 3HZJA 4Q47A 1WGXA 2AS5F 1V55H 1LFPA 1SVLA 1O3SA 1JKPC 1YITI 1S72I 4U7BA 4BUPA 2EZHA 4XICA 4M9XA 5F59A 1D8KA 2QKMB 2G9WA 2W82A 3BROA 4HG2A 3FX3A 1FT9A 2L9RA 1I6HJ 3WTUC 2EV0A 3CUQA 1P4AA 3DKXA 2FOKA 3A01A 2F2EA 1FBUA 2VIXA 3GYHX 2ESNA 1K78A 3Q9SA 1MH3A 1T8IA 3X2QH 3BPVA 3QYFA 1YS7A 3TDUC 4B44A 3IRQA 2HOAA 1QGPA 1HDPA 2OBPA 2VT2A 1VQNI 3FBIB 5L3CA 1RUOA 4A6EA 3R0AA 1IXRC 2KDOA 4W1UA 4M74A 5TJJA 5BPDA 3IH3A 4PDKA 2NVXJ 4QPOA 2BE5F 2CSOA 1JKQC 5FRNA 3QOEA 5F04A 1OPCA 1PUEE 1S29A 2E35A 3IKVA 1FNNA 4GXOA 4Y52J 3P7NA 5EZGA 5DUKA 4RGSA 1APLC 4C3JJ 1CQTA 3G1LA 4CCOA 1FBQA 3BZ6A 2BHYA 3IH2A 3TKYA 1Z3YA 4BBSJ 1KQ9A 1Z1DA 2DN0A 1S7OA 3GUDA 1A36A 3BY6A 3FMSA 3PQKA 2UZKA 1T98A 1FX7A 5KJLA 3MZYA 3ABMH 2LMDA 1ZLJA 3E6DA 4ENJA 1WJCA 1H0MA 1J59A 1AHDP 4C1QA 4N9HA 1MH4A 4LLNA 2XAJA 2H1LA 2IS2A 2ZO4A 1BI1A 4BQQA 1TQMA 2JPBA 4V19K 3TG4A 2W5YA 4L9NA 1T0FA 1S5LC 4RAFA 4L0ZB 1OCOH 5JFRA 2X6WA 4BEHB 2MG4A 4I01A 4B1RA 3B6AA 1XTAA 2BVLA 1X3ZB 2MLKA 2YS9A 3O8HA 4Q48A 3ZQ7A 1R5GA 3J81Z 2TDXA 4NQWA 4S05A 4ZYAA 4RGXA 2ZFUA 4DBQA 1P4XA 2ETHA 2KRHA 2HGCA 3M56A 4PJNA 2K3PA 4HBLA 1U5TB 3ZGKA 3MKWB 2IXSA 1BIBA 2DLLA 2L7MP 1YIJI 3ECHA 2OCCH 2LNBA 1R6RA 4F55A 5K5RA 1XQHA 1YHQI 5D4SA 2EK5A 3Q0WA 3HDDA 3J80Z 3M53A 2QKLB 2EZIA 5CJ9A 2DT6A 2ZMEB 1Y0NA 1Z0XA 2QSGX 3GTLJ 2JMWA 1TQPA 4MQVA 4IX7A 3CUQC 1VF9A 2XUBA 1UAAA 3IUOA 5BMZA 2Q1ZB 5E3MA 2X1DA 3JTHA 4HPQA 1B8IA 3LSIA 4CCMA 1BIAA 1ACIA 4M71A 2R3AA 1D1BA 1R7JA 1X1DA 3M8JA 4HF0A 2QUFA 3S2DJ 5FJ8J 5EJCA 1J9IA 2VKEA 3OR2C 4ZDPA 3CP8A 1T08B 2Z99A 2KHMA 2YX7A 2VOOA 2NOGA 1WI3A 3CDLA 3AL0C 5IP7J 1YW8A 5KJMA 1WCMJ 3KP4A 3K1PA 5CCLA 1S9HA 2IW5A 1XN7A 4M3BA 2X4HA 1LDKB 3S8PA 2Y31A 2XKOA 1UMQA 4HDUA 1BL0A 1K6YA 1F1ZA 1R9TJ 2VT3A 1OR7A 2L4AA 3R61A 3KMAA 2XIGA 3LQQA 5TTFA 2GQQA 3DBLB 1ITYA 2M8EA 2DA2A 4GO1A 3H1CA 2V1NA 1YTYA 3TMOA 4U0YA 4HAMA 4P9UA 3KETA 4CCLA 2GIZA 2Z9OA 2E2IJ 2VQCA 1UZCA 2UV1A 3BG7A 1SAUA 3D0SA 4P1WA 3K1MA 1UFMA 2QM3A 1K6OA 2R7XA 4C2MJ 2R5YB 2H1KA 2EZLA 3A0BC 2LKSA 3HPGA 3PNYA 3HL2A 4U88A 1K79A 1J5YA 2EB7A 4O30A 3K10A 4KJZA 4I99C 3MO2A 5K5QA 2OTJI 3GZ6A 1AU7A 3BTIA 3H5RA 2EFWA 3OPEA 4L9VA 3CP2A 3LFKA 1B72A 5FRMA 4L9TA 4Y4RA 3WTWC 1U5TC 4IQJA 5LHIA 4DOZA 1RRJA 1U78A 1LNWA 3VODA 2AXLA 3ZCOA 4FTHA 4IRGA 1R5ID 1MMGA 2HYFA 4NUBA 2OPTA 4KIGA 1MIJA 3RKWA 1FZPB 1KU3A 1MJAA 1Z6RA 3CLQA 1KU2A 2DXIA 1N75A 1DU6A 3L09A 2R0QC 2WWYA 1MBFA 2M5WA 3ZQHA 1T2KA 5HDGA 4BGDA 2OV7A 4EGYA 3V7SA 4IHSA 5IOZA 5EEAA 2XAUA 4YNMA 3BCBA 4CSWA 3T8RA 1SD5A 1BJZA 5BS6A 4BY7J 2HQ5A 3OXGA 3HKZA 2XC7A 2AQEA 2HYGD 5J1UA 3C2BA 4XKBA 2JA2A 3FXKA 1FTTA 3GEZA 1MNEA 3OS0A 2CUZA 5LHHA 1AOYA 4Y3OA 1ERDA 2MSYA 5AONA 4B43A 1X1BA 3QOPA 3MCZA 2HVQA 1MZBA 1SFOJ 3B02A 2VI6A 2ID6A 1ZKGA 1E0EA 4XONA 1FTZA 3MKYB 3WTXC 5CPRB 3HNAA 4F52A 4LD5A 3DBRB 2JJ7A 4S0HB 4BE0A 3E97A 2CV0A 3J7AO 4QENA 3GVAA 2QQAA 1XGNA 4M72A 4EJWA 4J7IA 1DQUA 5J1RA 3H3VK 1ETOA 3HUGB 2DI3A 5CVVA 1Y56A 3OSGA 2QBYB 2IA2A 2RQPA 4PGGA 2C6YA 1K4SA 1CF7A 5JR3A 1ETXA 4JX4A 4BKXA 3PNTA 2B0LA 2W24A 2E71A 1XSXA 3Q3SA 1AKHB 3JRGA 4XRMA 1ON2A 2A5WA 4YNPA 1BC8C 4HQEA 1SVMA 1YS6A 3RPQA 2DMQA 1WJ5A 3NWSA 1MMAA 3DLLF 1G6NA 2R7FA 3KYLA 4DIQA 4G7ZF 4DYRA 4C30A 3RJPA 5TH7A 2ZMEC 3PDNA 2NAZA 1NG6A 1SEUA 4LMYA 3DPTA 1E17A 3ZPLA 1PYVA 3ABKH 3OYNA 1N6CA 3G1MA 4M3FA 4EJUA 2JQ7A 4IO9F 5GAHJ 4U87A 1RETA 3FM3A 1VQLI 5C4XJ 1Z91A 4NDLA 3GWZA 1IGNA 3M59A 2X1EA 1I6XA 1YX3A 2DDAA 2WV1A 4Y15A 3R0JA 1Y1WJ 1D0ZA 1KYWA 4C3IJ 1T39A 4YNDA 5ARFA 5F0FA 4IOAF 5FROA 3RPUD 3IHXA 1LVKA 3O2PE 3P9CA 4PK4A 4XLPF 1Y0UA 3W6VA 2V4JC 3HGGA 2ZJQF 2DYSH 3F6VA 1IW7F 1SFKA 3K70C 4BHCA 2BVMA 3VSLA 2CFXA 3AG2H 3RZDJ 1K4TA 2EBIA 5FKKA 4EV0A 5EYRA 3LSJA 1FYKA 1X2NA 1DP3A 3S14J 2XASA 2FF4A 4OINF 3OYJA 3HOTA 2XB0X 2LP0A 2O61A 3ZXSA 4IKFA 2Z1DA 3A4CA 2MC3A 1XPXA 1IDYA 4JDSA 4C3HJ 3AFHA 1YOVB 2LYCA 1G4DA 4NBQA 4KICA 3FK7A 1DUXC 1ZYRF 4MFEA 3QU3A 2XSDC 2DA5A 4J83A 4LG0A 4R1HA 2JSCA 2IRFG 1JJ8C 1R23A 1VQ9I 1UG2A 4LLGF 4AUXA 2KDZA 4N0BA 1WJFA 1R71A 2L01A 1QVUA 4CCNA 1RUNA 2K5CA 3NQOA 3GW2A 3V8LA 3IC7A 3JR9A 3DPLC 2F6CA 2Y9ZA 2R7ZJ 1J0RA 3HOXJ 1W4MA 1MUFA 2BXYA 1W36C 3EP0A 4G7OF 1ETYA 1F36A 2Z16A 4QTRA 4A3DJ 1XCVA 1P4WA 2KKOA 1B9MA 4M3EA 4IVNA 5HNHA 1QBJA 1ZH5A 4R8HA 3BG9A 4AU7A 3K2AA 5FGMA 3VUZA 2BW3A 5EG2A 1TP4A 1YW7A 3C2HA 1NTCA 2E34A 3PJRA 1TWGJ 4S04A 3LA2A 4IPAA 4EM0B 2ESHA 3QYBA 4EJVA 3WU0A 2Y0SA 3T0YA 1FYMA 2HI3A 3HHHA 4B47A 4KUMA 2M8GX 2A6TA 4HX7A 5BNGA 4ZC3A 2YU9J 4Z2YA 2TRTA 4U0WA 3CCQI 2Y30A 3DPUA 2MYSA 4H12A 2LC2A 1SD6A 3H5NA 4A3KJ 1ZRDA 3IHUA 1KONA 2ZSIB 1FYLA 5F1RA 2QENA 2M3AA 5GP9A 4ZDLA 2CO5A 4NC6A 1I5ZA 3BTJA 4Y7NJ 4FCYA 2HPMA 2LREA 2O03A 1FOKA 1TNSA 2W7NA 1Z7LA 2MABA 3RKXA 4OOIA 3W2AA 5CVIA 4OIRF 4A5MA 3DB5A 4ASNA 3GFMA 2E1OA 2A07F 3I58A 2IA1A 3RDIA 3EYIA 3WTVC 3ONQA 5EGOA 2Q0OA 1X3WB 3SZTA 5DTDA 2DPDA 1VQ6I 2CUFA 3ASOH 2D45A 1O3QA 2D1VA 2KZVA 3D5SC 5GAEJ 2E7WA 2FX0A 1EV7A 2G7UA 3JRIA 5DEQA 3F8FA 1UB9A 2L9VA 1EH7A 1MBEA 3HOUJ 3S2HJ 4G6TB 1LKXA 3UR3C 2HXOA 3HRMA 2P8TA 2W25A 4JK1X 2COMA 2R5ZB 2VONA 5TEGA 3L2VA 4CCKA 2HWVA 4HOBA 4ZYDA 3ZQLA 1PP8F 4LITA 3H3UA 2IGNA 3TDZC 4BHPA 2OZ6A 4G8XA 3A02A 2VC1A 3OIOA 5CKTA 4L0YB 2O8JA 5FKMA 1J7KA 3RSNA 1O3RA 3K4BA 2ME0A 3DP7A 2NOJB 4HYEA 3O3KA 1OYIA 4M3GA 3WE3A 4ANJA 2CQKA 4LB5A 3BJOA 4XQFA 4X0GA 2LD5A 1LEAA 3DEWA 3BR1A 2VKHA 4CDGA 1U5TA 1IN7A 2CUEA 2Y69H 1F5TA 1B6AA 1G3WA 2XSJC 4HSRA 1ZGAA 5DDGA 2P5KA 1IO2A 1SFXA 3TOAA 3VEPA 3SW9A 3HSEA 2K02A 4II2A 4A3LJ 1B1BA 1B4AA 1W1WE 1Z67A 2H09A 3BZKA 1X4PA 4U7DA 2GZWA 1LVAA 1OCCH 3F21A 1GT0C 1ML9A 1RZ4A 4HA8A 3QRFF 1BBYA 1IC8A 5EEHA 1D3YA 2BEOA 2X6OA 3HIFA 3CJRB 1K7AA 2L02A 2NS7A 4IHTA 3M8EA 3QWLA 2MA3A 3CTAA 2A6HF 2RDPA 2X48A 3ML6A 4M73A 2HXIA 4CA0A 3WTYC 2VL8A 3HYIA 1JGGA 4LLLA 5L3BA 1H89C 4JBAA 4FASD 4D0PA 1L0OC 5IYCJ 4AIDA 3H3ZA 2V9PA 5B5EC 2L7FP 2ZJRF 3LAPA 1R4NB 2W4SA 3R6SA 4ESBA 3C7JA 1ENHA 3F9YA 2E5ZA 1BR1A 1TWAJ 4PCQA 2P6SA 2O7OA 4BACA 1Z05A 2VB6A 2Q8KA 2STWA 3GTPJ 4UB6C 2HOEA 5TRDA 1H3IA 1KQ8A 3S7DA 3C2GA 3N05A 2B9SA 4DQ2A 5E3LA 2XPWA 3BOQA 3E5QA 1D0YA 1UHSA 4HQMA 3ABLH 4RMNA 1XS9A 4ZZLA 2XVCA 3S1QJ 1IRZA 2DA4A 5KJNA 1H8AC 2R3SA 3BR2A 3ZR8X 3EUKL 3L7WA 3V7RA 1ZGJA 6PAXA 4M9SA 5LGTA 2R7WA 1PUFA 1LE8A 2LH9A 4ESJA 1USTA 1B9NA 2J5PA 4HEA2 5ICGA 4QWQA 1YIOA 4RDUA 1D0XA 4HNVA 1B72B 2ACJA 2FBKA 3CBMA 5EX3A 3VFZA 3BG6A 2LG4A 3L00A 1WFXA 3MKLA 2JVHA 4PJLA 5HLIA 5H6RA 1VQ7I 3RPUA 4A93J 1I1GA 3GZ5A 4EEFG 2R7SA 2HEOA 4XN0A 4A3CJ 1N25A 2K9SA 1ZTRA 4O5VA 1UCRA 3T8TA 4O6JA 1NG7A 1SMTA 4YFKF 5HNFA 4RZ0A 2CQQA 2DMUA 4PFOA 3HRUA 4KIFA 3JTGA 2VQLA 3U9GA 2PX9A 4JLGA 1VTNC 1H9TA 3HPHA 4D1QA 4RB2C 4FMUA 2RGVA 1VQ4I 3M1CA 4I2OA 4HLYA 4EGZA 1ZG3A 4JX6A 4B09A 4NJ5A 1BR2A 4IJDA 3OY9A 2PBIA 1U3EM 3BR3A 3MAJA 2AXTC 3VB2A 1BC7C 4IZZA 3KX2A 3BT9A 3JSPA 4MI5A 2EZKA 1VQKI 1SC7A 1ZHFA 2JTVA 4FISA 2ME6A 3KYCB 4LB6B 1YG2A 5C4JJ 2RREA 2PJPA 4F93B 5LLQA 2F48A 2KQRA 2M9HA 1MBKA 5EEGA 3WG7H 3GLXA 4C9YA 3LWFA 4WWCA 2ZBKA 1TZLA 4UNOA 3MQ0A 4GGGA 1LJ9A 3H9JA 2LKPA 1HW1A 5FD6A 4NHJA 4RGUA 3OYHA 2JA6J 1WJDA 1IN5A 2J5OA 1JUSA 2RC4A 4MI0A 3G4SI 3AAFA 2VPLA 2D5VA 4ENNA 5ARGA 3DCFA 3FF5A 1FOXA 1FBSA 2LBFB 2PMZN 4A3GJ 1MJBA 3M9AA 3DXJF 4E4HA 2CV2A 2LSOA 1JTXA 5FKOA 5T5GA 3CLOA 4UVBA 1A6QA 1TBXA 3WODF 1A04A 3Q9VA 2F5FA 3M3YJ 1H9GA 1FSHA 4LIUA 3SDGA 3TO7A 3I5UA 1QRYA 2W5ZA 5DYMA 3OV8A 3QP5A 1QZYA 1T33A 2HDCA 2FRHA 1IUYA 4CO8A 4L5JA 1LQ1A 2L9NA 4PUSA 2Y0SN 1TW3A 4PFPA 1IRFA 3RTRA 2IGMA 2FU4A 3GTOJ 4L5EA 5LD2C 5L3EA 1YRNA 3K70D 4HNUA 1KQ0A 2AQFA 3HEFA 5IT9K 1SVOA 1JKOC 3FM5A 4BE1A 3LOCA 1JXSA 3KFWX 2DYRH 4RAZA 2HDDA 3IL2A 4BXUA 3S15J 2BQZA 1IG7A 1XMKA 1YYVA 2KJBA 2KRFA 3M7GA 2PI0A 5K1YA 5EX0A 3COAC 4AYBA 4XLNF 4KFCA 1TTYA 3MN2A 2VXZA 3E6CC 2IS6A 3CD6I 3CF5F 2W84A 3CCRI 1YJWI 2UXNA 4ZZDA 5HLGA 3J7AY 2XF7A 4LGWA 4IHYA 4XMYA 5HI7A 2V6EA 1BJAA 1HXDA 4IEJA 1IXCA 2HOTA 1Q1HA 1O7LA 2IT0A 1XDSA 3K4CA 2F4IA 2LVSA 5D5UB 2GAUA 3OYAA 5C44J 3CQZJ 1VQPI 5KJKA 2QQ8A 4I09A 4GCVA 4FE4A 1HSJA 2V6CA 1V5EA 3QODA 3GLLA 1BA5A 2RKHA 3CCVI 4MEXF 2BY0A 4M3DA 1FPQA 5H2FC 3FXJA 4TV7A 4IRHA 2MC4A 4D7NA 2GM4A 4WXCA 3CUQB 3E5XA 5FB2A 3ZQGA 4DZPA 3UNGC 3ZP5A 3A01B 3PIPF 2DOAA 5LBQA 5DUIA 1T6SA 2A68F 2JK3A 4JX5A 5L3DA 3MZ8A 1P9QC 2B63J 2MFZA 3OS5A 2ZNYA 1YJ9I 4BY1J 4I51A 4XKCA 2X85A 3PQJA 5EF6A 1ZRCA 3S1NJ 3M57A 4CZCA 3RQ4A 2DK8A 2L3DA 1VQOI 1SAXA 1J09A 3JAMZ 1R00A 1LFBA 3HTSB 3K1NA 5BPIA 3HOZJ 2NVYJ 4HZFA 3AG3H 3D5LA 4JQFA 4BQOA 3E5UA 2PG4A 3QP6A 1W36D 4MNUA 4MQ9F 4G6QA 2ID3A 2HKXA 5K7ZA 4QSHA 2HPIA 2ZNZA 3ROUA 1FLIA 4KA4A 3ABTA 3CDIA 5L3FA 3KP6A 1X58A 3GTMJ 5ERIA 4YRVA 1VQ5I 1ZRFA 2H6CA 2DODA 2DJIA 5D6EA 5FFZA 3AKZA 4BDZA 3HGYA 1P7IA 4MFDA 4ZH4F 1HOMA 1EKEA 5M5YJ 3G6EI 1MMSA 4J8OA 2E2HJ 3I4NJ 3OIPA 5K7FA 1RR8C 2JA8J 2EFNA 3OYKA 4I0AA 4F91B 3BR6A 2VBYA 4HV5A 1IF1A 2V7FA 1ZG1A 2GA1A 2NNNA 3ESWB 3T1BA 3WGHA 5KNLA 3DU5A 3OYFA 5J3LA 2E2JJ 4UXNA 2CW0F 4A0YA 2WA0A 2JSPA 2DTRA 3WHBA 5FLMJ 3ERMA 4M6VA 2OD5A 2PMUA 3ZMSA 1DDNA 5KAIC 4RLQA 2DMPA 2XGEA 2DFHA 4A3IJ 1LB2A 1TWHJ 1QVTA 1XGOA 2F4OB 3BP8A 4HX8A 4ON0A 5ICFA 3H9GA 3P5JA 3L2UA 2RNGA 3F8CA 2EILH 1TWCJ 3B6CA 3AL0B 4DZJA 3RYRA 1ZAOA 1Q1VA 2KRCA 3IKTA 5ILUA 1VQMI 2IPQX 1XX5A 1RKTA 2DAOA 1TWFJ 3RIRA 4DGWB 5IOYA 4FQGA 3IWFA 5CVJA 4YIIA 3OS2A 1SMYF 4IJAA 2GIVA 2ECCA 3F22A 5JHUA 5J4YA 3OMYA 2R7RA 2CV1A 5E17F 3SDBA 2ELHA 3KYDB 2M0MA 4RAYA 3MO0A 4Y33A 2CW8A 3DTIA 2LR8A 2NS0A 5F27A 1FP2A 1B8IB 2F4MB 4AVPA 4O6FA 2XAGA 3GMEA 2JA7J 2KL4A 3MMYB 4H4KC 1QNTA 4W97A 3JREA 3F9ZA 3OYIA 4KITB 5B1BH 3ZQFA 3R60A 3GTJJ 2PFBA 3TW6A 5E3NA 2ZKZA 2L7KA 1JE8A 1UELB 3K4NA 3TO6A 2H27A 4ZYHA 5GTHC 1IRGA 4NC7A 2ZXHA 3CCJI 1O4XA 5FLVA 3S16J 4BQAA 4AIKA 2VJ4A 1ETQA 4OMZA 2ECBA 2DBBA 2WC2A 1IRXA 2CWEA 2K3FA 4R79A 1XD7A 3ELKA 3GFLA 3FKIJ 5GADJ 1JTYA 3DBHB 3WHCA 5KK1A 4LDGA 5HVQC 1L3LA 4AVZA 4NC8A 1I27A 3FISA 4BH9A 3I0TA 3ZQCA 4B4CA 2NVQJ 4IHWA 4EQQA 1ZARA 3IH4A 4U0VA 2OF7A 1WVRA 5E8GA 2V9KA 1SFEA 4X1EA 1GXPA 5AYFA 3BWGA 4MHGA 3QYEA 4I02A 2VBWA 1LDJA 3I53A 2V26A 3WE2A 1OKRA 1N78A 2G46A 3WG9A 3OOIA 4Z4PA 4LK1F 1ZQ3P 3I56I 2B7EA 2N8GA 3M5AA 5LGNA 4CYCA 5IYDJ 2LY2A 4WF2A 5DM6F 4BNCA 1DGRM 1X1CA 2ZB9A 2EIJH 3J7ZI 2HYJA 4J00A 4HLXA 4BS9A 3VYTB 3KZYA 1TT0A 2M0CA 4AIHA 4D5FA 2WAQN 4LJZF 4XLCA 2PMZA 1XB4A 1EH8A 4IHVA 1T38A 2DTZA 3MWMA 3BQZA 2KT0A 5CVRA 5JJ0A 3EDPA 1ZLKA 2DMNA 2IS1A 2WV0A 1FIAA 2W85A 1MMNA 2NVUB 2O6GE 1PUFB 2KIMA 3I54A 2BGCA 3QPHA 4XM3A 4BYYA 2BY2A 3Q0VA 4WCGA 2FQ4A 3I59A 1A35A 1XCBA 5AIQA 2GXAA 1HC8A 2K7LA 3ZMZA 4JP0A 4WXHA 1ZGWA 2M7BA 1G3TA 3EYYA 1ULYA 3ZMVA 4UY8I 3DEUA 1FSEA 4XRSA 2CW7A 2R4GA 3VYUB 3CUOA 4CZZA 2A69F 3DTEA 1XMXA 2DJNA 5J4VA 1BOAA 3E3VA 2DFEA 1NK3P 4YELA 2L0KA 1GLNA 3I4MJ 3RAYA 1QZZA 1P7JA 2K9LA 2BXZA 3ZN0A 5DCMA 2K4BA 1U6GA 2Z3YA 2LY1A 2ELKA 3FIWA 3FMQA 3HJEA 2VQGA 2OUMA 1W0UA 2FNAA 5M5XJ 3HM5A 4EMSA 3A2KA 2YX4A 3DQVC 3FWEA 2PEXA 3SWCA 1LDDA 3OYDA 1WRJA 1U9OA 2VKDA 4HF2A 2DT5A 4AC0A 2E1CA 3M8FA 3SEZA 4I0BA 2IGQA 4L5IA 3HXLA 2EV6A 2KMUA 4XLFA 3O8GA 4CXFA 2YPRA 2PN6A 4XOTA 4QPQA 2QA4I 4OIOF 2NS8A 4P9FA 4ZJZA 2LTPA 3F72A 4PSXA 1IV8A 2FSWA 3LA3A 5D8LB 1AKHA 1N6AA 4E7KA 3CCSI 1QHHD 1RNLA 2YSRA 1YX5A 3PFYA 1R1TA 1KGSA 3SZGA 1DPUA 4A0ZA 3SFIA 3MEKA 2QSFX 2M4GA 3V4GA 3F6OA 2VLAA 3HOSA 3DWLE 2H6BA 3I4PA 4CICA 3OR1C 1SFUA 2EIKH 2ZC2A 4JYKA 4RAGA 4KDPA 3RIBA 4OMYA 3WU1B 3NRVA 1YJNI 1STZA 1ETKA 1DPRA 3QU6A 3S7FA 1ZELA 1HKQA 2M1BA 4UVCA 2R7UA 1RESA 2JRMA 1G59A 4PSWA 4F3QA 3JSOA 4EM1A 1KA8A 1WKMA 5F08A 4E7JA 2LF7A 2Y75A 1ZK8A 4PGHA 4QLCU 1W5SA 4L9JA 3OYBA 1N3JA 5BOXA 1HW2A 3BR0A 3FDYA 3E6MA 3LA7A 3U21A 2YR2A 4P5OA 4Q4ZF 3UKGA 3L2RA 3F9KA 3KCCA 4E7ZA 1ZN2A 2HZDA 2BY3A 3LMMA 1ZKKA 4WK8F 1RR7A 1WWXA 3GTGJ 1LUJB 2M4KA 2EFPA 2R7QA 1YW9A 1MD0A 4XLAA 4A2UA 2DMTA 4Z6YA 2XF5A 3OS1A 5EG0A 4N4NB 5F6LA 2E1NA 3SXYA 4A3FJ 2STTA 2HQAA 2W00A 3OYLA 5FKLA 1LEBA 2FUG2 4GYGA 2R5YA 3OYEA 1KYZA 2Y9YA 1TT5B 2G0EA 2MW8A 2VBZA 2Q2EB 1R49A 2HNHA 3WTTC 4A12A 4RLFA 4YIRX 2FMLA 3FPDA 3OOUA 3EPZA 3PIOF 2JPCA 4BJ6C 2Z5UA 3HSRA 4V2GA 5B66C 4M9ZA 5IPAA 1TL8A 1OR7C 3I71A 1FP1D 5E1WA 2XPVA 3L1PA 3VWBA 2QQ9A 2D1HA 3L2QA 1IN4A 5L3GA 2O0YA 1W7PB 2WADA 4PJ0C 1RC9A 4UV8A 2PJRA 1AA7A 2DQLA 3RCOA 3OXFA 3RZOJ 3FHNA 5EDNA 4EJOA 2D2WA 1Y8RB 4BJ5C 4XBFA 1E2XA 5JLWA 2A5YB 3H36A 1R36A 3QPSA 2DFFA 1V54H 2VC0A 1HCRA 2KISA 5FLXZ 5ED4A 3H92A 2OQGA 2XAHA 3OYGA 1T95A 3PNVA 4Y17A 4F7ZA 2HZTA 3OIQA 1HSTA 2AHQA 1IAWA 5HDNA 2LKXA 1FIPA 1VI0A 4KIBA 4GRIA 4KN4X 4A69C 3K4JA 1ETVA 2P4WA 2E1MC 3KZIC 3RQIA 3CMAI 4P55A 1D5VA 3FMRA 2RVCA 2MGQA 1TC3C 1WJBA 3GCMA 3HSFA 2XB5A 5CLSA 4P96A 2CRGA 4II3A 1BW6A 5K5OA 2DA3A 4A3EJ 3DKYA 3K0LA 3K69A 1QZEA 2ZFWA 1S7AA 1FWZA 1K83J 2E60A 2W57A 4H0EA 3AG4H 3N71A 1PJRA 3HKZN 2Y2ZA 4WXDA 3JRBA 5JINA 2X6XA 2IGOA 1P92A 2KIUA 1HA8A 2DO7A 5JLXA 1Z77A 1K78B 4J7FA 4DJAA 3ZQIA 2IEKA 1X4OA 1Z9CA 2UUZA 4B48A 1WI9A 2HS5A 1Y6IA 4CH7A 5D5XB 4QIWN 2CQ7A 1MKMA 3OL3A 3VPRA 4AM3A 1QHGA 4PZJA 1ODDA 3ZOBA 4G94A 2OZUA 5CCMA 3QQAA 3WU2C 5D5VB 3RKYA 4K2EA 4EJTA 5A2QK 3ZMTA 4E47A 5FLXK 3D1NI 4E7IA 3RJWA 4HF1A 1R1UA 1WH7A 2IBDA 3LSMA 4IXAA 1MNMC 2QGUA 4AWXB 2ELJA 1C0WA 3BR5A 2MD5A 4D5CA 2KP6A 4HX4A 2BZTA 2BYVE 5FO5A 2PMHA 1GV2A 2EA2A 3S17J 1AWCA 4RGRA 3JW4A 3KE2A 4WX9A 1LPQA 3HC7A 4N4OB 3W3CA 1V3FA 3QWWA 4MLOA 1IN6A 4CUGA 5D5WB 3V7CA 1IV6A 3HBLA 3H35A 1XGMA 1GDTA 1QA6A 3S93A 4UUSB 4LK0F 1EA3A 2JVGA 3IWZA 3ULQB 3GX4X 4BEHA 4BDYA 4G6DA 5E8IA 2QF7A 5JVGF 5F5EA 1N77A 1HLVA 3MO5A 5HOOA 4XNFA 3I9V2 1MT6A 1TLHB 1R5HA 3TP3A 4QEPA 3J80K 2OCEA 5KVRA 3EETA 3OOPA 1HBXG 2VPRA 2E5NA 4ZYEA 2OAZA 1EF4A 3NWTA 2M45A 3CC4I 3HOYJ 2E19A 2WY7Q 3A1YA 2WAQA 5DV5A 4I6ZA 1ZG5A 4FX4A 2FXAA 3REOA 2V9VA 3CJTB 3N4MA 2OJED 3DV8A 5IP9J 2XF6A 1FMVA 3K4LA 4XORA 1G2HA 1VNDA 1FMWA 1W7PD 3CDHA 2DCEA 3S32A 2HQNA 2ZMEA 4IL6C 1YQAA 2BOLA 3RYPA 4AYBN 3JCUC 2P7VB 3LSRA 2P6TA 4MIMA 3FKJA 3I55I 2JZYA 5F6FA 3TL4X 2HTJA 2WTEA 5IYBJ 3I3LA 3OSFA 2CFOA 3SFZA 2XGXA 4LG3A 2QWWA 3TP0A 5LRRA 2DA7A 2CGPA 2HVSA 1GHCA 4LG0B 3KP7A 1TW2A 1O3TA 1UG0A 1A31A 2MLGA 3M58A 3CCMI 2V79A 1MDMB 2YU3A 5HDKA 3PUBA 2XGDA 2DA1A 1R4MB 4XR6A 1MVHA 2GWRA 4UUTA 1V4RA 5BQTA 5TISC 2QZ8A 2E36A 4PJMA 2NXNB 2VN2A 1LFUP 1U0JA 2VOPA 3KP3A 3L2WA 2P0WA 2RAEA 4FT8A 2K40A 4OU0A 3M07A 5T0MA 3PSFA 4A3BJ 2VODA 3LSKA 2JA5J 2KPMA 2MH9A 3JRAA 2G7HA 5CYVA 4LOCA 3OL4A 4YPUA 3G73A 2Y48A 5D6FA 2GA2A 2VJIA 5GAGJ 3IAS2 3B73A 3GF2A 1Z7UA 3EUAA 3W2WA 4HNTA 4CYCB 3BO5A 2NVTJ 1MSFC 1ORKA 2ADUA 4XRSG 2CMPA 3MEXA 2VASA 3WTSC 4B3AA 4ZTJA 1J75A 2FOWA 3J81K 3BC8A 2K9MA 3IP4B 4RM2A 2O9LA 3BPXA 2L5QA 5HLHA 3OYMA 3G71I 4E7SA 2W48A 3DFGA 3CC7I 4CYDA 4RA2A 3OWTA 1X1PA 2EJRA 1MGTA 3BG3A 3ISPA 4DNCA 3HHGA 2LK2A 3CESA 4XLHA 1I1SA 4HW0A 3DLAA 1VZ0A 3KEOA 2DPUA 2JWTA 4ZDOA 3KP5A 5B1AH 1V5GA 1IUFA 2QQBA 3A0HC 2CQNA 2XKPA 5JHFA 4MGRA 2QPWA 2X1CA 5LSXA 3LFUA 5HS8A 5D4RA 3E1SA 3VDXA 3KZZA 1U8BA 3K9TA 5IT3A 4IRIA 3EUHC 1YI2I 5DCMB 1PDNC 5D8KB 3K4KA 2GXGA 2RV8A 1HDDC 1EH6A 4BHBA 4XKVA 2FJ1A 5LEKA 1CGPA 1G3SA 1JHHA 3DALA 3JRHA 1I3AA 3PM1A 1KZHA 5LHGA 3FBNB 3V8JA 4RS8A 2OC6A 1O57A 5EZHA 4NVQA 3RI4A 3KMJA 4BJTA 3VYSB 2KLOA 3CMYA 3LSGA 2O5RA 5DCFA 1D1CA 2EFQA 3H0DA 2DW4A 4YFNF 2FA5A 5LSZA 3HG9A 1JGSA 4J19A 3OXLA 4MO7A 3GFJA 5T0KA 2IS4A 1RPWA 3HOVJ 2QBYA 4UVAA 4IJ8A 4XOPA 3LSTA 1CF7B 3HTUA 3CZ6A 4A3MJ 3MVPA 4J01A 1NH3A 1G8XA 1DP7P 4HDVA 3TEDA 4RBOA 4N9IA 4A5NA 4KT5C 3TW7A 4JOMA 3VV0A 1I3QJ 2KIQA 3FXOA 2CS3A 1QPIA 1JHFA 2LFBA 1FOWA 5LRSA 2QSHX 1DGWY 2FE3A 1JUMA 2JV0A 4RB3C 2F69A 3QWVA 3BG5A 3PO2J 4BXXJ 1ON1A 1YRNB 2LOOA 3LAJA 1OCTC 2P7CB 3WTZA 3GO5A 1POGA 5GTIC 3KMTA 1WQ2A 4PJJA 5GPCA 4YFXF 1JT6A 4OIQF 2VJ5A 1HW5A 3CJNA 4V2FA 2GLOA 4CHUA 2E7XA 5ILSA 2L9SA 2JUGA 2QEXI 3EQLF 3CJQB 2K9QA 3CMMA 3KLNA 5TGTA 5FD5A 3Q0UA 4ESFA 4YIFA 3CC2I 2AO9A 1PVEA 3CCLI 2FD5A 4DBRA 4E7HA 1BM9A 2EFOA 2EINH 1F9NA 3MZHA 1OYWA 4M6XA 4HRIA 5DS9A 1Z6TA 2A3SA 2O3FA 3LSHA 4G12A 3FXRA 2DQRA 4NB5A 2H8WA 4YPAA 4KN7X 1OISA 5KHDA 2Y0MA 1OYYA 3F8MA 2ISZA 1WJAA 1UJ8A 5J40A 5M3MJ 3ZQQA 2DU9A 2Q2EA 2V1XA 3CF2A 4XKWA 5FKNA 3CO7C 1TQIA 4FHTA 1YO5C 1S3JA 3EUHA 4BU2A 1V5FA 1LE8B 5F64A 2TCTA 4Q5SF 3ZRGA 3S7JA 4KYWA 1QU3A 2M7AA 4A0XA 3M1EA 3MD2A 4LFUA 3F8BA 1K61A 4YG2F 3E6BA 1OCZH 2M87A 3K4MA 4UV9A 4E7LA 2NRAC 2R7OA 2WBMA 3H5AA 1U9NA 1X2MA 5JIYA 2A05A 3NARA 4C2UA 2GBYA 2OQRA 5LGUA 3IRRA 2VQHA 4EM2A 1OCPA 2DT7B 1D8JA 2BV6A 1IDZA 1R58A 1P2FA 2GOMA 1XG1A 4MTEA 1G3YA 2IJLA 2M30A 3BTCA 2KJCA 2ZXIA 2VUMJ 2X51A 3ZMDA 2XAQA 2QLZA 5CVUA 2F5CA 2NNYA 2DDBA 2UWMA 3I59B 3S1MJ 2F5EA 3O6BB 1X19A 5KCMA 2R92J 5H20A 4IF4A 2R7TA 5HS7A 3W2VA 1PP7U 2EPFA 2BW3B 2HU9A 2LRDA 5F0HA 4CCJA 3QWPA 2FBHA 3HRTA 3GFIA 4ENMA 1X1AA 1VFCA 2H8RA 5A2QZ 1WHUA 2RFIA 4BXFA 4I7HA 3BQYA 3F9WA 1RKWA 3SHFA 1E3PA 4ZTFA 2DA6A 2VJJA 1O7FA 2XV4S 1QPMA 1UHMA 1T0FC 1WH5A 4F92B 2ISYA 3G1OA 3IAM2 5J6XA 3PSIA 2LF8A 5F1JA 5CQEA 2FQ3A 4I98B 4DYQA 3V42A 4HV6A 4GYIA 1YLFA 1B59A 1RI7A 4ZYGA 3HRSA 2L4MA 3S3OA 2ZXWH 1WSUA 2EH3A 2WAFA 1HKTA 2RN7A 4KISA 2NYXA 3F0CA 2ZJPF 1Y1VJ 1OMIA 3F3XA 1XC5A 3PL8A 2IGKA 3SEQA 5LEJA 1MVXA 1M1EB 4OIPF 1OCRH 3D5RC 1F4KA 2A61A 5DD8A 2LBFA 2XGCA 5FFXA 5HODA 2HQRA 3PFIA 1BW5A 5EGOB 1XMAA 3HUGA 4BQNA 2COBA 3JAMK 1NK2P 3P9IA 4NQWB 2XRNA 3ZMUA 1E3HA 2R7VA 3TBIA 2LLKA 2Z33A 1Y8QB 2RNJA 2VXDA 3C1DA 2WB1A 2L7ZA 3J7YJ 2O8XA 1R22A 1S8NA 2LY9A 4YPEA 3RU0A 1W5TA 2HDWA 4UUVA 3S3NA 9ANTA 3FXQA 4I76A 3FXMA 1GXQA 3I64A 4UUSA 4O3MA 4A3JJ 4G9YA 2JUCA 2QYOA 2VBXA 1F43A 3M55A 2IA0A 1IZ1A 1U8RA 2V1UA 4BE2A 4IHXA 4XL9A 3KLOA 5E1ZB 5IT9Z 2WAEA 1Z21A 1ZR4A 2MD0A 3BZCA 2ZSHB 2BY1A 1GUUA 4Y13A 5J47A 3LSPA 1Z3XA 5F0CA 1YE9A 1JUPA 3LL7A 1W0TA 1FC3A 3K2ZA 4KMUX 3CMEI 1W5CC 4KMFA 2ZJ2A 2BHZA 4OAZA 2JRTA 3GBGA 2GOXB 3E0JB 3WGIA 4GDFA 1UHWA 1MBJA 3G2BA 2OA4A 1YFHA 3BJAA 5IP6A 4L18B 2PLYA 4UHTA 5ILVA 1D5YA 3H9QA 3JRFA 2JN6A 3BTLA 3CBPA 3KEYA 5IY5H 3L9FA 3IV5A 3T5XA 3KIOA 3SJMA 2M2EA 3MFKA 1BI0A 4XLEA 1X3UA 3HOWJ 1GV5A 2K27A 4YEJA 2FEZA 4HSTA 3W6KB 4FETA 1MDMA 1I50J 2XHKA 2IVMA 2P5LC 1TNTA 1MNDA 1W7PA 2XRLA 3L2CA 2PJRB 3CCYA 3PO3J 3SYTA 1VQ8I 2I5UA 2CG4A 4EATA 2IP2A 3M54A 1BN5A 4BBRJ 1JT0A 4MTDA 3S3MA 4IQ4A 2X0LA 2QCOA 2F5DA 2ICWG 3WGGA 5B3SH 2K9NA 3S7BA 2LDUA
chains in the Genus database with same CATH topology
3NWSA 1MMAA 1EA3A 2JVGA 5LFAA 4C2TA 3KYLA 4BDYA 4BEHA 2CUJA 3DU6A 4DIQA 3UNGC 4C30A 5F5EA 1N77A 3MO5A 5TH7A 5HOOA 2DOAA 3PDNA 2W1OA 1NG6A 3I9V2 4XNFA 1MT6A 3CBOA 3DPTA 3VYRB 1P9QC 5JHNA 2MFZA 3OS5A 4QEPA 4I51A 2E5NA 1PYVA 4XKCA 3OYNA 2X85A 4WUYA 1N6CA 3M57A 4CZCA 4OWRB 3RQ4A 3NWTA 2WY7Q 1J09A 2WAQA 3A1YA 4U87A 5HQ8A 2XF6A 1MMDA 2HVRA 1FMVA 3K4LA 2X1EA 3M59A 1YX3A 3D5LA 4JQFA 4XORA 4BQOA 4YNDA 1D0ZA 1FMWA 5ARFA 1W36D 2DCEA 3S32A 5FROA 3RPUD 2BOLA 2Z2SB 1LVKA 2HPIA 4PK4A 2V4JC 3FKJA 4YRVA 3TL4X 3I3LA 1SFKA 2DJIA 3AKZA 2E1MB 4BDZA 3K70C 2CFOA 2BVMA 3VSLA 4LG3A 2F5VA 3MKZA 4J8OA 3BCAA 3OIPA 2HVSA 2X6YA 3OYKA 1UG0A 1DP3A 1WJEA 3M58A 4F91B 3OYJA 3HOTA 5F6KC 2V7FA 3PUBA 3ZXSA 4IKFA 2Z1DA 3A4CA 1OLTA 4XR6A 1O9SA 5KNLA 4JDSA 3DU5A 3AFHA 4LIVA 1MVHA 3OYFA 4B3XA 2LYCA 2CH0A 4PJMA 4XN3A 1U0JA 3L2WA 2P0WA 2WA0A 2JSPA 4J83A 5T0MA 3PSFA 3LSKA 2KPMA 4RLQA 1WJFA 3K6GA 4CCNA 2K5CA 3OL4A 4YPUA 3DPLC 2F6CA 1JI8A 2VJIA 3IAS2 1MUFA 4QEOA 3EUAA 1W36C 3H9GA 3L2UA 3W2WA 3EP0A 2RNGA 4HNTA 3AL0B 3BO5A 2Z16A 4BL0B 4KT6A 2KRCA 2XDVA 2CMPA 2VASA 4DGWB 4ZTJA 3OS2A 1BOBA 5HNHA 3BC8A 2CV1A 3OMYA 4AU7A 2K9MA 3IP4B 4RM2A 2R7RA 3SDBA 3VSKA 2L5QA 2M0MA 3OYMA 3MO0A 2I8DA 4Y33A 3TG5A 3VUZA 2BW3A 2CW8A 5EG2A 3DTIA 4E7SA 3C2HA 3PJRA 4O6FA 3OWTA 2KL4A 3MMYB 4H4KC 1D1AA 3QYBA 3F9ZA 2Y0SA 3OYIA 3CESA 4KITB 4XLHA 4OAYA 4B47A 3DLAA 1VZ0A 2L7KA 2A6TA 4ZDOA 1UELB 1V5GA 3K4NA 4ZC3A 4ITVA 4NC7A 2ZXHA 5JHFA 5HLTA 3DPUA 2MYSA 2X1CA 2LC2A 3LFUA 3H5NA 2QPWA 4H12A 5LSXA 1BR4A 2RQQA 3DTKA 1KONA 2ZSIB 2VJ4A 3E1SA 3VDXA 2M3AA 3F9XA 3EUHC 4ZDLA 1IRXA 2HPMA 4R79A 2LREA 3K4KA 3OYCA 1Z7LA 2MABA 2W7NA 3W2AA 4XKVA 3DB5A 2L2OA 4LDGA 5HVQC 3DALA 3K5KA 5CQGA 3ONQA 4AVZA 4NC8A 3FBNB 3DEEA 1MW7A 2OC6A 4NVQA 3KMJA 4E6KG 4BJTA 2KZVA 3VYSB 2KLOA 3D5SC 3LSGA 2V9KA 1PEGA 5AYFA 2O5RA 1D1CA 3QYEA 4RM3A 3OOIA 3H0DA 2V26A 1N78A 2G46A 4Z4PA 5LSZA 3HG9A 4G6TB 1LKXA 3UR3C 2WY8Q 4NNJA 4D9JA 3M5AA 3BLYA 3OXLA 2LY2A 1DGRM 1X1CA 5TEGA 3L2VA 4J00A 4CCKA 4BS9A 3VYTB 1TT0A 1LFPA 2IS4A 5T0KA 4IJ8A 4LITA 4XOPA 4XLCA 2IGNA 4BUPA 3CZ6A 4U7BA 2PMZA 4J01A 1G8XA 5F59A 2QKMB 5CKTA 2W82A 2O8JA 4JOMA 3RSNA 4HG2A 3K4BA 3VV0A 5JJ0A 2IS1A 2CS3A 2NOJB 1MMNA 4ANJA 4XM3A 4XQFA 4X0GA 1DGWY 3DKXA 2VKHA 3QWVA 2JV0A 2F69A 2VIXA 2LOOA 4HSRA 2XSJC 2M7BA 3QYFA 3KMTA 2CW7A 2R4GA 3VYUB 3S93A 4B44A 3SW9A 4II2A 4PJJA 3DTEA 3FBIB 1X4PA 2VJ5A 4YELA 1ML9A 1GLNA 2KDOA 3RAYA 2K9LA 4QPOA 2L9SA 2JUGA 5FRNA 3CJQB 3CJRB 3QOEA 2LY1A 3CMMA 5TGTA 2VQGA 2OUMA 4CA0A 3A2KA 4DBRA 4E7HA 2VL8A 3DQVC 3SWCA 3OYDA 4CCOA 2VKDA 4FASD 1Z3YA 4HRIA 3SEZA 2IGQA 3HXLA 3LSHA 4XLFA 2KMUA 5KJLA 4YPAA 2W4SA 5KHDA 4XOTA 1WJCA 1WJAA 4QPQA 4C1QA 3ZQQA 3F9YA 4ZJZA 3CF2A 4XKWA 2E5ZA 1BR1A 4PSXA 2IS2A 4BACA 2VB6A 4BQQA 4BU2A 1V5FA 3TG4A 2W5YA 1N6AA 3ZRGA 4E7KA 3S7JA 1QU3A 1QHHD 1H3IA 2M7AA 3S7DA 1YX5A 3C2GA 3MD2A 3N05A 3PFYA 3SZGA 1D0YA 3K4MA 3MEKA 4E7LA 2M4GA 2R7OA 2WBMA 4RMNA 2VLAA 3HOSA 3H5AA 2X6WA 4BEHB 3DWLE 5JIYA 3OR1C 4C2UA 5KJNA 2BVLA 3ZR8X 3RIBA 3EUKL 2VQHA 2DT7B 4ZYAA 2R7WA 2GOMA 2ZFUA 4DBQA 2KRHA 2LH9A 3M56A 3S7FA 4PJNA 1ZELA 2K3PA 2R7UA 2ZXIA 4HEA2 3ZGKA 2X51A 3MKWB 2IXSA 1D0XA 1G59A 4PSWA 4F3QA 5EX3A 3CBMA 4E7JA 3BG6A 2LG4A 2UWMA 1R6RA 1WFXA 4F55A 3OYBA 1XQHA 1N3JA 2JVHA 4PJLA 3M53A 1X19A 3FDYA 2QKLB 5KCMA 2DT6A 3U21A 2R7SA 2R7TA 4P5OA 4XN0A 3W2VA 3L2RA 4IX7A 3F9KA 4E7ZA 1UAAA 2HZDA 3IUOA 2BW3B 2HU9A 2LRDA 3QWPA 1NG7A 2Q1ZB 4CCJA 5HNFA 2X1DA 4RZ0A 3LMMA 1X1AA 1ZKKA 4HPQA 3LSIA 4PFOA 4CCMA 2RFIA 4BXFA 3F9WA 2VQLA 4JLGA 2M4KA 2R3AA 3HPHA 2R7QA 1D1BA 2VJJA 1X1DA 3M8JA 4D1QA 1T0FC 4ZTFA 4F92B 4FMUA 4XLAA 3M1CA 3IAM2 3OR2C 4ZDPA 2XF5A 3OS1A 3CP8A 4N4NB 4NJ5A 1BR2A 3PSIA 5F6LA 5CQEA 2KHMA 4IJDA 3OY9A 2HQAA 2W00A 3OYLA 3AL0C 2FUG2 3V42A 3OYEA 4IZZA 3KX2A 5KJMA 5CCLA 1S9HA 3S3OA 3IHXA 2WAFA 1LDKB 3S8PA 4KISA 2Q2EB 4MI5A 1K6YA 3KMAA 5TTFA 2HNHA 3PL8A 4RLFA 3FPDA 2IGKA 2V1NA 2RREA 3EPZA 3OOUA 3SEQA 3TMOA 4BJ6C 1MVXA 4F93B 4CCLA 2VQCA 2KQRA 1OR7C 3D5RC 2UV1A 3BG7A 3VWBA 1SAUA 3L2QA 4P1WA 2LBFA 4C9YA 2PJRA 2WADA 2R7XA 1TZLA 1AA7A 3RCOA 3OXFA 3HPGA 3PNYA 3HL2A 4O30A 3FHNA 4BQNA 4BJ5C 3H9JA 2R7VA 3K10A 4KJZA 4NQWB 3TBIA 3OYHA 3MO2A 1WJDA 2VXDA 2WB1A 4MI0A 3OYGA 2VPLA 1T95A 3H5RA 3PNVA 3OPEA 4YPEA 5ARGA 3RU0A 3CP2A 3OIQA 2HDWA 5FRMA 4Y4RA 2LBFB 4IQJA 4GRIA 4E4HA 2CV2A 3S3NA 3K4JA 4DOZA 5T5GA 2E1MC 3ZCOA 4LIUA 1WJBA 1MMGA 4NUBA 2W5ZA 4II3A 3M55A 3DKYA 4BE2A 2DXIA 1N75A 2E60A 4XL9A 2WAEA 1Z21A 3N71A 1PJRA 2L9NA 2MD0A 2ZSHB 4PUSA 4PFPA 3RTRA 4BGDA 2OV7A 5JINA 2IGMA 1Z3XA 2X6XA 1YE9A 5LD2C 2IGOA 3S7BA 3LL7A 1HA8A 2XAUA 4YNMA 3BCBA 4CSWA 4J7FA 3K70D 4HNUA 2AQFA 4DJAA 4OAZA 3OXGA 3HKZA 2XC7A 1X4OA 2AQEA 3GBGA 2GOXB 4BE1A 3E0JB 2UUZA 4B48A 4XKBA 2JA2A 3G2BA 2BQZA 1Y6IA 4CH7A 5EX0A 3OL3A 4AYBA 1MNEA 3H9QA 3OS0A 2CUZA 2VXZA 4Y3OA 2IS6A 1QHGA 1ERDA 3CBPA 3KEYA 4B43A 1X1BA 2HVQA 3J7AY 2XF7A 5CCMA 4XMYA 5HI7A 1E0EA 4XLEA 2V6EA 4XONA 4E47A 3MKYB 4E7IA 5CPRB 4YEJA 3HNAA 3RJWA 4HSTA 4F52A 3LSMA 4FETA 4BE0A 4QENA 2ELJA 2CV0A 3K4CA 2F4IA 1MNDA 2PJRB 4J7IA 3OYAA 1DQUA 3SYTA 2KP6A 3HUGB 4EATA 1Y56A 5KJKA 3M54A 3S3MA 4IQ4A 3PNTA 1V5EA 3QODA 3HC7A 4N4OB 3W3CA 3QWWA 4MLOA 2A5WA 4YNPA 4CUGA 3H35A 2MC4A 1WJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9Z A;  3SWC A;  5F5E A;  3MO5 A;  5TH7 A;  3OXF A;  3PDN A;  4O30 A;  1MT6 A;  3CBO A;  2IGQ A;  5JHN A;  3OS5 A;  4QEP A;  4I51 A;  5KJL A;  4YPA A;  4WUY A;  3MO2 A;  1N6C A;  3M57 A;  3RQ4 A;  4MI0 A;  4C1Q A;  2QPW A;  4H12 A;  5LSX A;  3F9Y A;  3OPE A;  4YPE A;  5ARG A;  3RU0 A;  3TG4 A;  2W5Y A;  3F9X A;  5HQ8 A;  1N6A A;  3S7J A;  3M59 A;  1H3I A;  3S7D A;  5T5G A;  4YND A;  5ARF A;  3DB5 A;  3MEK A;  4LDG A;  2W5Z A;  3DAL A;  5JIY A;  3K5K A;  5KJN A;  3M55 A;  3RIB A;  4NVQ A;  3N71 A;  3KMJ A;  4J8O A;  3S7F A;  3M56 A;  5JIN A;  1PEG A;  5AYF A;  3OOI A;  3M58 A;  4Z4P A;  2G46 A;  4YNM A;  5LSZ A;  4J7F A;  5EX3 A;  5F6K C;  3CBM A;  3M5A A;  3OXG A;  3OXL A;  1O9S A;  1XQH A;  4JDS A;  5TEG A;  1MVH A;  1N3J A;  3M53 A;  5T0K A;  2BQZ A;  4IJ8 A;  4BUP A;  5EX0 A;  5F59 A;  4J83 A;  2O8J A;  3QWP A;  4RZ0 A;  5T0M A;  3CBP A;  3VV0 A;  5JJ0 A;  1ZKK A;  2RFI A;  3F9W A;  5CCM A;  4JLG A;  2R3A A;  5HI7 A;  4FMU A;  4E47 A;  4YPU A;  3QWV A;  2JV0 A;  2F69 A;  5CPR B;  3HNA A;  3RJW A;  1MUF A;  4NJ5 A;  5F6L A;  4QEO A;  4QEN A;  4IJD A;  3EP0 A;  3BO5 A;  3KMT A;  3SW9 A;  4J7I A;  5KJM A;  5CCL A;  3IHX A;  3S8P A;  5KJK A;  3M54 A;  4MI5 A;  1ML9 A;  3KMA A;  3RAY A;  4AU7 A;  5TTF A;  3FPD A;  3MO0 A;  3QWW A;  3VUZ A;  3TG5 A;  5EG2 A;  4YNP A;  1MVX A;  4O6F A;  3S7B A; 
#chains in the Genus database with same CATH topology
 2DOF A;  3F8N A;  2VE9 A;  5LFA A;  4C2T A;  3U1D A;  2CUJ A;  3DF8 A;  3DU6 A;  4CGZ A;  2EIM H;  1HQC A;  2H94 A;  3NEU A;  1P6R A;  2XAF A;  4AIJ A;  4G7H F;  2CQX A;  2W1O A;  3H0G J;  3CBO A;  1MBG A;  3AG1 H;  5HS9 A;  3VYR B;  5JHN A;  3ECO A;  3QPT A;  5JI6 A;  4MEY F;  4DW6 A;  2VKV A;  2GXB A;  1FEX A;  4WUY A;  4ABZ A;  1GVJ A;  5E79 C;  3TGN A;  1HF0 A;  4OWR B;  4ENK A;  4XSZ F;  1U2W A;  2DFI A;  2R93 J;  3F23 A;  1ZRE A;  1XSV A;  4KNY A;  1A6I A;  3FZV A;  3GZN B;  3U1K A;  5HQ8 A;  2HVR A;  1MMD A;  3ZN1 A;  4E70 A;  4ETS A;  2A6E F;  3LNQ A;  1KU7 A;  2XRO A;  3KPH A;  3QAH A;  2Z2S B;  1E3O C;  3QPL A;  5AIP A;  5DD4 A;  2HTS A;  3A03 A;  4FX0 A;  1NHA A;  3S1R J;  1HKS A;  3BDD A;  3BJ6 A;  2E1M B;  2EV5 A;  3V8K A;  1WZ2 A;  2F5V A;  3MKZ A;  3G3Z A;  2EA4 A;  1USS A;  2ZXJ A;  3BCA A;  3CO6 C;  1BI3 A;  4IOC F;  2UXX A;  5E18 F;  2X6Y A;  3SZP A;  3ASN H;  3R4K A;  5M3F J;  3KP2 A;  1WJE A;  2FNP A;  2MBF A;  5M5W J;  4A6D A;  1KU9 A;  2K4J A;  3VOE A;  5KAF C;  4XID A;  5F6K C;  4RB1 A;  5DM7 F;  1OLT A;  2KIF A;  1O9S A;  3U2R A;  3N97 A;  4LIV A;  2CJJ A;  3ABU A;  1H88 C;  4B3X A;  1SD4 A;  2IAI A;  5K7H A;  2CH0 A;  4XN3 A;  5H6Q A;  1FJL A;  3E7L A;  4XSX F;  4GFB A;  3TO9 A;  2FBI A;  3FHZ A;  1XGS A;  3HB9 A;  2QVO A;  3JRC A;  4XRF A;  2KFD A;  5E3O A;  3GXO A;  2MH2 A;  2M34 A;  2CU7 A;  2HR3 A;  1IXS B;  3P9K A;  3K6G A;  5C3E J;  2R5Z A;  1WPK A;  3KEQ A;  1JI8 A;  3PUF A;  2K86 A;  1MSE C;  3GTK J;  4QEO A;  3LQR A;  2FMY A;  4BAY A;  2X9D A;  2I10 A;  1ETW A;  1J2X A;  4KT6 A;  4BL0 B;  2XDV A;  1BOB A;  3GTQ J;  1OQY A;  5GPA A;  4XK4 A;  5E20 A;  2R7D A;  2JT1 A;  3VSK A;  3M4O J;  2I8D A;  2XPU A;  3TG5 A;  1REP C;  4D7M A;  1JJ6 C;  3FXU A;  2YUS A;  2VE8 A;  1ONV A;  3C3W A;  1ZR2 A;  1RIO H;  1SD7 A;  3K7A J;  3CCE I;  1D1A A;  3NAU A;  2CYY A;  3TQN A;  1QQI A;  1S6L A;  5J8C A;  5J8F A;  3W6J B;  4OAY A;  1Y39 A;  2WB1 N;  1BI2 A;  1GVD A;  5EG0 B;  3RKQ A;  4X6A J;  1XSD A;  2DOE A;  4B8X A;  4FE7 A;  3DKW A;  1QO0 D;  4ITV A;  5E1X A;  1EJ9 A;  2P81 A;  5HLT A;  5JVT A;  2O8K A;  2KZG A;  4DYC A;  1BR4 A;  1SAN A;  2RQQ A;  3S2W A;  3DTK A;  2HOS A;  2P5V A;  1DU0 A;  1T56 A;  4RB0 A;  3F9X A;  4UB8 C;  4AD9 A;  1I39 A;  2EWN A;  3ERE D;  3OYC A;  3TOB A;  2OU2 A;  2DK5 A;  2EQR A;  1FOY A;  2L54 A;  2PQ8 A;  2L2O A;  3SQN A;  2HKO A;  1S7E A;  1A5J A;  1XDU A;  5ICC A;  3K5K A;  5CQG A;  2HFH A;  2BBY A;  1MW7 A;  3DEE A;  3FXL A;  4EVI A;  2OTL I;  1JKR C;  3FK6 A;  1MBH A;  2ZCW A;  4E6K G;  5ICE A;  4M6Y A;  1MJ9 A;  1R1V A;  1PEG A;  3Q5F A;  3CCU I;  2K85 A;  4RM3 A;  1IN8 A;  1IJW C;  5J1Y A;  1FY7 A;  2WY8 Q;  4NNJ A;  4D9J A;  3BLY A;  1OJL A;  2V1D A;  3C18 A;  3JRD A;  1OFC X;  3HZJ A;  4Q47 A;  1WGX A;  2AS5 F;  1V55 H;  1LFP A;  1SVL A;  1O3S A;  1JKP C;  1YIT I;  1S72 I;  4U7B A;  4BUP A;  2EZH A;  4XIC A;  4M9X A;  5F59 A;  1D8K A;  2QKM B;  2G9W A;  2W82 A;  3BRO A;  4HG2 A;  3FX3 A;  1FT9 A;  2L9R A;  1I6H J;  3WTU C;  2EV0 A;  3CUQ A;  1P4A A;  3DKX A;  2FOK A;  3A01 A;  2F2E A;  1FBU A;  2VIX A;  3GYH X;  2ESN A;  1K78 A;  3Q9S A;  1MH3 A;  1T8I A;  3X2Q H;  3BPV A;  3QYF A;  1YS7 A;  3TDU C;  4B44 A;  3IRQ A;  2HOA A;  1QGP A;  1HDP A;  2OBP A;  2VT2 A;  1VQN I;  3FBI B;  5L3C A;  1RUO A;  4A6E A;  3R0A A;  1IXR C;  2KDO A;  4W1U A;  4M74 A;  5TJJ A;  5BPD A;  3IH3 A;  4PDK A;  2NVX J;  4QPO A;  2BE5 F;  2CSO A;  1JKQ C;  5FRN A;  3QOE A;  5F04 A;  1OPC A;  1PUE E;  1S29 A;  2E35 A;  3IKV A;  1FNN A;  4GXO A;  4Y52 J;  3P7N A;  5EZG A;  5DUK A;  4RGS A;  1APL C;  4C3J J;  1CQT A;  3G1L A;  4CCO A;  1FBQ A;  3BZ6 A;  2BHY A;  3IH2 A;  3TKY A;  1Z3Y A;  4BBS J;  1KQ9 A;  1Z1D A;  2DN0 A;  1S7O A;  3GUD A;  1A36 A;  3BY6 A;  3FMS A;  3PQK A;  2UZK A;  1T98 A;  1FX7 A;  5KJL A;  3MZY A;  3ABM H;  2LMD A;  1ZLJ A;  3E6D A;  4ENJ A;  1WJC A;  1H0M A;  1J59 A;  1AHD P;  4C1Q A;  4N9H A;  1MH4 A;  4LLN A;  2XAJ A;  2H1L A;  2IS2 A;  2ZO4 A;  1BI1 A;  4BQQ A;  1TQM A;  2JPB A;  4V19 K;  3TG4 A;  2W5Y A;  4L9N A;  1T0F A;  1S5L C;  4RAF A;  4L0Z B;  1OCO H;  5JFR A;  2X6W A;  4BEH B;  2MG4 A;  4I01 A;  4B1R A;  3B6A A;  1XTA A;  2BVL A;  1X3Z B;  2MLK A;  2YS9 A;  3O8H A;  4Q48 A;  3ZQ7 A;  1R5G A;  3J81 Z;  2TDX A;  4NQW A;  4S05 A;  4ZYA A;  4RGX A;  2ZFU A;  4DBQ A;  1P4X A;  2ETH A;  2KRH A;  2HGC A;  3M56 A;  4PJN A;  2K3P A;  4HBL A;  1U5T B;  3ZGK A;  3MKW B;  2IXS A;  1BIB A;  2DLL A;  2L7M P;  1YIJ I;  3ECH A;  2OCC H;  2LNB A;  1R6R A;  4F55 A;  5K5R A;  1XQH A;  1YHQ I;  5D4S A;  2EK5 A;  3Q0W A;  3HDD A;  3J80 Z;  3M53 A;  2QKL B;  2EZI A;  5CJ9 A;  2DT6 A;  2ZME B;  1Y0N A;  1Z0X A;  2QSG X;  3GTL J;  2JMW A;  1TQP A;  4MQV A;  4IX7 A;  3CUQ C;  1VF9 A;  2XUB A;  1UAA A;  3IUO A;  5BMZ A;  2Q1Z B;  5E3M A;  2X1D A;  3JTH A;  4HPQ A;  1B8I A;  3LSI A;  4CCM A;  1BIA A;  1ACI A;  4M71 A;  2R3A A;  1D1B A;  1R7J A;  1X1D A;  3M8J A;  4HF0 A;  2QUF A;  3S2D J;  5FJ8 J;  5EJC A;  1J9I A;  2VKE A;  3OR2 C;  4ZDP A;  3CP8 A;  1T08 B;  2Z99 A;  2KHM A;  2YX7 A;  2VOO A;  2NOG A;  1WI3 A;  3CDL A;  3AL0 C;  5IP7 J;  1YW8 A;  5KJM A;  1WCM J;  3KP4 A;  3K1P A;  5CCL A;  1S9H A;  2IW5 A;  1XN7 A;  4M3B A;  2X4H A;  1LDK B;  3S8P A;  2Y31 A;  2XKO A;  1UMQ A;  4HDU A;  1BL0 A;  1K6Y A;  1F1Z A;  1R9T J;  2VT3 A;  1OR7 A;  2L4A A;  3R61 A;  3KMA A;  2XIG A;  3LQQ A;  5TTF A;  2GQQ A;  3DBL B;  1ITY A;  2M8E A;  2DA2 A;  4GO1 A;  3H1C A;  2V1N A;  1YTY A;  3TMO A;  4U0Y A;  4HAM A;  4P9U A;  3KET A;  4CCL A;  2GIZ A;  2Z9O A;  2E2I J;  2VQC A;  1UZC A;  2UV1 A;  3BG7 A;  1SAU A;  3D0S A;  4P1W A;  3K1M A;  1UFM A;  2QM3 A;  1K6O A;  2R7X A;  4C2M J;  2R5Y B;  2H1K A;  2EZL A;  3A0B C;  2LKS A;  3HPG A;  3PNY A;  3HL2 A;  4U88 A;  1K79 A;  1J5Y A;  2EB7 A;  4O30 A;  3K10 A;  4KJZ A;  4I99 C;  3MO2 A;  5K5Q A;  2OTJ I;  3GZ6 A;  1AU7 A;  3BTI A;  3H5R A;  2EFW A;  3OPE A;  4L9V A;  3CP2 A;  3LFK A;  1B72 A;  5FRM A;  4L9T A;  4Y4R A;  3WTW C;  1U5T C;  4IQJ A;  5LHI A;  4DOZ A;  1RRJ A;  1U78 A;  1LNW A;  3VOD A;  2AXL A;  3ZCO A;  4FTH A;  4IRG A;  1R5I D;  1MMG A;  2HYF A;  4NUB A;  2OPT A;  4KIG A;  1MIJ A;  3RKW A;  1FZP B;  1KU3 A;  1MJA A;  1Z6R A;  3CLQ A;  1KU2 A;  2DXI A;  1N75 A;  1DU6 A;  3L09 A;  2R0Q C;  2WWY A;  1MBF A;  2M5W A;  3ZQH A;  1T2K A;  5HDG A;  4BGD A;  2OV7 A;  4EGY A;  3V7S A;  4IHS A;  5IOZ A;  5EEA A;  2XAU A;  4YNM A;  3BCB A;  4CSW A;  3T8R A;  1SD5 A;  1BJZ A;  5BS6 A;  4BY7 J;  2HQ5 A;  3OXG A;  3HKZ A;  2XC7 A;  2AQE A;  2HYG D;  5J1U A;  3C2B A;  4XKB A;  2JA2 A;  3FXK A;  1FTT A;  3GEZ A;  1MNE A;  3OS0 A;  2CUZ A;  5LHH A;  1AOY A;  4Y3O A;  1ERD A;  2MSY A;  5AON A;  4B43 A;  1X1B A;  3QOP A;  3MCZ A;  2HVQ A;  1MZB A;  1SFO J;  3B02 A;  2VI6 A;  2ID6 A;  1ZKG A;  1E0E A;  4XON A;  1FTZ A;  3MKY B;  3WTX C;  5CPR B;  3HNA A;  4F52 A;  4LD5 A;  3DBR B;  2JJ7 A;  4S0H B;  4BE0 A;  3E97 A;  2CV0 A;  3J7A O;  4QEN A;  3GVA A;  2QQA A;  1XGN A;  4M72 A;  4EJW A;  4J7I A;  1DQU A;  5J1R A;  3H3V K;  1ETO A;  3HUG B;  2DI3 A;  5CVV A;  1Y56 A;  3OSG A;  2QBY B;  2IA2 A;  2RQP A;  4PGG A;  2C6Y A;  1K4S A;  1CF7 A;  5JR3 A;  1ETX A;  4JX4 A;  4BKX A;  3PNT A;  2B0L A;  2W24 A;  2E71 A;  1XSX A;  3Q3S A;  1AKH B;  3JRG A;  4XRM A;  1ON2 A;  2A5W A;  4YNP A;  1BC8 C;  4HQE A;  1SVM A;  1YS6 A;  3RPQ A;  2DMQ A;  1WJ5 A;  3NWS A;  1MMA A;  3DLL F;  1G6N A;  2R7F A;  3KYL A;  4DIQ A;  4G7Z F;  4DYR A;  4C30 A;  3RJP A;  5TH7 A;  2ZME C;  3PDN A;  2NAZ A;  1NG6 A;  1SEU A;  4LMY A;  3DPT A;  1E17 A;  3ZPL A;  1PYV A;  3ABK H;  3OYN A;  1N6C A;  3G1M A;  4M3F A;  4EJU A;  2JQ7 A;  4IO9 F;  5GAH J;  4U87 A;  1RET A;  3FM3 A;  1VQL I;  5C4X J;  1Z91 A;  4NDL A;  3GWZ A;  1IGN A;  3M59 A;  2X1E A;  1I6X A;  1YX3 A;  2DDA A;  2WV1 A;  4Y15 A;  3R0J A;  1Y1W J;  1D0Z A;  1KYW A;  4C3I J;  1T39 A;  4YND A;  5ARF A;  5F0F A;  4IOA F;  5FRO A;  3RPU D;  3IHX A;  1LVK A;  3O2P E;  3P9C A;  4PK4 A;  4XLP F;  1Y0U A;  3W6V A;  2V4J C;  3HGG A;  2ZJQ F;  2DYS H;  3F6V A;  1IW7 F;  1SFK A;  3K70 C;  4BHC A;  2BVM A;  3VSL A;  2CFX A;  3AG2 H;  3RZD J;  1K4T A;  2EBI A;  5FKK A;  4EV0 A;  5EYR A;  3LSJ A;  1FYK A;  1X2N A;  1DP3 A;  3S14 J;  2XAS A;  2FF4 A;  4OIN F;  3OYJ A;  3HOT A;  2XB0 X;  2LP0 A;  2O61 A;  3ZXS A;  4IKF A;  2Z1D A;  3A4C A;  2MC3 A;  1XPX A;  1IDY A;  4JDS A;  4C3H J;  3AFH A;  1YOV B;  2LYC A;  1G4D A;  4NBQ A;  4KIC A;  3FK7 A;  1DUX C;  1ZYR F;  4MFE A;  3QU3 A;  2XSD C;  2DA5 A;  4J83 A;  4LG0 A;  4R1H A;  2JSC A;  2IRF G;  1JJ8 C;  1R23 A;  1VQ9 I;  1UG2 A;  4LLG F;  4AUX A;  2KDZ A;  4N0B A;  1WJF A;  1R71 A;  2L01 A;  1QVU A;  4CCN A;  1RUN A;  2K5C A;  3NQO A;  3GW2 A;  3V8L A;  3IC7 A;  3JR9 A;  3DPL C;  2F6C A;  2Y9Z A;  2R7Z J;  1J0R A;  3HOX J;  1W4M A;  1MUF A;  2BXY A;  1W36 C;  3EP0 A;  4G7O F;  1ETY A;  1F36 A;  2Z16 A;  4QTR A;  4A3D J;  1XCV A;  1P4W A;  2KKO A;  1B9M A;  4M3E A;  4IVN A;  5HNH A;  1QBJ A;  1ZH5 A;  4R8H A;  3BG9 A;  4AU7 A;  3K2A A;  5FGM A;  3VUZ A;  2BW3 A;  5EG2 A;  1TP4 A;  1YW7 A;  3C2H A;  1NTC A;  2E34 A;  3PJR A;  1TWG J;  4S04 A;  3LA2 A;  4IPA A;  4EM0 B;  2ESH A;  3QYB A;  4EJV A;  3WU0 A;  2Y0S A;  3T0Y A;  1FYM A;  2HI3 A;  3HHH A;  4B47 A;  4KUM A;  2M8G X;  2A6T A;  4HX7 A;  5BNG A;  4ZC3 A;  2YU9 J;  4Z2Y A;  2TRT A;  4U0W A;  3CCQ I;  2Y30 A;  3DPU A;  2MYS A;  4H12 A;  2LC2 A;  1SD6 A;  3H5N A;  4A3K J;  1ZRD A;  3IHU A;  1KON A;  2ZSI B;  1FYL A;  5F1R A;  2QEN A;  2M3A A;  5GP9 A;  4ZDL A;  2CO5 A;  4NC6 A;  1I5Z A;  3BTJ A;  4Y7N J;  4FCY A;  2HPM A;  2LRE A;  2O03 A;  1FOK A;  1TNS A;  2W7N A;  1Z7L A;  2MAB A;  3RKX A;  4OOI A;  3W2A A;  5CVI A;  4OIR F;  4A5M A;  3DB5 A;  4ASN A;  3GFM A;  2E1O A;  2A07 F;  3I58 A;  2IA1 A;  3RDI A;  3EYI A;  3WTV C;  3ONQ A;  5EGO A;  2Q0O A;  1X3W B;  3SZT A;  5DTD A;  2DPD A;  1VQ6 I;  2CUF A;  3ASO H;  2D45 A;  1O3Q A;  2D1V A;  2KZV A;  3D5S C;  5GAE J;  2E7W A;  2FX0 A;  1EV7 A;  2G7U A;  3JRI A;  5DEQ A;  3F8F A;  1UB9 A;  2L9V A;  1EH7 A;  1MBE A;  3HOU J;  3S2H J;  4G6T B;  1LKX A;  3UR3 C;  2HXO A;  3HRM A;  2P8T A;  2W25 A;  4JK1 X;  2COM A;  2R5Z B;  2VON A;  5TEG A;  3L2V A;  4CCK A;  2HWV A;  4HOB A;  4ZYD A;  3ZQL A;  1PP8 F;  4LIT A;  3H3U A;  2IGN A;  3TDZ C;  4BHP A;  2OZ6 A;  4G8X A;  3A02 A;  2VC1 A;  3OIO A;  5CKT A;  4L0Y B;  2O8J A;  5FKM A;  1J7K A;  3RSN A;  1O3R A;  3K4B A;  2ME0 A;  3DP7 A;  2NOJ B;  4HYE A;  3O3K A;  1OYI A;  4M3G A;  3WE3 A;  4ANJ A;  2CQK A;  4LB5 A;  3BJO A;  4XQF A;  4X0G A;  2LD5 A;  1LEA A;  3DEW A;  3BR1 A;  2VKH A;  4CDG A;  1U5T A;  1IN7 A;  2CUE A;  2Y69 H;  1F5T A;  1B6A A;  1G3W A;  2XSJ C;  4HSR A;  1ZGA A;  5DDG A;  2P5K A;  1IO2 A;  1SFX A;  3TOA A;  3VEP A;  3SW9 A;  3HSE A;  2K02 A;  4II2 A;  4A3L J;  1B1B A;  1B4A A;  1W1W E;  1Z67 A;  2H09 A;  3BZK A;  1X4P A;  4U7D A;  2GZW A;  1LVA A;  1OCC H;  3F21 A;  1GT0 C;  1ML9 A;  1RZ4 A;  4HA8 A;  3QRF F;  1BBY A;  1IC8 A;  5EEH A;  1D3Y A;  2BEO A;  2X6O A;  3HIF A;  3CJR B;  1K7A A;  2L02 A;  2NS7 A;  4IHT A;  3M8E A;  3QWL A;  2MA3 A;  3CTA A;  2A6H F;  2RDP A;  2X48 A;  3ML6 A;  4M73 A;  2HXI A;  4CA0 A;  3WTY C;  2VL8 A;  3HYI A;  1JGG A;  4LLL A;  5L3B A;  1H89 C;  4JBA A;  4FAS D;  4D0P A;  1L0O C;  5IYC J;  4AID A;  3H3Z A;  2V9P A;  5B5E C;  2L7F P;  2ZJR F;  3LAP A;  1R4N B;  2W4S A;  3R6S A;  4ESB A;  3C7J A;  1ENH A;  3F9Y A;  2E5Z A;  1BR1 A;  1TWA J;  4PCQ A;  2P6S A;  2O7O A;  4BAC A;  1Z05 A;  2VB6 A;  2Q8K A;  2STW A;  3GTP J;  4UB6 C;  2HOE A;  5TRD A;  1H3I A;  1KQ8 A;  3S7D A;  3C2G A;  3N05 A;  2B9S A;  4DQ2 A;  5E3L A;  2XPW A;  3BOQ A;  3E5Q A;  1D0Y A;  1UHS A;  4HQM A;  3ABL H;  4RMN A;  1XS9 A;  4ZZL A;  2XVC A;  3S1Q J;  1IRZ A;  2DA4 A;  5KJN A;  1H8A C;  2R3S A;  3BR2 A;  3ZR8 X;  3EUK L;  3L7W A;  3V7R A;  1ZGJ A;  6PAX A;  4M9S A;  5LGT A;  2R7W A;  1PUF A;  1LE8 A;  2LH9 A;  4ESJ A;  1UST A;  1B9N A;  2J5P A;  4HEA 2;  5ICG A;  4QWQ A;  1YIO A;  4RDU A;  1D0X A;  4HNV A;  1B72 B;  2ACJ A;  2FBK A;  3CBM A;  5EX3 A;  3VFZ A;  3BG6 A;  2LG4 A;  3L00 A;  1WFX A;  3MKL A;  2JVH A;  4PJL A;  5HLI A;  5H6R A;  1VQ7 I;  3RPU A;  4A93 J;  1I1G A;  3GZ5 A;  4EEF G;  2R7S A;  2HEO A;  4XN0 A;  4A3C J;  1N25 A;  2K9S A;  1ZTR A;  4O5V A;  1UCR A;  3T8T A;  4O6J A;  1NG7 A;  1SMT A;  4YFK F;  5HNF A;  4RZ0 A;  2CQQ A;  2DMU A;  4PFO A;  3HRU A;  4KIF A;  3JTG A;  2VQL A;  3U9G A;  2PX9 A;  4JLG A;  1VTN C;  1H9T A;  3HPH A;  4D1Q A;  4RB2 C;  4FMU A;  2RGV A;  1VQ4 I;  3M1C A;  4I2O A;  4HLY A;  4EGZ A;  1ZG3 A;  4JX6 A;  4B09 A;  4NJ5 A;  1BR2 A;  4IJD A;  3OY9 A;  2PBI A;  1U3E M;  3BR3 A;  3MAJ A;  2AXT C;  3VB2 A;  1BC7 C;  4IZZ A;  3KX2 A;  3BT9 A;  3JSP A;  4MI5 A;  2EZK A;  1VQK I;  1SC7 A;  1ZHF A;  2JTV A;  4FIS A;  2ME6 A;  3KYC B;  4LB6 B;  1YG2 A;  5C4J J;  2RRE A;  2PJP A;  4F93 B;  5LLQ A;  2F48 A;  2KQR A;  2M9H A;  1MBK A;  5EEG A;  3WG7 H;  3GLX A;  4C9Y A;  3LWF A;  4WWC A;  2ZBK A;  1TZL A;  4UNO A;  3MQ0 A;  4GGG A;  1LJ9 A;  3H9J A;  2LKP A;  1HW1 A;  5FD6 A;  4NHJ A;  4RGU A;  3OYH A;  2JA6 J;  1WJD A;  1IN5 A;  2J5O A;  1JUS A;  2RC4 A;  4MI0 A;  3G4S I;  3AAF A;  2VPL A;  2D5V A;  4ENN A;  5ARG A;  3DCF A;  3FF5 A;  1FOX A;  1FBS A;  2LBF B;  2PMZ N;  4A3G J;  1MJB A;  3M9A A;  3DXJ F;  4E4H A;  2CV2 A;  2LSO A;  1JTX A;  5FKO A;  5T5G A;  3CLO A;  4UVB A;  1A6Q A;  1TBX A;  3WOD F;  1A04 A;  3Q9V A;  2F5F A;  3M3Y J;  1H9G A;  1FSH A;  4LIU A;  3SDG A;  3TO7 A;  3I5U A;  1QRY A;  2W5Z A;  5DYM A;  3OV8 A;  3QP5 A;  1QZY A;  1T33 A;  2HDC A;  2FRH A;  1IUY A;  4CO8 A;  4L5J A;  1LQ1 A;  2L9N A;  4PUS A;  2Y0S N;  1TW3 A;  4PFP A;  1IRF A;  3RTR A;  2IGM A;  2FU4 A;  3GTO J;  4L5E A;  5LD2 C;  5L3E A;  1YRN A;  3K70 D;  4HNU A;  1KQ0 A;  2AQF A;  3HEF A;  5IT9 K;  1SVO A;  1JKO C;  3FM5 A;  4BE1 A;  3LOC A;  1JXS A;  3KFW X;  2DYR H;  4RAZ A;  2HDD A;  3IL2 A;  4BXU A;  3S15 J;  2BQZ A;  1IG7 A;  1XMK A;  1YYV A;  2KJB A;  2KRF A;  3M7G A;  2PI0 A;  5K1Y A;  5EX0 A;  3COA C;  4AYB A;  4XLN F;  4KFC A;  1TTY A;  3MN2 A;  2VXZ A;  3E6C C;  2IS6 A;  3CD6 I;  3CF5 F;  2W84 A;  3CCR I;  1YJW I;  2UXN A;  4ZZD A;  5HLG A;  3J7A Y;  2XF7 A;  4LGW A;  4IHY A;  4XMY A;  5HI7 A;  2V6E A;  1BJA A;  1HXD A;  4IEJ A;  1IXC A;  2HOT A;  1Q1H A;  1O7L A;  2IT0 A;  1XDS A;  3K4C A;  2F4I A;  2LVS A;  5D5U B;  2GAU A;  3OYA A;  5C44 J;  3CQZ J;  1VQP I;  5KJK A;  2QQ8 A;  4I09 A;  4GCV A;  4FE4 A;  1HSJ A;  2V6C A;  1V5E A;  3QOD A;  3GLL A;  1BA5 A;  2RKH A;  3CCV I;  4MEX F;  2BY0 A;  4M3D A;  1FPQ A;  5H2F C;  3FXJ A;  4TV7 A;  4IRH A;  2MC4 A;  4D7N A;  2GM4 A;  4WXC A;  3CUQ B;  3E5X A;  5FB2 A;  3ZQG A;  4DZP A;  3UNG C;  3ZP5 A;  3A01 B;  3PIP F;  2DOA A;  5LBQ A;  5DUI A;  1T6S A;  2A68 F;  2JK3 A;  4JX5 A;  5L3D A;  3MZ8 A;  1P9Q C;  2B63 J;  2MFZ A;  3OS5 A;  2ZNY A;  1YJ9 I;  4BY1 J;  4I51 A;  4XKC A;  2X85 A;  3PQJ A;  5EF6 A;  1ZRC A;  3S1N J;  3M57 A;  4CZC A;  3RQ4 A;  2DK8 A;  2L3D A;  1VQO I;  1SAX A;  1J09 A;  3JAM Z;  1R00 A;  1LFB A;  3HTS B;  3K1N A;  5BPI A;  3HOZ J;  2NVY J;  4HZF A;  3AG3 H;  3D5L A;  4JQF A;  4BQO A;  3E5U A;  2PG4 A;  3QP6 A;  1W36 D;  4MNU A;  4MQ9 F;  4G6Q A;  2ID3 A;  2HKX A;  5K7Z A;  4QSH A;  2HPI A;  2ZNZ A;  3ROU A;  1FLI A;  4KA4 A;  3ABT A;  3CDI A;  5L3F A;  3KP6 A;  1X58 A;  3GTM J;  5ERI A;  4YRV A;  1VQ5 I;  1ZRF A;  2H6C A;  2DOD A;  2DJI A;  5D6E A;  5FFZ A;  3AKZ A;  4BDZ A;  3HGY A;  1P7I A;  4MFD A;  4ZH4 F;  1HOM A;  1EKE A;  5M5Y J;  3G6E I;  1MMS A;  4J8O A;  2E2H J;  3I4N J;  3OIP A;  5K7F A;  1RR8 C;  2JA8 J;  2EFN A;  3OYK A;  4I0A A;  4F91 B;  3BR6 A;  2VBY A;  4HV5 A;  1IF1 A;  2V7F A;  1ZG1 A;  2GA1 A;  2NNN A;  3ESW B;  3T1B A;  3WGH A;  5KNL A;  3DU5 A;  3OYF A;  5J3L A;  2E2J J;  4UXN A;  2CW0 F;  4A0Y A;  2WA0 A;  2JSP A;  2DTR A;  3WHB A;  5FLM J;  3ERM A;  4M6V A;  2OD5 A;  2PMU A;  3ZMS A;  1DDN A;  5KAI C;  4RLQ A;  2DMP A;  2XGE A;  2DFH A;  4A3I J;  1LB2 A;  1TWH J;  1QVT A;  1XGO A;  2F4O B;  3BP8 A;  4HX8 A;  4ON0 A;  5ICF A;  3H9G A;  3P5J A;  3L2U A;  2RNG A;  3F8C A;  2EIL H;  1TWC J;  3B6C A;  3AL0 B;  4DZJ A;  3RYR A;  1ZAO A;  1Q1V A;  2KRC A;  3IKT A;  5ILU A;  1VQM I;  2IPQ X;  1XX5 A;  1RKT A;  2DAO A;  1TWF J;  3RIR A;  4DGW B;  5IOY A;  4FQG A;  3IWF A;  5CVJ A;  4YII A;  3OS2 A;  1SMY F;  4IJA A;  2GIV A;  2ECC A;  3F22 A;  5JHU A;  5J4Y A;  3OMY A;  2R7R A;  2CV1 A;  5E17 F;  3SDB A;  2ELH A;  3KYD B;  2M0M A;  4RAY A;  3MO0 A;  4Y33 A;  2CW8 A;  3DTI A;  2LR8 A;  2NS0 A;  5F27 A;  1FP2 A;  1B8I B;  2F4M B;  4AVP A;  4O6F A;  2XAG A;  3GME A;  2JA7 J;  2KL4 A;  3MMY B;  4H4K C;  1QNT A;  4W97 A;  3JRE A;  3F9Z A;  3OYI A;  4KIT B;  5B1B H;  3ZQF A;  3R60 A;  3GTJ J;  2PFB A;  3TW6 A;  5E3N A;  2ZKZ A;  2L7K A;  1JE8 A;  1UEL B;  3K4N A;  3TO6 A;  2H27 A;  4ZYH A;  5GTH C;  1IRG A;  4NC7 A;  2ZXH A;  3CCJ I;  1O4X A;  5FLV A;  3S16 J;  4BQA A;  4AIK A;  2VJ4 A;  1ETQ A;  4OMZ A;  2ECB A;  2DBB A;  2WC2 A;  1IRX A;  2CWE A;  2K3F A;  4R79 A;  1XD7 A;  3ELK A;  3GFL A;  3FKI J;  5GAD J;  1JTY A;  3DBH B;  3WHC A;  5KK1 A;  4LDG A;  5HVQ C;  1L3L A;  4AVZ A;  4NC8 A;  1I27 A;  3FIS A;  4BH9 A;  3I0T A;  3ZQC A;  4B4C A;  2NVQ J;  4IHW A;  4EQQ A;  1ZAR A;  3IH4 A;  4U0V A;  2OF7 A;  1WVR A;  5E8G A;  2V9K A;  1SFE A;  4X1E A;  1GXP A;  5AYF A;  3BWG A;  4MHG A;  3QYE A;  4I02 A;  2VBW A;  1LDJ A;  3I53 A;  2V26 A;  3WE2 A;  1OKR A;  1N78 A;  2G46 A;  3WG9 A;  3OOI A;  4Z4P A;  4LK1 F;  1ZQ3 P;  3I56 I;  2B7E A;  2N8G A;  3M5A A;  5LGN A;  4CYC A;  5IYD J;  2LY2 A;  4WF2 A;  5DM6 F;  4BNC A;  1DGR M;  1X1C A;  2ZB9 A;  2EIJ H;  3J7Z I;  2HYJ A;  4J00 A;  4HLX A;  4BS9 A;  3VYT B;  3KZY A;  1TT0 A;  2M0C A;  4AIH A;  4D5F A;  2WAQ N;  4LJZ F;  4XLC A;  2PMZ A;  1XB4 A;  1EH8 A;  4IHV A;  1T38 A;  2DTZ A;  3MWM A;  3BQZ A;  2KT0 A;  5CVR A;  5JJ0 A;  3EDP A;  1ZLK A;  2DMN A;  2IS1 A;  2WV0 A;  1FIA A;  2W85 A;  1MMN A;  2NVU B;  2O6G E;  1PUF B;  2KIM A;  3I54 A;  2BGC A;  3QPH A;  4XM3 A;  4BYY A;  2BY2 A;  3Q0V A;  4WCG A;  2FQ4 A;  3I59 A;  1A35 A;  1XCB A;  5AIQ A;  2GXA A;  1HC8 A;  2K7L A;  3ZMZ A;  4JP0 A;  4WXH A;  1ZGW A;  2M7B A;  1G3T A;  3EYY A;  1ULY A;  3ZMV A;  4UY8 I;  3DEU A;  1FSE A;  4XRS A;  2CW7 A;  2R4G A;  3VYU B;  3CUO A;  4CZZ A;  2A69 F;  3DTE A;  1XMX A;  2DJN A;  5J4V A;  1BOA A;  3E3V A;  2DFE A;  1NK3 P;  4YEL A;  2L0K A;  1GLN A;  3I4M J;  3RAY A;  1QZZ A;  1P7J A;  2K9L A;  2BXZ A;  3ZN0 A;  5DCM A;  2K4B A;  1U6G A;  2Z3Y A;  2LY1 A;  2ELK A;  3FIW A;  3FMQ A;  3HJE A;  2VQG A;  2OUM A;  1W0U A;  2FNA A;  5M5X J;  3HM5 A;  4EMS A;  3A2K A;  2YX4 A;  3DQV C;  3FWE A;  2PEX A;  3SWC A;  1LDD A;  3OYD A;  1WRJ A;  1U9O A;  2VKD A;  4HF2 A;  2DT5 A;  4AC0 A;  2E1C A;  3M8F A;  3SEZ A;  4I0B A;  2IGQ A;  4L5I A;  3HXL A;  2EV6 A;  2KMU A;  4XLF A;  3O8G A;  4CXF A;  2YPR A;  2PN6 A;  4XOT A;  4QPQ A;  2QA4 I;  4OIO F;  2NS8 A;  4P9F A;  4ZJZ A;  2LTP A;  3F72 A;  4PSX A;  1IV8 A;  2FSW A;  3LA3 A;  5D8L B;  1AKH A;  1N6A A;  4E7K A;  3CCS I;  1QHH D;  1RNL A;  2YSR A;  1YX5 A;  3PFY A;  1R1T A;  1KGS A;  3SZG A;  1DPU A;  4A0Z A;  3SFI A;  3MEK A;  2QSF X;  2M4G A;  3V4G A;  3F6O A;  2VLA A;  3HOS A;  3DWL E;  2H6B A;  3I4P A;  4CIC A;  3OR1 C;  1SFU A;  2EIK H;  2ZC2 A;  4JYK A;  4RAG A;  4KDP A;  3RIB A;  4OMY A;  3WU1 B;  3NRV A;  1YJN I;  1STZ A;  1ETK A;  1DPR A;  3QU6 A;  3S7F A;  1ZEL A;  1HKQ A;  2M1B A;  4UVC A;  2R7U A;  1RES A;  2JRM A;  1G59 A;  4PSW A;  4F3Q A;  3JSO A;  4EM1 A;  1KA8 A;  1WKM A;  5F08 A;  4E7J A;  2LF7 A;  2Y75 A;  1ZK8 A;  4PGH A;  4QLC U;  1W5S A;  4L9J A;  3OYB A;  1N3J A;  5BOX A;  1HW2 A;  3BR0 A;  3FDY A;  3E6M A;  3LA7 A;  3U21 A;  2YR2 A;  4P5O A;  4Q4Z F;  3UKG A;  3L2R A;  3F9K A;  3KCC A;  4E7Z A;  1ZN2 A;  2HZD A;  2BY3 A;  3LMM A;  1ZKK A;  4WK8 F;  1RR7 A;  1WWX A;  3GTG J;  1LUJ B;  2M4K A;  2EFP A;  2R7Q A;  1YW9 A;  1MD0 A;  4XLA A;  4A2U A;  2DMT A;  4Z6Y A;  2XF5 A;  3OS1 A;  5EG0 A;  4N4N B;  5F6L A;  2E1N A;  3SXY A;  4A3F J;  2STT A;  2HQA A;  2W00 A;  3OYL A;  5FKL A;  1LEB A;  2FUG 2;  4GYG A;  2R5Y A;  3OYE A;  1KYZ A;  2Y9Y A;  1TT5 B;  2G0E A;  2MW8 A;  2VBZ A;  2Q2E B;  1R49 A;  2HNH A;  3WTT C;  4A12 A;  4RLF A;  4YIR X;  2FML A;  3FPD A;  3OOU A;  3EPZ A;  3PIO F;  2JPC A;  4BJ6 C;  2Z5U A;  3HSR A;  4V2G A;  5B66 C;  4M9Z A;  5IPA A;  1TL8 A;  1OR7 C;  3I71 A;  1FP1 D;  5E1W A;  2XPV A;  3L1P A;  3VWB A;  2QQ9 A;  2D1H A;  3L2Q A;  1IN4 A;  5L3G A;  2O0Y A;  1W7P B;  2WAD A;  4PJ0 C;  1RC9 A;  4UV8 A;  2PJR A;  1AA7 A;  2DQL A;  3RCO A;  3OXF A;  3RZO J;  3FHN A;  5EDN A;  4EJO A;  2D2W A;  1Y8R B;  4BJ5 C;  4XBF A;  1E2X A;  5JLW A;  2A5Y B;  3H36 A;  1R36 A;  3QPS A;  2DFF A;  1V54 H;  2VC0 A;  1HCR A;  2KIS A;  5FLX Z;  5ED4 A;  3H92 A;  2OQG A;  2XAH A;  3OYG A;  1T95 A;  3PNV A;  4Y17 A;  4F7Z A;  2HZT A;  3OIQ A;  1HST A;  2AHQ A;  1IAW A;  5HDN A;  2LKX A;  1FIP A;  1VI0 A;  4KIB A;  4GRI A;  4KN4 X;  4A69 C;  3K4J A;  1ETV A;  2P4W A;  2E1M C;  3KZI C;  3RQI A;  3CMA I;  4P55 A;  1D5V A;  3FMR A;  2RVC A;  2MGQ A;  1TC3 C;  1WJB A;  3GCM A;  3HSF A;  2XB5 A;  5CLS A;  4P96 A;  2CRG A;  4II3 A;  1BW6 A;  5K5O A;  2DA3 A;  4A3E J;  3DKY A;  3K0L A;  3K69 A;  1QZE A;  2ZFW A;  1S7A A;  1FWZ A;  1K83 J;  2E60 A;  2W57 A;  4H0E A;  3AG4 H;  3N71 A;  1PJR A;  3HKZ N;  2Y2Z A;  4WXD A;  3JRB A;  5JIN A;  2X6X A;  2IGO A;  1P92 A;  2KIU A;  1HA8 A;  2DO7 A;  5JLX A;  1Z77 A;  1K78 B;  4J7F A;  4DJA A;  3ZQI A;  2IEK A;  1X4O A;  1Z9C A;  2UUZ A;  4B48 A;  1WI9 A;  2HS5 A;  1Y6I A;  4CH7 A;  5D5X B;  4QIW N;  2CQ7 A;  1MKM A;  3OL3 A;  3VPR A;  4AM3 A;  1QHG A;  4PZJ A;  1ODD A;  3ZOB A;  4G94 A;  2OZU A;  5CCM A;  3QQA A;  3WU2 C;  5D5V B;  3RKY A;  4K2E A;  4EJT A;  5A2Q K;  3ZMT A;  4E47 A;  5FLX K;  3D1N I;  4E7I A;  3RJW A;  4HF1 A;  1R1U A;  1WH7 A;  2IBD A;  3LSM A;  4IXA A;  1MNM C;  2QGU A;  4AWX B;  2ELJ A;  1C0W A;  3BR5 A;  2MD5 A;  4D5C A;  2KP6 A;  4HX4 A;  2BZT A;  2BYV E;  5FO5 A;  2PMH A;  1GV2 A;  2EA2 A;  3S17 J;  1AWC A;  4RGR A;  3JW4 A;  3KE2 A;  4WX9 A;  1LPQ A;  3HC7 A;  4N4O B;  3W3C A;  1V3F A;  3QWW A;  4MLO A;  1IN6 A;  4CUG A;  5D5W B;  3V7C A;  1IV6 A;  3HBL A;  3H35 A;  1XGM A;  1GDT A;  1QA6 A;  3S93 A;  4UUS B;  4LK0 F;  1EA3 A;  2JVG A;  3IWZ A;  3ULQ B;  3GX4 X;  4BEH A;  4BDY A;  4G6D A;  5E8I A;  2QF7 A;  5JVG F;  5F5E A;  1N77 A;  1HLV A;  3MO5 A;  5HOO A;  4XNF A;  3I9V 2;  1MT6 A;  1TLH B;  1R5H A;  3TP3 A;  4QEP A;  3J80 K;  2OCE A;  5KVR A;  3EET A;  3OOP A;  1HBX G;  2VPR A;  2E5N A;  4ZYE A;  2OAZ A;  1EF4 A;  3NWT A;  2M45 A;  3CC4 I;  3HOY J;  2E19 A;  2WY7 Q;  3A1Y A;  2WAQ A;  5DV5 A;  4I6Z A;  1ZG5 A;  4FX4 A;  2FXA A;  3REO A;  2V9V A;  3CJT B;  3N4M A;  2OJE D;  3DV8 A;  5IP9 J;  2XF6 A;  1FMV A;  3K4L A;  4XOR A;  1G2H A;  1VND A;  1FMW A;  1W7P D;  3CDH A;  2DCE A;  3S32 A;  2HQN A;  2ZME A;  4IL6 C;  1YQA A;  2BOL A;  3RYP A;  4AYB N;  3JCU C;  2P7V B;  3LSR A;  2P6T A;  4MIM A;  3FKJ A;  3I55 I;  2JZY A;  5F6F A;  3TL4 X;  2HTJ A;  2WTE A;  5IYB J;  3I3L A;  3OSF A;  2CFO A;  3SFZ A;  2XGX A;  4LG3 A;  2QWW A;  3TP0 A;  5LRR A;  2DA7 A;  2CGP A;  2HVS A;  1GHC A;  4LG0 B;  3KP7 A;  1TW2 A;  1O3T A;  1UG0 A;  1A31 A;  2MLG A;  3M58 A;  3CCM I;  2V79 A;  1MDM B;  2YU3 A;  5HDK A;  3PUB A;  2XGD A;  2DA1 A;  1R4M B;  4XR6 A;  1MVH A;  2GWR A;  4UUT A;  1V4R A;  5BQT A;  5TIS C;  2QZ8 A;  2E36 A;  4PJM A;  2NXN B;  2VN2 A;  1LFU P;  1U0J A;  2VOP A;  3KP3 A;  3L2W A;  2P0W A;  2RAE A;  4FT8 A;  2K40 A;  4OU0 A;  3M07 A;  5T0M A;  3PSF A;  4A3B J;  2VOD A;  3LSK A;  2JA5 J;  2KPM A;  2MH9 A;  3JRA A;  2G7H A;  5CYV A;  4LOC A;  3OL4 A;  4YPU A;  3G73 A;  2Y48 A;  5D6F A;  2GA2 A;  2VJI A;  5GAG J;  3IAS 2;  3B73 A;  3GF2 A;  1Z7U A;  3EUA A;  3W2W A;  4HNT A;  4CYC B;  3BO5 A;  2NVT J;  1MSF C;  1ORK A;  2ADU A;  4XRS G;  2CMP A;  3MEX A;  2VAS A;  3WTS C;  4B3A A;  4ZTJ A;  1J75 A;  2FOW A;  3J81 K;  3BC8 A;  2K9M A;  3IP4 B;  4RM2 A;  2O9L A;  3BPX A;  2L5Q A;  5HLH A;  3OYM A;  3G71 I;  4E7S A;  2W48 A;  3DFG A;  3CC7 I;  4CYD A;  4RA2 A;  3OWT A;  1X1P A;  2EJR A;  1MGT A;  3BG3 A;  3ISP A;  4DNC A;  3HHG A;  2LK2 A;  3CES A;  4XLH A;  1I1S A;  4HW0 A;  3DLA A;  1VZ0 A;  3KEO A;  2DPU A;  2JWT A;  4ZDO A;  3KP5 A;  5B1A H;  1V5G A;  1IUF A;  2QQB A;  3A0H C;  2CQN A;  2XKP A;  5JHF A;  4MGR A;  2QPW A;  2X1C A;  5LSX A;  3LFU A;  5HS8 A;  5D4R A;  3E1S A;  3VDX A;  3KZZ A;  1U8B A;  3K9T A;  5IT3 A;  4IRI A;  3EUH C;  1YI2 I;  5DCM B;  1PDN C;  5D8K B;  3K4K A;  2GXG A;  2RV8 A;  1HDD C;  1EH6 A;  4BHB A;  4XKV A;  2FJ1 A;  5LEK A;  1CGP A;  1G3S A;  1JHH A;  3DAL A;  3JRH A;  1I3A A;  3PM1 A;  1KZH A;  5LHG A;  3FBN B;  3V8J A;  4RS8 A;  2OC6 A;  1O57 A;  5EZH A;  4NVQ A;  3RI4 A;  3KMJ A;  4BJT A;  3VYS B;  2KLO A;  3CMY A;  3LSG A;  2O5R A;  5DCF A;  1D1C A;  2EFQ A;  3H0D A;  2DW4 A;  4YFN F;  2FA5 A;  5LSZ A;  3HG9 A;  1JGS A;  4J19 A;  3OXL A;  4MO7 A;  3GFJ A;  5T0K A;  2IS4 A;  1RPW A;  3HOV J;  2QBY A;  4UVA A;  4IJ8 A;  4XOP A;  3LST A;  1CF7 B;  3HTU A;  3CZ6 A;  4A3M J;  3MVP A;  4J01 A;  1NH3 A;  1G8X A;  1DP7 P;  4HDV A;  3TED A;  4RBO A;  4N9I A;  4A5N A;  4KT5 C;  3TW7 A;  4JOM A;  3VV0 A;  1I3Q J;  2KIQ A;  3FXO A;  2CS3 A;  1QPI A;  1JHF A;  2LFB A;  1FOW A;  5LRS A;  2QSH X;  1DGW Y;  2FE3 A;  1JUM A;  2JV0 A;  4RB3 C;  2F69 A;  3QWV A;  3BG5 A;  3PO2 J;  4BXX J;  1ON1 A;  1YRN B;  2LOO A;  3LAJ A;  1OCT C;  2P7C B;  3WTZ A;  3GO5 A;  1POG A;  5GTI C;  3KMT A;  1WQ2 A;  4PJJ A;  5GPC A;  4YFX F;  1JT6 A;  4OIQ F;  2VJ5 A;  1HW5 A;  3CJN A;  4V2F A;  2GLO A;  4CHU A;  2E7X A;  5ILS A;  2L9S A;  2JUG A;  2QEX I;  3EQL F;  3CJQ B;  2K9Q A;  3CMM A;  3KLN A;  5TGT A;  5FD5 A;  3Q0U A;  4ESF A;  4YIF A;  3CC2 I;  2AO9 A;  1PVE A;  3CCL I;  2FD5 A;  4DBR A;  4E7H A;  1BM9 A;  2EFO A;  2EIN H;  1F9N A;  3MZH A;  1OYW A;  4M6X A;  4HRI A;  5DS9 A;  1Z6T A;  2A3S A;  2O3F A;  3LSH A;  4G12 A;  3FXR A;  2DQR A;  4NB5 A;  2H8W A;  4YPA A;  4KN7 X;  1OIS A;  5KHD A;  2Y0M A;  1OYY A;  3F8M A;  2ISZ A;  1WJA A;  1UJ8 A;  5J40 A;  5M3M J;  3ZQQ A;  2DU9 A;  2Q2E A;  2V1X A;  3CF2 A;  4XKW A;  5FKN A;  3CO7 C;  1TQI A;  4FHT A;  1YO5 C;  1S3J A;  3EUH A;  4BU2 A;  1V5F A;  1LE8 B;  5F64 A;  2TCT A;  4Q5S F;  3ZRG A;  3S7J A;  4KYW A;  1QU3 A;  2M7A A;  4A0X A;  3M1E A;  3MD2 A;  4LFU A;  3F8B A;  1K61 A;  4YG2 F;  3E6B A;  1OCZ H;  2M87 A;  3K4M A;  4UV9 A;  4E7L A;  2NRA C;  2R7O A;  2WBM A;  3H5A A;  1U9N A;  1X2M A;  5JIY A;  2A05 A;  3NAR A;  4C2U A;  2GBY A;  2OQR A;  5LGU A;  3IRR A;  2VQH A;  4EM2 A;  1OCP A;  2DT7 B;  1D8J A;  2BV6 A;  1IDZ A;  1R58 A;  1P2F A;  2GOM A;  1XG1 A;  4MTE A;  1G3Y A;  2IJL A;  2M30 A;  3BTC A;  2KJC A;  2ZXI A;  2VUM J;  2X51 A;  3ZMD A;  2XAQ A;  2QLZ A;  5CVU A;  2F5C A;  2NNY A;  2DDB A;  2UWM A;  3I59 B;  3S1M J;  2F5E A;  3O6B B;  1X19 A;  5KCM A;  2R92 J;  5H20 A;  4IF4 A;  2R7T A;  5HS7 A;  3W2V A;  1PP7 U;  2EPF A;  2BW3 B;  2HU9 A;  2LRD A;  5F0H A;  4CCJ A;  3QWP A;  2FBH A;  3HRT A;  3GFI A;  4ENM A;  1X1A A;  1VFC A;  2H8R A;  5A2Q Z;  1WHU A;  2RFI A;  4BXF A;  4I7H A;  3BQY A;  3F9W A;  1RKW A;  3SHF A;  1E3P A;  4ZTF A;  2DA6 A;  2VJJ A;  1O7F A;  2XV4 S;  1QPM A;  1UHM A;  1T0F C;  1WH5 A;  4F92 B;  2ISY A;  3G1O A;  3IAM 2;  5J6X A;  3PSI A;  2LF8 A;  5F1J A;  5CQE A;  2FQ3 A;  4I98 B;  4DYQ A;  3V42 A;  4HV6 A;  4GYI A;  1YLF A;  1B59 A;  1RI7 A;  4ZYG A;  3HRS A;  2L4M A;  3S3O A;  2ZXW H;  1WSU A;  2EH3 A;  2WAF A;  1HKT A;  2RN7 A;  4KIS A;  2NYX A;  3F0C A;  2ZJP F;  1Y1V J;  1OMI A;  3F3X A;  1XC5 A;  3PL8 A;  2IGK A;  3SEQ A;  5LEJ A;  1MVX A;  1M1E B;  4OIP F;  1OCR H;  3D5R C;  1F4K A;  2A61 A;  5DD8 A;  2LBF A;  2XGC A;  5FFX A;  5HOD A;  2HQR A;  3PFI A;  1BW5 A;  5EGO B;  1XMA A;  3HUG A;  4BQN A;  2COB A;  3JAM K;  1NK2 P;  3P9I A;  4NQW B;  2XRN A;  3ZMU A;  1E3H A;  2R7V A;  3TBI A;  2LLK A;  2Z33 A;  1Y8Q B;  2RNJ A;  2VXD A;  3C1D A;  2WB1 A;  2L7Z A;  3J7Y J;  2O8X A;  1R22 A;  1S8N A;  2LY9 A;  4YPE A;  3RU0 A;  1W5T A;  2HDW A;  4UUV A;  3S3N A;  9ANT A;  3FXQ A;  4I76 A;  3FXM A;  1GXQ A;  3I64 A;  4UUS A;  4O3M A;  4A3J J;  4G9Y A;  2JUC A;  2QYO A;  2VBX A;  1F43 A;  3M55 A;  2IA0 A;  1IZ1 A;  1U8R A;  2V1U A;  4BE2 A;  4IHX A;  4XL9 A;  3KLO A;  5E1Z B;  5IT9 Z;  2WAE A;  1Z21 A;  1ZR4 A;  2MD0 A;  3BZC A;  2ZSH B;  2BY1 A;  1GUU A;  4Y13 A;  5J47 A;  3LSP A;  1Z3X A;  5F0C A;  1YE9 A;  1JUP A;  3LL7 A;  1W0T A;  1FC3 A;  3K2Z A;  4KMU X;  3CME I;  1W5C C;  4KMF A;  2ZJ2 A;  2BHZ A;  4OAZ A;  2JRT A;  3GBG A;  2GOX B;  3E0J B;  3WGI A;  4GDF A;  1UHW A;  1MBJ A;  3G2B A;  2OA4 A;  1YFH A;  3BJA A;  5IP6 A;  4L18 B;  2PLY A;  4UHT A;  5ILV A;  1D5Y A;  3H9Q A;  3JRF A;  2JN6 A;  3BTL A;  3CBP A;  3KEY A;  5IY5 H;  3L9F A;  3IV5 A;  3T5X A;  3KIO A;  3SJM A;  2M2E A;  3MFK A;  1BI0 A;  4XLE A;  1X3U A;  3HOW J;  1GV5 A;  2K27 A;  4YEJ A;  2FEZ A;  4HST A;  3W6K B;  4FET A;  1MDM A;  1I50 J;  2XHK A;  2IVM A;  2P5L C;  1TNT A;  1MND A;  1W7P A;  2XRL A;  3L2C A;  2PJR B;  3CCY A;  3PO3 J;  3SYT A;  1VQ8 I;  2I5U A;  2CG4 A;  4EAT A;  2IP2 A;  3M54 A;  1BN5 A;  4BBR J;  1JT0 A;  4MTD A;  3S3M A;  4IQ4 A;  2X0L A;  2QCO A;  2F5D A;  2ICW G;  3WGG A;  5B3S H;  2K9N A;  3S7B A;  2LDU A; 
#chains in the Genus database with same CATH homology
 3NWS A;  1MMA A;  1EA3 A;  2JVG A;  5LFA A;  4C2T A;  3KYL A;  4BDY A;  4BEH A;  2CUJ A;  3DU6 A;  4DIQ A;  3UNG C;  4C30 A;  5F5E A;  1N77 A;  3MO5 A;  5TH7 A;  5HOO A;  2DOA A;  3PDN A;  2W1O A;  1NG6 A;  3I9V 2;  4XNF A;  1MT6 A;  3CBO A;  3DPT A;  3VYR B;  1P9Q C;  5JHN A;  2MFZ A;  3OS5 A;  4QEP A;  4I51 A;  2E5N A;  1PYV A;  4XKC A;  3OYN A;  2X85 A;  4WUY A;  1N6C A;  3M57 A;  4CZC A;  4OWR B;  3RQ4 A;  3NWT A;  2WY7 Q;  1J09 A;  2WAQ A;  3A1Y A;  4U87 A;  5HQ8 A;  2XF6 A;  1MMD A;  2HVR A;  1FMV A;  3K4L A;  2X1E A;  3M59 A;  1YX3 A;  3D5L A;  4JQF A;  4XOR A;  4BQO A;  4YND A;  1D0Z A;  1FMW A;  5ARF A;  1W36 D;  2DCE A;  3S32 A;  5FRO A;  3RPU D;  2BOL A;  2Z2S B;  1LVK A;  2HPI A;  4PK4 A;  2V4J C;  3FKJ A;  4YRV A;  3TL4 X;  3I3L A;  1SFK A;  2DJI A;  3AKZ A;  2E1M B;  4BDZ A;  3K70 C;  2CFO A;  2BVM A;  3VSL A;  4LG3 A;  2F5V A;  3MKZ A;  4J8O A;  3BCA A;  3OIP A;  2HVS A;  2X6Y A;  3OYK A;  1UG0 A;  1DP3 A;  1WJE A;  3M58 A;  4F91 B;  3OYJ A;  3HOT A;  5F6K C;  2V7F A;  3PUB A;  3ZXS A;  4IKF A;  2Z1D A;  3A4C A;  1OLT A;  4XR6 A;  1O9S A;  5KNL A;  4JDS A;  3DU5 A;  3AFH A;  4LIV A;  1MVH A;  3OYF A;  4B3X A;  2LYC A;  2CH0 A;  4PJM A;  4XN3 A;  1U0J A;  3L2W A;  2P0W A;  2WA0 A;  2JSP A;  4J83 A;  5T0M A;  3PSF A;  3LSK A;  2KPM A;  4RLQ A;  1WJF A;  3K6G A;  4CCN A;  2K5C A;  3OL4 A;  4YPU A;  3DPL C;  2F6C A;  1JI8 A;  2VJI A;  3IAS 2;  1MUF A;  4QEO A;  3EUA A;  1W36 C;  3H9G A;  3L2U A;  3W2W A;  3EP0 A;  2RNG A;  4HNT A;  3AL0 B;  3BO5 A;  2Z16 A;  4BL0 B;  4KT6 A;  2KRC A;  2XDV A;  2CMP A;  2VAS A;  4DGW B;  4ZTJ A;  3OS2 A;  1BOB A;  5HNH A;  3BC8 A;  2CV1 A;  3OMY A;  4AU7 A;  2K9M A;  3IP4 B;  4RM2 A;  2R7R A;  3SDB A;  3VSK A;  2L5Q A;  2M0M A;  3OYM A;  3MO0 A;  2I8D A;  4Y33 A;  3TG5 A;  3VUZ A;  2BW3 A;  2CW8 A;  5EG2 A;  3DTI A;  4E7S A;  3C2H A;  3PJR A;  4O6F A;  3OWT A;  2KL4 A;  3MMY B;  4H4K C;  1D1A A;  3QYB A;  3F9Z A;  2Y0S A;  3OYI A;  3CES A;  4KIT B;  4XLH A;  4OAY A;  4B47 A;  3DLA A;  1VZ0 A;  2L7K A;  2A6T A;  4ZDO A;  1UEL B;  1V5G A;  3K4N A;  4ZC3 A;  4ITV A;  4NC7 A;  2ZXH A;  5JHF A;  5HLT A;  3DPU A;  2MYS A;  2X1C A;  2LC2 A;  3LFU A;  3H5N A;  2QPW A;  4H12 A;  5LSX A;  1BR4 A;  2RQQ A;  3DTK A;  1KON A;  2ZSI B;  2VJ4 A;  3E1S A;  3VDX A;  2M3A A;  3F9X A;  3EUH C;  4ZDL A;  1IRX A;  2HPM A;  4R79 A;  2LRE A;  3K4K A;  3OYC A;  1Z7L A;  2MAB A;  2W7N A;  3W2A A;  4XKV A;  3DB5 A;  2L2O A;  4LDG A;  5HVQ C;  3DAL A;  3K5K A;  5CQG A;  3ONQ A;  4AVZ A;  4NC8 A;  3FBN B;  3DEE A;  1MW7 A;  2OC6 A;  4NVQ A;  3KMJ A;  4E6K G;  4BJT A;  2KZV A;  3VYS B;  2KLO A;  3D5S C;  3LSG A;  2V9K A;  1PEG A;  5AYF A;  2O5R A;  1D1C A;  3QYE A;  4RM3 A;  3OOI A;  3H0D A;  2V26 A;  1N78 A;  2G46 A;  4Z4P A;  5LSZ A;  3HG9 A;  4G6T B;  1LKX A;  3UR3 C;  2WY8 Q;  4NNJ A;  4D9J A;  3M5A A;  3BLY A;  3OXL A;  2LY2 A;  1DGR M;  1X1C A;  5TEG A;  3L2V A;  4J00 A;  4CCK A;  4BS9 A;  3VYT B;  1TT0 A;  1LFP A;  2IS4 A;  5T0K A;  4IJ8 A;  4LIT A;  4XOP A;  4XLC A;  2IGN A;  4BUP A;  3CZ6 A;  4U7B A;  2PMZ A;  4J01 A;  1G8X A;  5F59 A;  2QKM B;  5CKT A;  2W82 A;  2O8J A;  4JOM A;  3RSN A;  4HG2 A;  3K4B A;  3VV0 A;  5JJ0 A;  2IS1 A;  2CS3 A;  2NOJ B;  1MMN A;  4ANJ A;  4XM3 A;  4XQF A;  4X0G A;  1DGW Y;  3DKX A;  2VKH A;  3QWV A;  2JV0 A;  2F69 A;  2VIX A;  2LOO A;  4HSR A;  2XSJ C;  2M7B A;  3QYF A;  3KMT A;  2CW7 A;  2R4G A;  3VYU B;  3S93 A;  4B44 A;  3SW9 A;  4II2 A;  4PJJ A;  3DTE A;  3FBI B;  1X4P A;  2VJ5 A;  4YEL A;  1ML9 A;  1GLN A;  2KDO A;  3RAY A;  2K9L A;  4QPO A;  2L9S A;  2JUG A;  5FRN A;  3CJQ B;  3CJR B;  3QOE A;  2LY1 A;  3CMM A;  5TGT A;  2VQG A;  2OUM A;  4CA0 A;  3A2K A;  4DBR A;  4E7H A;  2VL8 A;  3DQV C;  3SWC A;  3OYD A;  4CCO A;  2VKD A;  4FAS D;  1Z3Y A;  4HRI A;  3SEZ A;  2IGQ A;  3HXL A;  3LSH A;  4XLF A;  2KMU A;  5KJL A;  4YPA A;  2W4S A;  5KHD A;  4XOT A;  1WJC A;  1WJA A;  4QPQ A;  4C1Q A;  3ZQQ A;  3F9Y A;  4ZJZ A;  3CF2 A;  4XKW A;  2E5Z A;  1BR1 A;  4PSX A;  2IS2 A;  4BAC A;  2VB6 A;  4BQQ A;  4BU2 A;  1V5F A;  3TG4 A;  2W5Y A;  1N6A A;  3ZRG A;  4E7K A;  3S7J A;  1QU3 A;  1QHH D;  1H3I A;  2M7A A;  3S7D A;  1YX5 A;  3C2G A;  3MD2 A;  3N05 A;  3PFY A;  3SZG A;  1D0Y A;  3K4M A;  3MEK A;  4E7L A;  2M4G A;  2R7O A;  2WBM A;  4RMN A;  2VLA A;  3HOS A;  3H5A A;  2X6W A;  4BEH B;  3DWL E;  5JIY A;  3OR1 C;  4C2U A;  5KJN A;  2BVL A;  3ZR8 X;  3RIB A;  3EUK L;  2VQH A;  2DT7 B;  4ZYA A;  2R7W A;  2GOM A;  2ZFU A;  4DBQ A;  2KRH A;  2LH9 A;  3M56 A;  3S7F A;  4PJN A;  1ZEL A;  2K3P A;  2R7U A;  2ZXI A;  4HEA 2;  3ZGK A;  2X51 A;  3MKW B;  2IXS A;  1D0X A;  1G59 A;  4PSW A;  4F3Q A;  5EX3 A;  3CBM A;  4E7J A;  3BG6 A;  2LG4 A;  2UWM A;  1R6R A;  1WFX A;  4F55 A;  3OYB A;  1XQH A;  1N3J A;  2JVH A;  4PJL A;  3M53 A;  1X19 A;  3FDY A;  2QKL B;  5KCM A;  2DT6 A;  3U21 A;  2R7S A;  2R7T A;  4P5O A;  4XN0 A;  3W2V A;  3L2R A;  4IX7 A;  3F9K A;  4E7Z A;  1UAA A;  2HZD A;  3IUO A;  2BW3 B;  2HU9 A;  2LRD A;  3QWP A;  1NG7 A;  2Q1Z B;  4CCJ A;  5HNF A;  2X1D A;  4RZ0 A;  3LMM A;  1X1A A;  1ZKK A;  4HPQ A;  3LSI A;  4PFO A;  4CCM A;  2RFI A;  4BXF A;  3F9W A;  2VQL A;  4JLG A;  2M4K A;  2R3A A;  3HPH A;  2R7Q A;  1D1B A;  2VJJ A;  1X1D A;  3M8J A;  4D1Q A;  1T0F C;  4ZTF A;  4F92 B;  4FMU A;  4XLA A;  3M1C A;  3IAM 2;  3OR2 C;  4ZDP A;  2XF5 A;  3OS1 A;  3CP8 A;  4N4N B;  4NJ5 A;  1BR2 A;  3PSI A;  5F6L A;  5CQE A;  2KHM A;  4IJD A;  3OY9 A;  2HQA A;  2W00 A;  3OYL A;  3AL0 C;  2FUG 2;  3V42 A;  3OYE A;  4IZZ A;  3KX2 A;  5KJM A;  5CCL A;  1S9H A;  3S3O A;  3IHX A;  2WAF A;  1LDK B;  3S8P A;  4KIS A;  2Q2E B;  4MI5 A;  1K6Y A;  3KMA A;  5TTF A;  2HNH A;  3PL8 A;  4RLF A;  3FPD A;  2IGK A;  2V1N A;  2RRE A;  3EPZ A;  3OOU A;  3SEQ A;  3TMO A;  4BJ6 C;  1MVX A;  4F93 B;  4CCL A;  2VQC A;  2KQR A;  1OR7 C;  3D5R C;  2UV1 A;  3BG7 A;  3VWB A;  1SAU A;  3L2Q A;  4P1W A;  2LBF A;  4C9Y A;  2PJR A;  2WAD A;  2R7X A;  1TZL A;  1AA7 A;  3RCO A;  3OXF A;  3HPG A;  3PNY A;  3HL2 A;  4O30 A;  3FHN A;  4BQN A;  4BJ5 C;  3H9J A;  2R7V A;  3K10 A;  4KJZ A;  4NQW B;  3TBI A;  3OYH A;  3MO2 A;  1WJD A;  2VXD A;  2WB1 A;  4MI0 A;  3OYG A;  2VPL A;  1T95 A;  3H5R A;  3PNV A;  3OPE A;  4YPE A;  5ARG A;  3RU0 A;  3CP2 A;  3OIQ A;  2HDW A;  5FRM A;  4Y4R A;  2LBF B;  4IQJ A;  4GRI A;  4E4H A;  2CV2 A;  3S3N A;  3K4J A;  4DOZ A;  5T5G A;  2E1M C;  3ZCO A;  4LIU A;  1WJB A;  1MMG A;  4NUB A;  2W5Z A;  4II3 A;  3M55 A;  3DKY A;  4BE2 A;  2DXI A;  1N75 A;  2E60 A;  4XL9 A;  2WAE A;  1Z21 A;  3N71 A;  1PJR A;  2L9N A;  2MD0 A;  2ZSH B;  4PUS A;  4PFP A;  3RTR A;  4BGD A;  2OV7 A;  5JIN A;  2IGM A;  1Z3X A;  2X6X A;  1YE9 A;  5LD2 C;  2IGO A;  3S7B A;  3LL7 A;  1HA8 A;  2XAU A;  4YNM A;  3BCB A;  4CSW A;  4J7F A;  3K70 D;  4HNU A;  2AQF A;  4DJA A;  4OAZ A;  3OXG A;  3HKZ A;  2XC7 A;  1X4O A;  2AQE A;  3GBG A;  2GOX B;  4BE1 A;  3E0J B;  2UUZ A;  4B48 A;  4XKB A;  2JA2 A;  3G2B A;  2BQZ A;  1Y6I A;  4CH7 A;  5EX0 A;  3OL3 A;  4AYB A;  1MNE A;  3H9Q A;  3OS0 A;  2CUZ A;  2VXZ A;  4Y3O A;  2IS6 A;  1QHG A;  1ERD A;  3CBP A;  3KEY A;  4B43 A;  1X1B A;  2HVQ A;  3J7A Y;  2XF7 A;  5CCM A;  4XMY A;  5HI7 A;  1E0E A;  4XLE A;  2V6E A;  4XON A;  4E47 A;  3MKY B;  4E7I A;  5CPR B;  4YEJ A;  3HNA A;  3RJW A;  4HST A;  4F52 A;  3LSM A;  4FET A;  4BE0 A;  4QEN A;  2ELJ A;  2CV0 A;  3K4C A;  2F4I A;  1MND A;  2PJR B;  4J7I A;  3OYA A;  1DQU A;  3SYT A;  2KP6 A;  3HUG B;  4EAT A;  1Y56 A;  5KJK A;  3M54 A;  3S3M A;  4IQ4 A;  3PNT A;  1V5E A;  3QOD A;  3HC7 A;  4N4O B;  3W3C A;  3QWW A;  4MLO A;  2A5W A;  4YNP A;  4CUG A;  3H35 A;  2MC4 A;  1WJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...