4BUQA

Crystal structure of wild type fimh lectin domain in complex with heptyl alpha-d-mannopyrannoside
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Cell adhesion
molecule keywords FIMH
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4buqA00
4XOBA 5AB1A 5FWRA 3SQBB 4ATTA 5CGBA 4AVIA 3RFZA 4CSTA 3JWNG 5IQOA 3BFQG 3MCYA 4AV0A 2JMRA 4AUUA 3ME0B 5FX3A 4AV5A 4AV4A 2JTYA 3BWUF 4BUQA 5FLUA 1ZE3H 2J2ZB 1KIUB 2WMPB 1TR7A 1N0LB 2XG4B 1KLFB 4X5QA 3JWNH 1UWFA 3BFWA 4XO9A 1N12A 5IQNA 2XG5B 4XOEA 4AVKA 5AAPA 5ABZA 5F3FA 4XO8A 4X5RA 4AVHA 4X5PA 2UY6B 4J3OG 3ZPDA 4AVJA 4CA4A 4AUYA 4XOCA 4CSSA 4LOVA 4AUJA 5LNGA 5FS5A 3ZL1A 2W07B 4XOAA 5LNEA 5AALA 4XODA 1PDKB 5JQIB 3JWNE 1QUNB 4J3OH 2UY7B 5IQMA 4J3OF 3ZL2A 2VCOA 5F2FA 4X50A
chains in the Genus database with same CATH superfamily
1G9NH 5B22A 1L6ZA 3SKOA 4ABWA 2WJ5A 2X53A 2B1AL 3U1PA 3QA3B 3D25A 4DETA 2HT2D 5BRZE 5IEHB 1AQKH 3QIBC 2KDYA 4OGZA 4K3DL 3ESMA 2YD8A 3CZGA 1U8QB 2YPLD 1YY8A 4GRMA 2Q6WA 3I3DA 2J72A 3PHQB 5SWZE 4ZO6A 3UTQA 3JWDC 3QJSB 3VFPA 2BY2A 2XA8H 4AEIH 3WU1A 3WLWC 5F6IB 3PG2A 4HUWA 3TN0A 3VXOB 3LCYA 4FL4B 5I71B 1KY6A 1OSZB 3H3PH 3QNXB 4K5MA 5DSCA 3PP3H 1DE4A 3FK3A 4X7TA 1H3XA 2ZWLT 3P0VL 4PI0A 2OYPA 2FEDC 2DKSA 3TBSA 4AMWA 5LVEA 4B95C 1MNNA 5DJAB 4HBCL 2GVYA 4LCWB 4TF4A 2FX7H 3PPSA 4WJG3 3VG0L 3TCTA 2VLJD 3T09A 1P69B 2GTWA 3MROA 4TRPH 1J12A 3IDNA 2EH7H 3NZ8A 3T6XA 1MW2A 3LY6A 4GG8B 1I9JL 1I8KA 3O6LH 1KENH 3X1GA 2COVD 1EEYA 2XTJC 2YMTA 1CLVA 1VF5C 1OSEA 2BVTA 4UIKH 5K9QG 3NQKA 1QQDB 5FUOL 3TPUA 5JR1L 4IBLT 2YA0A 3AWEA 1ETZA 2Q20A 2WKLA 3W38A 1TVBA 4KVCH 4ZJ9A 4PRID 1JBJA 3O0RL 1P7KB 5DWUH 2HJKB 1WFMA 1FHNA 3ZKMD 4ELME 5EIIG 3HG1B 3KLHC 1A47A 4YDNA 3V6OC 2WYTA 1Z6JT 1DEEA 3NK4A 2AXFA 3ZTEA 4GW5B 3QUXC 1NH6A 1KNOA 3FQWB 5FGBA 4XVSL 1MZYA 3RWGB 5I17A 3MRQA 1BZ7A 1D7BA 4X80H 5DRZB 5C08B 4FMFA 4KFZC 4AYID 3KG5A 4PJ8A 3FHQA 5IJKC 4W9IC 3ARDD 4ZPVA 3H9HB 5EN3A 3R7QA 4I2XB 1BOGA 3U0TB 1Z9PA 3MRCA 5A2CA 4S1RL 5CP7A 4BKLB 2QKIB 5E6ZA 3CC5B 5ITFB 5IB1A 1T3FA 3FFCB 1IJ9A 1DQLL 4H0HB 2PETA 3HHMA 3GO1H 1JD7A 1MVYA 4HT1H 2YMXH 4HK0A 3G6JF 4Z7NF 4C8XA 1JNJA 2VXSH 4BM7A 2RR3A 5KSBB 4JHWH 4OLWH 2KI6A 3QIBB 4X7FC 3FC8A 4FZEH 4IRSB 1OWRM 2R2HA 3ZZSA 4DPAX 3O3EA 5T1KD 5JW4N 3NJFA 5DC0A 2FGWH 1ZTMA 5BO0D 3GBDA 3LTVA 4R4FH 1M05B 1ZHKA 2EDJA 3HPLA 1Z2KA 4GSRA 1JFQL 1ZGLB 2XN9B 2OR7A 3B7RL 4GS7C 3HAEB 3Q1EA 2X4NB 2A1WH 4YLBA 1CTNA 1P4LA 1Y18A 2PTTA 1XGUA 5AENA 4QI3A 2IWKA 4PRHD 4D7BA 1V3MA 1AKJA 5ID0A 3UTSB 1ES0B 4FJ6A 4F1ZA 4NZUH 2Q2LA 3MXWH 1AQ8A 3GMQB 5I2IA 1KJ2B 4ONFL 2J56A 1QATA 5BUGA 4FF9A 3HTLX 2JJUA 1AD9B 4ZMZA 4HJUA 3U83A 1DLFH 2PP7A 5DJ8A 3BDYL 1YVLA 1WFNA 1HHIB 3R8QA 4JFVA 3G5VA 3COOA 3MLVL 4IRSA 4LVEA 1G1CA 3MLWH 2DI7A 3OX8A 4ZNEE 3NZSA 1HQ4B 3SDXB 1ZVSB 3QUYD 3WUZA 5C0BE 4ANWA 4U1GC 5JIKA 4PJBF 3V4PH 2KLTA 1FAKT 5IP4A 1Q0XL 1W0VB 2ITEA 2DQJL 3IDXL 4WZ9A 4PSPA 4TUJB 3VSQA 4EZLA 4WTQA 3UEZA 2FT7A 4KXZI 3EH1A 4OI9A 3VXRD 3O3UN 2DEWX 2R2HB 4FAAB 1T1XB 3U7YH 3N50A 3KXFB 1HCFX 1RVFL 5AL8A 1E90A 1RIHL 3IJYB 4M9PA 5D93B 2A5UA 3PNWB 3SN6N 4JPIB 1QRNE 3DX8B 1K6QH 5JUEL 3CFEB 3QJHB 1EFQA 4B96A 2G9HA 1JWUA 4W93A 2X38A 2QPSA 4XPFH 3D4ZA 5IB1B 1J5HA 3UMNA 1CO1A 4K94L 5F1OB 1HINL 4JHBA 4K23L 3BSHA 4K5LA 3QWRA 4TL4A 4P5KA 3ZL4H 4ES9A 4ETQA 1M7IA 4M7ZC 2NR6C 1W0WA 4ZQKA 4X8JA 3QUZD 3D69B 3R7RA 4BBWA 4LLMA 4XR8C 2LVEA 1M71A 2FZ3B 4XTRC 4AYBA 3PFQA 4FQLL 5IK3A 5IESL 1UXLA 3C08L 1HFUA 4JO1L 2OPCA 5HHOD 1KZQA 2K3TA 5F6HJ 2R2BB 1OL0A 5JW5A 4BH8B 2ADIB 2C4XA 4X4YA 4RMUA 4Y5XA 4FFWC 3X1FA 4PVMA 3AGWA 4P2OA 2E4FA 1I4FA 2H7WA 4P2RB 4YDJB 5T3ZE 1X5HA 1RZPA 2CBPA 2F5AH 5AVQB 2D7TH 1RIVL 3L7FB 5F7YC 2ENYA 3TT3H 1OSZA 4OZHF 2JCCF 2X9YA 4LLWB 1EEYB 1RHHB 4XVSH 5IFJA 4UT9A 1CDGA 2DM2A 3K91A 2DYPB 2FJHB 2ZKMX 5L2KD 3LNDA 4L3EB 2Q6WB 2H6PB 4WFGD 5IFAL 1AMYA 3T2LA 1U8MB 2BP8A 3VXME 4M5YH 2J1XA 3ZZQA 1ZHLB 3FB8B 4M8VA 2XLLA 3B2MA 2PN5A 3WY2A 1I7TB 1KIUB 2BNRA 2Q3ZA 3W0WB 2V0AA 5LB1A 4H8HA 2KC0A 2XETA 5K1VA 3HS0B 5JDSA 2OCFD 3U79A 1CR9L 1Z0MA 3QG6A 3E80A 3GZOA 4G6MH 5J1TC 1HHHA 5HVWA 3V4PA 1ND0B 1PZSA 3T2QA 2XVBA 5KSAA 5GGUA 2YA2A 5I1CL 1JXJA 2WQAA 4DSYA 3DPBB 3LRSB 2NZIA 2DQFB 3I9GH 2OQJB 1VGKB 3FSOA 1JZ6A 3EJZC 3VFSB 2Y7QB 5T33H 1S8DB 2E8YA 5F88B 4YXKH 1FVDA 1GGCL 3SKNA 2ICWB 3ECBB 2J5LC 1NBZA 3JUZA 4M7LL 4A63A 3C8KB 4M5ZH 1Z1WA 1J86A 2XKUA 2WGNB 2XVGA 5E6IB 1X5YA 4MCYA 2WB1A 3KPSE 4PV8B 3FL7A 3VACA 3CH1B 4EIUA 3KPRB 5L2JA 5CBAA 4F7CB 4DKTA 5I6NA 3TJEH 1C5DB 3L3DB 5EFIB 3DUSB 4R8WH 2Z31D 2W0PA 4N2MA 4Y5VB 1XQ4A 1AGBB 3UBXB 4GUQA 4DCQB 3ZHLA 4R0LC 5F0MB 5IMMB 1HHGB 2Z92A 3W5NA 4HWNA 4P2QB 4W9GC 1YY9D 3EXJA 5IBTL 2JV6A 4NNXB 4ZNEA 1IIIA 2RQEA 3QG7H 2O6FA 5EG6C 4B0MM 1HHKB 1N5YL 3G5XB 3V5KB 3VFMA 3EFDH 4FQIH 4X4XA 2WYIA 2ZP9A 3QQDB 5FR3A 4MD0A 1VFBB 4I85A 3PABA 1F8TH 2R0KL 1DVFC 5JDJA 4DERA 1O5DT 1WF5A 1GL4B 1UJTA 5SWZB 2X6BA 3RHWK 2QLYA 4UDTA 3MV01 4JPSA 2E75C 5GGRY 4AV0A 1N6UA 1PFCA 2R0LH 3SQRA 2HWZL 3EH5B 2OLDA 4LSVL 2A4ZA 4R96B 1JZJA 4QTHB 1L7IL 4A38A 2BNQD 2I07A 1YPZF 1I9RL 2D31B 2JXMA 1KXTA 2OTWA 1JPTH 3MRMB 5GGVL 4BFBD 2F7PA 4J3TA 1S5HA 4HXBL 5DHXB 4UQEA 4JJ5A 4QRSA 5B39B 4K7PH 4GRWH 4K3JL 3IS1X 1PY0A 5JA9A 3ZDXF 4RH4A 3LSOA 2VDKH 3U7AA 4P2CG 3JYCA 3O6FD 2ILLA 3WFBL 4MD5B 2X0VA 3TYFA 1WPCA 3RNQB 3H3KA 1O6TA 1B0IA 2YA1A 3PRZA 4OF8A 5BRZD 5FLUA 2MCG1 2X1WL 1ORQB 5IHWA 4J3XA 4FC3E 5E2UH 1B0RB 1PAMA 3KVDD 4TS6A 2C3VA 1E3XA 4DP2X 5I66A 5C0JB 5DLLA 4FTDA 4WI8A 3N0PB 1ZJBA 1P84J 3A22A 4U6YA 4WUKH 3D39E 3VGDA 5L7XL 3PFUA 1XCXA 4KJPD 2CIIA 4AJYV 1N6QL 1ETA1 3TTSA 3VFUA 4DKEH 4KJQC 5KUMA 3VXUE 1ZS8B 4KPHL 4F2MB 1A9BA 1G5AA 5HDQH 4NYLB 1KSRA 1LWHA 1QMUA 2HRLA 3DMMB 2XG5B 5FYLE 5BO1H 1EVTC 3I74A 5IVXE 2VMFA 4DCQA 2A0LC 5E51A 5F7DA 1MI5A 1KPUA 1B2YA 4PTTB 4Q6KA 2CCWA 3L3JB 1BAFH 3PU7A 5L4MA 3EDFA 2J8HA 1Q1JH 3S3BB 2R8SH 3NFSL 1UENA 4MNHA 3Q44A 3BVXA 5AZ2L 1B0RA 4QCIB 5JO5A 5J0BA 1A7RH 4Q6IB 3RGVC 3K2UL 1XIWA 1QUNA 2Y7MA 5B3JE 1OCWL 3II2A 4J8RB 2ICWA 3GNMH 3SBWC 4RETB 1TKWA 4K2UH 4X0KA 1JZDC 1NC2B 4WSKA 1XH3B 2DTSA 5CEZL 3HFFA 2D7NA 1CYXA 4YUEH 1GAFH 1PMYA 1EAOA 2FEDD 5CEXA 1CFTB 3WFZA 3C60D 5TF1L 4O2FB 5D2LB 2EDHA 2IAND 1RV6X 2OKMA 3SGKA 5I1GH 4POZC 3V0WH 4V1DB 4FCHA 4ZTOL 5KSVA 1WA2X 3HNTH 2CXKA 2PR4L 5I1AA 1KG0A 4F27A 4MZ2A 2GG1A 4DKFH 2YSTA 1R33A 2OJEB 3OR6B 4JDZB 4PY8I 3ARUA 4YLQT 2MRYA 3G04A 5DURD 3US1A 1FFPA 3GHPA 3HE7D 4X6BB 5J9PB 3HLAA 3DTUB 1N2RA 3DJRA 2F53B 3HFML 3D85B 4AKOA 2VM4A 3NCWA 4WW1A 2F08A 4W4OC 4R5VA 4YSPA 5JQIB 5IM7A 3PWNA 5LCVH 3PABB 2WXHA 2XOTA 3MRJB 4H8VA 3UYRL 5FFLA 2WXJA 2GBAA 1JZHA 3LHAA 3O4LE 4PJAA 5ESVB 1U92B 2WPGA 3AFLA 4H1LA 3LN9A 3BZEB 4Z5RB 2YZ8A 4RGMC 1FZKB 4C56A 4GRLD 4PJ5E 1JN6B 1SM3L 2HWZH 3MJ7A 4HIXL 1WICA 5G4MA 3BAYA 2MCPH 2E7HA 1AR1D 5HGGS 5KVDE 4LDCA 5AYUL 5A6LA 5GGRA 3WEXB 5I1HH 4EQ3A 3MRIA 3CTTA 5GRJL 4OGYH 1JV5B 2YGVA 1PEZA 1F86A 5DMJB 5FO7A 3CLEL 4ECNA 5G5DB 4HKJB 4N1EA 2CLZA 4R6UA 4HP5A 2C1PB 5HI4C 3TT1H 4AOFA 2AQQA 4XPHL 4BUGA 4QJ3B 1P84K 3ZE2F 2P80D 4JDVB 4U1KA 5B1JC 2AXWA 2FEEI 3O2DL 5I1HL 1EX0A 1B4LA 3MRHB 3IU3A 3PAUA 1TQUA 5CJQL 2LU5A 2R39A 1CK0L 5GJTH 3IBOA 3M88A 5HVHC 2DLFL 1QAWA 4XNMB 4LLVA 2CHZA 5JPMB 1HIML 1KIRA 3BSGA 3CG8A 4FMVA 3VNZA 2XG5A 5BXFA 1AS6A 4IYKA 5KSAB 1J9CT 2NY6B 1B4RA 1A6UL 1QABA 3GK8H 1BMZA 3ILQC 3KW7A 4QRTB 2EQDA 3QUMH 2Q8AH 2ESVE 4NCDA 3PGDB 3OM3B 4E41A 2BVYA 1MRFH 4PCYA 5JIQA 1NUFA 3N55A 2K9UA 4YPGA 5ETUB 5IWLA 3Q5OA 2WINB 2XX1A 3NDZE 1HJCA 3VCLA 2CDEB 4JMXA 3PWJA 5IQ9A 4FNSA 3VFVA 5JOFB 3WMQA 4R0LB 1HOCA 4G6KH 4TVPH 2ICWJ 2G5RA 1PW3A 4NXKA 4PRNB 4KDWA 5DT1H 3SQBB 5EN2B 3OR7A 3V0WL 4ONHA 1Z5LA 2R56H 2VUKA 4WWNA 3QXTA 4JZJC 3BFOA 3AXHA 4MA8L 4Z77A 4DJMA 3ZSTA 2YFOA 3DETC 3TZVD 2H1LM 4HFUH 3MJ9H 4N85A 4P4RA 2L4OA 2XZQH 2G3XA 2YLKA 3WHXB 1FO0B 4NC1E 1OE3A 4YXKL 3BCFA 4IQHA 4OCNC 4ANXA 4IIQA 1UASA 1OT1A 5CKAA 3ATFA 3EJSA 4MD4A 5T1LB 4FZ8L 2I5YL 1UKSA 2ZUUA 4QRQB 4TNVF 4E41E 3AABA 3QCUH 3NSCA 1VSCA 1ZE3H 2XQBH 2YK1H 5EBLB 5AAPA 4HSCX 2ZOLA 1EANA 1CJYA 1M7IB 2DB8A 2IV8A 3MO1A 4Z7QF 4X6DE 5EC2B 4LBEA 3FT2A 4MNGB 4PFEA 3ZE2E 2YQ2A 1U8NB 4I3SL 3EDDA 2CO2A 3NT0A 3V8CA 2EIDA 1FC2D 2IC2A 2N0MA 2B15A 4XX1E 3T77A 5I1KL 3MKGA 1U2CA 3KPQB 3UZQA 1COBA 3KPRE 3VWJC 3BDXA 3UPRB 5C3TA 3BXNB 3KPNB 2R9HD 4D3CH 5JIMA 1TJGH 3AS1A 4Y2DC 1OM3H 2WWMC 2WQWA 1FFOA 1I1YB 1NCAH 2AMGA 2X9XA 2FIKA 4G8GE 5ILTH 4I2XA 3U0TA 2TRYA 3BQUA 1YG9A 3ZT6A 1SGKA 1EZSA 1UH3A 3L16A 4LXFA 4MMZC 43CAB 1M7DB 5KBDA 1S7WA 4NQDB 4LKXB 1JV2A 1KN4H 1HL4A 1OK0A 4PGBA 5IGXH 3T0EB 2W9EH 3T65B 3FU3A 1ET8A 2B59A 4IIQB 4R7NA 5L9DL 2YOCA 5DA4A 1LDPH 3T4AC 2WTPA 5I8KL 2AS5M 1UCBL 1QTSA 3VI4B 1L7IH 3RWJA 4L4TB 2IJ0C 1DJHA 4JRYB 2DQJH 1F3JB 3B4NA 1CGTA 5BV7H 5HGAB 3KYMB 2NW2B 5EZJA 3BQUC 3O6KL 3RE0A 5CGYD 3K4DA 1L6PA 4Z3FA 1YDPB 3TJHD 5MI0C 1EFXA 3SE4A 4UILL 5I16A 3ZE0F 2WLYA 2J1WA 3T2PA 1EXGA 1WEJH 3QFJD 4KK8C 5EUOF 1WUNT 4HIQA 2GSGB 1MFUA 3ZHFA 1JDCA 1RVFH 4X5RA 1JDDA 2FATH 5KOVC 3VXSD 5HHVL 4AJVA 5DYFA 3S37L 3I75A 9PCYA 4S0HA 3IFOB 4NZRH 3WFHA 4FXTA 1WDAA 4X4ZA 4OTXL 4XXDB 5CD3A 3MJ9A 4KDTC 5CWSA 3EGXB 4R9HA 3SDAD 3RDTB 4DQOL 3FRUB 1AC0A 4YE0A 4CDHA 2VDNL 3ES6B 3GXNA 4P2OB 1XR9A 1N67A 3KM2A 2CXGA 3O6FC 2VITB 3UG5A 3VMNA 3GTTA 1VFMA 5CJOL 5J11B 4LRIA 3O6KH 4QLWA 3IM1A 3J7HA 3I6SA 5DD1L 2HPTA 5F7NC 4Q6IC 4PJDB 5GHWH 1FBIL 4GAJL 4AE1A 5E08L 3CVIH 3RVTD 4A2EA 1R19A 1QBMH 2J43A 2YUXA 4U0RC 4KKAD 5CWSB 4R4BB 3TGXA 3CXDH 1JRHL 5I8KH 1IMHC 3F5WB 1WLHA 4MBOA 1L6XA 1KGXA 3VXRB 4OLWL 4IKNA 3CU7A 1MEXL 2JIXA 2FBJH 4LCUA 2I9TB 3HHSB 3UCRA 1J10A 5K9JH 2YJQA 3R18A 1ZA6B 3FH7A 4XO5A 2FWOA 3NA9H 1ONQA 1EPFA 3AJ7A 1LO5A 1UA3A 3MUJA 1C1EH 3UERA 4DZBA 4JFEA 1ZT4B 1RZJC 2P48B 1I1AC 2YLHA 3B5TA 4TNFA 3D06A 4NQSA 1ZSDA 2V3FA 4N0YH 5TFSH 3CXFA 2NW3B 1JK9B 4K94C 4B3VA 4XN7A 1N64L 1BXVA 1EEZA 4FP8H 4G8IA 4KHTH 5ICXA 4GG6A 2HZHA 4IRSC 3ZE0B 5IFAH 3I75B 2DYSB 5I5JA 4JHWL 3EYVA 3ARXA 1J88A 3DGGB 3RWIB 3S4SA 5IMOB 4BXSV 3WTTA 4N20A 3VRIA 4F24A 2DM7A 3L4CA 4K9EC 1KLFB 15C8H 1SOXA 1V27A 3A6CL 2QR0A 4YX2L 1IAIM 2DL2A 2W38A 2Z91A 2WWOA 3CZEA 3DX1A 3HMWH 3KNBA 1J1XL 3QWQB 4FD0A 1KT2B 1LD9A 3VXQB 1KJVA 4OFVA 5LWYH 2V5SA 2VLKB 4X6DF 4NQDD 3U4EA 4DVBA 3VW3H 1ZVHA 1MVUA 2OMWA 3FTUA 1JI1A 1FZMA 2N7BA 4KKBC 4QF1B 2HVJB 4MQ7B 3OG6B 1RUML 3N44B 3FQTB 1DJZA 3HR5B 3S3CB 4NEHB 4KUZL 3SPVB 1TZGH 1IGCL 2F7OA 1NBQA 3HNVL 4FNRA 2GEQA 4PRIE 1FG9C 2CDGA 2EO9A 3ILEA 1CFBA 3QI9A 4JUSA 3U82B 2ITCB 4MAYA 4FN0A 3AAZB 4MMZA 5DQDH 1RZQA 1H5BC 4FP8L 4KHTL 4RAUB 3BE1H 4XMXA 3SYQA 1A0QH 4P07A 4DEPB 3TA3C 1MCEA 1ZLSH 2AQ2A 3CCHB 3QP3A 3S36H 5CSGA 1KBGH 1R3KA 2F74A 2UX6A 5CJ8A 4JPVH 3FMGL 5DJYB 3MLSH 4FXKB 2EC9T 4UT7L 4C56E 4XMUA 3SDAA 4OLYH 1A9VA 1J5OH 2WLKA 5AOLA 4F15B 5F3HA 5B1AB 1ASPA 3D08A 2JKTM 4OIAA 5IUCA 4WEBL 4IU3B 5E8PB 3KPSA 3QIWC 3Q5YA 2BW4A 3ARTA 1GIGH 3APDA 3GMOA 4TQHA 5DXWA 2WO4A 2HFEA 3UP6A 3H7BA 1JHTA 4HJ0D 4F9PA 1TYRA 3CVIL 4NOFA 3RVUC 2Y24A 5DTFA 3O2WL 4Y5VC 3TA3A 4GFTB 1KGCE 3LH2H 4OGAC 2F53D 4Y4KD 5LGHH 4NPYA 1AO7E 5C0AD 1BGXL 3HE7B 1UD6A 4KTGA 3UH8A 4E5XA 1PLBA 3QRLA 3ECVA 4URKA 3P3RA 4C57C 1ZWIB 3VSUA 2J4WH 4O2FA 1KGYE 2GI0A 4MJ6A 5D2LA 5I1LA 5AW2B 3CFBB 5KVEL 4U1MB 1URZA 1CXLA 1BZOA 3BKJL 2LFEA 1Z5HA 2ZXCA 2GUYA 3EIFA 2I25N 2TRHA 1KJMA 3MLVH 3QZMA 4ZD3L 1TKWB 4ODTL 2W92A 3QDME 4PJGF 4U6VL 3UBGA 4OTXH 2K7QA 5I6MA 4FG6C 4YHMH 2X4PB 2VDRB 3ERXA 4LU5L 3UPCA 4HKBA 1DLFL 2CRIA 2UYLB 4ABQA 4FQHA 3IDUA 3WO4B 3QZBA 1U4FA 4UB0L 1KN2L 1CGUA 2UWEE 5CR8A 1P7QA 3NJMA 4N0RA 4PQXA 4OH2A 4L0PB 3ZN6A 3JTBA 5ESQB 1FO0A 3ILDA 4H20L 4PM1A 4R7LA 3O6FA 4V1DA 1NWOA 4X7SH 3WUWB 4PJHA 2QZQA 5FF6B 3VD7A 2WLLA 2HFTA 5C07A 5FHAH 2BERA 3K6FA 3H9SD 3WN6A 2ZPKL 2EP6A 2WY3B 1AKPA 4L4JA 1TUPA 1U91B 2UYLA 4Q0XH 1KJ2L 4AW4A 2EUXA 1GGBH 1PG7X 2VSKB 1BYPA 1OM9A 1UVQA 1R3IL 1RP8A 1DYZA 3QJZA 4HUUA 1E2ZA 2N1KA 1JWMB 1MG3C 3BMWA 1OTUC 3IJHB 1J0HA 3IMRA 4XOBA 4YSTA 2WV3A 3FO9B 4QJ5B 5SWQB 3K71B 3X13B 4QHLB 5EZLA 3NJVA 3K7UA 3J2PA 1EERB 3Q6FA 1A6ZB 2EECA 4LK4A 3QORB 4UOZA 2Q7YA 1MHHA 4AC4A 1F1GA 4XNZC 3QCTH 3L1OH 3IJ9A 1TQSA 4D9QE 5EHFA 1VB9A 3RBGA 4DP0X 5AOZA 3PV7A 1MHEA 4N25A 5MEOA 3DX0A 2AV1B 5DZ9A 3SPCA 4B9CA 5HGHA 1XD1A 3PIQA 4FXGB 5LDUA 3QORD 3WDHA 1XH1A 2A9NL 5IQMA 4JMNA 3S8GB 2QTEA 4TLTA 4BGLA 4PJGE 2WQSA 4JO3H 5LAPA 3UO1L 5A2IH 1QLFA 4E9WA 3M1OA 3U6XA 4CW1A 4Z1PA 2X4UA 3GIZH 1TMQA 3F00A 4GRLB 4S1DC 4PJXF 5I66B 3AS0A 2WN3A 4EO5A 4FLOA 3US9A 1JNHA 1QBLL 2BVPB 3IJHA 4GIAA 4APQA 2OX5B 4IRZA 1BZEA 3N85H 5JIIA 3W39A 2EXTA 3SPIA 3Q9PA 4ZUUB 3PHOB 4JM2D 4PG2A 1NCGA 2WUCH 2KT6A 3DSNA 1CFQA 3GKWH 1KB5H 3QEGH 4KVCL 5TQ2L 3ZUCA 3P1VA 3ROOA 5AG9A 3FN0H 1DSFH 1J9RA 3LDBB 1TVHB 3Q8EA 4R90L 2R69L 5IB4A 1MNUH 1OP9A 2G5BA 3K46A 1FL3A 2EE0A 1QYGH 5AAWC 5F9OH 4HLJA 1E9PB 4JCLA 5EO1B 3QI9C 1CD1A 2X1PA 2VXVL 1HHHB 2X0UA 1DBMH 2P52A 2CJUH 4XGZA 1ACYL 4G6KL 4NHCH 4EIGB 3NCFB 4GAFB 4Z7UA 4GSDH 2LLNA 3A4FA 4IRJA 5CZXC 4CNIA 4MDRA 3IFPA 4XP6L 3EH3B 1FL3B 1M7XA 3KE0A 1X5FA 4HFUL 1OOAA 4PYGA 3U25A 3FOLA 3FQXB 4C59B 1QBBA 1D9KD 5MI0B 1NEPA 2VR3A 4D2NA 4YHLL 3WNPA 1F11B 2ODHA 4E5XB 1F4XH 3IFNH 1IM9A 1UZ8A 3RGBA 5IHZA 2QTVA 2V3EA 1U2YA 3WHE1 4LSQL 3V0EA 4GEIA 5GIRA 4HOXA 5FB8A 3ARFC 4LLWA 5J06A 4QT5B 5FM5M 5DMYA 2OXGA 1RZGB 3H1ZA 3VXTB 3NJXA 1U3JA 1HAWA 1Z9OA 5EU4B 4S2SB 1UM4H 5CJQH 3WY3A 4XX1G 3K6SA 3BUYA 5I23A 4YDVA 3B3BA 1H6UA 1KTRL 4HJJL 3CIAA 4PJXE 5KVGL 5I1JL 1QNIA 3CLEH 2AEOA 1J87A 4Y16C 2W65B 1ASQA 1ZCRA 3D3VA 4MB5A 5K9QI 1YEHH 1N68A 4UT9H 1A1OA 1RK0B 2ZP8A 3OHXC 2Y69B 4J39A 3P77A 5D5MF 4WAFA 3BZDA 2AXHA 3QZPA 1X7QB 5B7MA 2NUPA 3SE3C 2BLFA 3FF7A 5BRZB 4ZS6C 2GYSA 4UT6L 5I5RA 1R5IB 1ZS8A 1HE7A 1EWHA 1T4KA 2AV7A 4OQTH 4Y4HC 4PJFF 4Y19E 4CVUA 5DFWH 2WXLA 3NDYE 3OB0K 5IF0A 4Y4FD 3PXJA 5D6DA 5E2TL 4CSZA 3ISWA 4G82A 4DO4A 1XAKA 4JFUA 3WKQA 3FB8A 3RQ3A 4TOYL 4NUJA 2DYPD 4D8PA 3BH8B 4OGXH 3QORC 4OKVA 4JRLA 1N4XL 2QGCA 3VD3A 2EEDA 3MC0A 4WCYH 2Y1YA 1L9TA 3GM8A 2FL5B 4JM2F 2NTFB 2Y06H 2VDNB 4KY1H 3KPLA 5IMOA 3RWIA 3S4SB 2J21A 4HMDA 4MJJA 1C12A 1MHCB 2QPEB 4LSQH 1VKXA 5MEQB 3ALXA 1SHSA 5BMFL 3M86A 2VDMB 4J28A 1U30A 2BHFA 4I0KA 3LZRA 5B38G 3D9AL 5JYLA 1S7UB 4YDZA 1M2OA 5FAAA 3VGBA 2NR6A 4JRWA 3D69A 1F3JA 5DJ6A 1OANA 4YGVA 4FQJL 32C2B 2OM5A 1I85A 2AJVL 4AJ0A 4YC2B 5EC1A 1TJIL 5HYQB 5T5FL 3BKCL 3TFKD 3NSFA 2KL6A 4Y5YC 1Q1JL 1FRGH 3REVB 4JFXB 2ZXBA 4XP4H 5I0YA 1XGUB 2EIKB 1IL1B 4L5FH 5GGVY 3UZEC 3MHZA 4EQ2A 2NNFA 4XVJH 1R47A 3GEWB 3I6GA 1CMOA 3LQZB 3SQOH 2DBLH 1IAOB 1Q90A 4X9GA 1I7UB 3EOBB 1CLOL 2WZ5A 2DWYA 2ZXEB 1UT9A 4I9XA 3IGAA 3BC9A 4M6MH 3EZ8A 4F7MA 2IFFH 2DQEL 3T77B 3ZDYF 3CVHB 3TO2B 3KWVA 3VGFA 2C7FA 2P7TB 2Z7WA 2EILB 5K39B 2KLSA 4XH2B 4ZFOL 1XF5B 1KIPB 1LO0L 2DRUA 3AXLA 3GMMB 2ZOLB 2EH8L 1TETL 4PREB 5INCA 1JWSB 1UTDA 2RAMA 4ODVL 1YPZA 1PG7W 3KGTA 4BRJA 5E6IA 3ECQA 3MNVA 5IVZB 4AV4A 5CCKL 4RISL 1RUPL 1RZIA 2E9WA 1QFWL 3QXAB 3X1EA 4Q2ZA 1AO7B 1OCOB 3QO1A 1H3TA 4HMCA 1EDYA 2Y7QA 4NQDA 1NOLA 5HI5C 2EDEA 3MLRL 4NGHL 3VD2A 3E2HB 1ZK9A 2FECI 3KYNA 4P57A 1NCIA 4WU7A 4Y1SA 2NLJA 1I1YA 5GZND 3V4PB 4PRHB 4M9OA 1G7PA 2Y07H 1XX9C 2DQUH 2ENJA 1P5UC 3DUUA 2H8PB 3G6AB 3S35X 4UINL 4DUWA 2JWYA 2ZP0T 1N10A 4JZOB 4TQEH 3V95A 4DK5A 3C09C 1MFCL 1CLYL 4P2RD 4OZFH 1OGTB 1JUFA 3VA2C 4NZTL 4OF6A 5CP3H 4BCXA 1EEUA 1F2XK 4IW4C 3U7WL 2PYFA 3ECUA 1HH9A 2ZXWB 1IEBA 2BO0A 2CBQA 3CLWA 4KU1A 4NM4H 1RSYA 3EYUL 4NZ8A 2IPTH 4FQXD 1AQHA 2WBJA 1FA4A 1GOFA 2DQGL 5D7KD 5GSRB 3U4BH 3QIUA 2ADIA 1B6UA 3ETBJ 3QG7L 2IIJA 2FJFA 2Z0UA 3NTCL 4LDOB 2J8UF 2R2EB 1QRNB 5CP3A 4GUPB 5F93C 3VH8B 5ITBL 5J12B 5AYTA 2WTRA 3ARBA 2RGSA 3VSTA 4KKRA 1G7MA 3TZVA 3B9KC 2QVMA 1GGBL 1IUZA 3L7FA 4RZCA 2J6EL 4O5LL 1NZRA 4U1GB 3N44F 3VYPA 2Z93A 1IAIH 3ZOAA 1KPRA 1THCA 3WS3A 1SXBA 2VDQL 4ZOAA 4JR9H 1IBHA 1ZLUK 3HUJA 1BXAA 5F7BA 1M4KA 4GUOA 4HCRL 2OCCB 4Y2DA 3TVMA 3ZKXC 1A6WH 4FA8A 2LW3A 4ODWB 5DRNB 3WHE0 4CC1A 2BIIA 1CE1L 4ZMWA 2FWSA 5IK3B 5H35B 1AGFA 1JGLH 2AVGA 4TQPA 4NZUL 2V8MA 3IB4A 4WEEA 4FQ2H 3GSQB 1BVOA 4WI7A 1OAXH 3NABH 4P2RE 3SDYL 1MRDL 2UY7A 3VI3A 3PWLB 3HS9A 4FQPA 5FGBC 3TFBA 2WUBL 4NBXB 4OKVB 1NC4A 3QO0A 3QUYB 4M4PA 5I1DB 1XH2A 2WINA 3QJXA 3WJJC 4P4KB 4L9DA 4YHPB 1RU9H 3B83A 5LBGA 4D9RD 1BQUA 2J71A 3SPGA 5MERA 1FORH 1VCBC 2VN6A 3F01A 3QNXA 4XO4A 5DSCB 4TXVB 4D9RE 1GXEA 4Y5YA 1FNAA 2PXYC 3BD4A 1ZJAA 3L3IB 4M5YL 1JK8B 2BSSB 4WW2B 1FN4B 3LOWA 1EGJA 3QQ9C 3RWDA 5L8JB 2LE9A 4HGKC 1XBRA 1T1YB 3D48R 3EOAB 4WFED 3HVDA 4ODXB 3D4GA 3TH3T 4WK2B 1A5FL 3FRPA 1OGAD 8FABA 1MAKA 5MEND 5DD6B 4KUZH 3D85A 4PGCB 3FQ2A 3K5SA 3AUVA 4CRPA 1SJHA 4XP1H 3VCLB 4G6ML 4PJCB 4APXB 3EOTL 2NXYB 1UHVA 1IFRA 3DIVA 3KPOA 4A2DA 2BNUA 4JM0A 3BWZA 4PCKA 1GMEA 1SLWA 4NENA 4YDIH 3TP4A 4EVNA 1IM3B 1Z66A 4Y2NA 4WNQA 3C5ZD 5DYOB 1SYSA 4XN4A 3SCMB 3HZKB 4QRPE 1NMBH 5AWNL 4WLCA 1CU4L 4N2HA 4K7FA 5E1AA 2EIBA 3NIGE 1L0XA 3W82A 3CZUB 3HI5H 5JXEC 3QPQD 4L4VB 2WQ8A 1BPVA 5J6GB 3L2NA 3QA3A 2NCMA 1TZGL 3KVPA 4RCAA 4XVTL 3DI3B 3MRHA 3Q2WA 4PI2A 3D3VB 3LD8B 4Z0BH 4G1MB 3V79C 4FNQA 1SMDA 2D0GA 1UZ6F 1BEYH 4GKLA 4R2GD 1THAA 3V7AG 5LWYL 4XI5D 3WE1A 4BKLA 3D6GA 1X9LA 3PWNB 3JWDL 5KBMA 3FUJA 3EF4A 2HKAA 5D96B 3RTLA 3FOMA 3S48A 4HW6A 5F7DB 4RSVA 5K9JL 1X5AA 5E2VL 2E7CA 2EINB 3BP6B 1NGWB 2VMJA 1T1ZB 3HI5L 2NQDA 5C0CA 2DZEA 2WBKA 3QWRD 4PHXA 1BLNA 5EEUA 1YEFH 2WBWB 1A3LH 2VDLB 4LIQH 5HGHB 1CU4H 1DJGA 4Q4IA 5IJBC 3QQ4A 4RMSA 3BQVA 4P2QE 2W81C 5G4OA 5TFSL 3CC5A 2EKJA 4QHMB 1NCDL 1MWAA 3ZPDA 5DI8B 3S37X 3SDDB 1SLUA 3DRTB 2XA8L 2WBXA 3FOLB 4L8DB 2AGJL 4U6HB 3TPUB 3OAYH 3IAGC 4XP1L 2NY4D 5TF0A 5C3IA 3LNIA 5EB9A 2Y4SA 5C1MB 2C4FT 5ICYB 1GC1H 2D2OA 1SZNA 3LKNB 1UA6H 5DQJA 3SBRA 1GHFH 4JFXA 1BM3L 4H8WC 5J6HA 2MOVA 2ZKHL 3K1DA 1RIHH 3KDMB 4QEGA 4V1DD 1IKNC 1D5MA 4DT2A 5GISL 1TTCA 2VQTA 1XB3A 1N3NB 2NTFA 5L6YH 2QPUA 3NJGA 4TQ8A 4A37A 4WHCA 5JZ7D 4L3FA 3TBBA 3SPHA 2YC1A 2P5WE 3DIFA 1KPUB 2XV2A 2ZKYA 4KAQH 4OQ1A 4FNPA 1MW1A 4XHJC 3ZUNC 2A1WL 3VU2A 2ICEC 1NFIA 4NB7A 3PGFL 4MAYC 4QXUH 2PPFA 1YNLH 3F58H 5F3BA 1S78D 3LPGA 1N0XH 1NBVL 4NT6A 4YN3A 3TA4D 5BVPL 1F3DJ 2O72A 7FABH 4MXQC 1BVKA 2P8PB 4NZRL 3D39B 3RPBA 3EHBC 4DGYH 3GFUA 1JFHA 3P77B 5TE7L 4BE6A 1Y1UA 2UZIL 2YAHA 1T6WA 4OUUA 1BP3B 2DQHH 5IR1A 4NN5C 1IC7H 3NJKA 1UA6L 1QSEA 3U7WH 2WLIB 2R4SH 2BIHA 1WEJL 1KTBA 4BYHA 3C6SA 1QKZL 5A3ID 4FJZA 3PL6C 2H6OA 1GYWA 3VM5A 1MHEB 2O1AA 3ILPA 1NCDH 4EXPX 1YEIL 3SDXF 5E94B 3BW9B 3I9PA 4HJSA 1OM3L 4Y2OA 4RFNC 1JVKA 2FRGP 2MSPA 1Q38A 1AQDB 2NY3B 2P47B 3ASNB 4ZOBA 5FDWA 4L1LA 1V7ML 2F61A 2N7SA 4ZMOA 4WTZG 4TVPD 5D1XB 3BZEA 2ZUXA 5E2VH 4NHUA 3VWKA 4KQ3H 1KCUL 2YAQA 4G6JH 3MOBL 1OO2A 3P4OB 3MRKB 1BAGA 3QJVB 3T4YA 3ISYA 5E1QA 3SJVD 5BOJA 3MLYL 2XI9A 3MRIB 4IS6B 4JAMB 5KEZA 4F8TA 4AX3A 3GXUB 3JXAA 3MGTA 3E6FA 4EOWH 1MRCH 1AXTL 3NBNA 2BSTA 1AYRA 3MV7E 4U2YA 3V6ZB 1H8NA 1RZGA 3OMNB 1C9SA 1UURA 4TRPL 2HFGH 5DHYA 3HMXA 4ZMPA 1UD5A 2VXQH 4XNAA 4IGBB 2YARA 2VLKA 2OSLA 4MGXA 4N0FB 1PSKL 1UWEL 4ZS7L 1LNUB 1WVZA 1BZ8A 1SXAA 3MODL 4NWTH 5KSUB 4L1BA 5CZKA 1AS8A 1ET5A 1K4DB 1T4WA 2X2IA 2YKLH 3G6JB 3IF1A 5EOCJ 4DESA 3L5IA 4I18C 2NY4B 5T3XD 1GCFA 2XWTB 4N9GA 1B88A 2F53E 4IIZA 4KK9C 1U8JA 2F5BL 1P7QD 2V7NA 4JFDB 4QOKE 3O11A 1HQRA 5F7WC 3SDDD 4TTGA 1ZT7B 2FJGB 3AS3A 3W39B 1D9KA 3HG2A 1HXYA 3TEYA 1FRGL 1WD8A 2NYYD 3KLKA 3AITA 5CBEA 3O4LB 1BAWA 1BD2A 2H0JA 4I3RL 4OQTA 1WJ3A 3UG3A 3B2XA 3F7PC 1JCKA 3E6FB 3O9WB 3H6JA 4XCFH 1CWVA 2FE0A 4RMQA 3MVSA 3N42B 1OP5K 3VFNB 4W6WB 1NC2A 5C7XH 2R7EA 1CFNA 1WGVA 4ZTPL 3VX0A 2G75A 1TOXA 2CK0H 3F8UB 4RWYH 4IU2A 4DPCX 1SBSH 4Y1AE 4B9ZA 2ICCA 1HT6A 5IJKA 3C60C 4TNGA 5KN5A 2XWJB 2PP8A 1JZIA 1OWWA 1JRHI 3EJPA 3X2QB 2HT4C 3LZNA 4OZFG 3HZVA 5F1IB 3WFDL 3NABL 5ID1B 2BNUB 2EUZA 3QUXD 2YPKB 3QUZA 3UX9B 4FABH 4PTUB 4P5KB 3GMLB 4MXVE 3IK2A 5KG9A 1JGLL 4HS8H 1CDJA 4AUJA 4KKZA 1OF2B 3EAKA 4F57H 3EJYC 4BZ1A 5ABAA 1RLWA 5JLZB 5AKTA 2E9IA 4OGAD 4Z3GA 3P4NB 3BPCB 4L1TA 1KFGA 4JJHA 2AJ3A 4A2MA 1SYVA 1KYDA 3P9MB 3PNWA 4PJ9D 5EBGA 4YBHA 4PGEB 1KEGH 1HCZA 2XFXB 4FTVE 2X4QA 5J5EA 3RJDA 3MRNB 3BN9D 1Q9KB 3G6DL 1OOWA 3DJTA 3DIDA 4O5LH 3VNYA 2AKRA 3CSTA 4BK8A 2C3VB 3FTVA 2EYTB 2PCYA 1N8OE 3BT2H 3E6HB 3DX9B 2XWJA 4MX7B 2FK9A 1YMMD 5F9JA 2JB5H 2IG2H 5I5IA 1G1OA 3NESA 4PBVC 3F05A 3DX7B 5DEFB 2DQGH 3U4BL 2XWXA 4P9ML 5HYEA 2XPZA 4HOMA 4UNTA 3UTPE 4OVUA 2OP4H 2BRRL 3NAAL 1MJJA 1ZWIA 4NLHA 3NACH 5GRJH 1NCOA 5EOCL 4AVJA 4Q58C 4L23A 4Y7MA 2ITDB 3DRQB 5H2BB 4G9FD 1BCIA 3HCVB 3SOBH 1HXMA 2NZ9C 3QJHA 1AP2B 4RZCB 4RMTA 5CGTA 3V5HA 2IOOA 1KTCA 2FX9L 3B9EA 4AQ8A 5BVJB 1LO2H 4DW2H 3BEVB 3QEHB 4OZIB 4NS0A 5DD5H 2ETWA 2J6EA 5A40E 3T6VA 3MLRH 5F7EH 2G30A 3EKCA 5D96C 2H32A 5D1ZD 1QRNA 3KHQA 1W0WB 5E2JA 2OYKA 2XIDA 2G2PA 1Q0YL 3JV0A 3CZJA 4JHZA 4JUTA 3CZLA 3VO0A 1E4WH 2J8UB 2NSXA 4FADA 5BZDB 2QT6A 3VFGL 4X6CB 4D9QD 5GZOC 2DQDL 3W2DL 1OSPL 4LCYA 4AKQA 3QQ4B 3EBHA 2ENQA 3WTVA 5I16B 1K5NA 2P8LB 1AVAA 2XPGA 4N3UA 4AUUA 3BP6A 3HI6H 3KXFA 2CDGB 4MHHI 5D7JC 1FJ1B 2ICWI 3S7GA 2PWFA 4YL4A 1R3KB 1SOSA 3MJ6A 3GBNL 4P5MB 3I6LD 1NCUA 3C8KA 4W9FC 2NXYC 3T0EA 4QWWD 1U42A 1G7QB 1KT2A 5K9OA 2ITCA 3C12A 2V9TA 3FUEA 4KJWC 4IKLA 1CIUA 2NUTB 2DTMH 4NWUH 5AZ2H 3S97C 1E7VA 4E41D 2ARWA 1CDYA 2OW6A 2VZOA 4LRNH 5FKAA 43CAA 3X3GH 1ACYH 7PCYA 1IILE 2IAMD 1G0YR 3F12A 1BQHG 4FHBD 1XF5A 1CGWA 2CUHA 3FQTA 5AG8A 1M57B 1XT5A 4L4TD 4GSQA 3EUUA 3ZX1A 3L5XL 3RWDB 3B34A 3ZMRA 5JDSB 3VI4E 1KULA 2AABH 4L4TE 2EYRB 3J07A 2AEQH 1KC5L 2BCKA 3SDAC 2NY2C 4ISVA 2XN9D 3B5HA 2AK4B 4ZFQA 1IARB 4RGNE 4JM4L 4UQ9A 3ZKND 4N2GA 3MOBH 4ZI8A 4KTYA 5E4EC 3SDCD 4GT0A 2XDHA 3S3DB 1DJWA 2P5WB 4NBZB 4N86A 2YD0A 5DZOA 5DD6A 2B4CC 3HPLB 4J6RH 4WKXA 3X11A 3QB7C 1KGJA 2CD0A 4S10A 1WP6A 4YK4B 5HVFB 1ZIBA 1MJUL 4MMYA 3QH3A 2UXFA 3BIKB 4AITA 5AFAA 4OR1A 2WHVA 4F33A 3FZUD 3U48A 3JWNC 2CRYA 1CLZL 1GCYA 3MNWB 1MCOL 4X9BA 3GM0A 5LO7A 3NRPA 2E0PA 5EIVA 1U9KA 3ARFA 3CPLB 5T3XL 4LVOB 5FYJH 1E4XL 1UZ6E 3RVVD 3LN5B 1MFEH 3ML9A 5IBLC 3ROLB 5BZZA 1I8IB 5ABDE 3PGCB 4PJGA 1XAUA 1LILA 4PMFA 1A6VL 1OAKH 3ABZA 4Y5XB 4DP4X 1D5XB 4RA3A 4H88L 2BXZA 5FUCE 1BDYA 2Z1PA 2QVFB 4NKIH 2JK5A 4N2CA 4ZW5A 2IG2L 4JY4B 4JFHE 5D70L 4ZFFB 4MKTA 1TPXC 3IJYA 1J8HE 2HT2C 2WTRB 4TVUA 3HUJE 4X99A 5D8JH 4OCRL 1Z5LB 4QY8A 1KXHA 2QHLA 3TWYA 1TSRA 3D0LB 4LVHC 1YECL 1ZVNA 2P46B 1RQ5A 3PGFH 4OJFH 4QXUL 3U9UB 3VXRE 3STLA 4L1SA 3K8LA 4A7GF 3KYOB 2ALAA 1SJMA 4O9HH 2WXNA 3T8XA 5JOFA 2YXFA 5DEZA 3L13A 1SY6L 2GY5A 1UT2A 1G43A 3LIZH 4BKTC 1J0ZA 4F58L 1FFRA 4P9HL 4XBGA 3FRUA 4ZTPH 3VRLF 3WBDA 2QSQA 2ZCKL 5F1NA 43C9B 3F6LA 3ARBB 2V3DA 5B38A 1U3HC 3DKHA 3AY2A 2IO5A 2VLRB 3RL2B 3RHWF 5E8EB 3WFHB 3NPSB 5C8JB 4ZUTA 4X6CF 1WBZB 2C1OB 1HHIA 3DURA 4JFFA 4NX0A 1S9VA 4BV1A 5DJXA 3Q5TA 3IDMA 1F4YL 4KX8A 4DGVH 2WVUA 4EUPB 1SRDA 5TDNB 3C5ZB 5CHNB 1KGWA 2E4TA 3QZWG 4YHIB 3DNKA 5D6CB 1MFDL 5AZEH 2V2XB 1JXFA 4WHTB 3DWTA 1E6JH 1R17A 5D5MB 3MR9A 3JV6B 4UTBH 3MLSL 1Y1DA 3WXVL 1BGXH 5E9DE 3F62A 3RVWC 1YA5A 2YKLL 3VD9A 1Y18B 3ZJAA 4GQ9H 4PJ7E 3VRJA 3BAIA 5HDLA 4YOKA 5LGYA 4JG1H 1WWCA 1V05A 4ZS7H 1IGTB 3CFJB 1MQKL 3DVGA 2XXCB 5D7JB 4P57B 1CFSA 4J3SA 3H42L 5CLTA 3D0VA 3RTQD 2QEJA 4OLUL 2H6UA 1F00I 4IJ3B 3BLBA 5K59E 3OAYK 4PG2C 1YEJL 2V8LA 2YOAA 3U1QA 2YD4A 1BBDL 3UTTD 1H8SA 1QG3A 2I24N 3NP4A 5AOIA 1SDDB 5A2LH 1GYCA 4WW2F 3TVMC 3MUHL 2XIBA 1W6WA 2ZF8A 4RGNC 2XBTA 2PWEA 3ETTA 1I1AD 5IJCC 2H0FA 3W37A 2KZWA 2A9DA 3QXUA 4LEXL 3FT2B 1ZGLP 1FH5H 1SMAA 4LCCA 4PS3A 1BOGB 1YEKH 2BX5A 1A3RL 1H15B 2WZ6A 2NMSA 3VYOA 2X09A 2NQCA 4BK5C 4Z7VE 4LFHD 4ZSOB 3HB3C 2LV4A 4EVNB 3IFPB 1QVOB 2P8LA 4RX4D 4OCLC 3WN5C 3BGFB 3GINA 4ZW3A 1M9WA 2XZZA 3FQRA 5FM8A 2ATKA 3HBGA 4I1PA 3PXHA 3T5WA 4WNJA 2VE6A 3LPPA 3BHBA 5CJXA 2X88A 1LDSA 4HK3J 5B1CA 1WFTA 1R0AH 1L5GA 3O81A 3VI4F 3JT0A 4N8CL 3LQZA 2EO1A 2ZE0A 4KROD 2KERA 3CQQA 2R4SL 1BFSA 1K6QL 2HRGA 5JUEH 3FQWA 3RG1C 3ET9F 5C0EA 2J3SA 4RFEB 3OZ9H 4RLDA 4FQLH 4K9EH 4OF3A 4S1SH 1MLBB 2NSMA 4FLHA 1QBML 2WXMA 2X6VA 3P30L 4XCEA 3PWPB 1M1XB 2P5WA 5IQ9B 5KYUB 1YEGH 5FA3B 3FT3B 1CF1A 3Q1SH 5CJXC 1AFVH 5DJ6B 3WFEL 4UZUA 5CJOH 1F3RB 4FI7A 3L3JA 4W9HC 1RUQL 1QLFB 2F58H 1WBYB 2ZX6A 2NXZB 4NKMB 1RP9A 5JXEA 2VDNH 3IYLW 4L3AA 4ZUWB 4HCGA 4X5PA 4AQAB 3TIEB 1QUPA 2CHDA 4BQBA 2XQYG 2EXWD 2PO6D 2RQ8A 2FBRA 3OLDA 2R1XB 4Z7UF 4EN3C 1SF3A 4F2MA 5EUOA 2VERA 2P5EA 2RA1A 3TL5A 1QEWA 2NUPB 1QSED 3MLZL 2R29A 1NCBL 3GJEB 3C2AH 3GLDA 5KG9B 4C4KO 5DU7A 2CA3A 1EZVY 1AO7D 5GISH 2YAFA 1NBVH 1TQBB 1AG0A 1MW0A 5EOTA 4ZD3H 5EU6B 1BJ1H 1JPSL 5GGTA 4B9KC 1RUAL 4I87A 1XL4A 3RJOA 3QNZB 3DUUB 2VDQH 1QA9A 5AW9B 3KZ8A 4JY4A 2JLPA 4MLSA 5ANMA 1MLCB 3S5LG 3PHQA 3UTQB 3ZE1B 1I9IL 3TBWB 1LE9B 4W9ZA 1D7CA 4AGLA 1UH2A 4BFOA 4U0QB 1BA9A 2YEZB 4IHBA 1AFVL 3WFEH 1KEMH 2HLFD 2HVKB 2Q86A 5H8DA 4MXWH 2FEJA 3SD5A 3L3OB 1AD0A 1IQWH 1JHLL 3BUBA 1Y0LA 2BXYA 1RK0A 1BX2A 3C2AL 3V0VA 3MLZH 4S1SL 5TJWK 4G7SB 3MJ7B 4P23D 4CMMA 3ZIMA 1AO7A 1MPAH 2GCYA 1F1AA 4MA3B 1JS4A 3CH8A 4JL2A 2UX7A 2R4RH 2W9EL 2I85A 2HN7A 5IROC 4HCRA 4H26B 4PJ5A 5ESVA 2TAAA 4UUJA 3UC0L 4PEEA 2ATPB 3QWOA 4HIHA 2VXUH 4BD4A 3ZDYB 1TSHA 3EOYG 2M2DA 5H37A 1XWVA 2BK8A 2WKGA 1BD2E 1GZQB 2HT4D 4XMPH 1KTJA 2D73A 3TWCH 2F53A 1C08B 4KVNL 3S88L 1J48A 2HLFC 4JG5A 2M8XA 1M7UA 1Q9WB 3RZCD 4J7RA 5JIPA 5DQDL 5JIDA 1QFPA 3BFWA 5BV7C 4KKLC 5D1QD 5BJTB 3KDPB 2GJ6A 2HRPL 3GXPA 4M8QB 1DTUA 2D2CC 3MV8A 4HMEA 3TF4A 3HNVH 5KSVB 2WSPA 4FXLA 4JBSA 4NNXA 1QRKA 5AALA 1A7PH 4JM2A 1BVLB 1W72A 4JN2A 2AQTA 4E42A 1QD0A 1MSPA 1MJJB 2O6DA 3IETA 2K70A 3KCWA 3K0WA 1N19A 4PJHF 3H55A 1IL1A 5J9PA 4X0NA 2DWEA 3E9TA 2Z3FA 2KPNA 2FDBP 4LRIC 2AK4E 2MPAH 3DX3A 1YMMB 3ATEA 4DPRA 3MV8B 4KRPB 2AAVA 4PJFA 4XP5H 3VSVA 4HFWB 5C0AB 4PRDB 4W6YB 4IKJA 5SWSA 5DJZB 2JB6B 1U0QA 2K9FB 5E5MA 4LCIH 4WV1A 4ZBJA 2AJYL 4FQ1H 3CDZA 2EUWA 1I4FB 1UOWA 4YDJA 1CFTA 1FJ1A 1PJWA 1MN4A 2W1NA 3QI9B 5KBKA 3P0VH 4MYPA 1OKEA 3CVHL 3LNFA 2HTKC 4OLXL 2Z31B 3GHBL 1O6SA 1IAKA 4NRYA 1S5IL 3EG9A 3IMBA 1HKLH 4LESA 3LKRA 4GSUA 2J25A 4XC1H 4GFXA 1HKFA 3U2SA 2AV1A 2DMBA 1DBJH 2VSMB 3N9GL 3X3FL 3O45B 1WIUA 1I9JH 5F21B 1IJNA 4RAVB 2YN3A 1FV1B 5F9DC 2X10A 5J57B 2H1PL 3PWVA 3OJDA 3W56A 1DVQA 2L7EA 3VG9C 1K8DA 1OP4A 4XAKE 4OF7A 3EZJB 1H3WM 5H94A 1U6AH 3CDGB 3VQ1C 3KR3H 2MFNA 4J3BA 4ZUSA 4BELD 4Y19B 1HEZA 5H4ZA 4I88A 3BWUF 4H0GA 4NP4L 3U2SB 5GHWL 4NO0A 4NQEB 3WLBB 3X14B 3CVBA 2L0DA 1KPVB 4J5VA 3ZQXA 2OL3A 1NKRA 2AJZB 3I9AA 3TBTB 2BVQA 1AIZA 3QIUC 1EJ8A 3QUML 4LOVA 1OTUD 3IFLL 4TNEA 2Q8AL 2AJXL 4NP9A 4W9KC 1K8DB 3ASOB 5D7KE 1S7TA 3W0WD 3V0GA 2P24A 2BCMA 1IBDA 1HIMH 3FT3A 1PF3A 3DK2A 2R9HC 3UL4A 3UZVB 4DQAA 2JB6A 2DQ6A 2BZDA 3O45A 3T08A 3V4VH 5TQ0H 2HB0A 3LH9A 3KLHD 3JQOB 1QFUH 2FJGA 2GIYA 4LSPH 2R2BA 5IQLA 1SY6A 4IU2B 1CE1H 1P2CA 1YEEH 3BYYA 3FB7B 2AK1H 5FA4B 3DYOA 3AXIA 4W1TA 1T7VA 2WC7A 4QHUB 4MD5A 5CXPA 4NM4L 4YAQB 3S5LA 4ORZC 1X5XA 1VJSA 2Q87A 1I3RA 2O5XH 4NQUA 3WTUA 5B1KA 1SFHA 1YRKA 3RU8H 1TZIA 1VRSA 2MIZA 3T0WA 3RX9A 1EVUA 4IGBD 5A2KH 2VDOH 5FO9A 1NCTA 3IBEA 3V52H 1IV8A 4JHUA 3LZLA 2WIMA 1NGYA 4M00A 4Y9GA 4KO6A 2VDQB 3HE6B 1UD4A 2EDFA 3QXDA 2CGZA 1JGEA 1HNGA 3ZVVA 4Z7IA 2ZUTA 4Q9QH 3R06A 4NM8H 5LN8A 1PNDA 3WE6B 2HXAA 1GOHA 3II1A 3FTGA 4JVUA 2D9CA 2AQNA 1ANUA 3VXUB 4KO9A 5KSUA 5EEYA 5SWZA 3ZW3A 1QBAA 1XZ0A 3RZCB 1NGPL 2DICA 2IDSA 4JM2B 1OPOA 4FXKC 3ZRFC 1DJSA 1NL0H 5C92A 1ZTXE 5DHVH 2J1YA 2UZPA 2NY1C 2BSBA 4N22A 3G5XA 2GBUA 2X4RB 5KANG 4KXCA 1IQDB 4DEPC 7CGTA 1T5XA 3DJSA 3JUYA 5DJ2B 5C0CE 1ZRUA 2BIMA 3CCHA 5I0ZA 5ENWB 2MCPL 2Y07L 2EH8H 2E9BA 2OYMA 4FLRA 2AZAA 4P49A 2RCSH 5ICUA 3MGTB 3MCKB 2IBZY 4ZO8A 1ZD6A 2PTVA 1JXDA 1KCVH 4N2IA 2UVEA 4DN3H 3CDCA 5E9DD 5EBWA 3UYRH 3QFDB 1A4BA 4BFIA 1FE8H 2VABA 4KK8D 3SCMC 3VXSB 5ANMB 4PV8A 1OP3K 3KXFE 2O6EA 5D7IB 1YJDL 5HGBB 2H0EA 5CEZH 2A77H 2VRKA 1GVIA 2VXQA 3S34L 2WXIA 2AEQL 3NQIA 5KYWA 1A7RL 1VFOA 5KJ4A 3KPOB 1S8DA 4MRBA 5GS1B 4GSDL 3L9RB 3DYMA 4A6YH 1I8UA 2DMKA 2XQBL 4FQXC 2XWBB 1T22A 1HEJC 5CHNA 5J3HD 2DD8L 4KMTH 5IB5A 3MRGA 4Y16A 4XP4L 4PD4J 3FRPB 5GGUB 1LNUA 3JWOH 1U4EA 4OI8A 4LRNL 4TNWF 2YPVA 1HNYA 4LEOA 3UYOD 3O41A 1WC7B 4QF1A 4AYSA 2CUIA 4B5EA 5MEPA 3AG3B 4PHZA 3HAEG 5FGSA 2CJTA 4LPVA 2JCCB 1K3ZA 2VLJA 4OM0L 2GHZA 3HRZC 3HBPA 1DCLA 2VNCA 3WNMA 1ET7A 5MHSD 4LARL 1FPTH 3GMPB 3SE3A 1T03L 2QADC 1P4LB 1QPKA 4YHIA 4FNTA 2DDQL 1UJ3A 5HYSG 4JAMA 4WFEE 2DF3A 3IDIA 1QR4A 2QSCH 5KWYC 4DH2A 2NR6D 2UY7B 3A67L 2VB5A 4N90D 5FECA 3L4VA 2AXGB 5HYJB 3BP7B 4KMTL 3WL9B 1K72A 3WIHH 1NCCH 3H7LA 3ABMB 2Z4QB 3AG1B 4KTDH 1L7TL 2NNAA 3C6LD 1MKFA 3FONB 3KPSD 1FNEB 4Z6AT 4X8JB 1W15A 3KCPB 2D4DA 4PJDA 1OHZA 1IBGL 3KJ6L 5HHME 3U6RA 4Y5XC 5HDQL 5IV2B 5JTWA 2Q0ZX 3LKSB 1KZYA 1PPIA 2IH8A 4WK0B 4A66A 3WV0A 3FBKA 2QKIA 1FF5A 2A6DB 1MDTA 3QDJA 3FFCD 3WLWD 3D9AH 4KDVA 3EUDA 4HX1B 2YUVA 3BN3B 3OVUB 3ZYOA 1YCSA 1A6UH 3LEVH 3VQ2C 4KZDH 5IOKA 2X2JA 5C0EB 1RJYA 1QTYT 4PB0L 4YIQB 5KYXA 4XXDA 1XB8A 2W80C 1EXHA 3WKPA 4X7EC 4WO4A 1ADWA 4A7UA 2GY7B 4MQSB 3MTXA 3QDJB 1MIEL 1X9UA 1T2XA 3QIWA 4U2ZA 4UQCA 4UZGA 3Q05A 5DVOA 1KV3A 5HDBE 1YQVL 4OIBA 4HWBL 3UZEA 3D3VD 5H37G 1AJ7H 1KIQB 1MCDA 1P7BA 4KKCC 3DDFA 2YRPA 3VAEA 1NDTA 1CLCA 5BZXA 1DE4B 2DWXA 4K3GA 3DUHA 4HJIA 4PGDB 3KPSB 5D4JA 4EZMA 5E6SB 1E2WA 3H2QA 3VVVA 3E2HC 5A2AA 2XNAB 5DZLA 5FK9B 3Q48A 1E8YA 2NT0A 4M4RB 1D6EA 4W9DC 4DK6A 2GFBA 4PH8A 3UTTB 4P5TC 4KVPA 1QZ1A 3SCMD 1D2PA 4QYOB 5E7BA 5TDPA 1PDKB 1VPOL 5F0JB 5D7HA 4GXUM 5JHDE 2CHXA 1JGVL 1JYVA 5E6YA 1OD9A 4MYWB 5E03A 4LCWD 5FPIA 1IM3A 1RZFH 1SBSL 5LCVL 3NIFE 3OX8B 5EU7E 4WFFD 5FW7A 1E5UI 2ORBH 1JIBA 4DNLA 1Z9SB 5C09E 2RMNA 4DGWC 3LH2L 3LS5H 5LN4A 4K55A 4Z76A 3VFPB 3GRWA 1BECA 4LEOB 3HJ0A 2AEWA 3REWB 1FSKC 4R97B 4AQOA 1U8KB 4PIBA 4DTGL 1NBYA 4YDKH 2DLEA 1IGFH 5DWPA 1OAYL 4XH2A 5E1HB 1J5DA 4UV4H 3RLSA 2DLGA 4L0ZA 3E1F1 4A2FA 1KXQA 3M1BB 2ZJSH 1FN4A 3L3OC 1A7OH 4WNQB 5DYOA 1IVLA 4ZTOH 3SCMA 1EJOL 3RB7A 4R26H 3ZE2B 3IGAB 4BZ1H 4WWOA 2AJXH 5FO8A 3GPEA 1QSZA 2R29H 3SJVE 4LCYB 2A6IA 5TDPB 4U1IB 4HS6A 2VJXA 5KS9B 1TCRA 3NZHH 3BGMB 1KIPA 5FKPB 5JORB 1XGQB 4HPOL 4M6NL 1WWAX 1G5GA 3AQZA 2EIZA 3UO8B 1RPUA 4TVPE 2JKWA 4R83A 1FFPB 3GSWB 4X6BA 5AB1A 2H1PH 3GC3A 1IGIL 4LL1A 4JHAH 2YN5A 3FTXA 1D6VL 4WI6A 1G7HB 2PLTA 2XVKA 3WEOA 1FQ9C 2CGRL 3GDBA 3UO1H 1GYAA 1INDH 1NGYB 1IAOA 5ES4B 4LFHG 2NNCA 2F5AL 3ARGD 2X89D 1T20B 1EZUA 3IRZA 1CFSB 3JTSA 1NFDA 1XCQB 4YSEA 1DUYB 1MHPH 5DFVD 2O5ZL 2VUYA 3P9LB 4FYRA 4Z77B 5HYFA 4BFKA 2ZCLH 5IOPB 2QGEA 1E4HA 4H8QA 4QHUA 3R06B 3OKMB 1MCHA 1NGQL 3T71A 4GKSB 3Q2CA 1M6OB 2V5TA 1F58H 3FDWA 2N01B 5TGBB 4Q97A 4YXLL 1P7HL 1DZBA 2BWDA 5LKNA 4KX7A 1B0WA 1SEBA 4HULB 4WFHD 5PAZA 8FABB 1T6VN 3HUJF 4DP5X 4NFCA 4LPWA 1HINH 4K23H 3ZQWA 2JNZA 3ZQ9A 2P5WD 4PGEA 3TXAA 2I69A 1T89C 4F2EA 1T4KB 2AV7B 2JKIS 4AQEB 3X14A 1NAML 1VGEL 2G9KA 2MJWA 1FC1A 3NN8B 3OHXB 5FKAB 3P11H 3HB3B 3PWLA 2DLTA 4F80A 5DZNA 4ELMB 2IALA 3CLFL 5I73C 5ID1A 1JHKH 2QSVA 2P28B 2X4QB 2I7SA 4TTDC 1E65A 4ZFOB 2BMKB 1EZLA 3ZTNL 2W65A 3BZFA 3RAJH 3VXOA 5JHDD 5IG7B 1A7QL 4M3JA 1MWOA 5IEKB 1IB5A 1NGXA 3X1BA 3BVNB 2I9LA 2C9AA 2WVSA 3O3DB 3SIKA 3RU8L 1T89A 4AGOA 4E5XG 5FHAL 5JLZA 3G5ZB 5DDHA 25C8L 5I75C 1WWBX 2ED6A 1JPST 3QFDA 3TYFB 1CBVL 1SUHA 3EFDL 4FQIL 3ZRCC 2VDLH 2R1YA 3MXVH 3CMGA 3WEXA 4H20H 2CMRH 5EIQA 3SGEH 5CN1A 3PNRB 3PDOB 4P8QA 1X6LA 3HZMB 4XTRD 4M6OL 43C9A 2VW4A 1IQWL 1JHLH 2EIEA 1RXLA 4HWZA 3TTYA 4BIKA 3CE1A 1FZKA 2MPVA 1EHNA 1BM3H 1HXYB 2WSKA 2VR4A 3EJYD 3V4PL 3K4AA 1MVFA 3CFDB 4G43B 4L5FE 1LK3L 3QK0A 1I9IH 3NSYA 2V5MA 2VABB 1WITA 2JTDA 4AYFB 5D2NA 2NY1D 3IFLH 3IDGA 3MLWL 4ZFZB 1TTBA 4LSDA 2QELA 3KBHE 5I1EL 1XF2A 4YWGH 2YZ1A 2MCMA 1NMAH 3MV7B 3VXSE 1F90H 3KLAA 4JRXA 1L9SA 3CVHA 4RESB 2PYFB 4F8QA 4Z0XB 4KJYA 3G04B 4CNIB 3I02B 1QLRA 4XX5A 3WKMH 4GMSL 4BRVA 4UQ3A 4JREC 2BJMH 4XVOA 5AD0A 4ADGA 2EYRA 4N87A 4F1SA 3F64A 1G6RA 1YYCA 5G2NA 4JL1A 1M53A 3HG0A 3ZKSD 3RA7L 1U3HA 3C87A 4NO3A 3I84A 4O58H 2IVFC 1RMFL 3FO1A 5ICZA 3OF6A 2CGYA 1PJ9A 2VO5A 3HE6D 4G9FB 1K4DA 2AGJH 3PJSA 1YHPA 1DBAH 3WTWA 3STZA 4P46D 1RUQH 4N8CH 3UBXA 4KK6C 2MQGA 3MLTB 5HXMA 2E76C 4Z7UE 4KMQA 3REVA 1ZANL 2FGWL 4DP6X 2H45A 1JGEB 2FQEA 2A0LD 1A0QL 1T0PB 3GSXB 1PQZB 3H54A 4K3EL 3PHOA 1UKQA 5H2BA 4P3DB 3U30B 3HW7A 2DAVA 4NC1C 4IEFB 3BH9B 2FR4B 2KMWA 2NNXA 1T7WA 1XEDA 1PZDA 3UIYA 2QGDA 3BKMH 4G2AA 1NGQH 4J3WA 1BX2B 1UWGH 3V0VB 1WS8A 3LV3A 1DVFA 1F18A 3GTVA 4Y4FB 4XCCL 5I74C 2V2WB 1GZQA 4ELDA 4H13C 4HWEL 3C5JA 5B8CB 5EWIL 4LLUB 1ZA3B 4MFHA 2F68X 2MPAL 5IZ7A 4P46A 4MSWA 2OL3B 4IBWA 3TX4A 2X1QA 1RIUH 2DMCA 2XKNA 4ZG1A 4QRRD 1FDLH 1R5IA 1ZLVH 1TNMA 5E8OB 3S5ZA 3KPRD 1Q4NX 1J1XH 1KCRL 3ARRA 1DQQB 5CLXA 4RIRA 1KIUA 4FTVA 2VRQA 2EH7L 5INDB 1AOHA 4NQED 3NH7H 4PTUA 1BZ9B 1XZ0B 4XB3A 3RZCA 1OCRB 2FIRT 3BW9A 5CIPH 4GW1A 4ELKB 2WNGA 3LIUA 1TFHA 4QR7A 1U8MA 4QHLA 3A6BH 2P43B 3RFZB 1YEKL 5DD3H 3RY6A 4GMSH 1MJ7L 2HRHA 5KN5B 2K7PA 3CMOL 5EF0A 1UD8A 1HHJA 1KCBA 4RNRB 2OSXA 5DD1H 4C47A 4P5RA 1TO4A 3BUIA 5CNHA 1HEZB 2AF2A 2VM9A 5CIPA 1MCJA 3KH3A 3OTTA 4LL9A 1CD0A 2WK2A 2VXUL 3AACA 3H0TB 2PPAA 4AZUA 4ZMVA 4GY4A 1HYRC 2AQSA 4LO9A 5AVXB 4HLEA 5DT1L 1SLVA 4NCC2 1UA7A 2VIRA 1ZK5A 3TNMA 5ESQA 2HG0A 1OAYH 4GQRA 3U7YL 3WSQL 5HHXH 2CLVA 1G9NL 3O4OB 1RY7B 2HLAB 3CXDL 4DP8X 2CR0A 2O30A 2X42A 3O9WD 2WO3B 4FNLH 4KOCA 2ESVA 4L3ED 4OLZH 2RACA 4ODBD 5AVYB 3TNNA 3WKML 3VMOA 5H4YA 1E27B 4HDIB 2WAHA 4L3EE 1PX8A 2FB4H 1FFQA 2C9PA 4GW4B 3MBWA 25C8H 5F7AA 1QWHA 4WWKD 4WI2A 3ZYZA 3C6LA 3ULVC 1YYML 3BD5A 2WXKA 4WV1C 3SGJC 4ZX5A 4OBRA 4MD0B 2CHWA 1A1NB 2L3BA 4ENEC 3HC4H 5KYNA 3CFIC 1EDQA 4K5PA 4DGVL 2PXYD 1U92A 5I73B 4M8QA 5DTFB 1XGTA 4OZFA 1TZHA 2IH1B 2OMBA 2HUHA 4OZHA 3PV6A 4NN6B 3WKNA 1QLRB 5D7LD 3F85A 3S37H 3MACH 3O2DH 5HI5D 3GZKA 3KEDA 1DP0A 5D7LE 3GSVA 1T1XA 1G9NC 3ARYA 4X9IA 5LJYH 2B5IC 3EYOB 2V33A 1DUZA 2VR9A 1FIGL 4X6CE 3TT1L 3B3IB 2H9GA 4OM1H 1WGOA 3JBG7 2FO1A 5DI8A 2F19L 2IGFH 1ZY9A 2EE9A 2WZPD 3WGUB 3SO3B 3WKYA 4WJ5A 1NTDA 2V9RA 1P5VA 1BLIA 4HHAA 3UJIH 3ZKQD 4AUYA 2ATKB 5I19L 1JMXA 3SJVB 2G3MA 2J5LB 5JW3H 2Z7UA 1WTGT 2GB2A 5ANHA 5ILTL 3MLXH 5E8DH 4MMXB 2BFGA 5EO1A 1PG7H 5F44A 4LMQI 4NN6C 4BQCA 3EBAA 1CE6B 4F8PA 4PVNA 2P80A 2HA1A 5DVMA 2R0ZH 4ZAKB 2IQ9L 3US0A 1UKTA 1VLXA 3LEVL 2ZZUT 3LKPA 4U3SB 2J1KA 3U36B 3J8F7 2WANA 5JXAL 1FO0H 3MUUA 3SY0B 2OFQA 3ZU8A 3O3DA 4PS8A 2VW6A 3WXWL 1MCWM 1B4TA 5JW4Q 4JM4H 1QA9B 4J6IA 2BVPA 4B3EA 1JZFA 4JFDA 3DXAE 3ULSA 2GBVA 2QV4A 2E56A 4LLQB 5AW1B 4DO6A 1ZPUA 4IDLA 3PDOA 4PP1D 4XCNB 2BNRE 3HAEA 3HNSH 2WCPA 3PJSB 3LRHA 2JFCA 4WU5A 1HWHB 5HI3C 3IDMB 1IGIH 1LHZA 2VZSA 5KVDH 3MRRB 3GBLA 1R46A 2NY0C 3BH4A 4L29B 2MOQA 4YNYB 2RTTA 2ZYSA 4W6XB 4I3SH 2Q7YB 3VXMD 2Z8VC 2BP0A 4YHPA 1MFMA 3JYBA 3F7KA 4G8EB 4ODVH 4OM0H 2P5EE 4X5WB 5HYSB 4NRZA 3O8XA 2QQKL 5HHNB 2A9CA 2WWNA 4G9DA 2PKDA 2NX5B 1FIEA 1TDQA 3DYPA 4PWHA 4X4YB 2EDRA 3IN0A 4M7LT 4U1HB 3STLB 3LKQA 3Q9QA 4WI3A 4FQHB 1TPXB 2MKLC 1A7OL 4MVBD 1LL1A 2ZJSL 4GG6B 4N6QA 3EADA 1AIFB 5DQJB 5J6HB 4WGVB 3VU1A 5J13C 5IOPA 4OKDA 1XBDA 2EICA 2WLLB 4HZLA 4W9LC 1CIDA 1FLRL 2YGOA 4ZXBC 1SFDA 4OZ4B 1UQSB 1YNTA 4Y4KB 5C70A 2CLRB 1ZGLM 2OMZA 4UTBL 2O5YL 1KPRB 4PJIF 3PQYA 1MAMH 4H8PA 3LQMA 2GK0B 1SNRA 1FZOB 4XB7A 2VW7A 1BOYA 1ETB1 2VZTA 2JIXB 3OKMA 3AT0A 1GYUA 3C6EA 2ZWNA 1AE6H 1NFDE 4KZ0A 4GPVA 3K72B 1KYOJ 2DBJA 3F7LA 3B2PA 1EO8H 4BINA 1AQKL 1V54B 1AANA 1S7XB 2RCSL 1BF8A 5ECGA 3ULUH 3IFOA 2VQ4A 1S3RA 5BQ7B 5C0NC 5IFHH 3F7RA 1VFAB 1L9OA 4M61B 1TMCB 2XQYA 3C6LC 1L3WA 2QPDB 2Q76A 3ARBC 2ZCZA 4HUKB 4L8SA 4WJKB 5CEZD 4PUBH 5EORH 3ES6A 2CIKB 1SF5A 3GI8L 3GZPA 3NGBC 3P3UA 4AXWB 1OW0A 3P3SA 5ISZB 3N1QC 3AW5A 2E7LA 4HWBH 1NFIB 1TTFA 2VL4A 1GS7A 1A14H 2KYIA 3BO8A 2UZXA 3CFCL 3QHZL 3PHSA 4KKPA 5E4OA 4H5SA 2IXQB 2ZNWA 4U1SA 4JGMA 5HHPA 4KY1L 5D93C 5ACMA 1PD0A 2B39A 1F41A 2VYRE 1NBCA 3L3KA 1CD8A 2V5YA 1PZBA 5L2JB 4QXTA 4PB0H 3PWPA 4NKOA 4TOYH 3QYMA 1P9MC 4QD2E 5FOJA 4OD2B 1UB5A 3AC0A 4NNYA 1I31A 2JVUA 3LS4L 3NACL 4CVZA 6CGTA 3PDDA 2R15A 2Y25A 4PJ7B 5D7JD 3VFTA 1UT1A 1W16A 3UBHA 1A6VH 1OAKL 3TPKA 1MXDA 4JFPB 5AW5B 4AZ8B 1G9EA 3POHA 2ARJA 5AOMA 3V9FA 2QR0B 5E7FA 5D1ZI 1NSNL 3ZXAC 1J18A 5IKCA 1D7DA 2W91A 4F57L 3U2IA 1A64A 3FXIC 4W9CC 4ODXA 2NXYD 1CLZH 4RFNB 5KVFE 4JO8A 1MIML 3GSOB 3P3YA 2VLRA 4L0YA 4R8WL 2CBMA 5MENB 1OAZL 1OGAB 4CVXA 4ONGL 2YBRA 4PW3A 1F42A 5A6IA 5I1GL 3ULUD 2QSCL 2H47C 2DI9A 2RHEA 4P5MA 4XBGB 2BSEA 1I7UA 2DQTL 1T5XB 5FW8A 3LRGA 4FA6A 2E9JA 3K81A 4J4PA 4HIEB 1M05A 5C7ZA 1A7BA 5JYMA 3GXMA 3V7MA 5J1AA 3RI5F 2HAZA 2X6CA 4NN5B 5HHQB 4ZUTB 3RIAK 5TH2B 3LH8A 4HVBA 2EC9U 2P7TA 5T33L 2ZX9A 3FT4B 3D52A 3BJ91 5D7SH 3LMJH 4QLRA 4XNQA 5AW6B 2QQLH 2AQRA 5PCYA 4PLJD 2PP9A 1WIOA 2XQ0A 4LSUL 5CGYC 1FZJB 3ARDC 2APWA 3OKEA 5C2UB 3NCEB 2K8QA 4MAYB 3SKMA 4IDJH 4KO5A 5BCAA 1J05B 1PIGA 4HD9A 1ESOA 1ONQB 1LEGA 1D7FA 2QQKH 5A3IC 4JE4B 5FYKD 4KDTA 5GS3A 1FPTL 2GITB 2VC2H 2TSBA 1OQOA 2H2SC 1I1FA 1NIBA 2WOBA 5DMKB 1S7XA 2JKLA 3SKJH 3KXFD 1BZ7B 3EH4B 3QFJA 4G3YL 1A1MB 3L5WB 4NQVB 4PMEA 4RMVA 5TE6L 5CD3B 3UIZA 4LLMB 1FVCA 4HKXA 4GO9A 3U4EB 4DVBB 1U3ZA 1JF5A 2WN2A 1EHAA 2VZVA 3X1NA 1HXMB 3AY4A 4RRPM 3BT0A 2OTPA 1SJHB 1NC4D 1UB5B 4NNYB 2HG5A 4OJEH 3MBEC 1V7NH 1KLFA 4UU9B 4Y9CA 3H56A 5DZVA 2UWEA 2JI1A 3KEHA 2D0FA 1EMTL 3ZY7A 3WTSA 1QQDA 3NMEA 1M3JA 2MNWA 3PWPE 5L4FA 2IXQA 2WXFA 3UJTH 1TR7A 4LHJB 1D5RA 1ITCA 4XMLH 3RGVD 4JRYD 2W07A 4NQTA 1G7LB 2AJ3B 3ATBA 4HKZA 2IDFA 4OD3H 1A4KA 2B5IB 3BIAX 2FQFA 5B3SB 4HJTA 4OJYA 3EJQA 2DIBA 3H9YA 2FL5A 3OXSA 1G4RA 4PCSA 5IESH 5AL0A 5JPMA 4ACPA 2J1ZA 4LCWA 3MA9L 4ACTA 3HIZA 4B27A 2B59B 1MCSA 2GTZA 4EOWL 2V7HB 5E2UL 4U3XA 4PR5A 3K74B 2VR5A 1VACA 2CDFB 3LX9A 3TWCL 4Q2ZB 1QP1A 3ZE1E 2VC2B 5DVLA 1JL8A 3STBA 3MLYH 4E41B 4OV5B 2VDOL 1XO8A 4F7TB 1SYVB 1B9ZA 3UC0H 3QYNA 1SJXA 3UGEA 4ODWA 1I1FB 2F19H 1JZ2A 1OY3B 3M17A 1R5WA 1D5XA 2Y2WA 4JFQB 3BSZA 1V10A 4UANA 3BUYB 3CHXA 1V7MH 4M1CC 1AZNA 1LGVA 1UACH 1YEEL 1H3UA 3OKLA 2SEBB 3LKSA 4MCZA 1SJVA 4ZOCA 2Y2TA 3UACA 2B1HL 5GS0D 1VAHA 2NZ1A 5DRWB 3T3MF 4ANKA 2BS71 4Z3IA 3W3BA 1PVHA 3ML8A 2XUWA 1JV2B 1Q0XH 3ALWA 3HC0B 2EYSB 3MRFA 4FFYH 3QSKB 3LRLA 2Z4QA 4PRDA 1JTOA 4X6CA 3TJEL 2C1PA 1QKZH 4ATWA 4TTDD 2ZWYA 5B1BB 3FU5A 4FFZH 3L6FB 3P2DA 1CL7I 1G9MC 2FIKB 4BCZA 1ZVYA 1DFBH 2IGFL 3QIUB 2D3VA 4KKCD 2ZYRA 4O51B 3VDAA 2XU9A 4WUUE 5EOQH 2GSGA 5FDYA 2G5UA 3EO0B 3VD0A 3K72A 2M1KA 1JUFB 4PJIE 3N1MC 3WJMB 4JG9A 3EJTA 5I0VA 4YHKL 1HZHH 1AP2A 2E3VA 4YEEA 4A7GA 5GS2H 1OTTD 2NDFA 4OJAA 3PJLA 4MXVF 5IVNA 4GBXB 5H37H 4N0UE 4ODTH 1X7SA 2F6AA 1XGPA 4OFDA 2EUVA 4FQCL 3KWWA 4FFVD 1ILSA 3CXHK 3KBEA 4HUXB 4L4TA 1HEHC 5CLZA 4AIOA 4F20A 1INEH 3LEXA 2C9SA 4HIIA 1U8PA 4I0PB 2AQPA 2VH5L 4IS6A 2DWDB 3L7EB 3ASWA 1ZPLA 3FTGB 1BG1A 3L3GB 3WIIL 1HKLL 2WOYA 5DVPA 2DW5A 3S36L 1A02N 3SE8L 3QRGH 3H85A 1QEXA 3BUTA 1VKXB 1E4KC 4JKNA 1NM9A 1FFNA 2ZUQC 2FX8L 1WZKA 3RFZC 4OCXL 4I4WB 4JDEA 2E46A 1T66D 5FYKL 1MI5D 1R3LB 4K7PX 1HSAA 1LQBC 1ETZB 3OPZH 4BFFA 5DUJA 4NI6A 3DX6B 2OMYA 3WD5L 1XDTT 3D33A 4QHNB 3V4VB 5IROD 1Q9KA 1SUJA 2XV6B 3NCJH 1DQLH 1WA0X 4HH9B 2WM0A 4H5SB 4IMLB 1OGSA 4OLYL 1J8HA 2Z0BA 3B2UD 4FKHA 3T3ME 2K0RA 1TG8A 5K93A 3M7FB 1A6TA 3AROA 4EI6A 1FNGB 5FW6A 1KBGL 4FXGA 4LVOC 5DJ2A 1UXWB 1B3JA 3VH8G 2UVFA 1T1WB 8PAZA 4R4NC 5EPMB 2Q76B 3A6CH 3N41F 2AANA 5IB2B 3QORA 4HH8A 4JO1H 1OGPA 4P23B 1JTTA 5DO2C 4XMKL 2WNKA 1N7ML 4IBQA 4UBDC 4XBEL 2X2UA 1JGUH 2XFXA 3D39A 3MCLL 4QJ4B 4UTAA 1F6AB 1LVEA 3UC2A 1JWMA 1EBAA 4TUUA 4LAQL 1CYWA 3GRWL 3OZLA 3ULUC 4Z8FH 1TJHL 3QEQE 1RIVH 3VFUB 3PYCA 4P48A 3JT2A 3NCMA 3HE6A 3PF2A 2J44A 4KKNA 3VW3L 4JY5L 5KSBF 1T2JA 4N2BA 3CDGA 4XPFL 3DROA 1WZLA 3EOTH 2Y22A 4ZAKA 3DOIA 3Q8AA 1IC0A 4P4RB 3QUMB 5ERWB 1A6ZA 2X9ZA 4HUCA 5INDA 4O58L 4KQ3L 1ZHNA 3FYIB 3CN3A 4EBQL 2OK0L 3O2VL 1WBXA 1E43A 3GDCA 4Z5RA 4QYAA 3H42H 2YRLA 5AVUB 3WENA 2XKNB 3RP1A 5IQ7H 4OCXH 4HHWA 1XF4A 4JLRA 1O6SB 5HPOA 4TQIA 1RERA 1IKFL 1F45A 2YR3A 2OJZL 2PYEB 1QFHA 3LNHA 1ED3B 3CN4A 3RIAF 2Y7OA 3UAAA 4DP9X 4QNPE 4S2SA 3FJTA 1G1YA 1GPOL 1TQCC 1T0OA 1TEFA 3Q3GA 3PAVA 4N0FA 4GUCA 4ZXBB 2FO4A 4FGMA 3LEYH 4HOWA 5EF1A 3TBTA 4Y89A 2ZXDA 1EAPB 4DOHE 1IU1A 4R96A 4Q89A 1HZKA 1XEUA 3C9NA 2BJML 4M6OH 5TE7H 5FHBL 2RIKA 3FYEB 3WJMA 5DGRA 4JRFA 2FX8H 5CINH 2PWDA 2GJZA 5D4IA 1Z7JA 4RDQF 4F15C 4HJ1A 5DUBA 2BOLA 4Q74A 2VDLL 2DQCH 3MXWL 1RK1B 1KDIA 1MFAH 3MBWB 4M48H 2YSSA 3BMVA 4K9JA 3WIIH 3MOAL 4F58H 3KWWB 1DVSA 2OZ4H 2XBDA 4LLAA 2HN7B 35C8H 1JF6A 1NAMB 3UOAB 3SYOA 3RILA 4A39A 3LVTA 1ILUA 3RIKA 3EH2A 2J73A 5G5DA 2EXYC 2FUTA 1WISA 4XO3A 4IRJC 5C0CB 2NYKA 4GRLA 4R5TA 5K1JA 3OKYA 4B97A 2LABA 1Y0LB 3L3HA 2CKBH 1HYSC 5ANME 4NKIL 1XH3A 1M2VB 4X6DA 2ZKHH 3BRFA 1X5KA 5TPWL 4AYFA 2VDOB 3MREA 4HCRH 1CXHA 4Y4HA 3IMSA 1J8SA 3TBWA 3PJNA 1Z5YD 3C5SA 1MFNA 4URTB 3JSSA 4I1RA 4JN1H 1CLYH 4NXSA 5GIRB 5IG7A 4TQEL 3JWOC 2QDVA 4HWZB 1AZBA 4MA1B 5FYJL 2OXHA 4MDJB 4J1UA 4WY7H 1TTRA 3T9WA 4YHNA 2AI0