4BUQA

Crystal structure of wild type fimh lectin domain in complex with heptyl alpha-d-mannopyrannoside
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Cell adhesion
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4buqA00
1TR7A 2WMPB 5F2FA 5AB1A 4J3OG 1ZE3H 4X5QA 5ABZA 1KIUB 2VCOA 4CSSA 3ZL2A 5FLUA 1KLFB 1QUNB 4XO9A 2J2ZB 4XOCA 5CGBA 4LOVA 5F3FA 5FX3A 4XODA 1N12A 4AVKA 4J3OF 1PDKB 2XG4B 3JWNH 3MCYA 4X5PA 4XOAA 3ME0B 4BUQA 3SQBB 5FWRA 5IQNA 4J3OH 1N0LB 2JTYA 3BWUF 2XG5B 4XOEA 4AV0A 5IQOA 4AV5A 3ZPDA 5JQIB 4AVJA 4AUYA 2W07B 3BFWA 4XO8A 5AAPA 4X50A 4XOBA 2UY7B 5AALA 1UWFA 5LNEA 3JWNE 4AUJA 4AUUA 4CSTA 4CA4A 4AVIA 3ZL1A 3RFZA 5IQMA 2JMRA 2UY6B 4X5RA 3JWNG 5FS5A 3BFQG 4AV4A 4ATTA 5LNGA 4AVHA
chains in the Genus database with same CATH superfamily
1RSYA 1QKZH 3AS3A 3ML9A 3ZT6A 5JIMA 4G9FB 4ISVB 2YPLE 1WBYA 3C60A 3H42L 3HB3B 4AKOA 4X8XA 5K9OA 4IYKA 5CJXC 2FUQA 3RHWF 2J25A 4C55A 3TPUA 2E9BA 2WLZA 1G0YR 4IKKA 1FO0B 5MI0C 2YR3A 5E9DB 5FLUA 4A1RA 1QUNB 3MRDA 4R3SA 1R5VB 1MXDA 3UDWA 5ACZB 3LRHA 1BBJB 5DJAA 3CSFA 4WY7H 1C8PA 4LSUH 1FH2A 3VG9C 3LH9A 3X11B 1FYTE 4PBWD 2R0LH 2PYEE 5C0JB 5FUOH 4YNYA 1FYHB 1GGIH 2QPFA 3UTQB 4UI2A 3HCVB 1ZD6A 4ZPVB 2ICWI 1CLZL 1LDPL 1S7WB 4R26H 1P1VA 4HKZB 1KJMA 3MRJA 4IKIA 1KJ2B 1M4KA 2OMZA 3PQYB 2VMCA 3P0GB 3QUZC 1BVNP 5DDHB 5EFIB 1SBSH 3BPOC 4IU2B 1H5BB 3CG8A 1TJGL 3VYPA 3WY2A 3V0GA 4M03A 4RAVA 3WYRA 5LG1A 4ONHA 1U3HC 2BDNH 2DLTA 2QQKH 4S1DD 2HG5A 2BJML 3BJ91 1LHZA 1E28A 2K3TA 4GI6A 3GMRA 4NQVA 5F7YC 3VVWA 4M1CC 2WBXA 3ASWA 3BQVA 3RKPA 1J5OH 2YIHA 1OB0A 1W6LA 3MMEA 4FDWA 5CLZA 1UZ8B 3MV7B 5T5FH 3LV3A 2GI0A 4LO9A 1MFCL 3BD3A 1AGEA 1IU1A 3T6XA 5LBSL 2WWNA 4Z7NF 3WXVL 4IRJC 4NC2B 1KJVB 2IWKA 4JFPB 4MA1C 3PXJA 1DBBL 4JKNA 1WA0X 3P4LA 3MKKA 3C5SB 3NRPA 4UILL 3H9HA 2X28A 4B9ZA 4MXQC 2NYYC 1E4XH 3TWCL 3FCSA 2UY7B 1YYCA 4GMTL 2K4AA 4GG8A 3G5VA 2BXZA 3VNYA 3WIFA 4KFZC 3EDKA 5IV2B 4K3EH 4MZ2A 5ECJE 4PJDF 4HUUA 2PYFB 3ZHDA 3STLB 4G9DB 1FBIL 1UUSA 4QHKJ 1DLHB 3NCFB 4NUQA 4ONGH 3TA3A 4XNZB 3ZKND 3BXNA 3HHSB 2YAHA 1IGIH 3ZW3A 1BCIA 4HPYL 4HWZA 3JV6B 3IM1A 5CZXC 2R4RL 1CE6A 3CN0A 3GUFA 4L3CB 4ODBD 4F8NA 4D3CH 4ZNCD 4Q9BA 5DC0A 3DETC 3W2DL 2XX1A 1CJYA 1LP9B 5KYYA 1UB5B 2NQDA 1JZIA 1MCIA 3BN9D 4Z77A 5LAXB 4JRFA 3RGVC 1FUNA 2EYTB 1I3GL 4FYTA 1QD0A 5G2NA 3G6JE 1OP3H 3EH2A 1S7VA 3FO9A 4XX5A 3MV9A 1E0OB 1XF4B 4LVNB 4MDRA 3T0WA 4OD3H 1U8QB 3PDDA 4I3RH 3VRJA 1YEKH 7PAZA 1SYSA 2BNRB 4HMEA 5J1AB 3ORJA 3NK3A 1RMFL 4RRPA 4AY0A 4F7CA 5IT2L 1E9QA 4IEFA 1UD6A 4ZXBD 5EEWA 4Y2NA 4PB9L 1MH5A 5HGHB 1CXIA 4GBXC 3CCHA 4JFUA 5HVGB 5CR8A 3RL1A 4P46D 5FO7B 3VDBA 1YDPB 4A2HA 2VJ0A 5FKPA 4MCYA 4J12A 5HDWA 1NANH 4A7VA 3CVHA 1FNGA 1Q0XL 1T83A 2R9HD 3RTQB 3V7AE 1PG7X 2IDFA 4OCNC 1GSKA 4H8QA 1VLXA 3CHPA 4FQIL 4TUUA 5GHWH 5IQ9A 5JOFA 4NN6B 5HHXH 4NLHA 5L6YH 1KC5L 1G7MB 3BQUB 3C08H 1SDDB 3AGVA 3IGAB 3ZY7A 1H8LA 4MBRA 2DQCH 2TSAA 3B9KB 2RFXB 4J27A 2HRPH 2Y7SA 3FOLA 5DT1H 3BZEA 5B7FA 4QRRA 2NDFA 1NGQL 1P7QB 5DJXA 4YVUA 4EIZC 2XN9A 5LLIC 5K1JA 5C09E 3GIVA 1F90L 1WZLA 3SE6A 3X1EA 4E9QA 3SE4A 1KB5H 4JMNA 5I76A 2IAND 2C9QA 1V7MH 3HC4H 5FGCE 3AROA 4R9HA 2CK2A 3EO9H 3VXTA 3M88A 2HVJB 4U6TA 2OMNA 3O6KL 5DJ6B 4IK6A 2EE2A 5CGTA 1EXGA 1HHGA 1ZGLA 3CK0H 4F20A 4MMXC 2FUTA 3ZKMC 3FONA 4FFYA 3W0WA 5TGBB 4B9GA 2ILLA 1D6VH 1A3LH 2HX8A 4OFDA 5FA4B 4RGNE 1CZ8H 1HHHB 3CFKA 4CAGA 4J3UA 4PJGE 4NGHH 4XC1L 3Q8CA 1KXHA 3FQXB 2Z7YA 3BEWB 4OZIF 2H1LM 4IBYA 2JJSA 4X6CA 4ZT1A 5A3ID 2NT1A 2WNXA 5BCAA 5I8CA 3QJSB 2OYKA 3VXNA 1ZTMA 5A2JH 2V17L 3BCDA 4UU9A 1M6UA 1OGSA 2FHFA 3FT0A 3QG6B 5MENB 3RNQA 5F6IB 1J1XL 2B2XL 3EH3B 3P3UA 4U3XA 4N0FA 4PV8A 3UTZA 4Q97A 4I8DA 4WFED 6TAAA 4JFOB 1F3JB 1DVTA 1GAFH 4PS4L 3GIZL 1COBA 2NX5A 3D25A 3GRBA 1DVYA 3NMEA 1ACCA 3P2TA 4AL8C 3MGTA 2BOBA 5HD8D 1PVHA 3QJOA 4OZGB 2BMKB 2FWLB 4XZUA 4N1CA 1NBZB 4HIXL 3MR9B 4F57L 2QFRA 3WXWH 1K8IA 4OJFH 4PLJC 3PWJA 3G08A 3TU6A 1CFVL 1WHOA 2KC0A 2PTTB 3NUKA 4YX2H 4JO4L 5D7JC 5HYJB 1IO4C 5IVXB 2AK1L 1WIPA 5HHQB 4MAYD 2YPKB 1IGJA 4GUCA 4QNPF 2RQ8A 3ECQA 5DK0B 3HVDA 2ZOTA 3CXHJ 1FPTL 4ZI8A 2A6KB 4KHXL 4LLQA 2YFOA 2VDKB 2VDQH 1W72L 4E9YA 4RWYL 3UAJD 3TNNA 3OGOE 1MRDH 3MRCB 4E42A 2V3FA 4MXWL 3TBTA 1FAIH 3DURB 4M5YH 3CFEA 3QFDB 4AEHL 1KEML 2VLRB 3L3KA 4KH2A 4ZFOB 2CJTA 3H4FA 1IBBA 2WXOA 4N2MA 5T5NF 5KAQG 3NCJH 4WWNA 3GSUA 3HZYA 5DHXB 4P99A 1M71A 4ZZFA 2R69H 3TO4C 2XNAA 1S5IL 1RZIA 1L9SA 2XWBA 4L1SA 5FYKE 2IG2L 4J3OC 4A2FA 3GXDA 3D3VD 4DK3A 1EBAA 3RDTC 3PPEA 2YN3A 4AK2A 1MCNA 2UXFA 4UMSA 3TCLB 2XZCL 4AQ1A 6FABL 3KNBB 1M7IA 4L29B 1YMMA 4U3SB 4U1IB 4Y5YA 4OLXH 5D7SH 2M26A 2B0SH 2BW5A 3BEVB 4Q9RH 3QQ3B 3KYOB 5GSVA 1TTAA 1PKQA 3FQNA 2C7FA 3BWUC 2VLLA 3QR1A 1CFSB 2VMDA 3T3PF 3CXDL 2B5IC 2YGPA 4A7GA 1BM3H 5TD4A 1JGDA 2V3EA 2C3VA 3OB8A 3PWPB 4LASH 3B2UD 5JW5A 4JG5A 4UINH 2G2RA 4M48H 3HFML 3ZL1A 1DEEA 4GQRA 5FB8B 2HCZX 4LPTA 1Z3RA 4LCUA 4QI3A 1LWHA 5D2NC 1OGAA 4MCZA 5A43C 4R7DB 4X99B 3R4RA 3CSBA 4O4YL 4POZC 2VLKA 3GK8L 3WFCL 3RWDA 2F7OA 4PJCA 3BZDA 3QDJA 4G43B 4NM4H 1OM3H 5ISZE 1H0DA 3O8XD 5I1IL 4HLJA 4WJKB 2OMUA 1ML0A 1M1XB 3KPSB 2CCLA 1S8DA 5CJQL 3S36H 5KVEE 1GC1H 3GSWA 3MC0A 2D31B 4GW1B 3U0TA 2HRLA 3HZMB 4GUQA 1JD9A 3BH4A 4BZ1L 1OTUC 1RZKC 4UTBL 2ORBH 1M3JA 4YR6A 1TFPA 4LSQH 1UZGA 4KO7A 4QLWA 2O72A 5I8EB 5ABZA 1Q9LA 5IJBC 1FJ1A 4L8CB 4MA8L 1PLBA 3SY6A 4CGTA 1VIWA 4CILA 2WK2A 2FX7L 4JANB 2O93L 3EYOB 3AB0C 5D2LB 2GEQA 5AW5B 2VB5A 1KJ3H 3ARXA 3BSZH 4WK0B 1BYNA 4KUCD 2EVGA 3HBGA 4A63A 3EDDA 5CBAA 2EVJA 1LO0H 3POCA 3AG1B 1Z5HA 5LHDA 2QQLH 4WUUA 5DO8A 2VKXA 3C12A 4P2OC 3K1KC 4OJCA 4OLEA 3BVUA 2OQJB 3MGAA 4K3DH 2CM5A 5EF1A 4N26A 2ICWB 1ND0B 3JT0A 4U6XB 3EYQD 3MRNB 4XMUA 4NHUB 1FGVH 3BCFA 2N4IA 5KBDA 3PV6A 2PWGA 4CADA 2GAZB 1H3TA 2X4UB 5IIEA 2PR4H 4NZJA 4BFOA 1ZT7A 3SGKC 1OAUH 3D85D 1A0QH 3UJTL 5D1ZA 1CDGA 3GEFA 4ZOCA 5EZIH 1OZTG 1N6UA 3BKYL 5DRZA 1E42A 2BW4A 2GEEA 2YGVA 4F7PB 1XGYH 4NO5A 3BAEL 4JJHA 2Y7MA 1U8JA 3W5NA 3O6ML 1BPVA 1QBBA 2LFEA 3APDA 4NWUL 2OCFD 3FSAA 3HG5A 5DD0H 3DI2B 1PBYA 3SGDI 4ZNEE 4AUUA 1MREL 3F6IA 4S0SD 4PSPA 1HXMA 3EOTH 1BZ9A 3O4OB 1G1CA 1V3MA 1MCCA 1I1FA 2EXYC 2YPLD 3KR3L 3QQDB 1T2QH 5K9KB 3PF2A 2ZXGA 1JYWA 1G6RL 4M4RA 2VUKA 4NPJA 4QXUL 1N59B 5HHOA 1MVUB 3BDBA 4XWGH 4YHYC 5KYWB 5B3SB 2Q7AA 3MI6A 3EJTA 4U1KA 1YUKB 4HPOL 2KKQA 4EAEA 4P23C 5AWNL 3DK0A 1A2YA 2J73A 4ATTA 2RMNA 3EYVA 3NFNA 4FLSA 5D5MA 5DWPA 5EU3B 5GIRB 1FO0H 3L5XL 4KX7A 2D03L 1FYTD 2N7SA 3PL6A 2OXHB 1U21A 2PYED 4XMLL 1AZUA 2RGSA 4R96B 3RL2B 1TJIL 1FV1B 1ZE3H 1VFAA 4U1NB 4DP6X 3L3OC 4KUZL 1A47A 4U1MB 1FNSH 1XF5B 4Y2DB 3BIKB 5C0CB 3C75A 3U2IA 1I8IB 3PDGA 1CDBA 5JHLA 2VABB 5IB1B 1FG9C 3CFCH 3X12B 4DETA 4S1RL 2NXZD 2A9CA 3MLTB 2Z35A 4MWFB 2FX8L 3OR7B 4WV1C 4DGVL 3M46A 1CE1H 3RVUC 3B2XA 1E9PB 2LVCA 2QV4A 2GJPA 1K4CB 1VFOA 3FB8B 3HRZA 5CF3A 4BV1A 2R1WB 3BH8B 1KJ2H 1KBGL 1T03L 5CINL 2DQJH 1JAEA 2ZE0A 4G8FA 5BXFB 3HI5L 3ISRA 4BRJA 1U8LA 1UCBL 3NEOA 2FECL 1XZ0A 2NNAB 5MERA 2ATPB 1U41A 1SXAA 5E8PA 2OL3B 1DUZA 3MQIA 1F3RB 3KH4A 2NY3C 3DO3A 1EEZB 4H2AA 5TK4A 5FWRA 4BK4A 3H1ZA 5C0BB 3PJNA 5EDXA 3T0XA 3MV11 5EO1A 2EC9T 3Q3GA 1HI6A 2UYLB 1YVLA 3DUUA 5CLWA 4NBYB 2BP0B 1N6QH 3AY2A 3FO1B 1ZS2A 1L0QA 3A24A 3V79C 3K6FA 4YDVA 1B3IA 3WV0A 4KHTL 1G7PA 2WN2A 3CFBA 4G6KL 2ZXBA 4XO8A 3KPRE 5CZKA 5F9WC 5I1JL 3RYMA 1A9EA 3DIDA 1IQDB 4N8CL 4XXDB 1EAQA 3LPGA 3JWOC 1QEWB 1I1YB 3LN5A 1NAML 3SGEH 1S7RB 3ML8A 3JWNE 1JXKA 4U2ZA 4RDQF 1TVHA 4HV8B 1NGWB 1JJUA 4YLQT 1P2CA 1MCFA 3HS8A 4LB8A 1CGSH 1ZT4B 2AVFA 5FHBH 2ZPKH 1FA4A 2LAGB 1ES0A 2DLFL 4Q6IB 5DQDL 3W11C 1LGVA 4BCYA 3FQTA 4Z76B 4ANXA 4EDWH 4B95C 1H15A 4UZUA 5HJ3B 3CMGA 2K7QA 5C71A 1AANA 1E6OL 4U0QB 3BUIA 2AJSH 4GIPD 2YJLA 1T7YA 2PTVA 1T20A 5C0AE 4K0OA 4N2LA 1XGUB 5K59F 3RAJH 2ARJB 3SEPA 4HAKA 4BFEA 3WFHA 1CD9B 4WHDA 4HS6B 3BW9A 4GAGH 4JRXB 4GRLC 4ZO7A 4UM8A 1KYFA 4H5SB 4ZX4A 1X5MA 4XBPA 1B3JA 1I75A 1KCVL 4GQ9H 2EVFA 1NCCH 4OM0L 4DQOL 4J8RA 1TKWA 1U3JA 2LQRA 4KROD 4PWEA 3BUPA 4N2AA 5ERWA 2LTQC 2NTFB 2AZAA 5DK2B 2CRYA 3LNIA 4J3TA 1EUTA 2AZUA 3OB0H 3FL7A 1JGVH 4QJ3B 1CFTB 1QP1A 2CK0H 3PP4L 3UZQB 1JZGA 1A6WL 2AEQL 2FD6H 3PHSA 2B4CL 2XTJC 5HGDB 2PETA 4LEBA 1LQBC 3FRPG 4HJGB 4XNUL 5GZNC 1RHFA 4ZMWA 3QZOA 5C09D 2APTA 3VFWA 5G4OA 2JELH 1FH5H 3V6FA 5JTWA 1X5HA 2ZG2A 3LHAA 3FFDB 3GO1L 5B7MA 2KZWA 2I9TB 3L81A 1N7ML 3LKPB 3DROB 3FMGL 4HWEH 2XWEA 1G94A 3A3YB 4U3CA 1FL6B 4FQXC 1XCQB 2ZCLL 5TE7H 1EJOL 2XI9A 3C9NB 3AM8C 3JVGC 5JPNB 5I18L 4KMTL 4TMPA 1CL7L 1JSYA 4HQQL 3ZQWA 2W81C 3GPEA 2GUOA 1NCJA 4Q58C 3RB7A 1AD9B 1KTRL 2E0PA 4LPYA 1IBFA 3BUYB 4AV5A 4ZW5A 1SXNA 3QUYC 2BS71 1N10A 3QXAB 1KYAA 3QI9D 4HH8A 4N86A 3WEAA 2IF7A 3SD2A 1J87A 3NCCB 4RGNC 5KW9H 3MVSA 1DQLH 2DMBA 3D4CA 3D51A 3WTSA 4QLRA 1LO2L 3WG7B 1I4FB 2CBMA 4IJ3C 1J5HA 5CGYC 1TVBA 4M4PA 3S3SA 4TSCL 3UIYA 1J0YA 2V5MA 3G5ZB 4MX7B 3K6SA 4HUWB 5H4ZA 2ZP9A 3VXQB 4E5XA 2VOTA 3FRPB 1HEHC 5KSBE 3GMQB 4K7FA 3VTAA 1C16A 2ADJB 3TGXA 1KG0A 1MPAH 3HUJB 1R75A 3F7YA 4TSAH 4TUOA 4WUKL 2NRDA 4P46A 3KLDA 2DM7A 3SY0B 2GITA 2R2HB 3FPYA 3G5WA 2WQSA 4ZDHA 5HHPA 5EIIA 5INDB 3QJQB 4WTZA 1U8OA 4LLMA 5DYOA 2O5XL 2JJVA 4RFOL 2X6CA 4S2SA 4G6ML 2FH8A 4M6OH 1S9YB 1X5AA 2ODHA 3GBML 4UTAL 3E8UL 5KVFE 2Z31B 3TZVB 1OP4A 3Q1SH 4W9KC 3RI5K 4PB0H 3QEQA 1ZOXA 2M2DA 5ICYB 5A40E 3BVWA 5CLXA 2XFGB 2NDGA 4JDEB 1HQ4A 2DKSA 2C8NA 2NY4D 2YD3A 1NFDF 2VDKH 3KBPA 3WEMA 1AS7A 1AYRA 1M05B 1NQBA 2WTRB 2IANA 3CQFA 4PLNC 1J1PL 3BLPX 4Q14A 5JZ7C 3IFPA 4LHJB 3WSQL 5SWQB 3FK3A 4XHJD 2H4EA 3RX9A 4W9HC 4Z7UA 5I5JA 3V6OE 4QOKE 4TULH 5ICXB 4CW1A 2D0GA 3T6WA 3PPSA 5CJ8A 4XAWL 4RMVA 4U1SB 4CN1A 2BWIA 3DXAE 2DWDB 2OSWA 1SDAB 4YBHA 3DX7B 1VFBB 4PJAF 3VWJB 1EHLL 3LH2H 3S35H 4FKKA 4JFDE 4I3SH 3T0BA 3U0WH 3PE9A 3SQOL 3VO0A 5C6TL 2QZ5A 3BVTA 3O4LB 4HKXA 4UAHA 2A6DA 5CCHE 1MFNA 4Y5XB 3MOQA 1QO3A 2Z7ZA 1H3PL 3CZGA 4RA3A 1SN5A 2O6DA 4HXAH 4MKTA 1GS8A 2N1KA 4D7BA 1X6NA 4IBSA 1ZV9A 1O6SA 4XRCA 4L8SC 4G8AC 3T77B 4B60A 4OCRL 3J7HA 3CZFB 3M86A 5C2BH 4L4VE 4ERSL 2QPEB 5MEOA 3CVIL 4BXSV 3U4EB 2B59A 3HMWL 4Z8FL 2W38A 3OHXA 3VCLA 1HSBB 1BZ7A 1LVEA 2GJZB 3QUXD 2HJKA 3IDNA 1RZ7H 1UQSA 5IQ7L 5KS9A 1IVLA 3MLXL 1SOSA 1Z9NA 2VAAB 2J4WL 3GBLA 1TPXB 4N6RB 1XHHA 4F2ME 5ISZD 1J9RA 2KBGA 5DR5H 3VAEA 3MFFA 3GUTA 2EKJA 2ZP0T 4FXKC 5DC4B 5AVUB 4WTXA 3D8MA 2IGFH 1EJFA 5EEXA 1UFGA 2YD2A 5CWSB 4M3JA 2Q2LA 4PW9A 3DOSB 5L2JB 3DC0A 4I0PC 5C8JB 2AMGA 1RUPL 4U4BA 1UASA 5BUGA 1ED3B 3FFOA 4JO3L 4KX9A 1CDHA 1GZHC 2ZXWB 4L3FA 5D1QC 3V8CA 5B38G 4B6ZA 3NCWA 4QRBA 1RZPA 1MAML 5ICZA 4M3HA 3DO4A 1CU4L 1AZZC 1W0YT 5E8NB 3GRWH 3RBSA 2JKNA 3F3HA 2OR9H 4Q2ZA 3UAJA 3INOA 4JG0H 4NZUL 3GSXA 1SXZA 3FH8A 3T08A 5HGBA 2VXQA 1YECH 5B21A 1U2YA 3CU7A 4L3AA 3RDTA 3QWNA 4BFBD 2CKNA 2WKGA 3QW9A 4KTEL 1DR9A 4J6IA 2YD7A 3L4WA 4OGYL 3U36A 5L2KE 1C5BH 1MCEA 1QNIA 5TQ2L 4ZMLA 4D9LH 4GKNB 3SDXF 4K94L 3RUGB 3BRDA 1J88A 4JPIA 3VSUA 3UBXG 1VADB 4APQD 4Y1TA 5IVZA 3ISWA 3QUKA 3TEUA 3B7YA 1X7SA 1OAYH 5EUOE 5HY9A 4ABUA 1JMXA 1MZZA 1CGTA 2DAVA 3SPGA 4TM9A 3BYTA 1OGTA 4DEWA 1UM4L 4NWTL 3ARDD 1IAOB 2YXMA 5GGUA 5D2NA 4EI5B 5E1GA 4G6FD 4BFKA 8PAZA 4FNSA 2H1PH 4XMVA 3X3FH 1MHCA 2VQ1B 4BZ2H 1F1AA 5IQLA 4W93A 3RVXC 3OVUB 2D9CA 3DX6A 4NKQB 1IV8A 5B38B 3HE7B 2FJHB 5HYIA 3IMSA 1F2QA 2CUIA 4PUBL 5AKVA 5IOPA 3AWEA 5K9JL 1QFUL 2WXLA 3VI4A 4NQCE 3ZGHA 4G8IB 1CG9B 2WLIB 4OLVL 4HEPG 4M8QB 2JTYA 4QY8B 5E23A 5IM7B 1E90A 1LL1A 4N0UE 4AW7A 5DZOA 2CSPA 3D07A 3O8XA 4D0BA 5DC2A 3D0VA 5I75B 3GMOA 2CU9A 4KI5F 2E86A 4JEGB 3TJHC 1YCSA 4XNXH 2WW8A 1M2VB 2NNFA 4IHOA 5JQ6H 3MLSL 3VRLF 4L9LB 3UBXB 3I6LE 4WWPA 2OXGB 1TJHH 2BSTB 1AZVA 4YO0B 1V54B 3VE0B 1HL9A 5ADPH 2ZXCA 2AK4B 2JH2A 4L1LA 1T0NB 1S9WB 1Y6MR 1X9LA 2ZOLA 4W9JC 5K39B 4KQ0A 3EGDB 5F7LB 3TTYA 3MTRA 3D6GA 4LBEA 1QFPA 4OKVB 3WJJA 3MJ6A 4QJ5B 2JMRA 3E2HB 4JY4A 1SM3H 5I73C 2LLNA 4WU5A 3KCWA 5I1GL 4Z0XA 1NCAH 2AJVH 4RFNC 1HNYA 4JHVA 3V0WL 4QRTB 3LRLA 5I9QC 5IB3A 1CQYA 4TSBH 4QCIA 5E8OA 1CICC 2QVMA 1N68A 4MS8C 1BD2E 4BIKA 2WWMC 2V2WB 4HZLA 2C3HA 2ZUVA 4TXVB 1KYUA 3DJ9A 5AL8A 1ZWIB 4JPVL 2MEJB 3RKDD 3L3HA 3NPZB 3S4SA 4OZHE 2HT3C 5DHMC 2V9TA 3MUGB 5LQBL 1D5XA 2NY0D 3FSWA 3KMDA 3BP6A 3HG1E 1E3XA 2IDTA 3GINA 3L9RA 3N5AA 3IDIB 3B6SB 4LLAA 3SDDB 2BPBA 3MRPB 3D85A 1VKXB 5BVPH 3QWOB 1E27A 5FAAA 1HXYB 5AEAA 1AGCB 1F5WA 1N8ZA 2R56H 4JMXA 4QUOA 1P5VB 2F68X 3LSOA 1F18A 3RPIA 1P84K 1NKGA 2UZYB 2OL3H 5C6WH 4G6AD 4OZIB 4DTGL 3MBEB 4W4OC 3TVMC 5C08E 3WLWD 5JHDB 4KXDA 3SKUD 1NH6A 1WZKA 1PDKB 4JJOA 2Q8AH 4D9RE 1NCUA 1GOGA 3CLFH 1XB3A 3KWWB 3GXTA 4ACPA 4IM8A 4EBQH 5C92A 3VXUE 5I1DA 3KPRD 4HT1L 4H1LA 4K71B 2DIAA 3KYNB 3LKQA 2CBQA 1BECA 4IOSD 5IFHH 3T65B 2YPLA 4XP6H 3WMQA 2UWEB 3QFGA 1PGRB 1YEEL 1J1OH 2E56A 3SDCC 5CEYB 3L1FA 4FEIA 1DCLA 3O2WH 2DQEL 2ZP8A 3KCPA 2BRRH 1E3FA 3ZKXB 1R46A 1R19A 3VG0H 1I8LC 3L6FB 4LFHG 4GRWE 4FULA 3JWNC 2WSKA 1X7TA 4MA3B 2JTDA 2VN3A 1U58B 1KPVB 4MXVE 4IBZA 5E1AB 5IY5B 5CLYA 2NNCA 2YAQA 1E3ZA 1FYTA 3LQAL 4ZAKB 3MACH 4WO4B 2JKWA 3MRQA 2PYEA 3ZZQA 1TQCB 3C6SA 3LZQA 2AEPH 4FQLH 3QCTH 2YD8A 4ZO8A 1KIRB 4TNGA 1RZFH 2DLEA 2AJYH 3M1BB 3WHE1 1G7IB 3EGXA 3K7UA 4JGUA 4N2BA 1LLAA 4YHLH 5BNXD 4AGOA 5CS7A 2AFNA 2D7QA 3OKNA 1CXEA 1IC4H 4PY7A 1EX0A 1NUGA 5CJ5A 4OVUA 3T4YB 5DJ0B 3V0HA 5FFLA 3MBXL 1PKOA 2ZKXA 5F89A 5E6ZA 3ASOB 3RTLA 4M1GH 1DBJL 3WD5L 5AAMA 3SHSA 3HHMA 4NP4H 2AJZB 3VWKD 1URZA 3PGCA 1GS6X 5HI5D 1K2DA 4NNYB 5BVJA 2F8XC 3ATAA 1JL8A 4HG4J 2F2HA 1ASOA 1DQQA 3C2AH 3NTCH 1QVOA 1ZHNB 2IALB 3QJFB 1T1ZA 2J6EA 3HNVH 3I9IA 3NJHA 1BVKA 2ESVD 3KBFA 3OAYH 3E3QE 3OX8A 3T09A 4LAQL 4YHIB 3C5ZB 1HZLA 4P5MA 4Y4KB 5HDQL 2WBJB 2ZOKB 4P9HH 1BXUA 2VR6A 4I48A 3ZE1E 3PP3H 4Z7OB 1HE7A 4ODXB 2D4FA 1J18A 1FGNL 2HWZL 2X89D 3ARGB 4MNQD 2G3ZA 4MJ4A 4GG6E 3VDAA 5GS0H 1KCSH 3WEXA 4KY1H 3EGSB 4H2CA 3PFQA 3F5WB 1DVSA 5LG6A 3ZE2B 2H32A 3BVNB 3N9GH 1U93A 3DK2A 4XVTL 1PSKL 1DQDL 4Q9QH 1KV7A 5BRZB 2VZSA 1OSZA 4LVHB 1ID5I 1NBYA 1LO3L 2VM9A 3P4MB 4MLIA 5AL0A 3DV6B 2FWOB 4G80B 4K8RD 1N19A 2DW5A 1TYEB 4WFFE 1NLDH 3V4VA 3IAPA 5DD6A 1QI3A 3G6JA 4P3DA 4MJIB 5F1SA 1H6TA 4YDZA 5EIVA 2ZUWA 3K4DA 4OCXL 3EJUA 3IWUA 3I02B 2KLRA 2PCFB 5I6OA 2WAQA 3ELAT 4XTRD 1T6BX 5IK3B 5JPMA 3X1FA 4P2RB 2KERA 3EF7A 4PRPB 2Z9TA 1NBQA 2AV7B 2PP8A 4AVJA 3VFRB 4EIGB 5F0LB 4DQAA 3ZOAA 1D3CA 4H20L 2WVUA 4PTTA 3K71B 1N5YL 1NFIA 3RWJA 4MJ5B 3IAGC 3QRGH 4XOBA 5BV7B 1ACZA 3MA9L 4OGAD 2A9MH 1LEKA 3MX0A 1I7ZB 4XN1A 5L7XL 1XD0A 1XXDC 2P42B 1QLFA 3OJDB 4QTIH 3D06A 4EIUA 3DVIA 3EJQA 2BNUB 2CKBB 3P0VL 3OAZK 1EXHA 3E6HB 4LVOB 4I18A 2I85A 2YWZA 3MXVL 1GJIA 2H3XC 2X4NA 1ZLUK 3CZNA 2EAEA 1B4RA 5C09A 4PCTA 1HJBC 3ZE0E 1O6VA 4C54A 4M93C 4N2EA 3X13A 4LSVL 5FS5A 4WW2F 3U7WH 1XTLA 3V6ZB 4HIJB 3HB3C 3RY6C 3BKMH 3QULA 3NZ8B 1FVCA 4QOKD 4YDIL 3BT2H 4WHCA 3K2KA 2Y5TA 1FN4A 3BE1L 5BO1L 3IE9A 2WD0A 2EDYA 4L23A 4KTDH 1QPXA 1E40A 3DX4A 2KLSA 1HS6A 3DHPA 4A37A 4Y4FB 4ZUWB 3T6ZA 3IJEB 1MIML 3IK2A 4DK6A 1ZE3C 1SN2A 2APVA 3PXHA 3QPXH 4PJGA 1LDPH 4FNLH 4XI5D 32C2B 1X4XA 4ILDA 3D69B 3VW3H 1DVXA 1JZDC 3EFDL 1MLBB 3ZHNA 3QI9A 4HC1L 4C56B 5A2FA 3PDOA 2NY1D 1X7QA 1OOAA 4ODTL 2JB5L 2BJMH 4L4VD 3IBOA 4M62H 2EVHA 1DBML 1BLNB 5LWYH 3VMNA 3S88L 1WT5C 7FABL 5KTEH 3WGUB 1H5BC 2XZAH 1TU2A 3QA3A 5G5DB 4JDZA 2CXKA 4O51B 1GJWA 2L4OA 3IJSA 4AW4A 2H45A 2J88H 4FYSA 4IDLA 3WJMB 3HC2A 1UD5A 3ULUL 5DGQA 5LBSH 1EFXD 3TBSA 3L3GA 3GB7B 1T7ZA 1DJSA 2DEXX 3C6LD 4OT1L 3S37X 3CU1A 4K3JL 3TT3L 1HDMB 1B9ZA 5IROD 3QHZL 1IBZA 4FI8A 2OZ4A 3DBXB 4L4TE 4Z3HA 4AGLA 4Z78B 1EO8L 5IMKA 2KHAA 1LK2A 3QCVL 1YEDA 4Q9CA 4V2CB 3SGDH 4ODVH 5I66B 5EOQL 1T21B 5I6PA 5T3ZH 4LKCA 1NAMB 2ATKB 2OMXB 1FI8C 1U8HA 2X4QB 3WFBL 1BEXA 4XPFH 2OULB 3WIHH 5I30L 4QD2E 3FBQA 4KY2A 3EOAB 3Q9PA 4X0KA 3L3IB 5E00A 2R4RH 4QT5B 1OW0A 1YPZF 3FN3A 4X83A 4PR5B 1Y0LB 3IDGA 3THML 3FUEA 4XNZC 5DMKA 3MLZL 3DVNB 2OJEA 1DVFB 4FCHA 1I3GH 1SYVB 5EC1A 2CO6B 3NA9H 3QDMB 3N44F 12E8L 3U6XA 2A74C 2VH5L 5L2KD 2MSPA 2O5YH 1F4WL 1I7UB 1EAPA 3GSQA 4N2KA 3VFMA 1DBKL 3H9SB 1YQVH 4UIMB 2J21A 5FGSA 3GZPA 2AP2A 4GAYB 4GB9A 4NXSA 3ZDXF 4YLBA 5ICUA 4MCMA 4LVNC 3JTTA 4B53A 2BP8B 3DVGA 1MCPL 4Y89A 4ODWB 4QXGH 1JZ8A 3GGWA 2RH0A 4WW1B 1W2KT 2B9BA 2GBTA 2L7EA 2H6UA 1GPOH 3AGWA 2YXWA 3K81A 4H26A 3IXTA 3GHBL 5DJDB 3N04A 2Q7NA 3NABL 2F19L 3UYPA 4AH2A 3G9AB 5LB1A 4PJ9D 1AY1L 1LO4L 4UV4L 2OFQA 4FQIH 4EUPA 2HKFL 3GMLA 4XNBA 1QSEB 4LDOB 2IOMA 3N41B 1JZ2A 4PGJA 2COQA 1MUJA 3NIFE 3ARYA 3QUXA 1G7QB 4NQCD 4WGVB 5HDBE 5C0DA 3BP7A 3QEGL 1F90H 4NN6C 4I4WB 3WN5A 4R6UA 4WFHE 3BQUC 3UOAB 2A77L 1AMXA 4YGVA 3WIAA 3DGCR 5ISZA 4OZFG 3BKJH 1EHAA 3B9KC 5JA9A 1S9XB 3O3BB 1GZHA 1DL7H 5FO8B 3ZK0A 3E80A 3L8QA 3M17B 2CA4A 3KHQA 5DJCB 1FFPB 4YWGL 2DQTL 4HUXB 4F3FB 3QRLA 1Z0NA 1CFBA 3DX3A 3TV3H 3I6LD 1A66A 4PRBB 1MFEH 2UVFA 5IJKA 2SEBA 2CO3A 5DJ2A 1FZOB 3NIGE 3QIBB 1FG2A 1BXXA 1MFAH 1OP3K 3LS5L 1NGXB 4FXTA 4IKNA 2HPTA 1VB9A 2PXYB 4JN2A 1EGJA 3MV8E 4JAMB 4XCYB 5GRUH 1NGYB 1S7QA 3JSSA 4WHTB 1I8MB 4OW6A 1L7TH 1V3JA 3QSKB 3MBWA 3N91A 1YY8A 2EDBA 5GS1A 1GJUA 1ESOA 3P9MA 4YXKL 1UVQB 2WTOA 2VL4A 4JHBA 5KVDE 2B2XH 5EIQA 4HG4K 5IW1B 4KQ4L 1B0WA 1BD2D 3VD2A 1MRCL 4MJ6A 4OM1H 1MHEA 5B3JF 4NAMA 2DYSB 1VEOA 1AO7D 1ASPA 1RUQL 1JHKH 4HX1A 5BPPA 4APQA 4QWWD 3Q06A 2B77A 5DUJA 3N42F 3NSYA 1FZMB 3QNZA 3B3IB 5B39A 1AXTL 3ATDA 1IILE 2F1BA 2JKJA 1KLFA 1I9RL 3P4NA 4YL4A 5IUSA 1FFRA 1SGKA 2YN5A 3HG1D 4HIXH 4OZFB 4UOZA 1JK8A 4MNHB 1KSRA 1J05B 2XDHA 1I9EA 2OMBA 4UWQB 1ADQL 3ARDA 4GSDL 4JO4H 1DJXA 1T6WA 2IV8A 3GSRA 3LNFA 4HJJH 5FCUH 1KEGH 2BVPB 2WLMA 5C07E 4LCWB 4XN2A 1IFHH 5LGJA 3DX8A 4HUKB 2Y7OA 4ZFGL 2F18A 1GKOA 1FPTH 1YMHA 1R5IB 5F93C 3CN3A 1KT2A 3UPRB 2Q8BH 3LPPA 3LNHA 4N8VA 4M43H 5C08D 3SQBA 4WDIB 1IAMA 3SPCA 3V0DA 1L9NA 3V0IA 2XTSA 4ZNEA 3MZTA 4I2XB 4U1JB 2RA1A 4Q89A 4KZ0A 4Z0BH 4Z5RA 2AI0L 4M9PA 1ZVSB 1MJJB 5IEKA 4ALAH 4A67A 4B50A 3VXUD 4UYPA 4AEHH 4LDEB 1FL5A 3LIZA 3PIQA 1SQ2N 5AYQA 4JVPA 5LUMA 1XGPB 4P2CG 2JXMA 2EE6A 2YS4A 5E8EA 3LRMA 3RWEB 1QZNA 3K5SA 2EYRA 4MDIA 2A6JB 3MJ9L 3OR6B 3HS0C 1TUPA 5A2BA 2PTUA 4CC1A 2Q6WB 3DHUA 3IF1A 3QUMA 4JFZH 1UXSA 1G43A 2IPUG 3S8WA 1CGUA 4HBCH 1A9BA 1TCRA 1WBYB 3PAZA 5K9OB 4NS0A 4W68A 1F6AB 4PTUA 3P2DA 3FQ1A 2DQHL 3TPUB 3Q43A 1JCVA 2I7OA 3DV4A 4AQ8A 2FEDC 2MQ3A 1YYLL 4BA0A 3MRDB 3ZDYB 3H85A 3K1DA 4Q4EA 5DJAB 1QSFE 1UWYA 1KBVA 4R4ND 2NXYB 4CGUB 2FBJH 2IWEA 1PFCA 2IC2A 3VFVA 2CGRL 4LLVA 2JB6A 2IGLA 2EDDA 1DDHB 4P9MH 3WTUA 1HZHL 4YC2B 4YNYB 4GW4B 3ZDZF 4Y88A 1GGCH 3WS6C 4EE2A 3CLWA 4JPSA 1E9OA 2P8LA 4M7KL 2G5UA 1KJMB 2DI7A 3MRJB 5LNEA 2OMZB 2K4WA 3ZMRA 2ZXQA 2NY6C 4TLTA 4ZTOL 5JW4Q 4HCRA 5CJQH 3Q05A 4M61A 1JHLL 4OCSL 1WAAF 3GSNA 1MVFA 2C4FU 2WO4A 4AQZA 4ONHB 3MRBA 2HG5B 1E4KC 2EACA 4ZS7H 3EBAA 1E28B 4NQVB 3GMRB 3FHAA 2V5YA 3IDJA 1QA9A 5D1ZI 3GZQA 5E8DH 4XXWC 2HKHH 3MMEB 4KKQA 5D7KE 2WV3A 3LV3B 1FF5A 2CCVA 4PWHA 4PBXA 4XPBH 5AYUH 3V6BR 1AGEB 1ID2A 1WE5A 4ZUTA 2P80D 4AL8L 4B41A 5B8CA 4MVBD 3MOAH 3I85A 4RRPG 1AHKA 5I8KH 1JPTH 1QG3A 1W80A 3JTBA 1BVNT 2MOGA 1Z9PA 4DP9X 2VT0A 3BN3B 3H9HB 3QEHA 1CVRA 1BMZA 3FCSB 3KPRA 2FQGA 3G5VB 4N20A 3DTUB 4TL4A 5T3XL 1QWUA 3WFDL 3WIFB 3BOVA 4KZEL 4IOSA 2YMXH 1O9WA 2J72A 2YKLH 4Z7NE 4HUUB 1BAFH 1BEYL 3TA3B 1CYXA 2LV4A 3BXNB 2C1OA 2EEAA 4JM4L 4WFFD 2HMID 5D1XB 4JPKL 4KBPA 2WQXA 4HWZB 1E4HA 4RMRA 1VFUA 3BUTA 1CE6B 3VI4F 1A9VA 4UT6L 4F33A 5I17B 4RFEA 2DL2A 1AHMA 5KYYB 4HD5A 3K6OA 4TVPH 4Z77B 4PJDE 1IM3D 4LXFA 2FLMA 5EH1A 2R2BA 1U8CB 2AJXL 3BKYH 1S7VB 1JYNA 3FO9B 3U2SA 2R0WH 3B43A 3MV9B 4EVNA 1G4MA 2FO1A 2W9DL 2L0DA 3VRJB 1SYSB 3DWTA 4FI7A 3PAYA 4F7CB 5IR1A 2FNWA 2YXVA 1E9QB 4IEFB 2F7QA 1JTOA 2VDPL 1ONQA 4PJ6A 1MH5B 4K15A 3F00A 1I31A 3CCHB 3QZMA 1ZXKA 5FCSH 3RL1B 3GKZA 3QFJE 2E7MA 2VXUH 3NJXA 4IRSD 4CRPA 3SE8H 1OALA 2QSCH 3PJSB 2AAVA 4WKZA 5BV7H 4Y9FA 1FNGB 3LS4H 3VWKA 2A9NL 2XY2A 4BSVB 1B0RB 2GYSA 3ZR6A 5DHVA 1T3FA 3KR3H 4JREB 4KU1A 3PUUA 4KUCF 1KGYE 4NPYA 5IQ9B 2XIBA 2X9XA 2XBDA 2AXJA 5JOFB 4TVUA 5DVKA 2CKBH 2ERJB 5AVRB 2ITDA 3O4OC 3L5WA 3TEYA 5J13B 1AR2A 3MHZA 4P4RA 2FX9L 1HEZA 3BZEB 3FOLB 3O6LH 4HPOH 3RFZA 3RWCA 2WXIA 4QRRB 5DJXB 4RZKA 4LHUD 2VSDA 3NIDB 2XN9B 3LEYL 4NI3A 5IMMA 3GIVB 2X89A 1RIVL 1XMWA 4YQXL 5I76B 1JVLA 2HUEA 1CIDA 1CN4A 1BIIA 5A7BA 4TLSA 1N0XH 1S78D 2G75B 3LRSA 4KMLB 5JLZA 4M7JH 4M7LT 1ZGLB 1HHGB 1RZKL 2DTML 2WWKT 3VGHA 4FQ2H 2OYLA 3FONB 4V1DD 2RCSL 4J3XA 3W0WB 1D5MA 3VUAA 3HNSL 1HILA 2NY5H 2WLJA 4LKXA 2E8ZA 2WXJA 4XVOA 5F7KC 2B1AL 4BINA 4DGVH 3CDCA 3RIAF 4BM7A 1BQLH 2GJ6E 3CFKB 1I85A 1XGTA 1M57B 4Y2DC 5F6HJ 5M95B 1OSPL 1R24A 3HC3L 4J1UA 1T03H 1J0ZA 3H2PA 5DD1L 4RGOH 1B90A 4X6CB 3VSTA 5I8CB 2ICEA 2HPOA 2F0CA 1MJUL 3QS3A 4HJ1A 5DJ8A 3VXNB 4DGYL 5HDRA 4UU9B 1OCOB 3TONA 1NBCA 3AXIA 3AQZA 1WYJA 2EICA 1ZRUA 3BC9A 3OKKA 2KMWA 3LYRA 1IB5A 3VI3F 4P2QE 5KSBA 3SE9L 4AIXA 2LU4A 3CBRA 3MLVL 4N0FB 4FA8A 4PV8B 5AW2B 5EBLA 1L9PA 2W9EL 1JHTA 4FGMA 1U3ZA 1RP9A 4L4TD 2OYMA 4XB7A 2NX5B 3D25B 3MGTB 3ZU8A 2BOBB 5GGVY 3E9TA 1HZKA 4OQTH 2OCCB 4KHTH 3LQMA 3AT9A 3MJGX 3I84A 4HSCX 2HFEA 4G7QB 3G08B 1AOHA 2P8MA 4NNXB 2BVQA 5IFAL 2EIZB 1R33A 1ZK5A 3HIZA 1IGJB 4UDTB 3O3EB 1NAMH 2HTLC 4MRBA 3KXFE 3A6BL 1N4XL 1KF9B 3WAJA 1CXFA 1FNLA 2MTPA 2VR5A 4QTFA 2IBBA 3C5XA 1Q1JH 4F80A 4MQ7A 4LLQB 1K5NA 1RL1A 4JE0A 2XQYK 5DQDH 2MJWA 4Y5VA 3TNNB 1WS8A 2XQBL 3KEHA 1XDTT 4M7LL 3V6OA 4QOKA 1F1GA 1QX1A 2AJ3A 4E42B 2Y9RT 3L4CA 4R84A 3TBTB 4CMMA 4QNPE 3KL5A 1F8TL 3CFEB 3MGOA 3L3KB 1AAJA 2H2SC 4RCAA 4HOWA 1PZ2A 1L9RA 3GSUB 4JFDA 5CEZH 3HZYB 2Z8WC 5F7EL 3ELQA 1M71B 3H8NA 1N5AA 2XNAB 3U4BH 1RZIB 2PPCA 2XWBB 3EJCA 4R97B 2CO4A 5DI8A 1E5AA 2X6AA 2CG9X 2DKUA 3VFUA 4AQ1B 2GC4C 1M7IB 4MSWA 1YMMB 4Y5YB 2J12B 4L4VA 4ZD3H 1KLUA 4I5BA 5GSVB 3FQNB 1PKQB 4LMQE 1A6WH 2B1HL 2VLLB 1D7CA 2B4CH 3EH1A 4KRPD 3BX7C 3OKDA 1V3LA 1JGDB 1EFXA 2FATH 1P4LA 3LNGA 2C3VB 5HTSA 2QSQA 4JCWA 5JW5B 1ITBB 1BFSA 1DEEB 4WFHD 1R17A 3KS0H 3EHBD 3LB6D 3FB5B 4FE9A 3GI8H 2XV6B 3KM1A 1OGAB 4LCUB 4MCZB 5IROA 4F2MA 5L9DL 1QR1A 1GTNA 1N7MH 3HZKA 5F21B 2X38A 4G1MA 4P9HC 2C3GA 3GDBA 3I75B 3OC8A 1JVOA 2VLKB 2I7SA 2YSSA 3RWDB 4WEUD 4PJCB 3QDJB 1SN0A 3T3PE 1XSIA 3EJZD 4FFTA 1H0DB 3COOA 4FP8H 1DQJA 3NJIA 4MD0A 4WI0A 3TOPA 2OMUB 3G6JF 1CLYL 4KMTH 4YHZL 2EE9A 2G4EA 2X53A 4MAZA 1S8DB 3KGUA 1T04A 3FAWA 5EB9A 4FKEA 4ECNA 3GSWB 5BMFL 1IE5A 2WQRA 4Y9CA 1USZA 1TFHA 1A3RH 1TETL 5H8DA 3U0TB 4JM2D 1BF2A 4BGDA 2CDFB 2ICCA 3BSHA 4FLRA 4QHNA 5CD5D 5JPNC 5AVWB 4R2GB 4YAQA 3MV8D 3QP3A 4YR6B 2Q7YA 2WQWA 2G60L 4LP4A 5EBWA 1D2OA 4NC1C 4HGKC 1UWEL 1Q9LB 3N0PB 1FJ1B 5FUZL 2B16A 5FV2A 3TFKC 2VLJE 1PY4A 1D9KD 1RIHH 1HVXA 1BGXL 2WHVA 4UQAA 2EDLA 5C7XH 1LO2H 4JR9L 2C9XA 4Y7MA 5L2KA 2XIIA 2EUXA 3FN9A 3WIIL 1HYSD 5DZPA 4TNVK 4AKQA 1A7RL 5CBAB 3KLSA 3GLDA 4HKJA 1MW1A 3FTYA 4WUUB 3JWOL 4GIAA 4ZUSB 2W0KA 5F88A 2B08A 2CLRA 5EOCL 4XBMA 2QGDA 2ITFA 3E8VA 1BP3B 5M94B 1WUZA 3OB0K 2WTPA 3OZKA 5HI3D 1QAWA 3CXFA 2N56A 2QADB 1SVZA 4FG2A 2IH1A 4OV5A 5BRQA 4OZFH 3UAAA 1JRHI 5T1DH 4CADB 3O9WC 5C07D 5IUCA 5FGBA 5IIEB 3INUH 1URLA 1LILA 4UTAH 2X9YA 3GXIA 1G0XA 3E8UH 1ZT7B 2VO8A 5CUSL 3LKRA 4JJ5A 3V5HA 5DA0B 4EMZA 3MV01 1LWRA 2ZKWA 4W9IC 5D1ZB 4DZ8A 4OGZA 5INCA 3LZNA 4N9GA 3FJTA 3IDXL 2N7AA 5DRZB 4NQCA 3LRGA 5C97A 4NO5B 2QKIA 4UBDC 3WNJA 1VZGA 1U8JB 2Z31C 4N0UA 3TZVC 1ZTXE 2NY2C 1OB1A 4S10A 3T8XA 3M8OL 3LEVL 4LRNH 2FT8A 3L2MA 1EMTH 3V0AC 1RAMA 1A6UH 2FB4L 1BVLA 3K8KA 3MLWH 4XMTA 2C26A 1ZVNA 1T7XA 2R2CA 1E5CA 1HXMB 3WS3A 1AGDA 1OAZL 5DURB 4TPRH 1BZ9B 1H6EA 4P59L 3ZQXA 2VCOA 1T1XA 3EOBB 1I1FB 1WGVA 4A68A 3NQKA 2C9RA 4EDXA 3GTNA 1IEHA 2WCPA 1UEMA 4AI7A 1HWHB 1R3IL 2W5PA 4M4RB 4Z3GA 2HRGA 4R4FL 4ZUVA 2C7UA 4TOYH 2Y1YA 4GMSH 1XEUA 1A7QL 5FW6A 1BQHA 1QRNE 3CJJA 4U1KB 5CD3A 1YEWA 2UV3A 1QSFD 2I26N 4Y5XC 4WSGA 1YEGL 4P2AA 5DVOA 5F7MC 5IEHA 3NFNB 3MLUL 5D5MB 3EJJX 4JNXA 1U6AL 2WKOF 3DO7A 1A14H 4N90E 4LQFH 3PL6B 1Z9MA 1BD2A 4P5TD 5FYJD 4HVBA 5EU7C 5A2AA 2A9BA 3QNXA 2NPLX 1VFAB 2AVGA 2ZD0A 4OZHA 3EOYG 3BWAB 3H6JA 1NICA 4WLCA 3V55A 3HG1A 2X5PA 1HIMH 2YBGA 1FNHA 2CO7B 3U1SL 2X10A 2Z35B 3EUUA 4NCDA 4L8BA 1FZKA 1A21A 1QEXA 4G9FE 3NFSL 3B34A 5GZOD 5I8OL 4A2MA 4EOWH 4I9WE 5BJTB 1RUPH 5FGRA 1RVFL 5GRJH 3I3EA 1WICA 4UQ3A 1RZJC 4G8FB 2BSDA 4JO3H 4LOUD 3GD1C 5L4IA 2LGNA 5MP6L 3MPCA 1PIGA 1U8LB 1XZ0B 4PS3A 5D7KD 5B1KA 5K1VA 4F9LC 1KPUB 2JWYA 2XWTA 1BV8A 1CI3M 5MERB 3RU8H 5E8PB 4Z7IA 1DUZB 5TQ0L 5C08A 1WG3A 3X17A 2J5LB 5AW4B 3IKCA 4R8WL 4MQSB 3WO4C 1B2WL 1NCTA 4DH2A 2Q3XA 2F54B 4KKPA 3VXUA 4K9EC 3HS0A 3Q3GB 1HI6B 3AG2B 3AG3B 4UNIA 5AVZB 3DUUB 1TDQA 3WTWA 2NSXA 4NM8L 3U6XS 5B22A 5LO7A 5IHHA 1FCCA 1FHGA 4NZTH 4YDVB 4CVXA 5HPMA 5GXBB 3N85H 1G7PB 3OLEA 2F5BH 4UM9D 5KSAD 3ABKB 3GM0A 2FCBA 1JNHA 1R1CA 1CF8L 4OB5L 4JG1L 1A9EB 1QKZL 5MI0B 2MWCA 5AVVB 3CFNA 3E7JA 5FIEA 1BLIA 2R15A 4YL9A 3LN5B 1EDQA 1UZ6F 1Q1PA 2CLVA 3HMXA 1TVHB 5AB1A 1QLEB 2KLTA 1L9MA 3VG9B 2PWEA 1OZUA 1P2CB 2JJTA 2G3NA 2NTSP 5T33H 5JW4R 1ES0B 4WY7L 4M02A 4ZFZA 3FQTB 3NA4A 3QXUA 5CGMA 1BAGA 4LSUL 4BQBA 1H15B 3K8LA 3EDEA 2LR4A 1Q9WA 2XG5A 3PY9A 2R0LL 2VGLM 4XAKD 4XOCA 5FUOL 1QFUH 1T20B 2NYZA 3BPOB 5JO5A 1GGIL 5J12C 1AC0A 2YC1A 4AC4A 3F2LA 4WEBL 4UAOB 3I9PA 3QJTB 3QAQA 4N5ED 5AUMA 4HWBA 4LP8A 3WFHB 2ZYIA 3HE7C 2XN2A 3BW9B 3ESNA 3QFJD 4J4PD 4KH9A 4R26L 5FYKL 3T1FA 4UM8B 4JO5A 1SBSL 3DX2A 4XBPB 4KX8A 1N2RA 4FRWA 4PLKC 4BUQA 4AIZA 3ULVH 4J8RB 1TKWB 2BDNL 2QQKL 4CKQA 1IL1A 5ERWB 1YEIL 3WJLA 1M6OA 2JKRM 1GXEA 2WLNA 3VD0A 3FYEB 4JZJA 2WIIA 2LT9A 1J5OL 3HG4A 5CHNA 4A38A 5IHBA 4H40A 5T5FL 5I75C 3WY1A 2X6MA 1IEAA 1S7UA 1XGRA 1M3IA 2P80A 4E5XG 2VDRL 4XMXA 4L9LC 3CZJA 3VFWB 5DHYA 3KH3A 2WY3B 4GG6A 3V6FB 3FN0H 2OMTA 2BNRE 3NQIA 5DTFA 3DX9A 4RBPK 1E4XL 2ADIA 2ENSA 2P1YA 1I1AD 1M9WA 3AS2A 3OZLA 4GAAA 5DEJA 5EIIG 4MA7H 4Z9KB 4RZCA 2FLBT 4WTZG 3E2HC 1LXMA 4K3EL 3T8VA 4NRZA 4KDTA 4YSCA 3CNKA 4UMGA 1S7TA 2HTKD 2KQMA 3NRQA 4Y16D 2FECI 4XP5H 3LY6A 1IGIL 1NCOA 3ATFA 1UURA 1LWJA 1WC7B 2GUOB 5LQBH 3FF8A 4FFYH 2FWUA 4D3CL 4IBQA 1S6NA 2NR6C 4ZW7A 2I32A 1QR4A 2CMRH 4KK6C 1UOWA 3CZLA 4LPXA 5GSRA 2EH8H 4AT6A 1I8KA 4IRZA 4ELMF 4F8LA 1OQOA 3TX4A 3V4UH 1IM3A 3B7SA 4P57B 5KUKA 1N3NA 4P2QD 4ANVA 3IFLH 2F61A 2ZKYA 4OD3L 4I3RL 3DJTA 1AHWC 1Z9LA 1SY6A 1YEKL 2VQUA 3GQFA 4CVZA 1TVBB 2KZKA 1XF3A 4PIRF 3SDDC 3TBYA 4PJ5E 4E9TA 3K6SB 5SX5H 4MD4A 3SOBH 4H8VA 2AQTA 2QDVA 1O7DE 3GTTA 4GKSA 4E5XB 4PSRA 1EEUA 4K7FB 1C16B 3N1GC 1Q0EA 2HN7A 4N0CC 4ZTPH 1F4YH 4ZBJA 1KG0B 1VAHA 1NFKA 2X3CA 3F7YB 4TUOB 1VFMA 2AABH 4P46B 4IRSA 3PYCA 3I74A 3K46A 3OMAB 3OG4B 4X4YA 2V2XA 4FNPA 2GITB 1UA6H 5HHPB 4ZDHB 2AQQA 5EIIB 3MBEC 4CUCA 3T3MF 3U9PL 1U8OB 3K2MC 4LLMB 5DYOB 4X7DC 4NFCA 1GY2A 4Y1SA 4DOHE 2BX5A 3DIFA 5GHWL 2QPDB 1KYOJ 4IOIA 4DN4H 3EJPA 5JQHC 3A4FA 4F24A 3KXFD 4YXHH 3U9UA 2JKIS 5L4JA 5HHXL 4K71C 3BD5A 4FXGC 3C08L 4S0TD 5IBTH 1INDL 1MDTA 3AQYA 4IDJL 5J3HC 4G1EA 2DQCL 3SBQA 3ILEA 5DRWA 2HRPL 3QEQB 5DT1L 2QVIA 1JGUH 3X3GH 3IDYB 3L4VA 5MENE 4DKDC 2XVBA 3MXWH 4GXFA 4LHUA 1L7IH 1JDDA 4L1HA 1HQ4B 5F8QC 4H13C 5IW3A 1KB5L 4MMXB 5DRNA 1ECYA 1V7ML 4JY6A 2IANB 3ZKXC 4RMQA 4UYQA 3EO9L 4C4KO 2FNBA 4YDLB 3IFPB 4KKZA 1S2EA 1UWGL 3O6FC 3NCYS 4Z7UB 1LJMA 3KLLA 4CW1B 3KGSA 5AKRA 2Y69B 1II4E 2ZX9A 3CK0L 3JT2A 4ZAKC 1R3JA 1KOAA 3OMIB 2Z93B 4Z7QB 4QHMA 3II3A 1A3LL 1TQCC 1SBBA 4IQHA 1UYWL 1CZ8L 1FIGH 3MBXH 5IVXE 2QLYA 1NFDE 4M5ZH 3MRGA 4NGHL 1T66D 2CLZA 4HKXB 3BVVA 4NSKA 4M6NH 1QO3B 3CZUB 3JQOB 3WD5H 2MKWA 4AYGA 1CXKA 1Z9SA 5DVLA 4U7KA 1PLAA 2ZZUT 2D0HA 4XRCB 4ZS6D 1SEBA 5CU9A 3QO0A 5J56B 4PJAE 4ZTEA 1PU0A 2XV3A 4QHUA 5DSCA 5MEOB 3TH2T 2B59B 3OHXB 3VCLB 4PVLA 3VXME 5E9NA 1BZ7B 5AZEL 1GAFL 4BK5C 2HJKB 2H0PA 3IDNB 1CL7I 4IIQA 5KS9B 2GVYA 2IQAA 4IOFD 4FFZA 2K45A 4L4TA 5DUBA 5CCGE 5D7JB 3TBCA 1L0YA 1ASQA 2ZAGA 2OR8A 1FGNH 3OLDA 4PMFA 2VZ1A 3C5ZC 4Y4KC 3WXWL 2VXVH 4OJFL 3JYCA 3MFFB 2WBJC 2H6PA 1JZ3A 3OKLA 2Z4QA 4YX2L 1PQZA 4UT7H 3ARGC 4IGBD 4MS6A 3X1NA 5ALBH 3H0TA 1BX2A 1LO3H 4HZAA 5AAWC 4DW2L 3OD3A 3IGUA 1E5ZA 2G9KA 4QO1B 4N9OB 2VDQL 5ICZB 4L5FE 2K6ZA 2VLJD 3AACA 4LVHC 3QQXA 4Q2ZB 2WLLA 5E6RB 4F5CE 1MRDL 4YFLI 1A3ZA 3BRGC 3GSXB 2IXQB 3TO4B 1EDYA 3UROR 1HC1A 1DJWA 1FAIL 1M7DA 1ZIBA 4M5YL 5E1QA 3V5DA 2EIBA 4HUNB 3RDTB 3V8OA 3UTSE 3TN0D 3Q7JA 4XCNA 4ANWA 1JPGA 3GTVA 1F13A 2R69L 2VDMB 3KJ6H 5JMRA 3G5YA 1E4WH 4TN9A 1BYPA 2GHZA 1N5YH 2OYPA 3WEBA 3C5JA 4JPIB 3QUKB 1C7TA 3DGDA 2ZCZA 4FNTA 5B4MC 4AG4L 4AMKH 5DXWA 1WK0A 3MA9H 3P3RA 2PP9A 2X2HA 5HJDA 2B5IB 4PRIE 3T2NH 5D7SL 3CDGB 4N22A 1Q9KB 2B0SL 2E59A 3OAYK 4OFVA 4XN9A 4WO0A 1OGTB 5JQIB 3WFZA 3NJVA 1AC6A 4PVMA 4K5MA 5GGUB 3TURA 5D2NB 1XIWD 5BV7C 1PEWA 3DX1A 3LIUA 3SDXE 4D9QE 4YSDA 2BCMA 4S11A 1MHCB 1BM3L 4NQSA 3PP3K 2MCG1 1YNTB 3VYOA 3B7RL 3LEXA 3QR0A 1UUNA 4LASL 3RBGA 1TSRA 3DX6B 4UINL 4M48L 1CLOH 2ZOUA 3DMMC 4P4KD 4HFWA 5IOPB 1AACA 3HPLA 3K8MA 4K5LA 5AW3B 1HCYA 3TIDA 4FHBD 3RWHA 4O2FA 4OU3A 1ORQA 1CXLA 2A2QT 2YA1A 2K70A 1G7LA 3S4SG 4KKBC 1QFWI 2BWQA 4ZJ9A 5SWZB 2XRAH 4A7QA 1ETA1 3WHXA 4DKFH 5FECA 4PJEF 4N3UA 4D0BB 3O8XB 4JGMA 2ADGB 1VGKA 3S36L 4YS4A 1ADWA 3FT2A 4Y4HC 3D0VB 3GMOB 4GT7A 4K5OA 3CFQA 1FHNA 3V0EA 4I88A 1XGQA 3L7EA 3CC5A 4JM2A 5D4QA 4IHOB 1TO4A 2K6WA 5C0IA 2ORBL 1YNLH 3MV8A 2XZZA 4Y4FC 4LSQL 4BSWA 3I6GA 1QRND 1XQ4A 2ZOLB 3II2A 1MLCA 2JB5H 2V2TA 4LBEB 4GNKB 1M9SA 1KJ3L 3ALXA 3BSZL 4JY4B 2ICES 4PRAA 2X40A 4RSYA 3RZCC 3QIUD 4Z7AA 3N1QC 4N90D 3IDMA 1WZ1H 1IGML 2D4DA 2GCYA 4Z0XB 5GRYA 2V4LA 3AT8A 4HA1A 1LO0L 1YY9D 5DUPL 3VRLE 3ULUH 4EEEA 2QQLL 1NSNH 2ZQKA 3CN1A 5IB3B 3T1WA 1LNUA 4UOW1 2P9RA 1JMZA 5FYLE 4OT1H 4QCIB 5E8OB 2H3KA 1X5IA 3VGFA 3O9WA 1S4IA 5I0VA 4K3DL 1OAKH 3N2JA 3GMMA 5AW6B 4HZLB 4L1TA 3KPNA 3OGCA 3SKMA 3IGLA 1K4DA 3L3HB 2IFFH 3S4SB 1FGVL 4ZMOA 4UT9A 2AS5M 4G9FD 3QCVH 3TH4T 3QPQC 2A4CA 4FZ8H 5JHLH 1D5XB 3L08A 4Y8AA 2NQCA 3BP6B 4I9WD 1I7TA 2PR4L 5C07A 3L9RB 3NJGA 2J71A 1FL3A 3II1A 3WFBH 4L1BA 1OAUL 1A0QL 4R0LA 4FOMA 4JKKA 2W88A 3MNWA 3D85B 3D30A 2J1XA 4H8PA 1KXVC 5ITBH 1E27B 3FULA 5DD3H 3HC0A 3W56A 4PP1D 4FA6A 4RETB 1N8ZB 3BIAX 3A5VA 3LSOB 3THMH 3VGEA 1U33A 2NZ9D 5EO0A 3MNVA 3AWGA 3EG9A 3RPIB 1KCUH 1G6VK 2IOIA 3BFWA 5DD0L 4TUKH 1LDSA 2WP3O 2CR0A 3U48A 1XEDA 3NEEA 5I1DB 5E56A 3EOTL 4YHYB 4LEXH 2QSTA 1LK3L 3LKQB 4H0HB 1F6FB 3QC6X 1GMIA 1T4WA 3MRMA 3CWGA 1T2QL 4P23B 2W59A 2YPLB 2ENPA 4PJ7E 3KPPA 1HINH 3G7TA 1GYWA 4QXTA 3GHBH 4XWGL 5D7IF 1X3DA 3FQWA 4OKDA 3MV7D 1DSYA 2CALA 4HGWA 1VZIA 2DLIA 4LP5A 5HGAA 3KCPB 3FAXA 4DERA 3FU6A 2V8MA 4TS6A 1C7SA 1AY1H 1QSFA 1QLEH 5A6MA 1B0GA 2X88A 4UQBA 5K9QI 2NY7H 2O4EA 5C0BE 1FRGH 1FYTB 1ZSDA 4P5TA 1IBDA 1A3QA 2VAJA 3MNDA 4ZMPA 3MRQB 2PYEB 3FOMA 3C6SB 4JQIA 3QORC 4RMTA 1JF1A 1FNSL 5CZVL 3DRQA 5EEZA 1BMWA 5JW4M 3EGXB 2V8LA 3CFCL 3E1ZA 4QRQA 4BH7A 3VFSA 1LE9A 3OKNB 4PY7B 1XH0A 2NXZB 5ENWB 1CE1L 3T2QA 2E8YA 1RUAH 1MJ7L 5F89B 3B7TA 4BCZA 5LN4A 4MQXD 3FH7A 5GZOA 3CHXA 2AQRA 3U0PA 4GXVH 4JQXA 5DLML 1OIOA 3CPLB 1ZV5A 2X0WA 2KH2B 3PGCB 1K2DB 5BVJB 3GZOA 1J9SA 4MQTB 2WZ5A 4JKPH 1QWHA 3BDYL 4N5UA 1DQQB 5E2TL 1QVOB 4L0YA 3SYCA 1OE3A 1NGPH 3OX8B 5KBPA 1BM7A 2EVIA 2BNRD 3QIBC 2MNJB 4P5MB 3MCLH 5AW0B 1MW3A 4AYEC 4J23A 1IBGH 4HJIA 4FQ1H 4I48B 1N6QL 2ZAHA 4DGIH 2XBTA 2Y7QA 4RQQA 1MIEH 2K7PA 3V7AG 3FTXA 2YAMA 3WEXB 3RQ3A 5EU5A 5GQBA 1D6EA 2E4TA 1J9QA 2EDRA 1JNNH 5IF0A 4UM9A 3IVKA 3RTQD 2XX0A 3CSYA 3S9DB 1U93B 1H9VA 1YYML 4W4NA 1QBML 1AXTH 4IJTA 3TEWA 3SDYL 4YZFF 5IKCB 1OSZB 4PJFF 1NBYB 4YSAA 4X6DF 1DN0A 5FHBL 1FFTB 1SXSA 3PU7A 2ZPKL 4PJDA 5DD6B 3V4VB 2B7DT 1KTLA 3T0EE 4P3DB 5J6HA 1IM9D 4N2HA 2CAKA 2O30A 1TQUA 5LCVA 4FX5A 2AJSL 2MHAA 2EDEA 5JPMB 5AYTA 2M8XA 4KDWA 2FYYA 3RAJL 4PFEA 4JZNA 5KVGH 2VSKB 4HUCA 4HWUA 4PJBF 1CLVA 2AI0H 2LTQB 4GAGL 4TF4A 4DPBX 3QFJA 4J4PA 1BZDA 4PTTB 4QRAA 4R7NA 1GH7A 1NFIB 3WKNA 4PJXE 3RWJB 2ZKHH 3HZ3A 5IZ7A 4GQ9L 1OANA 1NCCL 2GQHA 5D7LE 2OV0A 4RVBA 3WKQA 4KROB 5DZNA 5I16A 1LEKB 3MX0B 3FNKA 1EQWA 3B5HA 1GMEA 4JN1H 1QLFB 2CK0L 4DVBB 5FDWA 2FD6L 1MZYA 1XR9A 3NZUA 4I18B 4KK8C 3QDGE 1OARH 4L18A 4C59B 5MEND 1KIQA 3CGTA 2X4NB 4EXPX 1S5HB 4X6EA 3GMNA 1U9KA 2RB8A 4FQXB 2YZ1A 5CXPA 1FH5L 5C09B 3RILA 5IW6A 4PJIF 3NBNA 4URKA 3X13B 1T22A 5AB0A 1GKEA 1HWWA 1NLBH 4AJVA 5FGCB 2X1WL 4P0DA 2HRHA 4KKLC 3C60C 4X9FA 3RJOA 4BHUI 4HWEL 1I1AA 3B8SA 5I15L 3QULB 2VRKA 5I5IA 4MMZA 4IBVA 5HPOA 1FVCB 5GGVH 1CDIA 3Q2CA 1O5DT 2H5UA 2WYTA 2X2JA 2G5BA 3V7MA 2Y5TB 1FN4B 1A64A 2JE8A 4PS7A 8FABA 5KZCB 1RXLA 2B8OT 4LEEA 1J8HB 4LEOA 3RI5F 5B1CA 3NPSC 3QUYB 3UDWC 2OMWA 1L0XA 4Y16A 3L48A 4HIHA 3S96B 3ZZ1A 2NXYC 1Q38A 3UTPE 5TF0A 4RGNB 3FQ2A 2DRUA 2GJ6A 4PJGB 3MREA 5GPRA 3ARUA 1J0KA 3ATEA 1AHWA 3KVPA 3P77A 4YC2C 1ANUA 1OOWA 1UD4A 4YHPA 3QI9B 1MCWW 3O2DA 2EIKB 3ILQC 3BVDB 5IHWA 1JXGA 3PDOB 1X7QB 1YAZA 4FEMA 1DQLL 3BGMA 4WNJA 4BE5A 4NC0B 4P2QA 4TTDC 1JRHH 2CIIA 3LZRA 4Z3FA 1QOKA 4LL4A 4GP8B 1T2JA 3OQ3B 3WNPA 1TU2B 2CGZA 3QA3B 3VXMD 3HPJA 4IU3A 4JVWA 1TTRA 3IJSB 2VLRD 2WBKA 2NUPA 2I27N 2GTWA 3L9EA 2R29A 2A1WH 2IQ9H 3TBSB 1NEUA 3L3GB 4XMZA 3VGAC 4ZSOE 1TZAA 4XVUD 4XXCA 1MPAL 1BW8A 4TSAL 5SX4I 4DO4A 1BZQK 3L3DA 3K4ZA 2AXGA 2WM0A 4KQ3H 4BKTC 3WE1A 3DPDA 5HDOA 3VXSE 4FXGA 5J1SC 4LIQH 2CO2A 2H47C 2X1QA 5T3XH 5IMKB 2VR9A 5DFWH 1LEIA 1LK2B 2BLFA 1IIIA 1YEDB 2C9VA 3L9YA 5DD5H 5EBMB 4AMWA 4M6OL 3T9WA 1V5JA 1J9CT 2K0RA 2X4PA 3KXFA 1U8HB 3Q1SL 4PB0L 4JPKH 1MCOH 4JKWA 4A2DA 4X0KB 5E00B 1X5FA 2KS0A 4UT6H 4KO6A 5ITFA 2W60A 4JFQA 3TA3C 1TF4A 2OMVA 3IDGB 4U1HA 4YLCA 5DMKB 2FEEI 2VDKL 2NY4B 2OJEB 4HJTA 3KL3A 3RZWA 4OFYD 5F7HA 5EC1B 3UTSD 4A39A 4DPAX 5JYMA 4LPUA 3KYKH 1U8IA 2ZYHA 4FHKA 4YFDB 3EYUH 4OFIA 4TULL 4CSZA 4DP7X 3CZEA 3S36X 3TTSA 1RH8A 1TT6A 1XR8A 1EA9C 1EAPB 3GSQB 3VFMB 2KT6A 4YBQD 4ZFOL 1D2PA 1YPZE 1ROCA 3S35L 4XC3H 1F00I 3M7FB 4I3SL 2E7DA 4LOVA 4M5SA 3TBBA 3FSZA 3U0WL 2VDMH 3DVGB 3BAYA 4CMHB 5AZ2L 2WLHA 4J3OF 4PRID 4PYHA 3GGWB 2DJ4A 4DEUA 1AKJD 1C8QA 1FE8H 4HXAL 4G71B 4H26B 3IXTB 4QHKI 2A9NH 4D9QD 4W9GC 1YN6A 3S3PA 3UYPB 3AITA 4X7CC 4F1ZA 3ULVC 1A4JA 5C2BL 1KTDB 1RIUL 3ZDXE 5PAZA 3OSVA 1RK7A 5I74C 4NKMB 3GMLB 2VDRB 2EEFA 2J8UB 1EXUA 3BWUF 1T83C 5DFAA 1MUJB 1CK0H 1RZ7L 1JS4A 2FX9H 2HYMA 3P3TA 1YHPA 3FUMA 4FXKB 4JREC 1WA2X 3QJHA 3ZIYA 2MQCA 5J6GA 4KJWC 5C0DB 1SXBA 2HT4C 1HAWA 3WN5B 5B39G 1VACB 2E7CA 1MNNA 3D33A 4X8GA 1WBXB 5DR5L 4RRPM 5ISZB 3CHQA 1MFBL 3SZKC 4NO2A 4K7PL 1TZOA 4LSSH 2IGFL 5DMGC 2AC0A 2JCCF 4ZQTA 4E0RA 2EO9A 4A6YA 4O9HH 3ARBD 4HS3A 4KJPC 4IGBA 4Q8BA 5HBBA 2WSDA 3HR5A 3SE4C 4L05A 2WXQA 2Z0UA 2CBOA 2SEBB 3LNEA 5DJ2B 2JLLA 1NA8A 1WFOA 2VYRE 4LLDA 1FG2B 5E5MA 4L4JA 3WO3B 4AIOA 5TF1H 2ZXEB 4LAJH 3GRWL 5KJRH 2VLJA 4N8VG 4JG0L 5DD1H 3S6CA 5DFTA 4JN2B 4P06A 1S7QB 1BVOA 1MJUH 4CBZA 1T0PB 4DGYH 1WWWX 2FJSA 1YECL 4MJJA 1D5ZA 3BFQG 3MBWB 3LH8A 1YY8B 5GS1B 1MCLA 3D18A 3P9MB 1QBLH 5FYLD 3TN0A 2JJSC 1KZQA 1TR7A 2F74A 3ETSA 2DI9A 4D9LL 4NQDE 4KI5C 1RZQA 4MJ6B 3FKUS 1MHEB 2BY2A 4P5KA 2R0KH 4G6JL 4HX1B 3FB6A 4UB0H 4APQB 3QNZB 1S9VA 1OAYL 2L7QA 5B39B 1ZGLM 1CR9H 1KGXA 1KLFB 2XXMB 1T7WA 3P4NB 1Q90A 3AW5A 4ZODA 1JK8B 2FJGA 2IVFC 2YD1A 2Q3ZA 1OP9A 3ESVF 1ZMYA 2EYSA 1P4UA 4FTVE 4N2OA 5IGXH 1PYWA 2E6PA 5KSUA 4ABVA 1XIWA 3PREA 3STZB 3GSRB 2H1PL 4DO5A 3MJ7A 3X3FL 3P3SA 5B3JE 4G6FB 2NSQA 3FW6A 5DWUH 1RJCA 2R2EB 3A47A 2ISDA 3B9DA 3VXOA 4HGMA 3SZ6A 2A0LC 4HJSA 5LGJB 3ME0A 2DMCA 2BIMA 3DX8B 3QG7L 5F71A 1G7HB 1AZNA 3SYAA 1SUJA 2YA2A 4AEEA 5C6PB 3TLRA 1YMHB 5TDPA 3WNMA 4P4KA 4BFFA 1J0IA 3AMLA 2WJ7A 1WCBA 4N8VB 1IE4A 3SIKA 3SQBB 1U4EA 1AKPA 2OA9A 1FQ9C 4MMYA 2VWEE 4Z5RB 1IUZA 3VXPA 1GGBL 4KV5E 2DOCA 2J3SA 5IEKB 1AD0B 1CTOA 2G3MA 3JYBA 4OD1H 1GZPA 1FL5B 2OAAA 1KUMA 4ETYA 3L54A 3PIQB 4KKAC 4F9PC 4KK9D 1RURH 1WZAA 3B37A 2JXMB 4XNXL 4Z7VF 3SDAD 1JN6A 4GKZA 4F58H 2EYRB 1ZK9A 4MDIB 5I73B 1TJHL 4BA8A 5ADPL 1PD6A 4RFNB 4W9ZA 1ZHKA 3IF1B 1TMQA 4M6AA 5IBLC 1QRNA 2VR4A 4PMEA 1A9BB 1TCRB 2I5YH 1Q8MA 1G0DA 2QTVA 5T1KB 3LXBA 3VB9A 5CR1A 5IWLA 3RA7H 2GUYA 2VZUA 4KO9A 4N87A 4Z7WF 1SM3L 3L4YA 5AG9A 5C0BD 1NCAL 2AJVL 5J4MA 3QIUA 3DV4B 4AQ1C 1JGLH 3ARWA 1ZS8A 1JXFA 5JMOC 2MNUA 2Y1ZA 1J10A 2F8IA 4LCIH 4Y5YC 4TSBL 1VF5C 4NN7B 4JFYA 3CDYA 1T5WB 4OFKA 4FHJA 3VFVB 4LLVB 1R5WA 3LHPL 2JB6B 4JY5H 2DYRB 2IO5A 1I7RA 1MQKH 1G1OA 3MYJA 2XXFA 3VG0L 1BJMA 3JWNG 3O41B 1X9RA 3ARVA 2HLAA 4G9FA 5D8JH 1E9OB 1TENA 2EEBA 4LGPB 2FVNA 3WENA 3Q01A 2NY0B 2P8LB 1DO5A 2Y07L 5IMOA 1CLYH 2ZKMX 2DF3A 2J6WA 4M61B 1FO0A 3GSNB 5BVPL 1AQHA 1EZUA 1EHXA 5A7EA 5ACZA 2O6PA 8CGTA 1A02N 4XBEL 3QH3A 4HMCA 4IK7A 5D4HA 3ZDZE 2E46A 2R56L 3U7YH 1QA9B 2XQYA 3MLYH 5F9OH 3LZLA 2ZG3A 2Z65C 2OL3L 3Q2LA 4DP5X 3CZSA 4ZUTB 5B8CB 1ZPLA 4GRMA 2GT9A 1EO5A 1WAAE 3I6KB 2Q8AL 1A6ZA 4JRXD 4XODA 4TV3A 3L4UA 5G4MA 4PIBA 3QEHB 3WIIH 1BQSA 1DZ0A 1KJ2A 3S5LA 5HP5A 5B3NA 3KPRB 5C3TA 2YPVA 2PW1A 3F12A 1CDYA 5IFHL 2NLJA 2P5EE 3Q48A 4XP6L 3NIFF 1AR1D 2XVKA 4FFVD 4OLYH 5CFAA 3ARZA 5CBEA 4PJHF 3D3VE 1J1OL 2Y24A 4ZMAT 4JRWA 3O2VH 4YVNA 5CCKH 1UZ8A 3MV7A 2C1OB 3O2WL 1PNDA 1KWGA 5AB2A 2BRRL 4TLKA 1IGYA 2CJSA 1LQSR 3T0ED 3QORA 3JTSA 1KJVA 4QF1A 4F33B 4RFEB 2BVYA 4Z1PA 4CNIB 5GS0D 1AI1H 3F7QA 3V4VH 3REVA 3MACL 2QADC 2F9BT 2R2BB 5C0AB 3VSQA 3PJLA 4FQLL 3QCTL 4KKCC 1RZFL 4EVNB 1NMBH 2QGCA 2NW3A 4WI9A 4YHLL 3RVTC 5FPIA 3VI4E 5D1ZC 1IC4L 2L3BA 2EZ0C 5BRPA 5IR1B 1UA3A 3D4ZA 4NBXB 3P0YH 1ONQB 4JFFB 3RVWC 3U7AA 5IB5A 5D7LD 2FB4H 2DQFA 4ACTA 4KTGA 1L5GA 2VQTA 2ZUYA 1SRDA 5ES4B 2F53E 1VA9A 2ZX6A 2VRQA 4K4KA 4URTB 4WKZB 1UB5A 3KBEA 5EU4A 5ESVA 3MKGA 5DHVB 1T3FB 3QDGD 3C2AL 3MAWA 3NTCL 2ZXAA 4NPYB 1TJXA 3FUDA 4O02A 2X44D 2K9FB 3SCMC 2DEWX 4R4FH 5EZOH 3ESOA 2ITDB 1G9HA 3L5WB 2BNRA 1IC1A 4I87A 4P4RB 1DEDA 3DYPA 2Z1KA 3MOBH 4P9HL 1MJ8H 3PS6A 4GXUN 3RWCB 5M7QA 3ZBMA 5HVFB 2ZUUA 3NG5A 4JG9A 3SGJA 15C8L 5IMMB 5KSVA 5GS0L 2BY3A 1KCSL 3VXRE 4B5EA 1JPEA 4N8UA 4JHUA 1TTGA 1CD0A 3EAKA 3JVFC 2F6AA 3T0AA 1BIIB 1UM5L 3N9GL 1ZY9A 3RTQA 3IU4L 2X70B 2IBGA 3UTPD 4N2NA 4PWKA 2Z3FA 1RU9H 3LRSB 5K33A 2OTWA 5JLZB 4Q9QL 4XMKH 1PL3A 3PL6C 1O75A 1D5MB 1TEYA 4JCLA 5IP4A 1HILB 1P4BH 1J8RA 4LKXB 1MHHA 3MTXA 1NCGA 5I1HH 4HDIA 4JUTA 1NLDL 3NFSH 1XGTB 1HKLH 2N59A 4N2FA 2AHIA 4J1UB 1E30A 3CVBA 1KYDA 4WW2C 1UJ3A 3IFOA 2Z6FA 3VX0A 4KO5A 1IM9A 2OW7A 4I13B 1PY9A 5LDSA 5DJ8B 2X6VA 3NJMA 4PJ5A 1TNMA 3HRZC 3OKKB 3AREC 4GYBA 2D7TH 5KSBB 5E5RB 4AV0A 4J8QA 1CXHA 2J5WA 2OP4H 2MPVA 3HI6H 3LKSA 1F97A 2E9JA 3IMWA 1JHTB 3A21A 4P48A 1EH9A 5TGBA 3VXSD 3J2PA 3VWJD 4GY4A 3QRGL 4KJQC 1MOEA 3FUNA 3NAAH 5KOMC 1BF8A 1NL0H 1V7NH 2YAOA 5DHEA 5CP7B 5GRWA 1HOEA 4TQHA 5C1MB 3VI3E 4XWOC 3BPCA 3FTSA 2OZ4H 2HFEB 4QTIL 2DD8L 4M93B 1CF8H 4JG1H 2DWSA 5F1KC 2P8MB 2BVQB 2KI6A 5I1LA 1EWHA 3ZYOA 2YBRA 2HX7A 3DTXA 1SHMA 4PW4A 5MENA 5F1OB 1OK0A 4HF5H 2FWSA 5JNYA 3OAWA 3L17A 4MQ7B 4F7TA 3U7WL 2K3HA 3FCTA 2EEXA 2BNQE 3BKML 4KTYA 4FADA 1UD3A 4Y5VB 2VSMB 3UACA 4DUWA 3BT2L 1WTGT 2HLEB 4QOKB 3ULSB 4LNVA 2AJ3B 4WAFA 5I0YA 3ZN6A 3SSGA 4QR7A 4CMMB 3DXAB 4KTDL 4PU2A 5T3ZD 1CQKA 5KANG 2QELA 1A7BA 3IJHA 5H94A 4DGUA 4S1SH 4JFDB 4WEBH 4BQCA 5HYFA 3QPXL 3CUPA 5IVXA 4YSOA 1NFDA 4X5QA 1N5AB 2R0ZH 4FNLL 4HEME 5FYKH 4WEMB 3VW3L 4XX1E 3H3KA 5DI8B 3GS0A 5DK0A 4CDGC 1J8SA 2Y22A 1BQRA 3BGAA 1DO6A 5E6ID 4UAOC 1KN2H 4X5WA 4W6WB 2NY1B 4MSWB 1YEIH 4PJAA 4M62L 4P8QA 3S8GB 1NC2D 4L4VB 5LWYL 1T7VA 1KLUB 2IPUK 3H6AA 3UL4A 1RCYA 4CKVX 5KTEL 2XZAL 2DM4A 2DL9A 4PAZA 5GGTA 4I5BB 4GI9A 3VXMA 4AE0A 4NAJA 2J88L 3EJYD 3OKDB 4S1DC 1JV2A 1EFXB 1P4LB 2VDRH 4ZMZA 2GJRA 5FHAH 5JIIA 2Z34A 1IKOP 2JJUA 4OIIL 4P5SA 5FOJA 4JM0A 4IMKA 4NKIH 2ITCA 4PEEA 4RX4D 1AE6H 1QR1B 3HZKB 1UC6A 4G1MB 4EKJA 3HZVB 3S37H 1JNJA 1FDLH 1QACA 2AQ3A 3HLAA 4ODVL 1NOAA 1RZJL 2HA1A 2FL5A 5T3ZL 4MD0B 4OCWH 4WI0B 2F1EA 2OJZH 3L3JA 5KVEH 4XPFL 1T04B 3KYOA 3WIHL 4EI5D 2E76C 3LZPA 4JLRA 1E2VA 5JR1L 4WFGE 1EUUA 2ALWA 1OO2A 1CFSA 1ZKAA 4YEFA 1A6VH 3AQDA 2A74B 3OJ2C 3Q8BA 1A5FH 5CMAA 4YAQB 4F5CA 1EK3A 2Q7YB 5EBWB 3ZKNC 3I50H 4OY9A 5HHVH 3MLPA 3APFA 1SVCP 2J1ZA 3NA9L 4OFYA 2VC2L 4RNRA 3UTSA 1EGJH 3T0DA 4FFWD 2MCAA 3QJRB 2BHUA 2O5YL 4N0YH 5H2BB 4NQDD 4G43A 2BIOA 1YQVL 3BN9C 3H2QA 1JV5A 2B3IA 4YN3A 5JIQA 4HKJB 1M7XA 4PJ8D 3TBWA 2XPGA 1RJLA 3VRIA 5F88B 4QXGL 3ZTNH 2CLRB 1LO5A 5EUOB 1JWSB 4PRIA 1IGCH 3PFUA 1GPOL 2ZSVA 1AKJA 4FTVD 4G8GB 2GY7B 5EPMA 3W81A 3U9PH 1OKEA 5HYQB 5I24A 4ZXBC 1ETJA 4OV5B 3SDXA 1BQHG 4GPVA 4P46C 5E4EC 2G0KA 3GKWH 3HEIB 4OF0A 4FLQA 3SB3A 3KVDD 3OWEA 2BY0A 5EF0A 3LKRB 1I82A 4JJ5B 4D0DA 1L3WA 1INDH 2VZ3A 2R9HC 4IDJH 1XBDA 2PPFA 3M1OA 1IX2A 1ACYH 4DZ8B 1JUFB 5INCB 4N9GB 4WWKD 4NQCB 1UKTA 4WJG3 1EZVX 2QKIB 5KWYC 2AQ1A 4AJWA 2OQJA 4N0UB 4DHLA 3F05A 4PY8J 1NFAA 3BKJL 3BSGA 4YIQB 3QDHA 3PRZA 1OB1B 1DL7L 1K9TA 5F9AC 3T8XB 1SHXA 1E5BA 3IDYC 3ZX1A 2IH8A 1UWGH 3QXWA 1VSCA 1DQTA 3ARBA 2VWEC 4XNMA 1BVLB 2XN0A 3OV6A 4UOJA 3ABMB 1I9JH 3TV3L 1MFEL 5BOPA 4YUEH 1AGDB 1ICTA 4MGXA 4YDLC 3LIZH 1UYWH 2EKSA 1MFAL 1T1XB 2Y2TA 3AY4A 3EBGA 3KDPB 5GGRY 3S3BB 1JZEA 4EDXB 3GI9L