4BUQA

Crystal structure of wild type fimh lectin domain in complex with heptyl alpha-d-mannopyrannoside
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Cell adhesion
total genus 36
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4buqA00
2W07B 2WMPB 4XOAA 4X5QA 1N0LB 4XOEA 4X50A 4CSTA 4AVJA 1PDKB 4AUYA 2XG4B 5IQNA 5AALA 2VCOA 5F3FA 4BUQA 4AUJA 2XG5B 3ZL1A 4XO8A 3ZPDA 3JWNE 5IQMA 1ZE3H 1UWFA 2JTYA 5FWRA 4AUUA 5ABZA 5F2FA 4AVHA 5FLUA 4XOCA 3ZL2A 3MCYA 4ATTA 4X5PA 5JQIB 4XODA 2UY6B 3JWNH 3JWNG 3ME0B 3SQBB 3BFWA 2J2ZB 4J3OF 5LNEA 4J3OG 5AAPA 3RFZA 4AVIA 2JMRA 5LNGA 3BFQG 5CGBA 5IQOA 4XO9A 4XOBA 1KIUB 4X5RA 5FS5A 4AV5A 3BWUF 4CSSA 1TR7A 1KLFB 4CA4A 4AVKA 5AB1A 1N12A 4LOVA 5FX3A 2UY7B 4AV0A 4J3OH 1QUNB 4AV4A
chains in the Genus database with same CATH superfamily
3UZQB 2FGZA 3RVXC 3KDPB 4G9DB 2Y2WA 1RJCA 3WMSA 1QI3A 2ITFA 3H55A 2DQJL 4BK4A 2ADYA 1JVOA 4P2AA 2A3TA 2Y1AA 3ILQD 2J3SA 2VERN 1WA0X 5BO0D 3O8XC 4GRWE 1CGYA 1N0LB 4ODXB 4AGQA 5FO7B 4R4FL 3V6ZA 1HU8A 3HC4H 5EUOE 4DP2X 3ARBD 3VQLA 4EUPG 5EZLA 1RHHA 4OLUH 2GJZB 4N1CA 2N0MA 3PQYA 4YDVB 2BP0A 2XNAA 5C9JA 2VZVA 4IDJL 5LWYL 2KDGA 5GSVA 5HVHB 2KLRA 4JFWA 2YJQA 3N9GL 4KV5E 4P5MA 3LRKA 5E2UL 3TP4A 3ZRFC 1NDGA 1V3JA 2WHVA 1SJEA 4A37A 3P2TA 5A7BA 1HK6A 3RE0A 1KY6A 4OF0A 3N55A 1FC1A 4NUQA 4FNSA 2D3JA 1RZFH 4K07A 1DZBA 3I3BA 5FV2A 1NGXB 3QFDA 3NRFA 4EZLA 5ALCL 1X4YA 2EINB 4ONHA 2EDLA 1YEKL 3BAWA 3BE1L 4J3UA 1PQZB 3L4CA 2GAZB 5A2LH 2RCSH 3MJ7A 4ZAKA 2CLVB 3V79C 4JG1L 4BFRA 4GQRA 3TFKD 3MA7B 5D5ME 1KTKE 3CXHK 5L4JA 1S3RA 5GRVL 3ARQA 3JVGA 3QCVL 4HLZG 3QZOA 4QLRA 5JA9A 2KZBA 3VXME 3R8QA 3FBQA 5IVZB 4KHTL 2E7MA 1JJUA 1IGIH 2F74B 3FL7A 3L2MA 4NQVA 3UDWC 4CKQA 3LKPA 1M2VA 1OT4A 4Z8FL 2J6EA 4LCWE 3RJQB 4HV8B 1PJWA 4PN6A 3FYEB 3TJEH 4HUXB 3SYAA 4ZD3L 2DD8L 3MRCB 4XE5B 1F3JA 3KWWA 4EUPB 1N70A 1W0WB 4HFUL 4JFEE 1TO4A 3BVUA 1EERB 2V2WA 3CLFH 2OR9H 4FQIL 1AH1A 3P69A 1VA9A 4FXKC 4AI7A 5AVTB 1UUSA 3U48A 1C7SA 1ZIBA 1JTTA 2BJMH 1GGCH 1AGEA 3WJJC 1P84J 2DW5A 1XEUA 4YBQC 1U8JA 1DQJA 2AXGA 3N0PB 2XQ0A 4QO1B 2FYVA 1WS8A 4XP9L 3BDBA 3WN5C 4HCFA 1Q94A 1T03L 4KZDL 5ISZA 1HSBB 5CCJA 1JAEA 1PKQB 1W6WA 3QE5A 4HX1A 4MVBC 3SDXA 2Y2TA 4BKTC 3K6DA 2YK1H 1LHZA 2VLJD 4KVPA 3TN0C 3O6FD 5IMKA 3HE6D 3LNEA 4K7PH 4DETA 4KK5D 1S8DA 1GXEA 3AROA 4X9YA 1U92A 4P49A 1DQKA 2YA1A 1U33A 5E4EB 1XAKA 2XWZA 5AYTA 5DWUL 5F0JB 1XDTT 1OWRM 4X80H 3SGDI 5HYJE 4F8LA 4Q9BA 1BQHB 4UV7H 2MMXA 5JPNA 2WNGA 3HZYA 3Q01A 1XMWA 3LZFH 5EC1B 4XB3A 1EFQA 3ZGIA 3LPGA 3MNZA 1T0OA 1CTNA 3E9TA 4EI5B 4AJWA 1YUHA 5BO1L 2AJZB 3EYFB 4DWHA 1KWKA 1MCFA 3R4DA 3T3PF 3JWNE 5LG1A 1DUZA 2ENYA 1CYXA 3CQQA 1VFMA 2XWEA 2GPZA 3SDAC 1E9OB 4S2SB 3J27A 4PP1D 4I0CC 3KE0A 1B88A 3PP3K 5CHNA 3RKDC 4Z78B 4QHMA 4KVNL 4JFYA 2ICEA 4JHUA 2XYBA 1WCBB 4OI9A 1QPKA 4AUUA 4G8GB 2BIPA 1DEEB 1TJXA 2A6KB 3GI8H 2KMWA 3BRFA 3HFMH 2WNXA 12E8L 1M71A 2GBAA 1E4XH 2Y36L 3MOAL 3PWJA 5C0DB 1I8KB 4Y5YC 5KVGL 1X5MA 3EYQD 5CP3A 3V6OE 1MELA 3TM6A 3KPQA 5HTSA 5CEXB 4QGYA 2R69A 1EXUB 4WEBH 3V5HA 3TH3T 3TEUA 5FO8B 3EBAA 3GLAA 5LAXB 2R59A 4YBLB 4AENB 1NEPA 4QXUH 5CWSA 1M3JA 3DXAE 1UWXH 2ZYHA 3FQ2A 1U8CA 1Z5YD 1HHHB 4HWBL 2HRLA 4H1LB 1KGUA 1Q0YH 4LCVA 1UCTA 1HH6A 1FORH 4PRHB 5T1DH 4QRSB 1OV8A 2OL3B 1FVEB 1HE7A 3BN9C 4JO4L 3TO4D 2EDXA 3ZL4L 1QBBA 2V7NA 2VW4A 3EJSA 1M53A 1QLEB 2HP4A 4AH2B 3DOSB 5DZAA 4ZYKB 3GGWB 2LHAA 3EOBA 3UACA 1TTAA 2ADGB 4M6OL 4AVKA 5KSBB 4UIMA 2RMNA 1GYUA 2FJSA 5I1HH 1OPGL 3K8LA 2EIDA 2BXYA 3GJFK 4GNKB 2GJ6E 5JR1L 1P1ZB 3DHPA 2ZUTA 3RFZB 1BA9A 5LDUA 5FIEA 3PWPB 4UBDC 4EVNA 5I15H 1TYRA 3GC3A 1IE5A 1W72B 4Y7MA 3CHXA 2Z4QB 2OJEA 1UT2A 2PPAA 1PCSA 2B08A 3UTSD 4S11A 2PPCA 2YMXH 2X1XR 2GK0B 2MKWA 2P5WE 4GS7C 3T4AB 3WU1A 1XF4B 2LU7A 1D5RA 2OI9B 4P46A 4EO5A 3UTQA 1ZT1B 3J2PA 5IFJA 5GGSB 3MBWA 4NO3A 4XTRD 4GI6A 4CAGA 2DY2A 1NWOA 1ZRUA 4DKAA 3EO0A 1BVKA 3FO2B 1T1WA 1YNKH 3BUIA 2O72A 1LD9B 5K1VA 5GSVB 2X2HA 1ML0A 1SY6L 4PTTA 3CC1A 2ZP8A 1RIHL 2VQUA 5D7IA 4TUUA 1XGRB 5EU6E 5KYUA 5CFAA 4HUVA 4DTGH 1BREA 4JFOB 4U1JB 2H32B 3GBLA 2BHZA 4C56B 3TT3L 4G7YL 2VO8A 3VWJC 4MBRA 1MI5A 1V3MA 1PD6A 2ICWI 1UD3A 5LUMA 3UYPA 7CGTA 3ZKSD 1EO7A 1WC7B 4NXKA 4MCYA 3G5ZA 4O02A 5EZOL 4YPGA 3WNKA 1MXDA 2BNQE 4A67A 4ENZA 3EFOB 1YN6B 3RGVD 2FQGA 3GJEB 4RVBA 1YECH 4DCQA 4CDHA 4QKTA 3ZSTA 2OMWB 4W6WB 4P9MH 3FU7A 1BZOA 4NHUA 4ZFOL 1OALA 3GS0A 3O4LD 4RISL 3OKDB 1XO8A 2YPVH 1IIIA 1OLZA 1FE8H 3L13A 3EYUH 2BOCB 2XA8H 2R15A 4ZFFB 4C4KT 1T4KB 4WDIA 3LXBA 2WXLA 4RZKA 4QXTB 1OTTC 1TJGH 2Q8BH 3QULB 4N1HB 3H9HB 3IDNB 4P04A 5C6PB 4JY4B 4PU2A 4XC1L 4ETQB 1Z6JT 4UQ2A 1IM9A 1R24B 5HVWA 1D7BA 3G5YA 2QSQA 2VDLH 5C0AD 2HVJA 3OR7A 3E6HB 5DR5L 3H9SE 3CFCL 2NY2D 2BY3A 3UG3A 4AY0A 1W0YT 2HLFC 2ZUSA 1L9PA 5FOJA 5AD0A 2EDEA 1W2KT 1Z9MA 4RNRA 1NCTA 4X83A 3VTAA 1Y0LB 3GT6A 4MA7L 3RGBA 1QLFA 2Z92B 1DSFH 2CCVA 3QIUD 1U8LB 4P4KB 3QEHA 3FUJA 3IGFA 2YPKA 4OB5H 3O9WA 4KK9D 4WKZA 4YC2B 3RTQC 3R4RA 1GJWA 1SJHA 2YQ2A 3EOTH 3FB6A 2QGEA 2JCCB 1JK9A 4PJBE 4QNPF 4X6FB 5DF0A 1E4WH 2VMEA 2CR0A 5DUJA 4X6DA 1CDCA 3DUHA 5FK9A 5H8DA 2I85A 3N42B 3WIIH 3NZHH 4EPSA 3QRGH 3LN9A 4HGMA 4W9IC 5E0QA 5KSBF 3QAZC 3R1GL 4XNMB 1ZGLP 4QLWA 1JUFA 4IOFD 3FXIC 1HILB 2ZSWB 4HJ0C 4HWUA 4TUOB 3TA3C 5HYQB 1RSFA 3L5IA 1CDBA 1NZRA 5FF6A 3DSFH 5BZXA 4MKMA 2FUQA 4HDIB 5SWSA 4PJ8A 3N85H 1F11B 4JPKH 1F1AA 4R26L 4EBQH 3VG0H 1FBIL 5JPNB 1PIFA 4X99B 1Y1UA 2WXNA 4BFEA 3FHAA 5HJ3B 1T6BX 1ZTXL 3RVTD 3LKNA 1RZ8A 2FECL 1LK3L 3HG1B 3BUYA 4XO8A 3PAUA 3TL5A 1U8OB 1A6WH 1NDMA 4AJ0A 4YNYB 3LN4B 5SX5H 2YXFA 3V52H 2QHRH 1HJCA 3F2LA 4JM2D 2EDOA 5D1XA 1NLBH 4HC1L 1DZ0A 4KMTH 5F9AC 2LTQC 4FD0A 1CE1L 3F62A 2YD7A 5I1JH 1LEGB 1LLAA 2AAAA 1TZ8A 2CQVA 3UGXA 5I1DA 3KS0H 4GBXC 4P48A 1ROCA 3S98A 3TT1H 5DQ9A 5TDNB 3CN0A 2GUOA 2XZQL 3QDGA 1F5WA 4QOKD 3KPTA 2Z7YA 1Y07A 4FA7B 5CGYC 2AK4B 4AEHH 1JI2A 1HWWA 1N5AB 1Y7VA 2C8NA 5HPMB 4E9RA 5I8CB 4GRWH 2UY6B 4P99A 5T33H 3QJOA 3HC3L 4WKXA 2RB8A 3ETBF 4Y16C 3VFUB 5AOKA 2XWTA 2JIXD 4WW1B 5FDWB 3KBPA 2VXQH 1WAEA 4H40A 5EU7E 3AXLB 1A6UH 2CJUH 2PYFB 5FO9A 1YQVH 4HFWB 4F15B 1K2DB 1KB5B 2GFBA 4AW7A 1JGLL 2GI0A 1QNZH 3T0AA 3VI3B 2LAGB 4IRSD 2CAKA 4KXDA 1HH6B 2E47A 3RQ3A 2DKUA 1PL3A 4XWGL 3RJOA 4WY7L 4FL4C 4KFZC 1MHEA 4QJ5B 2L04A 5K93A 5KBKA 1WUZA 2CWRA 1D9KB 3V7AE 3VQMA 2V17L 4AQ8C 3L7FA 1I3GL 5AZEL 3SBRA 3UPCA 4MD0B 5IG7B 1JNLL 4FP8H 5KVDL 4CU8A 1KCRL 5AKSA 2VE6B 3UMTA 1FGVL 4ZUUB 4FTVB 4CRPA 4ACTA 3AGVA 3OKMA 3JV4B 2BRRH 4JREC 3GRGA 3EHBB 1H5BC 3WFBL 3VD4A 4UT7L 5BVJB 2EUZA 3EH1A 2FAUA 2BHYA 5BS0B 2NX5A 3W38A 1FN4B 5ABDE 4Y89A 3H2PA 5CUSL 4BFBD 1RP9A 4C83A 1OHQA 3RBSA 4NEHB 4FHKA 1CXFA 1OGAA 3TH2T 1XZWA 1ZKAA 2ICWB 4N26A 3M6DA 1ZMYA 2IGLA 1NFIA 4NC1C 4LNRB 1MCKA 3DX1A 4LPYA 2CRIA 5E9AA 3ARBC 5IGXL 3C9NA 4GMTH 1TVDA 4O51A 4Y19D 2VO5A 2YAOA 4YHPB 3KDMA 4JN2B 4F9PC 1LEIA 1GZHA 1P4BH 5BZDB 1OE2A 1SXCA 2MNWA 3BQUB 2JCCF 4UQ9A 3SKJL 4NQCA 4V1DB 2A1WL 3D3VB 1GZQB 1BM3H 3WNOA 2ZAHA 4P5KB 3QUYA 1GOFA 3OLEA 1F97A 3QNXA 2WBWB 2WOYA 3ULVF 4G1MB 1W91A 1AKPA 1UCBH 3V4VB 3GZKA 4M43L 1FP5A 4XP4H 4GQZA 3RU8L 4XHJC 1A14H 2I27N 1OAXH 3T2OA 5E6ID 2XVKA 4QRPE 5B1KA 4HOWA 2OZ4H 2C3HA 1MVYA 2YKLH 1E4KC 5JXAL 4GAJH 4KY1L 1X5KA 2K78A 4Q97A 3AWEA 4QXGH 5AVRB 1R33A 3ZO0A 3ZQ9A 4B9PA 2VUOA 1B4JL 1ZT7B 2Y9RT 4MCYB 2B9AA 4JVPA 4TPRL 3UAEA 4NNYB 1R3IL 4NZJA 4XGZB 5DHVA 3BEVB 1HC1A 2H9GA 5DMGD 4ADJA 4RH4A 5C86A 1AMYA 3AM8A 1SNRA 3A4EA 1X4XA 5E1QA 5I2IA 1CFNB 1UOKA 3KNBB 2BW4A 1IGYA 4K3DL 3GSRB 5JW4Q 3B37A 1U6AL 5DJ0B 5C09E 1BEYH 5FGCE 4CKVX 5CINL 1MCPL 4D8OA 4M5ZH 2AGJH 4WJ5B 4XI5C 1LNUB 4P57B 4CMHB 4N68A 4YHOL 1SXAA 5TQ0L 3VMPA 3ZW3A 1HTYA 2AEWA 3QIBA 3ZT6A 4OZ4B 2C34A 2GSGA 3NMEA 1KEMH 3KZ8A 2ZKHL 1JZFA 4Y4HC 5EIVA 1J8KA 2R39A 4WI0B 1NGPL 5AQ0A 4W1TA 2PPDA 1WZLA 2UXTA 3U36A 3VCLA 5FPIA 4PV9B 3T5WA 1J0YA 2CU9A 1Q38A 2XWCA 3LIZL 4QCIB 3T0EB 1L0XA 4S1QL 2OMUB 3S5YA 5DT1H 3OPUA 2D03H 2MHAA 4AG4H 1TQCB 2WIIA 1DBJH 1LDSA 3DGGA 4LPTA 5AZ2H 5AB1A 3ZTCC 4N2HA 4N2OA 1E3XA 1Q0XH 2V9RA 5HYSB 2AJXH 2DBJA 1MN4A 2XX1A 3OD3A 4XPTL 1VEPA 5DFVD 3VI3F 3INUL 4WWPA 4L29A 3ZUNC 1XZ0A 3O6FC 3N6YA 4D7BA 1ETZA 2WMPB 4OUOA 4L37B 3HE6C 2DQFB 4I0PB 4KK5C 3KYNB 4QAMB 2HKFH 4W9CC 4EMZA 3QJZA 1A8ZA 5BV7B 5EZJB 4FQXA 4AW4A 2O1AA 1FZOA 3CUPA 3UEZA 4MMXB 3X2QB 1PPIA 4XO5A 5F6IB 3J07A 1KJ2A 4UB0L 1ADQH 5K9JH 2NY1D 2IPKB 1IAIL 3AT0A 3GIZH 3OKNA 1OO2A 3U4BL 4YPJA 4TNVK 1RUKL 2X38A 4XVTL 1FNHA 2OXHB 4M7KL 4Z95H 3KG5A 4OZFA 5GXBB 2CPCA 5DRWA 3ZE0B 1CLZL 4JJ5A 4PJDB 2J88H 2JKJA 3SBPA 1I85C 4MJID 3P9MA 3QYCA 5D96C 3B2XA 1QSED 4I18A 5H37A 4WWID 1WT5C 3SODB 5IQMA 3RDJA 3FB5A 4AMXA 1IQWH 5I6XB 5C0BE 1ZHLA 1NCCL 4P2RA 4B41A 1BPLB 4PP1C 1EVUA 1AACA 4Y5YA 3ZSSA 2ZKWA 2IO5A 4JG5A 3QQDB 4R97B 5EULV 3T09A 3CVHL 4WSGA 3GBML 4EXKA 2BFGA 3MBEA 2N7SA 4HF5H 4LCUB 3N5AA 1PZ5B 5EU5A 3TBTB 6TAAA 2XN9B 5C07B 2EDDA 4PIBA 2L0DA 1RJYB 3OF6A 1S9YA 3HPJA 4PGBA 4YUEL 3PGFL 4QTIH 3C60D 3BIAX 5ACZA 5LBGA 5JPMC 2BSTA 3MRJA 1UH3A 4IKKA 2JB5L 3I6KA 4BQ9A 3AMLA 2KL6A 2NT0A 3B9DA 3ME0B 2RBLA 1R3KB 2VIRA 2HT4C 3RI5F 1OD7A 1KGYE 5E00A 4AGMA 3KM1A 2H0EA 2Y6TE 5HHOB 1BW8A 1J1PL 1KFGA 1G1CA 3H6JA 4PI2A 5CGBA 3BDYH 5CLYA 4PHXA 1YDPB 1TKWA 3QUZB 2FNBA 2E9BA 5DEFB 5SWQB 2H0PA 2DEWX 3OJ2C 4B27A 3B34A 3MLRL 5ECJE 2EVGA 4M8RA 2QSTA 3WEBA 1F58H 3VDBA 2Z6FA 4G6KH 1KFAL 2WIMA 4XP6H 5AUMA 4JZJC 2Q8AL 3RY6A 1RH8A 2NY4B 5F0MB 3E1F1 1U3NA 1FL5A 4LHQB 1FL6A 4XPGH 4OUUB 1G6RA 2CJTA 3GMPB 5IOPA 1AR1C 5DMKB 3T2NL 3WTVA 3DX7A 1AD9A 4NUJB 4N6QA 3L4UA 4HHGA 2D7TL 1QA9A 4Z18A 3FO1B 3QWOB 1FO0A 2AXFA 2QPEB 3HKFA 1DP0A 2FT8A 5KOVC 4KOBA 3O8XB 4TOYL 1E6OL 3C08L 3NJHA 3WO3B 4L8SC 1O75A 4C83B 3QZBA 1T0MB 1NCAL 5E7FA 3QPQD 1DVYA 1EVTC 1INQB 3KJ4B 4KAQL 3PUUA 3HFFA 1PKQE 5SX4H 4DN4H 1NC2B 4OIIL 5FHBL 4AYFB 4L2YA 1AQMA 2D9QB 5GGUB 3QDJA 4F37F 3QJHB 4JE0A 1G7MB 4L4TD 4WCYH 3FCTA 3MTXA 5LBSA 3CSGA 2HX8A 4KH2A 1WEJH 2Q9OA 4NNXA 1HZHL 2VZUA 5TE7L 4FTDA 3VRIB 4MLIA 1A8JH 5EPMA 2F54D 5LBVA 3UYRH 3VWJA 3VD9A 2EDKA 2WXRA 4LKCB 1I9EA 4ANKA 1YMME 5FYLD 2B4CL 1T3FB 1EGJL 1RIUH 5HI5C 3FONB 3QJTB 2CD0A 4E42B 3FQ1A 4OZIB 1WAAF 1KIRB 2F0CA 4FI8A 4G9FD 3MJ9H 1NCBH 4FS0A 2MQ0A 4U3SB 1BD2A 1QP1A 3QT2A 5DJ2A 2J4WH 3BSHA 1HQRB 2AQQA 3FRUB 3ZE0F 3VFTA 4AEEA 5KG9A 4PJDF 3I3EA 2LV4A 1S7UB 3D09A 3LPPA 1MFCL 3EDFA 2CKBA 4DT2A 5BNXD 1J88A 1TSRA 2H8PB 4JAMB 5J3HD 3HVNA 2QQKH 1II4E 4YQXH 3BH8B 1SGKA 3IDXH 3Q6GH 1UACL 4Z7QB 4AM0Q 1VACB 3CJJA 3DO7B 2AJVH 3L08A 4K3JH 4FXKB 1BX2A 4G8GE 2WINA 5I75C 3KW7A 1UD6A 4KHXH 2NZ1A 5AB2A 1N8ZB 4WO4A 2JJSC 3WAJA 4PGZA 1J5OL 4LDEB 3TU6A 4OZFG 4K5OA 4XBMA 2E8ZA 3NCBB 5EF1A 4IJTA 3E3QE 5IB1B 2EYTA 3MUY1 3KYOB 4DGIH 1AG0A 3WN5B 5EUKA 3QSKB 4NCDA 5C0FA 4WTQA 3TOPA 2IANE 5DDHA 2OK0H 3D18A 3US1A 2XVBA 4XPFL 3T8XB 3TN0B 1LO2H 2I69A 4PRHE 4D8PA 3ECWA 1MFVA 1U2HA 4QNPE 5CN2A 2AV7A 3H54A 4FXGA 2JB6B 2HT3C 1M7IA 1RUML 1XGPA 4X0KA 1TPXC 5IY5B 2ZKXA 3SY6A 5IESH 4LVEA 3WUWA 4G11A 5E9DD 2BOBB 3AAZB 3GSQA 5KSBE 3D69B 2XV3A 5DFTA 3ZT7A 2JWYA 1LP9A 4RDQF 1QFWH 1T1YA 3DPDA 4D9QD 4NKOA 5ES4B 4IOFC 4QHUA 2XN2A 3IWVA 4I7ZC 4BK5A 3O6KL 3OKKB 2JQMA 3CZFB 1U0QA 3CDYA 1JHKH 1Q9KB 2CMRH 2CUHA 2E56A 3P2DA 5IW6A 5A2BA 2W0FA 2ZOLB 3DDFA 5A3ID 3SKOA 1E5BA 5FFOA 4BUQA 2WXGA 2XUWA 3PNWA 3TYFA 3E8VA 5CFHA 4Z7UA 4PTUA 3SDAB 4F24A 2Y06H 1K6QH 3UTOA 2XV2A 3TBVA 4BELD 1Q9LA 3IFOB 5IT2H 4G83A 5D4JA 3GSUB 2JJUA 4G3YH 3UC0L 3WY3A 3M86A 4LLDB 4JZNB 2VT0A 3FSAA 5DHYA 5J13C 1HQ4B 3ARGA 2VDOB 2WYHA 1VFAB 4NRZA 1D6EA 4BUHA 1YHPA 4IMLB 5F2FA 4ZZFA 4RA3A 3AUWB 1BLNA 2GTZA 5BUGA 1FZMA 3AWFA 5HYFA 3WMQA 4JFDA 5GZOC 4XOCA 5HHMB 2ZWKA 1THCA 4XMVA 1PFOA 1YNTF 4XCYA 3WNJA 3NA9H 4L3CB 2O4EA 3VB8A 2YD9A 1Z0MA 1UG9A 3MRIB 1M9WA 1HOCA 2Z9TA 1DSYA 5I9QB 3F7QA 3IU4L 3ZHLA 4QF1A 2EXWD 1Z3RA 4S1SH 2BVUA 4UILL 3S34L 5KN5A 1T20B 3ARPA 1IARB 1QFUH 3RKPA 3V0WH 4M61B 3QYNA 4G80B 4NERA 1WG3A 3QZWA 1M1XA 2A6IA 3ORJA 4G7QB 4JFVA 4AQ8A 4HH9A 2AXWA 5DLMH 1P4IL 3FPXA 1JXJA 3K72B 3DSNB 1T22B 5DTFA 4I9WE 2K3HA 1AVAA 2GSIA 1UT9A 4X5RA 4LOUD 4NC2B 3PP4H 4MXVF 5HHQB 2F58H 1KGCD 1UOWA 4W4OC 2ADIA 2GBVA 4LOVA 5A16B 2YQBA 4JLRB 4ERSH 4EQ2A 1ZHNB 3LXCA 4B7IA 4POZC 4R2GD 2COVD 3VTTA 5AW6B 1NGWB 1CCZA 1MHCA 3QHZL 4OFIA 4X5WA 2WNWA 4WWKC 1IM3B 1XF2B 4XN5A 2IQAB 1MW1A 2DJSA 3ARBA 4AE0A 2ZCZA 4HK3N 3SQOH 3TV8A 4ONGL 4XNQB 3F7VB 3FU6A 2ATKB 3WAKA 1E67A 2YD0A 4LCCA 3RDTC 2VDNB 1INEH 4HLEA 4NO5B 2KUTA 4NCC2 1ZCRA 2KZKA 2R83A 5I8KL 5IR1A 4TVPH 4OD2A 1OKEA 4QJ3B 1CLCA 4NKMB 2EH7H 1AAJA 1AC0A 2PYEA 3GTVA 3CZEA 5E1AA 1RV6X 5CGTA 2K6WA 4N2LA 4M93C 4XPAL 4JANA 4LOEA 5T1MA 5GSRB 3QUMH 3G6DH 4Y8DC 5EOTB 4YDJB 2XTJE 1KIPA 3OHMB 3ZDYB 2EEFA 1LE5B 4RRPG 3KGUA 2VB5A 2R2CA 4WSJA 4KK8D 5DJAA 5BRPA 3ULVE 4HJJL 3B43A 3VWJB 2CK0L 3MN8A 4JN1H 5DZNA 3OLGA 4B3EA 4M02A 5E6IC 4XVUD 2FWOA 2VKWA 2WQAA 4K0OA 4Y2OA 3EJJX 3O45B 3U2SB 5E5LA 4PY7A 4XBPA 2ICCA 5CP7A 1QO3A 4BCXA 2OR8A 4JHAL 3QG6A 3RZCC 2ZWLT 1XBDA 2C9XA 1T0NA 3HG1E 3WO4C 2QQLL 3AU0A 2BSRB 1P69B 4X5PA 4XNYL 1FFNB 3RWCA 5JQIB 1Q9OB 1YEJH 1KXVC 2PP8A 3HMWL 4I3RL 3V0DA 1A6TB 1MCOH 3WUWG 2OYKA 2G2PA 4KPHH 4AK2A 4KKCD 3L1EA 1JHLL 4Q6IA 3P3RA 4M3JA 5HYIA 5JNYA 3FFDB 5GISL 3WELA 5INCB 1OP4A 4KRPB 3DYPA 4F7MB 1DL7H 4RMSA 3B8YA 3I02B 1MLBB 3DK0A 3QS3A 2AK4E 3W5MA 1P9MA 4O4YL 1GGIL 4WJG3 2BVTA 4PWJA 5I5MA 3C5ZD 3AT9A 1WZ1H 4C4UA 4QGTA 1CLYL 1B2WH 4B9FA 2B1OA 2ZJSH 2H41A 3LH9A 2AK1L 1UYWH 2VLJA 1BVNT 3FH7A 3RTQB 5I1CH 4E0RA 2WBXA 1FVCA 2X6CA 3HE6A 4GO8A 3BW9A 3RHWF 2JCWA 3VI3E 1J8RA 3PPEA 2RFXB 3T8MA 4F57H 4EN3C 3WENA 3QWNA 4AQAB 1HINL 3UG5A 3QG7L 1WK0A 1R3JB 4OT1L 4NCC1 2YPLA 1QYGH 2VDPB 4OD3H 4P3DA 5DD6B 3BH4A 5CSZA 2WLIA 2E7BA 1RZKH 3QAZB 3O2WL 1TFHA 1TCMA 3H3PL 5LKNA 4HIIB 1KLGA 4Z9KB 4U7MA 3SGEH 1NMCC 3TA3B 3VH8G 4GQ9H 3U1SH 5FA4A 3Q8FA 3IDMA 1R0AH 3QUKB 4MCZA 1JGEB 4AH2A 1D6VH 4AKOA 4FTVE 2PMZA 5TDPB 4WNSA 4RBPK 4C55A 5L2KB 4RMVA 1CR9H 2NY1C 2O5XH 2CA3A 3NJGA 4Z76B 1GIGH 1IVLA 3L3DB 3IXTA 4XCCL 1WZKA 1QATA 5IB2A 3V6BR 1M1SA 1RFDL 4UQIM 6PCYA 5FA3A 4AYEC 4NT6B 2C3GA 5E56A 4NPYB 3KWUA 1DQDL 2GTWA 3ZE2B 3RURA 1JZIA 5AG9A 5F44A 1RURL 1VDGA 4NAQA 3BP5A 2I5YL 3WEXB 1F86A 1MJ7L 2LTQB 3B9EA 3PABA 4OGYL 1CG9A 2VWEC 3FN0H 1Q9LB 1T83A 2EXTA 3NDYE 1LO5A 2I7SA 4GBXB 2Z7ZA 3SDCC 1H3UA 3MROB 4XT1C 3ZKQD 3DUSB 5A7EA 1JGIA 4V1DE 1JHTB 1FZJB 4HSAC 3RP1A 2GTQA 4ODTH 4ADGA 5DK2B 3CIQA 4WUKH 2DRUA 5JPMA 3ZDYF 3BUBA 1FGNH 3OKEA 1EO8L 4YDIL 3UTPE 1JRHH 1RZPA 4JX0A 5IHUH 4DP9X 1A1NA 4F1ZA 4A04A 2X6MA 2MTAA 5G4OA 4XNXL 2CJSA 1RU9L 3D4YA 3C60C 4RAHA 4Y16B 3VH8B 2WWMD 4IRZH 5DJ6A 2AQTA 5CR8A 1L6XA 2F08A 4LEOA 3W1ZA 1I1YB 4ZS6D 3I6GA 4JHVA 3LAFA 1NBZB 3SE8H 1JMZA 1MI5E 3TO4A 1VPOL 3G7TA 1U93B 5B38G 3GXPA 3UBXA 2M8XA 2A6JB 4HJUA 3GD1C 4G8EB 1KIQB 3LNDA 3L2NA 3BP4A 2OTWB 3IE4A 4MZ2A 1D5IH 1WYJA 1JFQH 2W1NA 1ZLSH 4HLZH 1FG2A 4G1EB 1OHZA 1FFTB 4GKOA 3FO9A 1OSYA 2XQYA 1ECZA 2NZ9D 1F3DH 3WHXA 2Y07H 3TZVD 3BPNC 4I48A 1EJ8A 3BPOC 5DTFB 4I77H 3BOVA 4PJGA 3LQMA 4OGXH 3QHFL 3FTGB 1IEBB 1H5BB 3VGDA 4J3VA 1AP2A 3QFGA 4DQOH 5IQ7H 3HUJA 3IJHA 3ZDZB 2YGQA 1ZD6A 3LQAH 3NZUA 1YNLL 3UPAA 1GC1H 4NWTL 1KBWA 2BNUA 3GMLB 3CPLA 5KVFE 3UTSA 1U8MB 4K2UH 2XXCB 4DVBA 5K1NA 4WSKA 5T1LB 2FBJH 4FFZH 4OZGB 4HALA 2IOMA 3T6VA 4PW3A 4UOZA 1ITBB 2P5PA 5C0CB 3S96B 4H0IA 4Z3GA 1FJ1B 3Q13A 1SM3H 3PYCA 4MCMA 2VXTH 3GXMA 4LF3A 5AVSB 1ZGLB 1IGTA 4HWEH 3RL2B 3LS4L 2QMJA 3NJNA 1KZQA 3S36X 1Z5LB 3KS0J 3T1FA 5B38B 1MFBH 2Q7YB 2X89D 5I28A 1I4FB 4YOKA 3QGVA 5ERWA 4AMKH 4AV5A 5BOJA 1DO5A 2WN2A 1GPOH 3KXFD 2ZG1A 3CFMA 5AB9A 3SY0B 4ADIA 3ZYOA 1VZIA 3IGUA 4OM0H 1A6AA 3C5SB 3V4LA 3WLBA 1G0YR 5EIIB 3RNKB 1JZEA 3C8KB 5CZXD 5IM7A 1MSPA 1SYVA 4NB7A 5H4YA 3KR3L 5KSVB 3B4NA 1F4XL 1FFPB 1NDTA 2R0WL 5KAQF 1YY8B 1KPRB 2A9ML 1I8IB 1E5CA 4JUTA 2QJDA 3RGVA 4DUWA 5FOBA 2FX8H 3GBEA 1E50A 2F5AL 4LAQH 3ZE0E 1DBBL 3SKNA 2DI8A 2Y3NA 3ZE2F 5ESVB 4PJDE 3O4LA 3BGAA 3DTDA 4TV3A 4UNIA 1HWGB 1UZ8A 1RJLA 4E9XA 1B0WA 3MJ8A 5CN1A 2P80D 2R51A 4TSCL 5ESQB 5PCYA 2EYSA 4BRVA 5INDB 4NKIH 4N85A 5E2VH 2VQTA 3T8VA 1T7ZA 3MLYH 1BAWA 1HAWA 1UWEH 4J3WA 4LLQB 4ODBD 2WUCL 3VFVB 1MCNA 3EO1A 5DMJB 3BPCB 5DHXB 4IDLA 2FLBT 3VFPB 3I9GL 3LN5A 1JZ8A 1FAKT 1I9IL 2R4RL 5IJVB 3UADA 4WWOA 1BXVA 5C0AA 3EGDB 3SE9H 1IKFH 4I85A 3QHTC 4M7ZC 4Y4HB 4ORGB 2XN9E 5C07E 5CSBA 1FAIH 5CMAA 5J9PB 4HC1A 4C8XA 1VCBC 1W72H 4H44C 3SJVB 5E6SB 1KACB 4NXSA 3P30H 3TEYA 4OV5B 5C71A 3MREA 2VH5H 4M7JH 4TRPH 4CSSA 4QI3A 3QIUA 4LIQL 3K46A 3WIHA 3PY9A 2V5TA 1CT8A 4OLYL 1QFWM 5JW4M 1A1OB 2UY7B 3O6FB 3SSGA 4EIZC 5C0JA 2FEDD 2UUDH 1YYMH 1FVCB 2K9FB 4HIQA 3KWXA 5L0QC 2P8MA 4FNLL 1NCHA 3TH4T 4CVZB 3LZOA 2H2SD 4GI8A 1VIWA 1L7IH 2YFNA 2FECI 4P3DB 4ZPTB 5ANHA 4KMLB 4K7FB 4TQEL 2EDHA 4TLUA 1K8IB 2H32H 5D6DC 4IBUA 4XMKH 3RVVD 2CZNA 2PNDA 1CFTA 1BFSA 3KCWA 4NZRH 3ZDZF 3T0DA 1T1ZA 4P5RA 3WFZA 1G7IA 1XD0A 3S4SA 1EEUA 1VKXA 1FZKB 4GKLA 1NEUA 2E7LC 5H4ZA 4KDVA 4OZGF 3CFQA 1CE6A 5D96B 3IFPA 4PJ9C 4QHLA 2EUXA 3VI4F 4CADA 4GO6B 4CGTA 4F20A 1QHQA 3QEQB 4PG9A 4PREB 1T5WB 4JM2A 4TNWK 1A7QL 3ZO9A 3ARRA 3PXHA 1A4KB 3NFPA 4NC0B 4HOZA 5F7HA 4K9EH 2NNAB 5ETUB 2R23A 5T5FA 4EN3D 1F41A 2J6EH 1XR8A 3B1TA 3QUXD 3UBFA 4XC3H 3FOMB 1PD1A 4HUCA 5SV4A 2GCYB 1T7WA 2ROXA 4QOKA 3TBCA 3UAJC 3ZHKA 4JO1L 3IDGB 4X98A 3U9PH 1PZBA 4YDMA 3VXPB 3G5WA 5A2FA 2B3IA 3MRMA 5I0WA 3PPSA 2DWEB 2JIXA 1JN6B 5J1AB 2EE9A 3NZ8B 4QRUB 1CGWA 2CXGA 4OZIE 3TS8A 4IRSA 4PJEB 2VMCA 3MCKB 3MNMA 5AOMA 3LEXA 2NUTB 4ISVA 4EDWL 3FB8A 1MH5B 2VSKB 1T89A 2Q7AA 3HR6A 3G04B 4B9ZA 1XGUB 1L9TA 3EGSA 3LH2L 4MFHA 3L95A 4PJCA 4JZJB 4IBTA 4KDTA 3NJXA 4W4OA 5D6CA 4ABWA 4Z7QE 4LOUC 1LDPL 4MXVE 1VADA 3O3AA 4WK4B 3IDYC 4XN2A 1TR7A 4JFUA 4KXBA 5LHDA 2XQBL 1AR1B 2AERT 4P2OD 5DVLA 5I0DA 2X4SB 1BFOB 1HL8A 1EPFA 5BQ7A 1TLMA 2ZXGA 3E2HC 3FQWA 3Q3GB 1GMIA 4LPUA 5HGDA 3ZVVA 4X6EB 4ZFOB 4KQ0A 1OT1A 3VYPA 4L8SB 3VXOB 3FTYA 4H0LC 4ORZC 1JGDA 5B1BB 3UJTH 1FHNA 3WYRA 4M4PA 2WJ7A 4KVCH 3EOYG 4UOQA 5ID1A 3VXMD 4F7CA 1NLDL 1NAMA 3V9EA 2DEXX 3PIQB 2OMTA 4LCWD 4ODSH 4UU9A 3PHOA 3A24A 2LT9A 3B9KC 3PDOA 2XBTA 1NTDA 4QJ4B 3GSWB 1P84K 3NVQA 1FCGA 3CHOA 3FT1A 1K4CB 4PV8A 5FYKH 5HSFA 3RWGB 4WW2F 5HHXL 3LIZA 5DD5L 1NGZA 3TIEA 2Z1KA 4DQAA 3QNFA 2BC4A 1MAMH 3PDDA 2BWIA 4HEME 1TZIA 3QS2A 2AJUH 3DRTB 3N06B 5CP3H 1O6TA 1AGCB 3PJNA 3V4UL 2AJSL 5D4HA 2R69H 5FFGA 4N2FA 3GJFB 4F7EA 5HI4C 5HVGB 2H5UA 4GAYA 2H2PC 4D0CB 3BP7A 3ZY7A 3SN6N 1N6VA 3KPPA 4LGSB 2IXQB 4JUSA 2IH3B 1XB8A 2DYSB 4YL4A 1N8OE 1OCWH 5E8PA 1ZANL 2BZ7A 1KWGA 4UQAA 3KYKL 3MRDB 2MCG1 2B59A 4M9OA 1TZGH 2KC0A 1CU4H 3WMPA 3L3KA 4N5EC 1TU2B 2X40A 5HYEA 3QRLA 1IBFA 4OLVH 4QYAA 4MX7B 1RPQA 4W93A 1W15A 2NY7H 2FL5A 1DQLH 1CYGA 4LZKA 5IEKB 4QT5B 1OGPA 3VX1A 2Q86A 1PG7X 4P2RE 1FH2A 4LRNL 3ZT5A 4LEXL 5J56B 5ILTL 2CBOA 5HYJD 1IBGH 3LXUX 4J4PD 4RFEB 5CCKH 4KZ0A 2Z91B 3S4SG 4NLHA 1SDYA 2VZSA 2PCPB 5HHME 2UYLB 3ZUCA 4XXDA 3MLZH 5IFAH 4AWJC 2GITA 1XH3B 4MASA 4DO4A 1L3NA 5HGAB 4OCSL 1KV7A 1GKOA 5HDBB 5F3HA 4G43A 3C5ZC 2UXVA 3WE6B 1BP3B 4ZUVB 3CVHA 2VDKL 3L9RB 4CA4A 1YQ2A 3GF8A 4LARL 4PJEF 5E51A 3U7AA 2R0ZL 5E70A 5HDWA 3LHPL 1IAII 1RKRA 1M6OB 2L4OA 2W9DH 2YD1A 1D3CA 2R1WB 1PW3A 2UWEB 2PXYD 3BHBB 4Z7VB 4WU5B 1TPXB 3L9BA 3PWVB 4POYA 1HEZA 4X5XA 4R0LC 2DQHH 1UHVA 2Y2YA 1S9WB 2IDFA 2QDWA 3HRPA 4BGDA 1SOSA 5FYJE 1W8OA 4ENED 4ZTOH 2GEQA 3IPBA 1DVFD 1MVUA 1MFEL 4JFXA 3K81A 4XXCC 3UGUA 1BWWA 3OQ3B 1IGJB 1JPGB 2AXHA 5T1JA 3KLDA 5C0ND 2IBZX 1ITCA 2IQ9L 1C9SA 3QJRB 5EEZA 2P49B 1Z3GH 3VFOB 3FQRB 2CO7A 3CVBA 5IZ7A 2XG4B 3MV7B 4MJIA 4W9DC 4LVNC 3ZE1B 1QSEA 5MEOB 4O02H 5TPWH 1RUQH 4IOSD 3QC5X 1NJ9A 2FT6A 3U4EB 4MAYC 1PZDA 2CO6B 3A4DA 3O3DA 1TJIH 1TXKA 3L1OL 5EG6C 4ELKA 2JK5A 2J8OA 2PWEA 5J13B 1HKLH 2P24B 1OGSA 3B5GA 1OAYL 3AT8A 1CXEA 2VR9A 3FNKA 5B1JC 2BLFA 3BWUC 1KLUA 4KJQD 1YPZF 4WJKB 2DJ4A 2E27L 3N04A 2HG5A 3DUUA 2W80C 4OCLC 4ZTPL 4ZFZB 1AJ7L 4MA8H 5C0IA 3ZZSA 4X6CB 3C60A 5KVFH 2PCYA 2J12B 3U2JA 4CBZA 3I2CL 3K2UL 1UA6L 2P1YA 1XCXA 1SUJA 3MJ6A 4OFVA 3ZX1A 3FOLB 5F88A 4B60A 2HJLA 4IGBD 4A55A 2Y6SD 3I6LE 2FJFA 2J56A 4Y4KD 4D3CL 3ULAB 1Y18A 3V6FB 5A6LA 3GXFA 4LVHC 3EG9A 1AY1L 4BFOA 2BP5M 35C8L 5FUOH 1C8QA 2VLMD 4TQIA 3FYIB 3NBNA 3IJ8A 4Z77A 1BD2E 4MJ6B 2KKQA 3AQYA 2XKUA 5AOJA 1SBBA 1HDMA 1TQBC 2Y24A 5MEQB 2R29A 3UPRA 3NRPA 1EHKB 3F01A 3JUYA 3T0BA 2O6FA 4PJXA 1KGIA 2DTML 3HAEG 5ITBL 3HC0A 1I1AC 1OF0A 5EU6D 4KXZI 2CGRH 1IFHH 5DFWH 3HS0C 4FQ1L 1QPXA 3BVNA 2VDMH 4L4JA 3G5XB 2WZAA 3H3KA 3GUTA 4G5AA 3EH3B 4QHKI 1A4JB 1SBSL 4WWKB 4XVSH 5L2JB 1HHGA 3EFDH 2BWQA 4KZEH 2BPBA 4MMZC 1MPAL 4LXFA 3I75A 5JHDB 3MBXL 4HJGB 4K7PX 2BNQD 3WIFB 4NBXB 4XZUB 3AS2A 1X5AA 5E8EA 3BWAB 3FPYA 5HDBF 1R34A 3U25A 4YL9A 1FRGH 5EOQL 2W0PA 5F89A 2NY6C 3RDTB 4XNDA 3OXSA 4WI4A 4X8JA 4AL8H 2JKIS 4Y19B 1URIA 2B0SL 1UVQB 4ZXBD 3ULUD 2VLKB 1NL0L 4L4TA 4YMPA 4JGUA 2WBJD 3CZKA 1R9FA 2DQIH 2EKSA 4M93B 5JQHC 2A9CA 2UWEF 2B2XL 4GUPB 5AZUA 4G8IB 1PLGL 3X3FL 2J1XA 4Z7VF 2F54A 5HHNA 5L9DL 4PRBA 2EDQA 3MLTB 1OP3K 1DQML 5J7CC 4J6RH 5ABAA 3RWFA 4QY8A 5DJ8A 1MKFA 4HXBH 5FR3A 3ZDWA 4A7GF 1PD0A 1WBZB 2F2HA 5B21A 3ATFA 1KTDA 5ENWB 3L3JA 3HAEB 4HMEA 2WSKA 3H9SD 4BDVB 4G9FA 3BGMB 2MJWA 4LO9A 5E6IB 2X53A 4JGMA 1TZAA 1W80A 2VITB 1KNOB 2ZXEB 1T21A 1LP9E 1VB9A 4M29A 5LDSA 3KEDA 5KJ7E 1YJDH 2WLZA 5ALBL 4OF7A 5C7XL 1X5HA 3FQYA 3JTTB 5MP6H 5JHAA 2B1AL 5DYFA 3RZCB 3T4YA 3ZE1F 1P7QB 4JCWA 1DJSA 2OW6A 3ZE2E 5GS1A 1CPUA 3DVGB 3WO4B 1FH5L 3QH3A 3RWIA 4XMLL 2OP4H 4NZUH 4L0YA 3CSFA 4UDUA 3AQXA 4IEFA 3NIFF 1MRDH 4DP5X 5JHLL 3OZ9L 4ZSOB 3K0YA 3QYMA 3DC0A 5F9JB 4OVVA 5FHAH 1EMTH 2PWFA 2BERA 4LSSL 1F8TL 3C09C 3ULUL 2BZCA 2LLNA 2UZIH 3IGAB 5I19H 3SCMD 1WIPA 3BCDA 3BKYH 3K4AA 1Q90A 4X6CF 5F7FA 2Y7QA 1MNUH 2M1KA 4HKZB 2WLJA 4EZJA 5JTWA 4CL7A 1C12A 1TJHL 4JFDE 1F56A 4NQXB 3N43B 5AYUL 3CXFA 2Q3AA 4B5ZA 1MRCL 4F8TA 4OAWA 4MB5A 4LGRB 1VGKA 5AVXB 5DRNA 3BXNA 1JZHA 1V05A 3L6FB 1CL7L 1A3RH 3AACA 4NJ9L 4Y8AA 3IJSA 2R0LL 5ICZA 3ABGA 3QWRD 2VGLM 5C6TH 4X4XA 1EZUA 4U1LA 4LPXA 3HG3A 4OU3A 1NBVL 4JY6A 4A2DA 2EEBA 2F1EA 5E9DA 5MERB 4IKLA 4NJAL 2BS71 5D6DA 5CBEA 3CE1A 3HW7A 2BVQB 1NMCB 2OMBA 3DBXA 1L0QA 3DPBB 5FKPB 4OLWL 4WF7A 1WD9A 5D2LA 1G9NL 4XOEA 1XL4A 1B0GA 3BZFB 5H2BB 3IRCA 1IGCL 2SEBB 2NY1B 5EV7A 5DUML 4NQDB 5I1EL 1V7MH 3ZDZE 4BFIA 3D05A 4GSQA 1S9XA 3FUMA 5GHWL 1OTSC 4MCNA 2ITCA 5DUPL 1KG0B 3B2DC 1EEYA 2RIKA 1QR1B 8FABB 1BQ5A 1YYLH 2CO7B 3EYVB 5GRWA 1FNEB 3CZNA 3MLXH 4UV4L 4Z5RB 4LHUG 2DN7A 4OZGE 5CJOH 5DD1H 9CGTA 1TMQA 1Q1JL 2AZAA 4NC1E 2B1HL 2ZXCA 2ATPB 3HE7A 4L8DA 4U6XB 3GYRA 1ZT4A 2QLYA 4H88L 3CBKB 2H0FA 1RUPL 3BZ4B 2IBGA 3KMDA 3SDCB 4XPBL 1CF1A 3DX6B 3ZBMA 3UO1L 2H3NB 3H6AA 4RSYA 4TQ8A 5L4IA 5E6UB 2EC9T 5AYQA 3OV6A 1ZS8B 3IKKA 5EU4A 2XXFA 1DHKA 4UTBL 1DJZA 3HS9A 4HAFA 4Q8BA 4P3CH 2DQEL 4OI8A 2ZNXA 1ZLDA 3CFTA 1DDHB 3JWOH 3L3OB 4QRTA 4NQQA 4LDOB 1J0HA 3ZYIA 4GG8A 4GXUM 2VDQL 3Q2WA 4ZW7A 1E3FA 4HAGA 4E9WA 1B3IA 2CLRA 4LSPL 3II3A 3L5XH 4NBZB 3DHMA 3KLQA 3X3GH 3CU7A 3QR1A 4WENB 5E5MB 3SPIA 4DAGL 1PEZA 2J2ZB 1RCYA 1MEXL 4FNRA 2W07A 3RIFF 5JORA 5IQLA 3K8KA 1P53A 5L88L 3GKWL 4LHUB 3L9EA 5ADPH 1N2RA 1LK2A 1VFUA 2ZX6A 3DKHA 1ZLWK 2B39A 3BPNB 3D85B 4M5TA 3BPOB 4KH9A 1CXLA 3WGVB 1G6VK 1WZMA 1A7RL 4HKBA 2O30A 3F58H 1BFVH 4MQSB 2EO1A 2MFNA 1BZ8A 1CDIA 3V2AR 4XMTA 3P0GB 5IJCC 1KBKA 4QRPD 3IJEB 4W9JC 3NH7L 3SGJC 2IF7A 4JFFB 1KJ2H 2ERJC 2VC2L 2X4QB 3X13B 3PRZA 4A7TA 1PGRB 3GTTA 4N9OB 5T1KD 1XGTB 2I60L 4WI2A 4K5NA 5EORL 1SEBA 2DTSA 1FLRH 3VU1A 4R6UA 4OZFH 3N43F 1G7LB 3SJVE 4WUUB 4FLOA 3CH1B 1AO7B 1KB9J 4GKSA 2PUQT 1UB5B 1WFTA 3DROB 3P11L 1HYSD 4HS3B 1KEGL 2CALA 4JW3A 1GCFA 3LDBC 1T2XA 1QZ1A 4XH2B 3ARFD 4QTHA 5KYWA 4R8WL 1M05B 4HQQH 3AY4C 3VWKC 5GQBA 3KPNA 5LB1A 2VDOH 4H2CA 1PDKB 4R7DA 4XMXA 5MEND 4FG6D 4Z7AA 3JV0A 3S36L 5GS2H 3LV3A 1F42A 4MJJA 4PRBB 5ADOH 4HS8H 3D7PA 1NGQL 3FSVA 3T77A 1NCDL 1CD1A 2CSPA 2DWTA 2JI2A 1KBGL 3GDCA 3NQIA 3CVIL 4R5XA 1OY3B 1CFVH 3QI9A 4YR6A 1UASA 5IQ9B 1IL1B 3PLYA 3RWJA 4YE4H 4KFMA 4Q6YA 4OQTL 1F6AB 1V7NH 5HY9A 4HBCH 1NOFA 3LKOA 2OV0A 2C9PA 2PWDA 3OPZH 5C2BL 3MODH 4R4BA 3FT4B 3SKMA 3Q05A 2BSSB 3GBDA 1N4XL 2F7PA 1S5HA 2UX7A 2Z3FA 1BAGA 4J3XA 4Q9QL 3B7TA 1F3DJ 4FFWC 1U8QB 2IC2A 3QEQE 1CFSA 2VLRA 1TEGA 4PB9L 5AW0B 1OPOA 5FYJH 2DF3A 2Z34A 4PJAA 5L7XH 1MOEA 4JRXB 25C8L 2CDEA 4N2KA 4KUCF 2C9QA 4Z3JA 1BBJB 5FKAA 3K3QA 3U4KA 1OT2A 2BDNH 3C5XA 2BO0A 3U6RB 3ZXAC 4I5BA 5DJCA 4GLRH 4FAAB 4L1BA 4M7ZB 1NCWL 5LNGA 1G6RH 3CDGB 3IDJB 4J4PC 3ISYA 4M1GH 5J89A 3MRFB 2AJYH 4WQOA 3FU5A 3U1PA 4EE2A 2F53D 3C5ZA 1LXMA 4I4WA 3U30C 1BWMA 4OSUL 3HLKA 1KJVB 4NM8L 4NIYE 3L1GA 1S6NA 4G72B 2Y7QB 1FO0H 5F1KC 2XVLA 3BKJL 3BZDA 4G7VL 4LLWB 4Q52A 2XACC 4EI6A 5HGBB 2DKSA 3TBBA 1J1OH 2ITDB 5IUSA 2HLEB 2WWOA 4NLAA 1DBAL 5D70H 4CU6A 4BD4A 2VDNH 1VSCA 3T65A 4F8NA 4FC3E 1N6QL 4PJEE 4NGHH 3KLLA 1GMEA 2IPUK 3O0RH 4U1KA 1TTUA 3GB7A 1XGYL 2ZE0A 1L9QA 5L0QB 5E8NB 3VMNA 4PGJA 1ES0B 4CC4C 5I23A 5ICZB 3CHQA 3OG4B 1G5GA 5TQ2H 2JQZA 3UBGA 4LCYB 3HNTH 5LBSH 3T3MB 4HSCX 3RIKA 1YEHH 3TV3H 4P05A 4ENEC 1S7RA 1HKFA 4XMPL 4FABH 2UXGA 3IS0X 3HI6H 4HU2A 3IFNL 4FZ8H 4O58L 5CLWA 4XXWC 4UT6L 4N3UA 4PY8I 1K3IA 2C7UA 1TTBA 1AHWC 2OMYA 1U3JA 2WLLB 4OGAD 4B96A 4DW2H 5IIEB 3L1FA 4U6YB 1T7XA 2IJ0C 4PJ9B 1MF2L 3MAWA 4BSVB 1IQDB 3B6SA 1C16B 3ZKND 1KJ3L 3PWLB 3ZZQA 1KUMA 3FQUB 2CKBH 2RJMA 2HTKD 3KPRA 5GZND 1ZV5A 4PJFA 5H35B 3OKLB 1YEIH 4PR5B 1GRWA 1NPUA 4K94L 3CFIC 4JFSA 3NJIA 4Y1AB 3FHQA 3QAQA 1AXTH 2X7LB 4YSEA 4LL9A 2W91A 2WY3B 5I1IH 1JWSA 2F68X 1ACYH 1Z66A 3WTUA 4L1SA 4YSRA 3GTNA 3ECQA 2MPAL 5MHSD 1EA9C 1A9BA 1I7ZA 1SMAA 3D0VB 15C8L 4UMSA 1KXQA 4G6ML 2DQCH 4MJ5A 4CBPA 4IGBC 1G9EA 1XVSA 1ZWIA 3MRRA 1FF5A 4PJHA 4FDWA 3O3EA 1E5ZA 1XF3A 3I6SA 5KZCB 4AXWA 4YK4C 3ESUF 4QWWD 2K6ZA 1G9HA 4FERA 4JG9A 1JNHB 5HHPA 4LPCA 2I32A 2WGNB 3TZVA 1WHPA 1G7QB 3HOGA 4GMSL 3QCTL 4Z0XA 3W2DL 1P5VB 5LQBH 3PJSA 3ELQA 3IDYB 2V7HA 1ORQA 1HIML 2K70A 4CC0A 1MQKL 2DQGH 4YXKL 3QNZB 4A63A 2AANA 4FFYA 5AKVA 1E3ZA 1ZTXE 2VR8A 3LRSB 4KO9A 3TYGH 3LPFA 5F1SA 4YX2L 3CK0H 4KBPA 3OC8A 5C0AE 2F8VA 4KROC 5B7MA 4EI5D 1CS6A 4N9GB 4O2EB 3V0GA 5AFAA 5K9OA 3I84A 4N8CH 3LSOB 4GW1A 1QR4A 2V9QA 3B9KB 3IPFA 3IAPA 1U8KB 4LMQI 4PQXA 4H0HB 3ML8A 3SKUD 5BRZB 4QYOB 3C6EA 4ZXBC 5GRJH 3ULUC 1HCFX 2BOLA 5FB8A 2X4NB 3GRWA 3BVWA 1TVBA 4LGPB 3KXFA 3LS5L 2UWEE 4OCRL 3VXNB 1IZKA 2J73A 2HKHL 3FQTA 4G8GD 4Z7VE 2FO8A 1AGBB 3CDCA 1QUPA 3AQDA 2D31A 4ETYA 3T3MF 2K8QA 4XWOD 5DYOB 1PZAA 3P0YL 4DKEL 2G75A 4YSPA 4QUOA 1IGFL 3MA9L 5I18L 4CMMA 1WBYA 1UADC 5LWYH 2X4PB 4IDJH 1UJ3A 5LVEA 4M48L 3F7YB 4OCMC 2R1XA 5E2UH 5BCAA 3BKMH 1GA2A 3MV7E 3M1CA 3VSUA 3IDIA 2K1MA 2P80A 3ZE1E 1WBXB 2R2EB 5ALCH 5KVDE 1J5IA 1Y6NR 3MCYA 3GMRA 4OZHA 4MXQC 3BE1H 1G9NC 1BM7A 1XSIA 4CW1B 4LLYA 1VGEL 1AQDB 4JG1H 1JXGA 3MGOB 1FNSL 2J1WA 1CGVA 3DX8A 3E6FB 3G6JA 2M26A 1F18A 5IB3A 3QCVH 4KHTH 2A73B 4UZSA 4QOKE 2DZEA 3SCMC 3HI1B 3PWPD 1P6FA 2Y3AA 4JFHE 1JGUL 4ONFH 1AZRA 2FB4L 5H94A 4QHNB 2Z1PA 2DD8H 2A74C 3REWA 4ZD3H 3ILDA 3ARSA 4G42A 4RGOL 4RAVA 5CIPB 3X11B 1S9VB 3CVDA 1EAJA 3HCVA 2P3YA 1LILA 3DARA 3DO4A 4D2NA 3F5WB 5ICXA 5JW3L 4N86A 5B8CA 4AIXA 2M2DA 3EW3B 3AREB 1G9ML 4P4RA 4F7TA 1KPUB 1IEAB 5EC2B 4R0LB 4AQZA 4DKFL 4U0RC 5FM5O 4JFPB 1TTGA 3FCSA 5HP5A 3IRPX 2W92A 4YHNA 1NFDB 5EZIL 4XP9H 2O5ZH 2NSXA 1A0QL 2OL3L 4NIKB 1T03H 3CN3A 3DX4A 4KZDH 2APWA 2DAVA 1JPSL 4R9HA 3ZTNL 1J0ZA 3F12B 3KHQA 1OAZH 3BEWB 2ZPKL 3MRPB 4N90E 1UWGH 3MV8B 4J7RA 4L8CB 4UDTB 1MQ8A 3OXRA 1OGTA 1ZHBA 4C56D 5T3ZE 3UZVA 2VRQA 2LLLA 4QR7A 1E27A 4BWUA 2F6AA 2Y7SA 1MJJA 1LJMA 3HC4L 2WXOA 4LVNB 4Y2LA 4WLCA 3SPVA 1X9RA 4ODUA 2OM5A 5JHDE 1RJZA 4NZFA 4OLUL 3AJ7A 4MAYB 4O2CB 3TEWA 4JK0D 4EN3A 3QUXA 5DWUH 4Y4FB 1LO4H 1LWJA 3G08B 1T5XA 1IBHA 5HDQL 3X14B 2PTUA 4I9WD 1UKQA 4Y19E 4GUOA 2BP3A 3PL6C 4YZFF 2VLKE 1JNJA 4H5SA 4NRXA 1U8IB 3DWTA 4EIBA 1V10A 2V5SA 4XNUH 4ZMLA 1WD8A 3QDMB 5BO1H 1PSKL 1HXMA 4HHAB 4OCYL 1G7JB 4ZODA 4J3OC 2ED6A 2ENPA 2IDUA 3UROR 3CQFA 3FCGA 4AYGA 2LW3A 1X7QB 4AQOA 4ANXA 4MNGB 3SYQA 1RPUA 5FC9A 1A1MB 1HHJB 3F65A 3LRMA 4C4KO 1H0DB 4LVHB 3VXRB 3ESMA 4ZPVA 1IGIL 1I8UA 4M8QA 1KELL 3JV6B 3MRGA 4PLJD 4DZBB 2KBGA 2PP7A 3GSNB 2AP2A 3EYOA 3U9UB 3KLAA 2FD6H 4EDXA 5KVGH 1UWXK 2RACA 3OAUH 5A2KH 3VFGL 3BZEB 2P26A 4P4KD 5DS8B 3WL9B 3ZYJA 3N0AA 4D0DA 1CDUA 1IAMA 4XO9A 3JUZA 3EJZD 5PAZA 5TGBB 4DZ8A 4QPEA 1UD4A 4NQSB 3I9AA 5JXED 4Q9RH 1I1AB 2VN3A 2G9HA 3QEUA 4P2OA 3HS0B 3STZA 1JIBA 1GGCL 4X5LA 4ZSOE 2ESVB 5FAAA 3ULVD 2V7HB 1I9RL 3HN8A 2QL1A 4PWHA 2Z7UA 2CCLA 2OMVA 3Q1SH 5D5MA 2IADB 4A6YA 3LHAA 1IMHC 2FQDA 5EN2A 4MMZB 2VNCA 3ZL4H 4HZLA 5DU7A 3RPIA 5DZLA 3VXMA 3QCUH 3UZEC 4L1TA 1KT2A 2NY6B 2X4OA 4LCWA 5I1LB 1UM5H 3EFFB 1OPGH 1NSNL 3HG1D 4X50A 4K7PL 3W9EA 1QEXA 5JR1H 1WFOA 1J9TA 1RK0B 4LEBA 3ILPA 2NT1A 1D5ZA 5DQDL 4X7SH 2ZXBA 2XY1A 3FSWA 1E42A 4GRMB 1W0VA 1ODUA 4K8RC 1A9EB 3JYBA 2WWKT 4LLMB 4PBXA 1U8PB 3IAGC 1QD0A 1AD0A 3HBZA 2AK4D 1JVLA 4NO2B 4B0MB 4JPQA 3GXNA 4HJTA 2PWHA 3QFJB 2PTTB 4Z7NB 2EUVA 4J8RA 4KKBD 3U7WL 2CPUA 3POHA 3POCA 3VE0B 2P43B 4IU3B 3TNNA 3ARXA 3QIWC 2JE8A 1IAKB 5KYYA 5IHLB 4JGJA 1HZKA 1RIHH 3V5KA 3S37H 1N59A 2G5RA 1JYVA 5J6GA 2XWDA 3WS6C 3HBPA 4YGAB 1EEZA 4NHCL 1QSEE 3VGHA 1GTNA 2TSAA 4GW4B 3HFML 1J48A 2VWEE 2J20A 3LTVA 2A0LD 2WQRA 1D9KD 3D39B 4H20H 4NYLA 4HETA 1JV2A 3H4HA 3ATEA 3IWUA 5CEZD 5HYJA 4YHIB 1Z5HA 3HPLB 1XIWC 1R19A 4WEBL 4K3GA 1HH9A 3C6LC 4FTVD 4M7LH 3U2IA 4ELMB 3NSJA 3WSQH 4F9LA 4WU7B 2A9NL 4QXUL 2EVFA 3EHBD 3EDEA 3FAWA 3REVA 3FTZA 4AT6B 4N0UA 5BS0D 3HRZA 2HJKB 4RISH 2Z8WC 2CBQA 4FADA 4HUUA 3NG5A 3VX0A 4H25B 1KTLB 4DPCX 1TYEB 2XI9A 4L48A 4LVOC 5T1DL 4A1RA 4BYHA 1IC1A 1FYTB 1BOGB 1K85A 5DQJB 4Z23A 4K94C 4JJHA 2PXYA 1H3WM 2AMUA 3GXUB 4XC1H 4AZUA 5JIIA 1U4FA 3KPOB 1NANH 4FEMA 3MYJA 2Q6WA 4X7TB 2Q20A 2KH2B 5IV2A 3D25B 1FDLL 2CLZA 3TPUB 4P4RB 3CFCH 3BQUD 4A68A 3B7SA 4MQXD 5I1HL 1BVLB 1DVFA 4OKVB 3V6OA 2X2UA 3D3VD 3HZVB 5EMYA 1OSZA 3JBG7 4YIQB 2ZCKH 1EZLA 5LGJB 1MHHB 3D50A 3UTPD 2BY0A 2PCFB 1TNNA 4PJXE 5I1AB 3VW3H 2AXJA 4PGEB 1AIFA 2MTPA 2FO1A 5JA8B 1KN2L 2ORBH 1LMKA 5AWNL 3IETB 4JFFE 5CEZL 1TETH 3QP3A 4NUGL 2CDGB 4IOSA 2IWKA 4RESB 2ZWNA 2VCOA 3HMXL 4HGWA 4MNQB 1H8LA 1QVOA 1WHOA 2WKOF 4F37K 3DYMA 2P8LB 2HFGL 1NIAA 4WUUE 4ZW3A 3K6NA 3ZKNC 3Q6FA 4FE9A 2QGCA 1YNKL 1ASQA 1AO7E 2VR6A 2EIZB 5JIQA 5E9NA 1A4AA 2PETA 4J3SA 1S7TB 4RRPM 5ANMA 2V9TA 3L4XA 3APFA 1B4LA 3CGTA 5DJDA 2ZX7A 2XY2A 4FJYA 3VD0A 4DSYA 1L6PA 3CLEH 4R26H 1FBIH 3BAEL 1XF5A 2YWZA 4L4TE 3MLPA 4U1NB 1TEFA 1U8NB 3GLEA 4C57C 2I9LB 3EBIA 1IX2A 5EBWA 4HKJA 1TF4A 2F54E 1U2CA 1M7DA 2XKNA 4LQFH 4X7DC 5IHZA 4LLUA 5LGYA 4DKDC 2P5WA 3ZTEA 3IRZA 4Y4KA 2Z31A 2ADJB 1UM4L 4AZ8B 3MUGB 4HC1H 2W60A 4OTXL 3FQXB 2EDTA 3V7MA 3UAAA 1KSRA 2GI7A 3T0ED 2OX5B 3V4VL 2VR7A 1CQYA 4ZW6A 2YPVL 2YS4A 5EBMA 1FE8L 2L3BA 3EYUL 3WIHH 1JXFA 3EO9H 2AMGA 3CFNA 1IC5L 4AJVA 1BGXH 3GWJA 3SYPA 3BVTA 1A7PL 2HN7A 2IFFL 4TYUA 2Q8BL 5F7KC 1WQVT 1B90A 4JDVA 4KU1A 4JO5A 5EU6A 1FUNA 2CIKA 5F0PB 3RL1B 1NAKL 3HC3H 4I0PD 4P3WA 2KI6A 3QNYA 5E0FA 4KKAD 1K8DB 4JRXE 1EUTA 4F7PB 1R3LA 3GINA 1M2OA 4WZ9A 4H26A 4N2BA 3VFRB 3D52A 2YJLA 3FT3B 4RSVA 1FV1A 2ERJB 4ELMF 2AQ1A 4ZDHA 2D7QA 1MW2A 2DM3A 2BNQA 3C6SB 4XWGH 1U3ZA 2NNFA 4WY7H 2XV6B 1X7SA 5JHLA 1CFMA 3B2UD 1CXIA 4NP4H 4EF3A 2VXUL 1DSFL 1YEDA 2EJ1A 4LASH 2HTLC 2NW3B 3MKGA 1I3GH 5AZEH 2N01B 1QQDA 3K4ZA 1JNLH 4M4RB 3IMWA 4YHZL 1KCRH 4ZXBA 3RUGB 1CXKA 2WBJA 1E4WL 3ZQWA 2VN4A 4PJIB 3WFBH 3CXDL 3VWKB 1MCWM 2NQ3A 1T1XB 4TTGA 4UT7H 2WLKA 4HUNB 3NZHL 5T5FH 5CUSH 1CF8H 2EXYD 2FJGB 2XVGA 4Z3FA 2MOVA 2G9KA 3VUAA 1IAOA 3BI9X 4JQIL 2HLAB 3VXQA 3EDKA 1XH1A 4HIJA 1WITA 3H9SA 4XWOC 3N85L 4JPKL 2XN9D 1BF2A 2JQAA 3FFCB 1W16A 2ZXQA 1WS7A 2OMZB 2X4RA 1P7BA 5E7BA 3QO1B 4X0NA 3IVKA 4OBSA 4WTZA 1YG9A 3LNIA 4FYSA 4M8VA 4QRQA 1BJ1H 4ZUWB 3SKJH 1G9MC 4U6HA 2MOGA 2K3TA 4F33A 2JKNA 4HIXL 3ZU8A 3MRLA 5HHOD 2NSMA 4PJBA 1Q72L 2BFVL 3U46B 1NLBL 5DK0A 4KMTL 1JCKA 4UQEA 3PHQB 4P23C 3QUZD 3RU8H 3ZZ1A 1MY5A 2XXGA 4N0FB 3SGKC 5KYXA 1OARH 2PO6B 1Q9WB 3WTWA 1NGYB 5F72S 2EYRA 3H42H 4WNQB 5JXAH 3P2BA 4IBWA 1BLIA 2R7EA 3BQVA 3B2MA 3SCMA 2NY4D 4AEHL 2WB7A 2YUXA 3HZ3A 4KKLD 4H2AA 1A3LH 4PSPA 2EH8L 5I8EA 4HD9A 4PRAB 5T33L 1PZ3A 3OGCB 3RVXD 3U30B 1R3IH 2XN0A 4BZ2L 4NDMB 5K39B 4F58L 3ROLB 4CILA 5J6HA 3IN0A 2JJTC 2VXQL 5BOZG 2ZF8A 1A6UL 2CJUL 2WCGA 2XDHA 3MV9B 5LGKA 1YQVL 1UATA 4PW4A 1OOWA 2A7BA 4RGNB 3V0HA 1KV3A 2Y1YA 3CFBA 4AYID 5CINH 5CBAB 1TVHB 3QWRA 1QKZL 3U0PA 3BISA 4N8VB 4GINA 2WXIA 1NC2D 1E6JL 1WUNT 1CBVL 2ZKHH 4CUCA 4N2EA 4V11A 3KPMB 5EO9B 5FECA 1NGPH 2O61B 4JPWH 3L8QA 3H0TA 4TNWF 5FGSA 5GS0D 4NENB 3LIZH 1QTSA 1WWBX 2C26A 2UZXB 4Y5XC 4Y9CA 3VFSB 2VISA 2IWEA 1KGCE 4PRNA 1JWMB 1P5UC 1H3TA 1AI1L 2FIKA 3NCJH 1AHWB 1I7RA 2V3FA 2RH0A 3QRBA 2EVIA 2K7QA 1A6ZB 5IMMB 1AGFA 5K69A 1P2CA 4MMYB 3QO0B 1C08A 3BO8A 4OLXL 1UTDA 4RAUB 1M56B 1ZIAA 4HUWA 4IBQA 4GMTL 5AL8A 3DURA 4HJ1A 5DXWA 1P7KB 5TK2A 3WFDH 3RUGF 1I7TA 1MWAB 3K6SA 4RMTA 4PJIF 4IS6B 1LEKA 4JPIB 3U4BH 1BM3L 5EA0L 2FX7H 1RUKH 1WFIA 5BRZE 4YZFE 2I9TA 5C0EA 1NCNA 4QRFA 4YSAA 1ZA6A 4CVUA 3CZSA 4XP4L 2ZKYA 3HLAA 1CLZH 1TCRA 1EJOL 3NGBB 5ESAB 4W9KC 3SOBL 1M7UA 1M7XA 2YKLL 3PHAA 4J3TA 3K71A 4GAJL 1G7PA 5K59F 3NJJA 2GABA 4IGBB 5GS0L 1BQKA 2F7OA 1U3YA 3O41B 3Q2CA 4BH7B 4NS0A 5DMYA 5KVEH 4GKNB 2N4IA 3CV5A 3VXUD 2APXA 3QA3B 3QRFM 4NUMA 5JOFA 3LYRA 4MD4B 5DD3H 3NPSC 1ETA1 3ETSA 4HYTB 3SQBB 3CVHH 2W94A 1KJMB 3OHXC 4PLJC 4YK4B 1UB6B 3OJDB 5AAPA 3TN0D 4APXA 1MLCA 2WLYA 2QSVA 1C1EH 5F1NA 2VLLB 3F7KA 1I82A 4AITA 3DX9B 4YUEH 3PGFH 1JYXA 4KNQA 4OQTA 3DNKA 4YAQB 1JWUB 1AZVA 5HGHA 2JB5H 2W65B 4E5XA 1ZJBA 3KGTA 4XVJL 5D1ZC 5IB5B 3S5LA 1PX4A 2EDJA 3TF4A 2LVEA 1P6AB 4IRJD 4MRCA 2A5UA 1MZYA 4QRPA 1FPTL 1KEML 4I1RA 1A47A 1J1PH 4MRBA 4WTZG 4PWGA 3CCHA 4GOSA 1UD2A 2J8UB 5T1KA 5IKCB 1L9RA 4MSWB 4WTWA 5EEYA 4JO2H 3NCYS 4XBGA 5L4MA 4KROB 3Q2LA 4UM8B 3QJUB 5E5UB 3N44B 3RB5A 1SYSB 2JF1A 5AZ2L 3GS7A 5F7DB 2P7TB 1MFMA 4LBEB 3A6CH 3HA0A 1KFAH 5F3BA 4Q58C 2Q8AH 1G0XA 2LFGA 2OXGA 3N1FC 3ARFA 1MG3C 5IMLA 3NYKA 2BY1A 4OM1L 4I3SH 4IU2B 3L54A 1XXFC 3JWDH 2HUEA 1E28B 5T5NF 4X9IA 5I16A 3ET9F 2D7TH 2CXKA 3CFDB 3T2QA 1HI6B 3K6OA 2DQ6A 1XCTA 3MXVL 4A2MA 3FN3A 1QOKA 3BD3A 5IVXB 1E6OH 3C08H 4X4KA 5LXGL 1NBCA 3TCLB 3UTTB 3NUKA 5K9JL 1ADQL 5DJYA 1NFDE 4KXZH 3X1FA 3LKRB 4JDEB 3ZRSA 5HJBA 4L3EB 2AAVA 1U58B 5TE6L 1SF5A 2IDTA 1UGNA 1DFBL 3GEWB 3MV8E 4OIIH 5FHBH 4GG6B 2J88L 2ZP0T 3DVFA 5I76A 3GSVA 3N1PC 3N2JA 4FMVA 2GT9B 4GO9A 2EDMA 5TDOA 2VN7A 3VRLF 4NUPA 4FNPA 4GEIA 1I8MB 2X0WA 3C87A 5IBLD 5TE7H 3BIKA 3QJFA 3CFKB 5DRXA 4AGNA 2KT6A 2XFGB 4HZAA 3T2LA 2X09A 3MRNB 3Q2VA 3PWUA 1UXSB 3GIVB 2B4CH 1EGJH 1J5DA 1X5LA 4TUKL 1AYRA 5D7JC 5EF3A 1KYDA 3PJLA 4HF5L 4JQVA 4JHWL 2A0LC 5GIRB 1UQSA 1MUJB 5DVNA 3D0AA 5J11C 3UFIA 3UZQA 2F53A 1H3GA 3VSVA 3GS4A 2FTAA 1MFCH 2H26B 3HIZA 1ZSDB 3BFQG 1VF5C 4KRLB 3VRJB 4FULA 3DTXB 2ED9A 2OS7A 4UBDD 3SB3A 2A74B 4A39A 1JPFB 1WP6A 1IM3D 3CMOL 1N0LA 4ODXA 4OFDA 1UACH 2RD0A 4MNGE 5FO7A 1U91B 2X88A 1UZ6E 1DVZA 1EWHA 1KXQE 3G5VB 4MQ7B 5F1IB 5DC9B 2GJZA 3ZIYA 3CFBB 4YDVA 1KTCA 1F58L 3H4FA 1X3DA 1ZVYA 1R5WB 4U4BA 1J5OH 2JXMB 2RAMA 3IM1A 4U0RB 3CG8A 4XPGL 2VDQB 2XZZA 4DUXA 3LY6A 2DMGA 2G5UA 4LMQE 2IDQA 1X9QA 1VAHA 3CC5B 3MCLH 1NGXA 4K7PY 4KDWA 4YBHA 1PZUB 1N19A 5DWPA 3TNMB 2VOTA 3VM5A 5FYLH 2Q87A 1HVXA 3IAQA 1XB3A 2ESVE 4XPFH 1HNYA 5C70A 1PQZA 2GAZA 1XD1A 2CLVA 2EO7A 4OLZH 1DN0B 2J8UF 3HHSB 1JVKA 3MX0B 2K9UA 1XTMA 3MA7A 3I6LD 4S1DD 2QKIC 4LCIL 4ZMNA 1VCAA 2YRBA 2PW2B 4GP4B 4KNTA 2BM3A 1RUMH 5FGBC 3N44F 4FF9A 5F7MC 1EDQA 4FYQA 5IVZA 1S7WB 1DYZA 1KYFA 2F74A 5FO2A 2V2XB 3I74A 4MJ2A 1NCGA 4F2EA 4HV8A 3OMNB 1RULH 5GZNA 2AKRB 4HUXA 2FATH 3PL6B 3MRCA 4NNPH 4PG2C 4RA0C 3S5LG 3O6KH 4EUPA 3EOAB 3ETTA 1W0WA 4GW5B 1OTTD 1RHFA 1YZZA 3V0VB 3TF7C 1A7OL 4HXAL 5IVXF 3W3BA 4L4VB 1RIUL 4HG4J 2EACA 4GKZB 1J9RA 4X9GA 1WGVA 4KRPD 5LLIC 1WE5A 3GUFA 3MJ9L 1KOAA 4ZOBA 3GLDA 5FFLA 1I7UB 3GM8A 4LIQE 2QTVA 3K71B 1YEFH 4QO1A 3UC0H 2X9YA 3QFJE 4PJCF 4GG6F 4Z7NE 1HSBA 2FJHB 1E9QB 3AVEA 3LKSB 1SDAB 1FFRA 1PKQA 1O6VA 2AV1B 2EEAA 3T0EC 4FG0A 1YC8A 3RY5A 3RTQD 1YC7A 5DEGB 3V4PL 5DJXB 3M1OA 5IQOA 4FKEA 1IV8A 2Z7WA 4JPSA 1JL8A 2PN5A 2AITA 1YEEH 1QFHA 3IU4H 3LMJL 4R7NB 4DESA 4UILH 3MRQB 3S34H 3D39E 1AZZC 2C1PB 2EO9A 2ZYRA 4TNFA 4A2EA 4HJ0D 3TA3D 1KLFB 1BQHA 3NESA 1CLVA 3QZNA 2O5NA 5EC1A 3HZKB 4QIRA 4MGXA 4KJWC 5L2KD 1ED3B 1ETJA 2FO4B 3EZ8A 4AV4A 4EI5A 7PAZA 1P4IH 3DVNB 3L3GB 5LCVA 3O2DA 2AJZA 3A6BH 2N1TE 4WFFE 2OK0L 3EYFA 3B2UC 2R2BB 4PMEA 1GY2A 1EEQA 4HISA 2A9BA 3OAZH 2B3RA 4M6ML 2WLMA 2X4TB 4KXAA 1JZ7A 3K7UA 4D94A 1D7CA 1FYTE 4S2SA 5ICYB 1AKJB 2CHNA 4Z78A 1J8HD 2YEVB 1AZBA 4RDBA 3VFWB 1WCBA 3GMMB 5DJZB 3S0PA 4G8GA 1DEEA 5I6XC 1OOAA 2A6KA 5MENB 1U95B 3HHRB 4GBXD 4HMCA 3DLQR 5C0DA 5IHWA 1I8KA 1QFWL 3S7GA 4MYWB 5F6HJ 4E41D 2BH0A 3L2LA 1AYOA 2BMKB 5CEXA 1T66D 3S97C 5CGYD 1EXUA 5FO8A 2L7JA 5LAXA 1BZ9B 3MNWB 4AENA 5I8KH 2VDPL 2DDQL 4Y16D 3HB3C 1LGVA 1HHHA 1HE8A 2Q76B 3KAAA 5IFHH 4H1LA 3QIWB 5I0YA 5DUBB 3NJMA 4XPAH 5F8RC 4PRHA 3A5VA 5DC0A 4ZG1A 1U30A 4YGVB 4QRSA 2OL3A 1FVEA 4XAWL 5ABZA 5IT2L 3ATAA 4MNQE 2F19L 3HR5B 3DOSA 1T5KA 4ZYKA 4PP2B 3GGWA 4Z6AT 3QWQB 3O4OC 5JHMA 3WI9A 2ADGA 5KSBA 4M5YH 2IV8A 2YFOA 4IK6A 1XIWB 4G71B 4MWFB 2VR3A 3C6LB 3SD5A 3NA9L 4TN9A 5C08B 1P1ZA 1N7MH 4KKLC 4J3OF 4JHAH 2JJTA 3RFZA 3CFJB 3PWPA 1KF9B 2F53B 4JRYB 4JBSA 1W72A 2XPYA 2Z4QA 3BSGA 4S1SL 2OTPA 4K3HA 1QFUL 3HMWH 4LVOB 3T4AA 2GK0A 2KPWA 3L5WB 5T1LD 1D5XB 1XF4A 4YDLC 1I8LC 3BAYA 2QSCL 4PS8A 1I1FB 5E2TL 1SXBA 1ZT1A 3T3PB 5BOPA 5GGSA 5C0CD 3K0WA 4UM9B 1GHFL 1ZY9A 2FVNA 1DJHA 1IC4L 1JHLH 3BT2H 1WFMA 5DLML 2QADD 3ECBB 3FO2A 1T7YA 3KJ4C 4MKTA 2UZYB 3B7RL 3U6XA 3V5DB 1LD9A 5HXMA 3KPSD 3WNPA 1QG3A 1F90L 2WC7A 4PS4L 3FUNA 4O4YH 1GGIH 1DCEA 4N0RA 4AJYV 4ERSL 1XGRA 4ZOCA 2ZZUT 4N2DA 2WZPD 3EADA 5GS0C 1J0JA 4JFOA 4U1JA 5F93C 1FNAA 2H32A 2AK1H 1HESA 4XHJD 4C56A 3O81A 3MMEB 3R0NA 3DK2A 4KJPC 1JV5B 1X5FA 4FNTA 3MLUL 4G6AC 4LLAA 4ANVA 4P0DA 1WC7A 5I66B 3F83A 1BYPA 5L8JB 4KKNA 3EFOA 2DB8A 3QG7H 3WJLC 1YMHB 1INEL 1YN6A 2ZOKB 3MNVB 5DMIL 2MQCA 3UJIL 1RY7B 2YRLA 3GJEA 3H3PH 4N2CA 4TL5A 2OMWA 1S7QB 4AEFA 3OKDA 3VXTB 3O6MH 2BOCA 4B95C 1C5CH 1F00I 3L17A 3ZGHA 4ZFFA 1T4KA 3FTWA 3QUML 4GP8B 3G6DL 4AIOA 4QXTA 1DUYB 3P4NA 3DMMD 3QULA 1KCSL 3H9HA 1FL3B 3IDNA 1RFDH 3P54A 4P2CG 4XE0A 3KLKA 1IC0A 4JY4A 4JB9H 1BQHG 4XI5D 4ETQA 4YVUA 3BDXA 1R24A 4DGWC 1KBBA 1RURH 4NI6A 3T6XA 3E6HA 1RVFL 1TITA 4U1HB 2I5YH 4Y4HD 4KRNA 2YA0A 1JDDA 5A2AA 3FFCE 1MJ7H 3MLVH 4FGMA 1SJMA 3IJYB 3SJVD 4JQXC 4DHLA 1HSAB 3ECUA 1Y0LA 3CAFA 2Z92A 5IF0B 3T0XA 1JPTH 4BQCA 1U8LA 4P4KA 2J8HA 4HPYH 4BRJA 4URTB 4X6FA 2JCCA 4AVIA 1MCOL 1EO8H 4FMFA 3AU1B 1WV7T 1TENA 4JG0L 5CKGA 4YDIH 5D72H 5JXEA 4HPHA 2ZX8A 3EF4A 5LN4A 2VDRB 1NFKA 3BH9B 1TT6A 3FN9A 3RVUC 3GFUA 2CUIA 4GAAA 1RMFH 1OTUC 2VAAB 1CGSL 1T6VN 4N25A 2J1KA 5E1IA 4YS4A 1VERA 4XNMA 4N2GA 2WANA 5HYQA 3VFMB 1HILA 2B16A 2EE3A 2ZSWA 2NNXA 4L3AA 4IRJC 2A83B 4TUOA 5DVKA 43CAB 1LE9B 4L9LC 2HA1A 4HDIA 2G5BB 4QXWA 1F11A 1KGJA 3N40P 2JKSA 5EWIL 2DBLH 2CHWA 1NKRA 3NFNB 4H1LG 4R5TA 4KI5F 4UQDA 2HZHA 4X99A 5IW3A 1BZ7A 1B2WL 1SDDB 3LEYL 2ZJSL 5HJ3A 4HIEB 2YRPA 4Z0BL 3DJZA 4N0UE 1I3RB 1GGUA 1HXYB 5JDJA 5E03A 5I1CL 1M42A 3MV9E 3KPLB 3H1ZA 3HG1A 4UI2A 1U8OA 1D5BB 4YNYA 2WXFA 3LN4A 4F57L 5DCCA 1NC4B 3F7RA 3QEQD 4CU7A 2FZ3B 3M46A 5D1ZI 1CGTA 5B39B 1QHOA 4Y9BA 4DJMA 2HRPH 1YNLH 1BBDL 1LEGA 2X41A 4OD3L 5B1AB 4NWTH 5JLZB 4U33A 4WI3A 1NA8A 2Y1VA 3WKPA 2OR7A 3K2KA 3TJHC 3VDCA 5TDNA 3W39B 4GQ9L 3U1SL 3NQKA 4WNJA 1HOEA 4APQC 1R0AL 1A02N 4DP4X 1MREH 2AK4A 2J72A 4JDTH 2O5XL 1N5AA 1PX8A 1N3NB 4NRYB 1GIGL 1QEWB 3LH8A 5HPMA 5I8CA 1CDHA 5K9KB 1DVSA 2UY6A 1SJXA 2CE6A 4KO7A 4JKKA 4QHPA 1DE4B 3VFUA 1CB4A 1MHPH 2IAMC 3HBGA 3ZKMC 4WW1A 2HT4D 5FDWA 1T04B 3AXLA 2PYFA 5JW4N 5I9QC 3VRLE 4HFWA 1IFGA 4RMQA 1K2DA 1BFTA 1KB5A 3ZTDC 3VI3A 1F4HA 5D1QC 3D30A 3VFNB 4AQ1C 2YD8A 4U4IA 1AE6L 1JF1B 4P23B 2CBMA 5IBLC 1G43A 3LNFA 3FN0L 3QXTA 4JO3L 2FCBA 4ZO7A 3NCCB 5KW9H 3KR3H 3UX9B 1D9KA 1NUDA 1SMOA 3QXAB 1E2VA 4ODTL 2C1OB 4MD0A 3O3BB 1F4XH 1KCVL 2VQ4A 3CX2A 4WUKL 3WGUB 5IG7A 2VE6A 2A9MH 1NPJA 3RIAK 5CZRA 5GRYA 3UYOD 5ANME 1O7SA 4FTVA 4ZUUA 2V2TB 1TFPA 3IJ7A 3JV4A 1JRHL 3LJ3A 1URZA 2Z93B 5IHUL 4LSTH 1AR1D 4MDIB 5BVJA 2F5AH 1NWPA 5BS0A 1DQQB 1FN4A 5E2WH 4RQQB 4IRZL 5EO0B 5FLVA 2WVUA 3IMVA 4FFYH 5T8IA 5CD5D 3US9A 3SE8L 4DOHB 4R3SB 3QR2A 2BIOA 3E8UL 2PW1B 4HLJA 2ICWA 5ITFB 1UEYA 5AOZA 2EDYA 2WUCH 4LNRA 3FT2B 3CFEB 2QPFA 3VD1A 1ZLSL 3MGTA 1JFQL 1JF6A 3SBWA 2YGNA 4YHPA 1I9IH 2VLME 2R4RH 3K6FA 4JN2A 5MI0C 1OCZB 2X0VA 3CSYB 1DCLA 1I1RA 5BZDA 2R1YB 5BW7A 5EZPA 2DM4A 2LU3A 2X9ZA 3BQUA 4FJZA 4ZMPA 2C9SA 2Y07L 3RFRA 4AV0A 5SWZB 5BUAA 3JYCA 4V1DA 3D3VA 4NO0B 2KQNA 4MZRA 1GZQA 3RWDB 3TJPA